WorldWideScience

Sample records for jsc jf1323 bldg

  1. STS-49 Endeavour, Orbiter Vehicle (OV) 105, Planning Team in MCC Bldg 30 FCR

    Science.gov (United States)

    1992-01-01

    STS-49 Endeavour, Orbiter Vehicle (OV) 105, Planning Team with Flight Director (FD) James M. Heflin, Jr (front right next to ship model) poses in JSC's Mission Control Center (MCC) Bldg 30 Flight Control Room (FCR). The group stands in front of visual displays projecting STS-49 data and ground track map.

  2. ASTP crewmen in Apollo Command Module Trainer during training session at JSC

    Science.gov (United States)

    1975-01-01

    The three members of the American ASTP prime crew are photographed inside the Apollo Command Module (CM) trainer in a water tank in bldg 260 during water egress training at JSC. They are, left to right, Astronauts Thomas P. Stafford, commander; Vance D. Brand, command module pilot; and Donald K. Slayton, docking module pilot (23430); Slayton attaches his life preserver as he egresses an Apollo Command Module trainer in a water tank in bldg 260 during water egresss training at JSC. Astronauts Brand (on left) and Stafford have already egressed the trainer and are seated in a three-man life raft.

  3. STS-49 Endeavour, Orbiter Vehicle (OV) 105, Orbit Team O1 in MCC Bldg 30 FCR

    Science.gov (United States)

    1992-01-01

    STS-49 Endeavour, Orbiter Vehicle (OV) 105, Orbit Team 1 (O1) poses in front of large display screens in JSC's Mission Control Center (MCC) Bldg 30 Flight Control Room (FCR) for group portrait. Lead Flight Director (FD) Granvil A. Pennington stands next to a model of the James Cook's ship, the Endeavour (left). Astronaut and Spacecraft Communicator (CAPCOM) John H. Casper stands at the right of the model.

  4. STS-30 crewmembers pose for informal portrait on JSC FB-SMS middeck

    Science.gov (United States)

    1988-01-01

    STS-30 Atlantis, Orbiter Vehicle (OV) 104, crewmembers pause briefly from their training schedule to pose for informal portrait in JSC fixed base (FB) shuttle mission simulator (SMS). On FB-SMS middeck are (left to right) Commander David M. Walker, Mission Specialist (MS) Mark C. Lee, MS Mary L. Cleave, Pilot Ronald J. Grabe, and MS Norman E. Thagard. FB-SMS is located in JSC's Mission Simulation and Training Facility Bldg 5.

  5. STS-29 Commander Coats in JSC fixed base (FB) shuttle mission simulator (SMS)

    Science.gov (United States)

    1986-01-01

    STS-29 Discovery, Orbiter Vehicle (OV) 103, Commander Michael L. Coats sits at commanders station forward flight deck controls in JSC fixed base (FB) shuttle mission simulator (SMS). Coats, wearing communications kit assembly headset and flight coveralls, looks away from forward control panels to aft flight deck. Pilots station seat back appears in foreground. FB-SMS is located in JSC Mission Simulation and Training Facility Bldg 5.

  6. ASTP crewmen have a meal during training session at JSC

    Science.gov (United States)

    1975-01-01

    Three ASTP crewmen have a meal in the Apollo Command Module trainer in bldg 35 during Apollo Soyuz Test Project (ASTP) joint crew training at JSC. They are, left to right, Cosmonaut Aleksay A. Leonov, commander of the Soviet ASTP first (prime) crew; Astronaut Donald K. Slayton, docking module pilot of the American ASTP prime crew; and Astronaut Thomas P. Stafford, commander of the American ASTP prime crew.

  7. STS-31 Pilot Bolden with beverages on the FB-SMS middeck during JSC training

    Science.gov (United States)

    1988-01-01

    STS-31 Pilot Charles F. Bolden holds three beverage containers while in front of the galley on the middeck of the fixed based (FB) shuttle mission simulator (SMS) during a training simulation at JSC's Mission Simulation and Training Facility Bldg 5. From the middeck, Bolden, wearing lightweight headset, simulates a communications link with ground controllers and fellow crewmembers.

  8. STS-31 crewmembers review checklist with instructor on JSC's FB-SMS middeck

    Science.gov (United States)

    1988-01-01

    STS-31 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) Bruce McCandless II (left) and Pilot Charles F. Bolden (right) discuss procedures with a training instructor on the middeck of JSC's fixed-based (FB) Shuttle Mission Simulator (SMS). The three are pointing to a checklist during this training simulation in the Mission Simulation and Training Facility Bldg 5.

  9. STS-37 Mission Specialist (MS) Ross during simulation in JSC's FB-SMS

    Science.gov (United States)

    1991-01-01

    STS-37 Mission Specialist (MS) Jerry L. Ross 'borrows' the pilots station to rehearse some of his scheduled duties for his upcoming mission. He is on the flight deck of the fixed-based (FB) shuttle mission simulator (SMS) during this unsuited simulation. The SMS is part of JSC's Mission Simulation and Training Facility Bldg 5.

  10. STS-44 Atlantis, OV-104, MS Musgrave on FB-SMS middeck during JSC training

    Science.gov (United States)

    1991-01-01

    STS-44 Atlantis, Orbiter Vehicle (OV) 104, Mission Specialist (MS) F. Story Musgrave, wearing lightweight headset (HDST), adjusts controls on communications module mounted on a middeck overhead panel. Musgrave is on the middeck of the Fixed Base (FB) Shuttle Mission Simulator (SMS) located in JSC's Mission Simulation and Training Facility Bldg 5. The STS-44 crewmembers are participating in a flight simulation.

  11. STS-44 Atlantis, OV-104, Pilot Henricks in FB-SMS training at JSC

    Science.gov (United States)

    1991-01-01

    STS-44 Atlantis, Orbiter Vehicle (OV) 104, Pilot Terence T. Henricks, seated at the pilots station on the forward flight deck, reviews checklists before a flight simulation in the Fixed Base (FB) Shuttle Mission Simulator (SMS) located in JSC's Mission Simulation and Training Facility Bldg 5. Surrounding Henricks are the seat back, the overhead panels, forward panels, and forward windows.

  12. STS-37 Mission Specialist (MS) Godwin during simulation in JSC's FB-SMS

    Science.gov (United States)

    1991-01-01

    STS-37 Mission Specialist (MS) Linda M. Godwin rehearses some phases of her scheduled duties on the middeck of the fixed-based (FB) shuttle mission simulator (SMS) located in JSC's Mission Simulation and Training Facility Bldg 5. Godwin is inspecting supplies stowed in the middeck lockers during this unsuited simulation.

  13. STS-48 MS Buchli and MS Gemar on MB SMS middeck during JSC training session

    Science.gov (United States)

    1991-01-01

    STS-48 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) James F. Buchli (left) and MS Charles D. Gemar listen to instructions while on the middeck of JSC's Motion Based (MB) Shuttle Mission Simulator (SMS). Buchli and Gemar are reviewing inflight procedures during this preflight familiarization session held in the Mission Simulation and Training Facility Bldg 5.

  14. STS-30 Pilot Ronald J. Grabe during preflight press conference at JSC

    Science.gov (United States)

    1989-01-01

    During preflight press conference, STS-30 Pilot Ronald J. Grabe answers a question from the news media. The event was held in the JSC Auditorium and Public Affairs Facility Bldg 2 briefing room. STS-30 mission will fly onboard Atlantis, Orbiter Vehicle (OV) 104, and is scheduled for an April 28 liftoff.

  15. STS-31 crewmembers during simulation on the flight deck of JSC's FB-SMS

    Science.gov (United States)

    1988-01-01

    On the flight deck of JSC's fixed based (FB) shuttle mission simulator (SMS), Mission Specialist (MS) Steven A. Hawley (left), on aft flight deck, looks over the shoulders of Commander Loren J. Shriver, seated at the commanders station (left) and Pilot Charles F. Bolden, seated at the pilots station and partially blocked by the seat's headrest (right). The three astronauts recently named to the STS-31 mission aboard Discovery, Orbiter Vehicle (OV) 103, go through a procedures checkout in the FB-SMS. The training simulation took place in JSC's Mission Simulation and Training Facility Bldg 5.

  16. JSC technician checks STS-44 DSO 316 bioreactor and rotating wall vessel hdwr

    Science.gov (United States)

    1991-01-01

    JSC technician Tacey Prewitt checks the progress on a bioreactor experiment in JSC's Life Sciences Laboratory Bldg 37 biotechnology laboratory. Similar hardware is scheduled for testing aboard Atlantis, Orbiter Vehicle (OV) 104, during STS-44. Detailed Supplementary Objective (DSO) 316 Bioreactor/Flow and Particle Trajectory in Microgravity will checkout the rotating wall vessel hardware and hopefully will confirm researchers' theories and calculations about how flow fields work in space. Plastic beads of various sizes rather than cell cultures are being flown in the vessel for the STS-44 test.

  17. STS-37 crewmembers train in JSC's FB shuttle mission simulator (SMS)

    Science.gov (United States)

    1991-01-01

    STS-37 Commander Steven R. Nagel (left) and Mission Specialist (MS) Jerry L. Ross rehearse some of their scheduled duties on the flight deck of JSC's fixed-based (FB) shuttle mission simulator (SMS) located in the Mission Simulation and Training Facility Bldg 5. During the unsuited simulation, Nagel reviews checklist while seated at the commanders station as Ross looks on from the pilots station.

  18. STS-44 Atlantis, OV-104, crewmembers participate in JSC FB-SMS training

    Science.gov (United States)

    1991-01-01

    STS-44 Atlantis, Orbiter Vehicle (OV) 104, Commander Frederick D. Gregory and Pilot Terence T. Henricks are stationed at their appointed positions on the forward flight deck of the Fixed Base (FB) Shuttle Mission Simulator (SMS) in JSC's Mission Simulation and Training Facility Bldg 5. Gregory (left) in the commanders seat and Henricks (right) in the pilots seat look back toward aft flight deck and the photographer. Seat backs appear in the foreground and forward flight deck control panels in the background.

  19. STS-44 Atlantis, OV-104, crewmembers participate in FB-SMS training at JSC

    Science.gov (United States)

    1991-01-01

    STS-44 Atlantis, Orbiter Vehicle (OV) 104, Commander Frederick D. Gregory (left) and Pilot Terence T. Henricks, positioned at their appointed stations on the forward flight deck, are joined by Mission Specialist (MS) F. Story Musgrave (center) and MS James S. Voss (standing). The crewmembers are participating in a flight simulation in the Fixed Base (FB) Shuttle Mission Simulator (SMS) located in JSC's Mission Simulation and Training Facility Bldg 5. A maze of panel switches appear overhead and in the background.

  20. STS-46 crewmembers participate in Fixed Base (FB) SMS training at JSC

    Science.gov (United States)

    1992-01-01

    STS-46 Atlantis, Orbiter Vehicle (OV) 104, Pilot Andrew M. Allen hands Mission Specialist (MS) and Payload Commander (PLC) Jeffrey A. Hoffman checklists from middeck locker MF43E during training session in JSC's fixed base (FB) shuttle mission simulator (SMS) located in Mission Simulation and Training Facility Bldg 5. European Space Agency (ESA) MS Claude Nicollier outfitted with communications kit assembly headset (HDST) and equipment looks beyond Hoffman to the opposite side of the middeck.

  1. STS-49 crew in JSC's FB Shuttle Mission Simulator (SMS) during simulation

    Science.gov (United States)

    1992-01-01

    STS-49 Endeavour, Orbiter Vehicle (OV) 105, crewmembers participate in a simulation in JSC's Fixed Base (FB) Shuttle Mission Simulator (SMS) located in the Mission Simulation and Training Facility Bldg 5. Wearing launch and entry suits (LESs) and launch and entry helmets (LEH) and seated on the FB-SMS middeck are (left to right) Mission Specialist (MS) Thomas D. Akers, MS Kathryn C. Thornton, and MS Pierre J. Thuot.

  2. STS-26 crew trains in JSC fixed-based (FB) shuttle mission simulator (SMS)

    Science.gov (United States)

    1987-01-01

    STS-26 Discovery, Orbiter Vehicle (OV) 103, crewmembers (left to right) Commander Frederick H. Hauck, Pilot Richard O. Covey, Mission Specialist (MS) George D. Nelson, MS David C. Hilmers, and MS John M. Lounge pose on the middeck in fixed-based (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5. A simulation for their anticipated June 1988 flight began 10-20-87.

  3. ASTP crewmen in Soyuz orbital module mock-up during training session at JSC

    Science.gov (United States)

    1975-01-01

    An interior view of the Soyuz orbital module mock-up in bldg 35 during Apollo Soyuz Test Project (ASTP) joint crew training at JSC. The ASTP crewmen are Astronaut Vance D. Brand (on left), command module pilot of the American ASTP prime crew; and Cosmonaut Valeriy N. Kubasov, engineer on the Soviet ASTP first (prime) crew. The training session simulated activities on the second day in Earth orbit.

  4. ASTP crewmen in Docking Module trainer during training session at JSC

    Science.gov (United States)

    1975-01-01

    An interior view of the Docking Module trainer in bldg 35 during Apollo Soyuz Test Project (ASTP) joint crew training at JSC. Astronaut Thomas P. Stafford, commander of the American ASTP prime crew, is on the right. The other crewman is Cosmonaut Aleksey A. Leonov, commander of the Soviet ASTP prime crew. The training session simulated activities on the second day in Earth orbit. The Docking Module is designed to link the Apollo and Soyuz spacecraft.

  5. STS-48 MS Gemar uses laptop during training session in JSC's MB SMS

    Science.gov (United States)

    1991-01-01

    STS-48 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) Charles D. Gemar, wearing lightweight headset, enters data into a portable laptop computer on the middeck of JSC's Motion Based (MB) Shuttle Mission Simulator (SMS). Gemar is participating in a preflight familiarization session in the MB-SMS located in the Mission Simulation and Training Facility Bldg 5. Visible to Gemar's right is a stowed extravehicular mobility unit (EMU) and on his left are forward locker mockups.

  6. JSC research and technology

    Science.gov (United States)

    1993-01-01

    The primary roles and missions of JSC incorporate all aspects of human presence in space. Therefore, the Center is involved in the development of technology that will allow humans to stay longer in Earth orbit, allow safe flight in space, and provide capabilities to explore the Moon and Mars. The Center's technology emphasis areas include human spacecraft development, human support systems and infrastructure, and human spacecraft operations. Safety and reliability are critical requirements for the technologies that JSC pursues for long-duration use in space. One of the objectives of technology development at the Center is to give employees the opportunity to enhance their technological expertise and project management skills by defining, designing, and developing projects that are vital to the Center's strategy for the future. This report is intended to communicate within and outside the Agency our research and technology (R&T) accomplishments, as well as inform Headquarters program managers and their constituents of the significant accomplishments that have promise for future Agency programs. While not inclusive of all R&T efforts, the report presents a comprehensive summary of JSC projects in which substantial progress was made in the 1992 fiscal year. At the beginning of each project description, names of the Principal Investigator (PI) and the Technical Monitor (TM) are given, followed by their JSC mail codes or their company or university affiliations. The funding sources and technology focal points are identified in the index.

  7. Renovation of the outside lighting - Bldg. 112 zone

    CERN Multimedia

    GS Department

    2010-01-01

    Due to the renovation of the outside lighting, the traffic will be disrupted along “Route Feynman”. From the water tower (Bldg. 227) to Restaurant Nr. 2 (Bldg. 504) between 18 and 30 August. We recommend great caution. Thank you for your understanding. SEM Group

  8. Center Innovation Fund: JSC CIF (also includes JSC IRAD) Program

    Data.gov (United States)

    National Aeronautics and Space Administration — JSC provides and applies its preeminent capabilities in science and technology to develop, operate, and integrate human exploration missions.  The Center...

  9. STS-57 crewmembers train in JSC's FB Shuttle Mission Simulator (SMS)

    Science.gov (United States)

    1993-01-01

    STS-57 Endeavour, Orbiter Vehicle (OV) 105, Mission Specialist 2 (MS2) Nancy J. Sherlock, holding computer diskettes and procedural checklist, discusses equipment operation with Commander Ronald J. Grabe on the middeck of JSC's fixed based (FB) shuttle mission simulator (SMS). Payload Commander (PLC) G. David Low points to a forward locker location as MS3 Peter J.K. Wisoff switches controls on overhead panels MO42F and MO58F, and MS4 Janice E. Voss looks on. The FB-SMS is located in the Mission Simulation and Training Facility Bldg 5.

  10. STS-37 crewmembers test CETA hand cart during training session in JSC's WETF

    Science.gov (United States)

    1989-01-01

    STS-37 Atlantis, Orbiter Vehicle (OV) 104, Mission Specialist (MS) Jerry L. Ross and MS Jerome Apt test crew and equipment translation aid (CETA) manual hand over hand cart during underwater session in JSC's Weightless Environment Training Facility (WETF) Bldg 29. Wearing an extravehicular mobility unit (EMU), Ross pulls the CETA manual cart along the rail while Apt holds onto the back of the cart. The test will determine how difficult it is to maneuver cargo in such a manner when it is done in space on STS-37. The goal is to find the best method for astronauts to move around the exterior of Space Station Freedom (SSF).

  11. NASA/JSC ISSLive!

    Science.gov (United States)

    Harris, Philip D.; Price, Jennifer B.; Khan, Ahmed; Severance, Mark T.

    2011-01-01

    Just 150 miles above us, the International Space Station (ISS) is orbiting. Each day, the astronauts on board perform a variety of activities from exercise, science experiments, and maintenance. Yet, many on the ground do not know about these daily activities. National Aeronautics Space Agency/ Johnson Space Center (NASA/JSC) innovation creation ISSLive! - an education project - is working to bridge this knowledge gap with traditional education channels such as schools, but also non-traditional channels with the non-technical everyday public. ISSLive! provides a website that seamlessly integrates planning and telemetry data, video feeds, 3D models, and iOS and android applications. Through the site, users are able to view astronauts daily schedules, in plain English alongside the original data. As an example, when an astronaut is working with a science experiment, a user will be able to read about the activity and for more detailed activities follow provided links to view more information all integrated into the same site. Live telemetry data from a predefined set can also be provided alongside the activities. For users to learn more, 3D models of the external and internal parts of the ISS are available, allowing users to explore the station and even select sensors, such as temperature, and view a real-time chart of the data. Even ground operations are modeled with a 3D mission control center, providing users information on the various flight control disciplines and showing live data that they would be monitoring. Some unique activities are also highlighted and have dedicated spaces to explore in more detail. Education is the focus of ISSLive!, even from the beginning when university students participated in the development process as part of their master s projects. Focus groups at a Houston school showed interest in the project and excitement towards including ISSLive! in their classroom. Through this inclusion, students' knowledge can be assessed with projects

  12. STS-9 crewmembers in training session in bldg 9A

    Science.gov (United States)

    1983-01-01

    Members of the STS-9 crew discuss flight procedures with a trainer in bldg 9A before the STS-9 mission. From left to right are Brewster Shaw, pilot; John Young, crew commander; Robert Parker, mission specialist; and unidentified trainer. They are reviewing procedures manuals on the shuttle mock-up hatch.

  13. Center Independent Research & Developments: JSC IRAD Program

    Data.gov (United States)

    National Aeronautics and Space Administration — JSC provides and applies its preeminent capabilities in science and technology to develop, operate, and integrate human exploration missions.  The center...

  14. JSC Orbital Debris Website Description

    Science.gov (United States)

    Johnson, Nicholas L.

    2006-01-01

    Purpose: The website provides information about the NASA Orbital Debris Program Office at JSC, which is the lead NASA center for orbital debris research. It is recognized world-wide for its leadership in addressing orbital debris issues. The NASA Orbital Debris Program Office has taken the international lead in conducting measurements of the environment and in developing the technical consensus for adopting mitigation measures to protect users of the orbital environment. Work at the center continues with developing an improved understanding of the orbital debris environment and measures that can be taken to control its growth. Major Contents: Orbital Debris research is divided into the following five broad efforts. Each area of research contains specific information as follows: 1) Modeling - NASA scientists continue to develop and upgrade orbital debris models to describe and characterize the current and future debris environment. Evolutionary and engineering models are described in detail. Downloadable items include a document in PDF format and executable software. 2) Measurements - Measurements of near-Earth orbital debris are accomplished by conducting ground-based and space-based observations of the orbital debris environment. The data from these sources provide validation of the environment models and identify the presence of new sources. Radar, optical and surface examinations are described. External links to related topics are provided. 3) Protection - Orbital debris protection involves conducting hypervelocity impact measurements to assess the risk presented by orbital debris to operating spacecraft and developing new materials and new designs to provide better protection from the environment with less weight penalty. The data from this work provides the link between the environment defined by the models and the risk presented by that environment to operating spacecraft and provides recommendations on design and operations procedures to reduce the risk as

  15. Apollo Spacecraft 012 Command/Service Module being moved to Operations bldg

    Science.gov (United States)

    1967-01-01

    Transfer of Apollo Spacecraft 012 Command/Service Module for mating to the Saturn Lunar Module Adapter No. 05 in the Manned Spacecraft Operations bldg. S/C 012 will be flown on the Apollo/Saturn 204 mission.

  16. Quality assurance monitoring during nuclear fuel production in JSC 'TVEL'

    International Nuclear Information System (INIS)

    Filimonov, G.; Tchirkov, V.

    2000-01-01

    The paper describes Quality Assurance (QA) monitoring during fabrication of nuclear fuel in Russian Federation. Joint Stock Company 'TVEL', natural state monopoly of the type of holding that fabricates and supplies nuclear fuel for the NPPs of Russia, CIS and Europe, incorporates the major enterprises of the nuclear fuel cycle including JSC 'Mashinostroitelny zavod', Electrostal (fabrication of fuel pellets, rods and assemblies for different types of reactors), JSC 'Novosibirsky zavod khimconcentratov', Novosibirsk (fabrication of fuel rods and assemblies for WWER-440 and WWER-1000), JSC 'Tchepetsky mechanitchesky zavod', Tchepetsk (fabrication of Zr tubing). Monitoring of QA is an important element of Quality Management System (QMS) developed and implemented at the above-mentioned enterprises of the JSC 'TVEL' and it is performed on three levels including external and internal audits and author's supervision. Paper also describes short- and long-term policies of the JSC 'TVEL' in nuclear fuel quality field. (author)

  17. Astronaut Terry J. Hart in training session RMS for STS-2 bldg 29

    Science.gov (United States)

    1981-01-01

    Astronaut Terry J. Hart in training session with the Remote Manipulator System (RMS) for STS-2 bldg 29. Views show Truly working at the command console while watching out the windows. Karen Ehlers, an RMS procedures specialist, can be seen at left side of frame while Astronaut Sally Ride waits on right for her time at the RMS.

  18. Astronaut Richard H. Truly in training session RMS for STS-2 bldg 9A

    Science.gov (United States)

    1981-01-01

    Astronaut Richard H. Truly in training session with the Remote Manipulator System (RMS) for STS-2 bldg 9A. Views show Truly working at the command console while watching out the windows. Karen Ehlers, an RMS procedures specialist, can be seen at left side of frame (34314); view from behind Truly as he trains at the RMS console (34315).

  19. JSC “ALFA-BANK” marketing policy. problems and perspectives

    OpenAIRE

    Kirillov, A.; Kuznetcova, E.; Martirosian, M.

    2013-01-01

    The article is devoted to the results of JSC “Alfa-Bank” consumers’ segmentation and the following complex marketing research. The article suggests the ways of the bank’s marketing policy improvement.

  20. Overview of Power Quality and Integrated Testing at JSC

    Science.gov (United States)

    Davies, Francis

    2018-01-01

    This presentation describes the basic philosophy behind integrated testing and partially integrated testing. It lists some well known errors in space systems that were or could have been caught during integrated testing. Two examples of integrated testing at the Johnson Space Center (JSC) are mentioned, and then an overview of two test facilities that do power testing (partially integrated testing) at JSC are presented, with information on the capabilities of each. Finally a list of three projects that has problems caught during power quality or Electromagnetic Interference (EMI) testing is presented.

  1. Astronaut Ronald Sega with Wake Shield Facility on test stand at JSC

    Science.gov (United States)

    1991-01-01

    The Wake Shield Facility is displayed on a test stand at JSC. Astronaut Ronald M. Sega, mission specialist for STS-60, is seen with the facility during a break in testing in the acoustic and vibration facility at JSC.

  2. Best Practices: Power Quality and Integrated Testing at JSC

    Science.gov (United States)

    Davis, Lydia

    2018-01-01

    This presentation discusses Best Practices for Power Quality and Integrated Testing at JSC in regards to electrical systems. These high-level charts include mostly generic information; however, a specific issue is discussed involving flight hardware that could have been discovered prior to flight with an integrated test.

  3. JSC Case Study: Fleet Experience with E-85 Fuel

    Science.gov (United States)

    Hummel, Kirck

    2009-01-01

    JSC has used E-85 as part of an overall strategy to comply with Presidential Executive Order 13423 and the Energy Policy Act. As a Federal fleet, we are required to reduce our petroleum consumption by 2 percent per year, and increase the use of alternative fuels in our vehicles. With the opening of our onsite dispenser in October 2004, JSC became the second federal fleet in Texas and the fifth NASA center to add E-85 fueling capability. JSC has a relatively small number of GSA Flex Fuel fleet vehicles at the present time (we don't include personal vehicles, or other contractor's non-GSA fleet), and there were no reasonably available retail E-85 fuel stations within a 15-minute drive or within five miles (one way). So we decided to install a small 1000 gallon onsite tank and dispenser. It was difficult to obtain a supplier due to our low monthly fuel consumption, and our fuel supplier contract has changed three times in less than five years. We experiences a couple of fuel contamination and quality control issues. JSC obtained good information on E-85 from the National Ethanol Vehicle Coalition (NEVC). We also spoke with Defense Energy Support Center, (DESC), Lawrence Berkeley Laboratory, and US Army Fort Leonard Wood. E-85 is a liquid fuel that is dispensed into our Flexible Fuel Vehicles identically to regular gasoline, so it was easy for our vehicle drivers to make the transition.

  4. Development of the CELSS Emulator at NASA JSC

    Science.gov (United States)

    Cullingford, Hatice S.

    1989-01-01

    The Controlled Ecological Life Support System (CELSS) Emulator is under development at the NASA Johnson Space Center (JSC) with the purpose to investigate computer simulations of integrated CELSS operations involving humans, plants, and process machinery. This paper describes Version 1.0 of the CELSS Emulator that was initiated in 1988 on the JSC Multi Purpose Applications Console Test Bed as the simulation framework. The run module of the simulation system now contains a CELSS model called BLSS. The CELSS Emulator makes it possible to generate model data sets, store libraries of results for further analysis, and also display plots of model variables as a function of time. The progress of the project is presented with sample test runs and simulation display pages.

  5. The JSC Engineering Directorate Product Peer Review Process

    Science.gov (United States)

    Jenks, Kenneth C.

    2009-01-01

    The JSC Engineering Directorate has developed a Product Peer Review process in support of NASA policies for project management and systems engineering. The process complies with the requirements of NPR 7120.5, NPR 7123.1 and NPR 7150.2 and follows the guidance in NASA/SP-2007-6105. This presentation will give an overview of the process followed by a brief demonstration of an actual peer review, with audience participation.

  6. Human Spaceflight Technology Needs - A Foundation for JSC's Technology Strategy

    Science.gov (United States)

    Stecklein, Jonette M.

    2013-01-01

    Human space exploration has always been heavily influenced by goals to achieve a specific mission on a specific schedule. This approach drove rapid technology development, the rapidity of which adds risks as well as provides a major driver for costs and cost uncertainty. The National Aeronautics and Space Administration (NASA) is now approaching the extension of human presence throughout the solar system by balancing a proactive yet less schedule-driven development of technology with opportunistic scheduling of missions as the needed technologies are realized. This approach should provide cost effective, low risk technology development that will enable efficient and effective manned spaceflight missions. As a first step, the NASA Human Spaceflight Architecture Team (HAT) has identified a suite of critical technologies needed to support future manned missions across a range of destinations, including in cis-lunar space, near earth asteroid visits, lunar exploration, Mars moons, and Mars exploration. The challenge now is to develop a strategy and plan for technology development that efficiently enables these missions over a reasonable time period, without increasing technology development costs unnecessarily due to schedule pressure, and subsequently mitigating development and mission risks. NASA's Johnson Space Center (JSC), as the nation s primary center for human exploration, is addressing this challenge through an innovative approach in allocating Internal Research and Development funding to projects. The HAT Technology Needs (TechNeeds) Database has been developed to correlate across critical technologies and the NASA Office of Chief Technologist Technology Area Breakdown Structure (TABS). The TechNeeds Database illuminates that many critical technologies may support a single technical capability gap, that many HAT technology needs may map to a single TABS technology discipline, and that a single HAT technology need may map to multiple TABS technology

  7. Organic Contamination Baseline Study on NASA JSC Astromaterial Curation Gloveboxes

    Science.gov (United States)

    Calaway, Michael J.; Allton, J. H.; Allen, C. C.; Burkett, P. J.

    2013-01-01

    Future planned sample return missions to carbon-rich asteroids and Mars in the next two decades will require strict handling and curation protocols as well as new procedures for reducing organic contamination. After the Apollo program, astromaterial collections have mainly been concerned with inorganic contamination [1-4]. However, future isolation containment systems for astromaterials, possibly nitrogen enriched gloveboxes, must be able to reduce organic and inorganic cross-contamination. In 2012, a baseline study was orchestrated to establish the current state of organic cleanliness in gloveboxes used by NASA JSC astromaterials curation labs that could be used as a benchmark for future mission designs.

  8. Developing drug formularies for the "National Medical Holding" JSC.

    Science.gov (United States)

    Akhmadyar, N S; Khairulin, B E; Amangeldy-Kyzy, S; Ospanov, M A

    2015-01-01

    One of the main problems of drug provision of multidisciplinary hospitals is the necessity to improve the efficiency of budget spending. Despite the efforts undertaken in Kazakhstan for improving the mechanism of drug distribution (creation of the Kazakhstan National Formulary, Unified National Health System, the handbook of medicines (drugs) costs in the electronic register of inpatients (ERI), having a single distributor), the number of unresolved issues still remain."National Medical Holding" JSC (NMH) was established in 2008 and unites 6 innovational healthcare facilities with up to 1431 beds (700 children and 731 adults), located in the medical cluster - which are "National Research Center for Maternal and Child Health" JSC (NRCMC), "Republic Children's Rehabilitation Center" JSC (RCRC), "Republican Diagnostic Center" JSC (RDC), "National Centre for Neurosurgery" JSC (NCN), "National Research Center for Oncology and Transplantation" JSC (NRCOT) and "National Research Cardiac Surgery Center" JSC (NRCSC). The main purpose of NMH is to create an internationally competitive "Hospital of the Future", which will provide the citizens of Kazakhstan and others with a wide range of medical services based on advanced medical technology, modern hospital management, international quality and safety standards. These services include emergency care, outpatient diagnostic services, obstetrics and gynecology, neonatal care, internal medicine, neurosurgery, cardiac surgery, transplantation, cancer care for children and adults, as well as rehabilitation treatment. To create a program of development of a drug formulary of NMH and its subsidiaries. In order to create drug formularies of NMH, analytical, software and statistical methods were used.AII subsidiary organizations of NMH (5 out of 6) except for the NRCOT have been accredited by Joint Commission International (JCI) standards, which ensure the safety of patients and clinical staff, by improving the technological

  9. Reducing Organic Contamination in NASA JSC Astromaterial Curation Facility

    Science.gov (United States)

    Calaway, M. J.; Allen, C. C.; Allton, J. H.

    2013-01-01

    Future robotic and human spaceflight missions to the Moon, Mars, asteroids and comets will require handling and storing astromaterial samples with minimal inorganic and organic contamination to preserve the scientific integrity of each sample. Much was learned from the rigorous attempts to minimize and monitor organic contamination during Apollo, but it was not adequate for current analytical requirements; thus [1]. OSIRIS-REx, Hayabusa-2, and future Mars sample return will require better protocols for reducing organic contamination. Future isolation con-tainment systems for astromaterials, possibly nitrogen enriched gloveboxes, must be able to reduce organic and inorganic cross-contamination. In 2012, a baseline study established the current state of organic cleanliness in gloveboxes used by NASA JSC astromaterials curation labs that could be used as a benchmark for future mission designs [2, 3]. After standard ultra-pure water (UPW) cleaning, the majority of organic contaminates found were hydrocarbons, plasticizers, silicones, and solvents. Hydro-carbons loads (> C7) ranged from 1.9 to 11.8 ng/cm2 for TD-GC-MS wafer exposure analyses and 5.0 to 19.5 ng/L for TD-GC-MS adsorbent tube exposure. Plasticizers included peracetic acid sterilization were used in the atmospheric de-contamination (R) cabinets. Later, Lunar curation gloveboxes were degreased with a pressurized Freon 113 wash. Today, UPW has replaced Freon as the standard cleaning procedure, but does not have the degreasing solvency power of Freon. Future Cleaning Studies: Cleaning experiments are cur-rently being orchestrated to study how to degrease and reduce organics in a JSC curation glovebox lower than the established baseline. Several new chemicals in the industry have replaced traditional degreasing solvents such as Freon and others that are now federally restricted. However, these new suites of chemicals remain untested for lowering organics in curation gloveboxes. 3M's HFE-7100DL and Du

  10. The JSC Research and Development Annual Report 1993

    Science.gov (United States)

    1994-01-01

    Issued as a companion to Johnson Space Center's Research and Technology Annual Report, which reports JSC accomplishments under NASA Research and Technology Operating Plan (RTOP) funding, this report describes 47 additional projects that are funded through sources other than the RTOP. Emerging technologies in four major disciplines are summarized: space systems technology, medical and life sciences, mission operations, and computer systems. Although these projects focus on support of human spacecraft design, development, and safety, most have wide civil and commercial applications in areas such as advanced materials, superconductors, advanced semiconductors, digital imaging, high density data storage, high performance computers, optoelectronics, artificial intelligence, robotics and automation, sensors, biotechnology, medical devices and diagnosis, and human factors engineering.

  11. Replacement/Refurbishment of JSC/NASA POD Specimens

    Science.gov (United States)

    Castner, Willard L.

    2010-01-01

    The NASA Special NDE certification process requires demonstration of NDE capability by test per NASA-STD-5009. This test is performed with fatigue cracked specimens containing very small cracks. The certification test results are usually based on binomial statistics and must meet a 90/95 Probability of Detection (POD). The assumption is that fatigue cracks are tightly closed, difficult to detect, and inspectors and processes passing such a test are well qualified for inspecting NASA fracture critical hardware. The JSC NDE laboratory has what may be the largest inventory that exists of such fatigue cracked NDE demonstration specimens. These specimens were produced by the hundreds in the late 1980s and early 1990s. None have been produced since that time and the condition and usability of the specimens are questionable.

  12. [Taylor and Hill, Incorporated's JSC Cryo Chamber A

    Science.gov (United States)

    Morales, Rito

    2008-01-01

    NASA commissioned construction of an environmental simulation test chamber which was completed in 1964 at Johnson Space Center (JSC) in Houston, Texas. The facility, Chamber A, was invaluable for testing spacecraft and satellites before deployment to space. By testing spacecraft in an environment similar to the one they would be functioning in, potential problems could be addressed before launch. A new addition to NASA's observatory inventory is called the James Webb Space Telescope (JWST), after a former Administrator of NASA. The new telescope will have 7 times the mirror area of the Hubble, with a target destination approximately one million miles from earth. Scheduled for launch in 2013, the JWST will allow scientists the ability to see, for the first time, the first galaxies that formed in the early Universe. Pre-launch testing of JWST must be performed in environments that approximate its final target space environment as closely as possible.

  13. Developing a Strategic Plan for NASA JSC's Technology Investments

    Science.gov (United States)

    Stecklein, Jonette M.

    2012-01-01

    Human space exploration has always been heavily influenced by goals to achieve a specific mission on a specific schedule. This approach drove rapid technology development, the rapidity of which adds risks as well as provides a major driver for costs. The National Aeronautics and Space Administration (NASA) is now approaching the extension of human presence throughout the solar system by balancing a proactive yet less schedule-driven development of technology with opportunistic scheduling of missions as the needed technologies are realized. This approach should provide cost effective, low risk technology development that will enable efficient and effective manned spaceflight missions. As a first step, the NASA Human Spaceflight Architecture Team (HAT) has identified a suite of critical technologies needed to support future manned missions across a range of destinations, including in cislunar space, near earth asteroid visits, lunar exploration, Mars space, and Mars exploration. The challenge now is to develop a strategy and plan for technology development that efficiently enables these missions over a reasonable time period, without increasing technology development costs unnecessarily due to schedule pressure, and subsequently mitigating development and mission risks. NASA fs Johnson Space Center (JSC), as the nation's primary center for human exploration, is addressing this challenge through an innovative approach allocating Internal Research and Development funding to projects that have been prioritized using four focus criteria, with appropriate importance weighting. These four focus criteria are the Human Space Flight Technology Needs, JSC Core Technology Competencies, Commercialization Potential, and Partnership Potential. The inherent coupling in these focus criteria have been captured in a database and have provided an initial prioritization for allocation of technology development research funding. This paper will describe this process and this database

  14. The need for health promotion in jsc „vilniaus baldai“

    OpenAIRE

    Melkūnaitė, Eglė

    2017-01-01

    The Need for Health Promotion in JSC „Vilniaus Baldai“ The relevance of the study. Health promotion in workplaces brings benefits to the employees, organizations, governments and society as a whole. In order to successfully implement the health promotion program in the workplace, it is important to evaluate facilities, demands and situation of the employer. The aim of the study. To measure the need of health promotion in the company JSC „Vilniaus baldai“. The objective of the study. Measure t...

  15. Human Thermal Model Evaluation Using the JSC Human Thermal Database

    Science.gov (United States)

    Bue, Grant; Makinen, Janice; Cognata, Thomas

    2012-01-01

    Human thermal modeling has considerable long term utility to human space flight. Such models provide a tool to predict crew survivability in support of vehicle design and to evaluate crew response in untested space environments. It is to the benefit of any such model not only to collect relevant experimental data to correlate it against, but also to maintain an experimental standard or benchmark for future development in a readily and rapidly searchable and software accessible format. The Human thermal database project is intended to do just so; to collect relevant data from literature and experimentation and to store the data in a database structure for immediate and future use as a benchmark to judge human thermal models against, in identifying model strengths and weakness, to support model development and improve correlation, and to statistically quantify a model s predictive quality. The human thermal database developed at the Johnson Space Center (JSC) is intended to evaluate a set of widely used human thermal models. This set includes the Wissler human thermal model, a model that has been widely used to predict the human thermoregulatory response to a variety of cold and hot environments. These models are statistically compared to the current database, which contains experiments of human subjects primarily in air from a literature survey ranging between 1953 and 2004 and from a suited experiment recently performed by the authors, for a quantitative study of relative strength and predictive quality of the models.

  16. MODERN RESOURCE-SAVING TECHNOLOGIES IN FOUNDRY PRODUCTION OF JSC «MINSK TRAKTOR PLANT»

    Directory of Open Access Journals (Sweden)

    F. A. Domotenko

    2016-01-01

    Full Text Available In article the main world tendencies of development of the production technology of sandy cores and value of this production in complex technology of manufacture of castings are considered. It is established that the most rational way of production technically and economically is manufacture of wafer sandy cores using the Cold-box-amin technology. Scientific, technical, technological and economic aspects of modernization of foundry production of JSC MTZ with complete transition to production of sandy cores on the resource-saving Cold-box-amin technology are provided. The main distinctive feature of this reequipment – all planned works are based on the domestic technological developments and the equipment created in the cooperation by specialists of JSC BELNIILIT and JSC MTZ. Within GNTP essential support to the provided works was given by the state.

  17. Overview of JSC “NIKIET” activity on ITER Procurement Arrangements

    Energy Technology Data Exchange (ETDEWEB)

    Leshukov, A.Yu., E-mail: leshu@nikiet.ru [Joint-Stock Company “N.A. Dollezhall Research and Development Institute of Power Engineering”, (JSC “NIKIET”), 107140, Malaya Krasnoselskaya 2/8, Moscow (Russian Federation); Dragunov, Yu. G.; Strebkov, Yu. S.; Kirillov, S.Yu.; Makarov, S.V.; Trofimovich, P.D.; Dubinin, G.V.; Maksimov, V.A.; Sviridenko, M.N.; Razmerov, A.V.; Parshutin, E.V.; Khomyakov, S.E.; Kolganov, V.Yu.; Zhmakin, A.V. [Joint-Stock Company “N.A. Dollezhall Research and Development Institute of Power Engineering”, (JSC “NIKIET”), 107140, Malaya Krasnoselskaya 2/8, Moscow (Russian Federation); Belyakov, V.A.; Mazul, I.V.; Gervash, A.A. [JSC “NIIEFA” (D.V. Efremov Institute), 189631, Doroga na Metallostroy, 3, S. Peterburg (Russian Federation); Safronov, V.M.; Romannikov, A.N. [Institution “Project Center ITER”,123182, Square of Academic Kurchatov 1, Moscow (Russian Federation); Eaton, R. [ITER Organization, Route de Vinon sur Verdon CS 90 046 − 13067 Saint Paul lez Durance (France); and others

    2016-11-01

    The two following ITER blanket-relevant Procurement Arrangements (PA) were signed by Russian Federation and ITER Organization in 2014: 1)1.6.P1ARF.01 “Blanket First Wall” (signed on 14-th of February, 2014); 2)1.6.P3.RF.01 “Blanket Module Connections” (signed on 19-th of December, 2014). The first PA is devoted to the development, manufacturing, testing and procuring to ITER site of 179 Enhanced Heat Flux (EHF) First Wall (FW) Panels. These FW panels are intended to withstand the heat flux from plasma up to 4.7 MW/m{sup 2}, and there are two institutions in Russian Federation responsible for the manufacturing, testing and delivering of these panels on the ITER site: JSC “NIIEFA” (Efremov Institute) and JSC “NIKIET”. JSC “NIIEFA” (Efremov Institute) will manufacture the plasma-facing components (PFC) of EHF FW Panels and perform the final assembling of the panels while JSC “NIKIET” will manufacture the FW beam structures, load-bearing structures of PFC and the all the elements of panel attachment system. As for the second PA (“Blanket Module Connectors”) the JSC “NIKIET” is the alone official Supplier and will manufacture and procure blanket flexible supports, electrical insulating key pads and shield block/vacuum vessel electrical connectors. This article briefly describes the joint activity of JSC “NIKIET” and Efremov Institute in the framework of 1.6.P1ARF.01 “Blanket First Wall” Procurement Arrangement and the material on the activity on the second PA. The main achievements on both PAs (during the period of 2014–2015) are presented and also critical issues and plans are underlined.

  18. Organic Contamination Baseline Study: In NASA JSC Astromaterials Curation Laboratories. Summary Report

    Science.gov (United States)

    Calaway, Michael J.

    2013-01-01

    In preparation for OSIRIS-REx and other future sample return missions concerned with analyzing organics, we conducted an Organic Contamination Baseline Study for JSC Curation Labsoratories in FY12. For FY12 testing, organic baseline study focused only on molecular organic contamination in JSC curation gloveboxes: presumably future collections (i.e. Lunar, Mars, asteroid missions) would use isolation containment systems over only cleanrooms for primary sample storage. This decision was made due to limit historical data on curation gloveboxes, limited IR&D funds and Genesis routinely monitors organics in their ISO class 4 cleanrooms.

  19. Improvement of Operational Reliability Resource for JSC “Beltransgaz” Main Pipelines

    Directory of Open Access Journals (Sweden)

    V. V. Mayorov

    2013-01-01

    Full Text Available  The paper considers prospects for modernization of the operating linear portion of JSC “Beltransgaz” gas transportation system, various methods and materials which are used while implementing  construction and installation works in the oil and gas sector. It has been shown that in the recent decade one of the most technically, technologically and economically efficient application of the material is double-composite polyurethane coating. The method for coating deposition has been tested and introduced by JSC “Beltransgaz” with significant economic efficiency.

  20. 77 FR 31794 - Financial Crimes Enforcement Network; Imposition of Special Measure Against JSC CredexBank as a...

    Science.gov (United States)

    2012-05-30

    ...; Imposition of Special Measure Against JSC CredexBank as a Financial Institution of Primary Money Laundering... for concluding that JSC CredexBank is a financial institution of primary money laundering concern...- money laundering provisions of the Bank Secrecy Act (BSA), codified at 12 U.S.C. 1829b, 12 U.S.C. 1951...

  1. STS-52 Mission Specialist (MS) Jernigan during food planning session at JSC

    Science.gov (United States)

    1992-01-01

    STS-52 Columbia, Orbiter Vehicle (OV) 102, Mission Specialist (MS) Tamara E. Jernigan sips a beverage from a plastic container using a straw. She appears to be pondering what beverages she would like to have on her 10-day flight this coming autumn. Other crewmembers joined Jernigan for this food planning session conducted by JSC's Man-Systems Division.

  2. STS-41 crew is briefed on camera equipment during training session at JSC

    Science.gov (United States)

    1990-01-01

    STS-41 crewmembers are briefed on camera equipment during training session at JSC. Trainer Judy M. Alexander explains the use 16mm motion picture equipment to (left to right) Pilot Robert D. Cabana, Mission Specialist (MS) Bruce E. Melnick, and MS Thomas D. Akers.

  3. The 2015-2016 SEPMAP Program at NASA JSC: Science, Engineering, and Program Management Training

    Science.gov (United States)

    Graham, L.; Archer, D.; Bakalyar, J.; Berger, E.; Blome, E.; Brown, R.; Cox, S.; Curiel, P.; Eid, R.; Eppler, D.; hide

    2017-01-01

    The Systems Engineering Project Management Advancement Program (SEPMAP) at NASA Johnson Space Center (JSC) is an employee development program designed to provide graduate level training in project management and systems engineering. The program includes an applied learning project with engineering and integrated science goals requirements. The teams were presented with a task: Collect a representative sample set from a field site using a hexacopter platform, as if performing a scientific reconnaissance to assess whether the site is of sufficient scientific interest to justify exploration by astronauts. Four teams worked through the eighteen-month course to design customized sampling payloads integrated with the hexacopter, and then operate the aircraft to meet sampling requirements of number (= 5) and mass (= 5g each). The "Mars Yard" at JSC was utilized for this purpose. This project activity closely parallels NASA plans for the future exploration of Mars, where remote sites will be reconnoitered ahead of crewed exploration.

  4. STS-36 crewmembers train in JSC's FB shuttle mission simulator (SMS)

    Science.gov (United States)

    1989-01-01

    STS-36 Mission Specialist (MS) David C. Hilmers, seated on the aft flight deck, discusses procedures with Commander John O. Creighton (left) and Pilot John H. Casper during a simulation in JSC's Fixed Based (FB) Shuttle Mission Simulator (SMS). Casper reviews a checklist at the pilots station on the forward flight deck. The crewmembers are rehearsing crew cabin activities for their upcoming Department of Defense (DOD) mission aboard Atlantis, Orbiter Vehicle (OV) 104.

  5. Boundary Layer Transition Protuberance Tests at NASA JSC Arc-Jet Facility

    Science.gov (United States)

    Larin, Max E.; Marichalar, Jeremiah J.; Kinder, Gerald R.; Campbell, Charles H.; Riccio, Joseph R.; Nguyen, Tien Q.; Del Papa, Steven V.; Pulsonetti, Maria V.

    2010-01-01

    A series of tests conducted recently at the NASA JSC arc -jet test facility demonstrated that a protruding tile material can survive the exposure to the high enthalpy flows characteristic of the Space Shuttle Orbiter re-entry environments. The tests provided temperature data for the protuberance and the surrounding smooth tile surfaces, as well as the tile bond line. The level of heating needed to slump the protuberance material was achieved. Protuberance failure mode was demonstrated.

  6. Gas Phase Pressure Effects on the Apparent Thermal Conductivity of JSC-1A Lunar Regolith Simulant

    Science.gov (United States)

    Yuan, Zeng-Guang; Kleinhenz, Julie E.

    2011-01-01

    Gas phase pressure effects on the apparent thermal conductivity of a JSC-1A/air mixture have been experimentally investigated under steady state thermal conditions from 10 kPa to 100 kPa. The result showed that apparent thermal conductivity of the JSC-1A/air mixture decreased when pressure was lowered to 80 kPa. At 10 kPa, the conductivity decreased to 0.145 W/m/degree C, which is significantly lower than 0.196 W/m/degree C at 100 kPa. This finding is consistent with the results of previous researchers. The reduction of the apparent thermal conductivity at low pressures is ascribed to the Knudsen effect. Since the characteristic length of the void space in bulk JSC-1A varies over a wide range, both the Knudsen regime and continuum regime can coexist in the pore space. The volume ratio of the two regimes varies with pressure. Thus, as gas pressure decreases, the gas volume controlled by Knudsen regime increases. Under Knudsen regime the resistance to the heat flow is higher than that in the continuum regime, resulting in the observed pressure dependency of the apparent thermal conductivity.

  7. Coordinated Analysis 101: A Joint Training Session Sponsored by LPI and ARES/JSC

    Science.gov (United States)

    Draper, D. S.; Treiman, A. H.

    2017-01-01

    The Lunar and Planetary Institute (LPI) and the Astromaterials Research and Exploration Science (ARES) Division, part of the Exploration Integration and Science Directorate at NASA Johnson Space Center (JSC), co-sponsored a training session in November 2016 for four early-career scientists in the techniques of coordinated analysis. Coordinated analysis refers to the approach of systematically performing high-resolution and -precision analytical studies on astromaterials, particularly the very small particles typical of recent and near-future sample return missions such as Stardust, Hayabusa, Hayabusa2, and OSIRIS-REx. A series of successive analytical steps is chosen to be performed on the same particle, as opposed to separate subsections of a sample, in such a way that the initial steps do not compromise the results from later steps in the sequence. The data from the entire series can then be integrated for these individual specimens, revealing important in-sights obtainable no other way. ARES/JSC scientists have played a leading role in the development and application of this approach for many years. Because the coming years will bring new sample collections from these and other planned NASA and international exploration missions, it is timely to begin disseminating specialized techniques for the study of small and precious astromaterial samples. As part of the Cooperative Agreement between NASA and the LPI, this training workshop was intended as the first in a series of similar training exercises that the two organizations will jointly sponsor in the coming years. These workshops will span the range of analytical capabilities and sample types available at ARES/JSC in the Astromaterials Research and Astro-materials Acquisition and Curation Offices. Here we summarize the activities and participants in this initial training.

  8. Commissioning of the Liquid Nitrogen Thermo-Siphon System for NASA-JSC Chamber-A

    Science.gov (United States)

    Homan, J.; Montz, M.; Ganni, V.; Sidi-Yekhlef, A.; Knudsen, P.; Garcia, S.; Garza, J.

    2013-01-01

    NASA's Space Environment Simulation Laboratory's (SESL) Chamber A, located at the Johnson Space Center in Houston Texas has recently implemented major enhancements of its cryogenic and vacuum systems. The new liquid nitrogen (LN2) thermo-siphon system was successfully commissioned in August of 2012. Chamber A, which has 20 K helium cryo-panels (or shrouds ) which are shielded by 80 K nitrogen shrouds, is capable of simulating a deep space environment necessary to perform ground testing of NASA s James Webb Space Telescope (JWST). Chamber A s previous system used forced flow LN2 cooling with centrifugal pumps, requiring 200,000 liters of LN2 to cool-down and consuming 180,000 liters per day of LN2 in steady operation. The LN2 system did not have the reliability required to meet the long duration test of the JWST, and the cost estimate provided in the initial approach to NASA-JSC by the sub-contractor for refurbishment of the system to meet the reliability goals was prohibitive. At NASA-JSC's request, the JLab Cryogenics Group provided alternative options in 2007, including a thermo-siphon, or natural flow system. This system, eliminated the need for pumps and used one tenth of the original control valves, relief valves, and burst disks. After the thermo-siphon approach was selected, JLab provided technical assistance in the process design, mechanical design, component specification development and commissioning oversight, while the installation and commissioning operations of the system was overseen by the Jacobs Technology/ESC group at JSC. The preliminary commissioning data indicate lower shroud temperatures, 70,000 liters to cool-down and less than 90,000 liters per day consumed in steady operation. All of the performance capabilities have exceeded the design goals. This paper will outline the comparison between the original system and the predicted results of the selected design option, and the commissioning results of thermo-siphon system.

  9. Commissioning of the Liquid Nitrogen Thermo-Siphon System for NASA-JSC Chamber A

    Science.gov (United States)

    Homan, J.; Montz, M.; Ganni, V.; Sidi-Yekhlef, A.; Knudsen, P.; Garcia, S.; Garza, J.

    2013-01-01

    NASA s Space Environment Simulation Laboratory s (SESL) Chamber A, located at the Johnson Space Center in Houston Texas has recently implemented major enhancements of its cryogenic and vacuum systems. The new liquid nitrogen (LN) thermo-siphon system was successfully commissioned in August of 2012. Chamber A, which has 20 K helium cryo-panels (or shrouds ) which are shielded by 80 K nitrogen shrouds, is capable of simulating a deep space environment necessary to perform ground testing of NASA s James Webb Space Telescope (JWST). Chamber A s previous system used forced flow LN cooling with centrifugal pumps, requiring 220,000 liters of LN to cool-down and consuming 180,000 liters per day of LN in steady operation. The LN system did not have the reliability required to meet the long duration test of the JWST, and the cost estimate provided in the initial approach to NASA-JSC by the subcontractor for refurbishment of the system to meet the reliability goals was prohibitive. At NASA-JSC s request, the JLab Cryogenics Group provided alternative options in 2007, including a thermo-siphon, or natural flow system. This system, eliminated the need for pumps and used one tenth of the original control valves, relief valves, and burst disks. After the thermo-siphon approach was selected, JLab provided technical assistance in the process design, mechanical design, component specification development and commissioning oversight, while the installation and commissioning operations of the system was overseen by the Jacobs Technology/ESC group at JSC. The preliminary commissioning data indicate lower shroud temperatures, 68,000 liters to cool-down and less than 91,000 liters per day consumed in steady operation. All of the performance capabilities have exceeded the design goals. This paper will outline the comparison between the original system and the predicted results of the selected design option, and the commissioning results of thermo-siphon system.

  10. Configuration Management (CM) Support for KM Processes at NASA/Johnson Space Center (JSC)

    Science.gov (United States)

    Cioletti, Louis

    2010-01-01

    Collection and processing of information are critical aspects of every business activity from raw data to information to an executable decision. Configuration Management (CM) supports KM practices through its automated business practices and its integrated operations within the organization. This presentation delivers an overview of JSC/Space Life Sciences Directorate (SLSD) and its methods to encourage innovation through collaboration and participation. Specifically, this presentation will illustrate how SLSD CM creates an embedded KM activity with an established IT platform to control and update baselines, requirements, documents, schedules, budgets, while tracking changes essentially managing critical knowledge elements.

  11. Human spaceflight technology needs-a foundation for JSC's technology strategy

    Science.gov (United States)

    Stecklein, J. M.

    Human space exploration has always been heavily influenced by goals to achieve a specific mission on a specific schedule. This approach drove rapid technology development, the rapidity of which added risks and became a major driver for costs and cost uncertainty. The National Aeronautics and Space Administration (NASA) is now approaching the extension of human presence throughout the solar system by balancing a proactive yet less schedule-driven development of technology with opportunistic scheduling of missions as the needed technologies are realized. This approach should provide cost effective, low risk technology development that will enable efficient and effective manned spaceflight missions. As a first step, the NASA Human Spaceflight Architecture Team (HAT) has identified a suite of critical technologies needed to support future manned missions across a range of destinations, including in cis-lunar space, near earth asteroid visits, lunar exploration, Mars moons, and Mars exploration. The challenge now is to develop a strategy and plan for technology development that efficiently enables these missions over a reasonable time period, without increasing technology development costs unnecessarily due to schedule pressure, and subsequently mitigating development and mission risks. NASA's Johnson Space Center (JSC), as the nation's primary center for human exploration, is addressing this challenge through an innovative approach in allocating Internal Research and Development funding to projects. The HAT Technology Needs (Tech Needs) Database has been developed to correlate across critical technologies and the NASA Office of Chief Technologist Technology Area Breakdown Structure (TABS). The TechNeeds Database illuminates that many critical technologies may support a single technical capability gap, that many HAT technology needs may map to a single TABS technology discipline, and that a single HAT technology need may map to multiple TABS technology disciplines. Th

  12. Lyndon B. Johnson Space Center (JSC) proposed dual-use technology investment program in intelligent robots

    Science.gov (United States)

    Erikson, Jon D.

    1994-01-01

    This paper presents an overview of the proposed Lyndon B. Johnson Space Center (JSC) precompetitive, dual-use technology investment project in robotics. New robotic technology in advanced robots, which can recognize and respond to their environments and to spoken human supervision so as to perform a variety of combined mobility and manipulation tasks in various sectors, is an obejective of this work. In the U.S. economy, such robots offer the benefits of improved global competitiveness in a critical industrial sector; improved productivity by the end users of these robots; a growing robotics industry that produces jobs and profits; lower cost health care delivery with quality improvements; and, as these 'intelligent' robots become acceptable throughout society, an increase in the standard of living for everyone. In space, such robots will provide improved safety, reliability, and productivity as Space Station evolves, and will enable human space exploration (by human/robot teams). The proposed effort consists of partnerships between manufacturers, universities, and JSC to develop working production prototypes of these robots by leveraging current development by both sides. Currently targeted applications are in the manufacturing, health care, services, and construction sectors of the U.S. economy and in the inspection, servicing, maintenance, and repair aspects of space exploration. But the focus is on the generic software architecture and standardized interfaces for custom modules tailored for the various applications allowing end users to customize a robot as PC users customize PC's. Production prototypes would be completed in 5 years under this proposal.

  13. ANALYSIS OF TRAIN SHEET IN THE INFORMATION SYSTEM OF JSC «UKRZALIZNYTSIA»: PERSPECTIVE

    Directory of Open Access Journals (Sweden)

    S. M. Ovcharenko

    2016-04-01

    Full Text Available Purpose. The system of train sheet analysis (TSA in the information system of JSC «Ukrzaliznytsia» provides work with passenger and suburban trains and has considerable potential. Therefore it is necessary to establish the prospects of development of the system. Methodology. Departments’ setup and the train delay causes should be carried out at every station and span, where such delays took place. This requires the fixation of condition deviations of infrastructure from normal and other adverse factors. In the sector of freight transportations the train schedule analysis is insufficient, since this analysis does not account for deviations from the terms of delivery. Therefore it also is necessary to analyze the delivery graphs. The basis for monitoring the cargo delivery is the method of control time points (CTP of technological operations performed with cargo at railway stations. On the basis of CTP to assess the quality of the transport process one should calculate the values of the analysis of cargo delivery schedule (performance level of the cargo delivery schedule, the coefficient of ahead of schedule/delay delivery. Findings. The article proposes to develop the system TSA using the input and display of the train delay causes on-line by transportation service employees, expansion of statistical databases and processing of the input delay causes during its calculation train sheet analysis of freight trains and quality assessment of the delivery schedule fulfillment. It is also appropriate before the new operator companies had appeared to make changes in the instructions TSCHU-TSD-0002 on the list of departments, which include delayed trains, by adding «the department» «The fault of operator companies» and corresponding causes of delays. Originality. The scheme of automated TSA in the information system of JSC «Ukrzaliznytsia» was improved. The author proposes to determine the cargo delivery quality on the certain polygon using the

  14. Measurement of Apparent Thermal Conductivity of JSC-1A Under Ambient Pressure

    Science.gov (United States)

    Yuan, Zeng-Guang; Kleinhenz, Julie E.

    2011-01-01

    The apparent thermal conductivity of JSC-1A lunar regolith simulant was measured experimentally using a cylindrical apparatus. Eleven thermocouples were embedded in the simulant bed to obtain the steady state temperature distribution at various radial, axial, and azimuthal locations. The high aspect ratio of a cylindrical geometry was proven to provide a one-dimensional, axisymmetric temperature field. A test series was performed at atmospheric pressure with varying heat fluxes. The radial temperature distribution in each test fit a logarithmic function, indicating a constant thermal conductivity throughout the soil bed. However, thermal conductivity was not constant between tests at different heat fluxes. This variation is attributed to stresses created by thermal expansion of the simulant particles against the rigid chamber wall. Under stress-free conditions (20 deg C), the data suggest a temperature independent apparent conductivity of 0.1961 +/- 0.0070 W/m/ deg C

  15. Osiris-Rex and Hayabusa2 Sample Cleanroom Design and Construction Planning at NASA-JSC

    Science.gov (United States)

    Righter, Kevin; Pace, Lisa F.; Messenger, Keiko

    2018-01-01

    Final Paper and not the abstract is attached. The OSIRIS-REx asteroid sample return mission launched to asteroid Bennu September 8, 2016. The spacecraft will arrive at Bennu in late 2019, orbit and map the asteroid, and perform a touch and go (TAG) sampling maneuver in July 2020. After confirma-tion of successful sample stowage, the spacecraft will return to Earth, and the sample return capsule (SRC) will land in Utah in September 2023. Samples will be recovered from Utah and then transported and stored in a new sample cleanroom at NASA Johnson Space Center in Houston. All curation-specific ex-amination and documentation activities related to Ben-nu samples will be conducted in the dedicated OSIRIS-REx sample cleanroom to be built at NASA-JSC.

  16. Leak Rate Performance of Silicone Elastomer O-Rings Contaminated with JSC-1A Lunar Regolith Simulant

    Science.gov (United States)

    Oravec, Heather Ann; Daniels, Christopher C.

    2014-01-01

    Contamination of spacecraft components with planetary and foreign object debris is a growing concern. Face seals separating the spacecraft cabin from the debris filled environment are particularly susceptible; if the seal becomes contaminated there is potential for decreased performance, mission failure, or catastrophe. In this study, silicone elastomer O-rings were contaminated with JSC- 1A lunar regolith and their leak rate performance was evaluated. The leak rate values of contaminated O-rings at four levels of seal compression were compared to those of as-received, uncontaminated, O-rings. The results showed a drastic increase in leak rate after contamination. JSC-1A contaminated O-rings lead to immeasurably high leak rate values for all levels of compression except complete closure. Additionally, a mechanical method of simulant removal was examined. In general, this method returned the leak rate to as-received values.

  17. Enhanced removal of Zn(2+) or Cd(2+) by the flocculating Chlorella vulgaris JSC-7.

    Science.gov (United States)

    Alam, Md Asraful; Wan, Chun; Zhao, Xin-Qing; Chen, Li-Jie; Chang, Jo-Shu; Bai, Feng-Wu

    2015-05-30

    Microalgae are attracting attention due to their potentials in mitigating CO2 emissions and removing environmental pollutants. However, harvesting microalgal biomass from diluted cultures is one of the bottlenecks for developing economically viable processes for this purpose. Microalgal cells can be harvested by cost-effective sedimentation when flocculating strains are used. In this study, the removal of Zn(2+) and Cd(2+) by the flocculating Chlorella vulgaris JSC-7 was studied. The experimental results indicated that more than 80% Zn(2+) and 60% Cd(2+) were removed by the microalgal culture within 3 days in the presence up to 20.0mg/L Zn(2+) and 4.0mg/L Cd(2+), respectively, which were much higher than that observed with the culture of the non-flocculating C. vulgaris CNW11. Furthermore, the mechanism underlying this phenomenon was explored by investigating the effect of Zn(2+) and Cd(2+) on the growth and metabolic activities of the microalgal strains. It was found that the flocculation of the microalga improved its growth, synthesis of photosynthetic pigments and antioxidation activity under the stressful conditions, indicating a better tolerance to the heavy metal ions for a potential in removing them more efficiently from contaminated wastewaters, together with a bioremediation of other nutritional components contributed to the eutrophication of aquatic ecosystems. Copyright © 2015 Elsevier B.V. All rights reserved.

  18. JSC Advanced Curation: Research and Development for Current Collections and Future Sample Return Mission Demands

    Science.gov (United States)

    Fries, M. D.; Allen, C. C.; Calaway, M. J.; Evans, C. A.; Stansbery, E. K.

    2015-01-01

    Curation of NASA's astromaterials sample collections is a demanding and evolving activity that supports valuable science from NASA missions for generations, long after the samples are returned to Earth. For example, NASA continues to loan hundreds of Apollo program samples to investigators every year and those samples are often analyzed using instruments that did not exist at the time of the Apollo missions themselves. The samples are curated in a manner that minimizes overall contamination, enabling clean, new high-sensitivity measurements and new science results over 40 years after their return to Earth. As our exploration of the Solar System progresses, upcoming and future NASA sample return missions will return new samples with stringent contamination control, sample environmental control, and Planetary Protection requirements. Therefore, an essential element of a healthy astromaterials curation program is a research and development (R&D) effort that characterizes and employs new technologies to maintain current collections and enable new missions - an Advanced Curation effort. JSC's Astromaterials Acquisition & Curation Office is continually performing Advanced Curation research, identifying and defining knowledge gaps about research, development, and validation/verification topics that are critical to support current and future NASA astromaterials sample collections. The following are highlighted knowledge gaps and research opportunities.

  19. Characterization of the flocculating agent from the spontaneously flocculating microalga Chlorella vulgaris JSC-7.

    Science.gov (United States)

    Alam, Md Asraful; Wan, Chun; Guo, Suo-Lian; Zhao, Xin-Qing; Huang, Zih-You; Yang, Yu-Liang; Chang, Jo-Shu; Bai, Feng-Wu

    2014-07-01

    High cost of biomass recovery is one of the bottlenecks for developing cost-effective processes with microalgae, particularly for the production of biofuels and bio-based chemicals through biorefinery, and microalgal biomass recovery through cell flocculation is a promising strategy. Some microalgae are naturally flocculated whose cells can be harvested by simple sedimentation. However, studies on the flocculating agents synthesized by microalgae cells are still very limited. In this work, the cell flocculation of a spontaneously flocculating microalga Chlorella vulgaris JSC-7 was studied, and the flocculating agent was identified to be cell wall polysaccharides whose crude extract supplemented at low dosage of 0.5 mg/L initiated the more than 80% flocculating rate of freely suspended microalgae C. vulgaris CNW11 and Scenedesmus obliquus FSP. Fourier transform infrared (FTIR) analysis revealed a characteristic absorption band at 1238 cm(-1), which might arise from PO asymmetric stretching vibration of [Formula: see text] phosphodiester. The unique cell wall-associated polysaccharide with molecular weight of 9.86×10(3) g/mol, and the monomers consist of glucose, mannose and galactose with a molecular ratio of 5:5:2. This is the first time to our knowledge that the flocculating agent from C. vulgaris has been characterized, which could provide basis for understanding the cell flocculation of microalgae and breeding of novel flocculating microalgae for cost-effective biomass harvest. Copyright © 2013 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  20. Commissioning of a 20 K Helium Refrigeration System for NASA-JSC Chamber A

    Science.gov (United States)

    Homan, J.; Redman, R.; Ganni, V.; Sidi-Yekhlef, A.; Knudsen, P.; Norton, R.; Lauterbach, J.; Linza, R.; Vargas, G.

    2013-01-01

    A new 20 K helium refrigerator installed at NASA Johnson Space Center s Space Environment Simulation Laboratory (SESL) was successfully commissioned and tested in 2012. The refrigerator is used to create a deep space environment within SESL s Chamber A to perform ground testing of the James Webb Space Telescope (JWST). The chamber previously and currently still has helium cryo-pumping panels (CPP) and liquid nitrogen shrouds used to create low earth orbit environments. Now with the new refrigerator and new helium shrouds the chamber can create a deep space environment. The process design, system analysis, specification development, and commissioning oversight were performed by the cryogenics department at Jefferson Lab, while the contracts and system installation was performed by the ESC group at JSC. Commissioning data indicate an inverse coefficient of performance better than 70 W/W for a 18 kW load at 20 K (accounting for liquid nitrogen pre-cooling power) that remains essentially constant down to one third of this load. Even at 10 percent of the maximum capacity, the performance is better than 150 W/W at 20 K. The refrigerator exceeded all design goals and demonstrated the ability to support a wide load range from 10 kW at 15 K to 100 kW at 100 K. The refrigerator is capable of operating at any load temperature from 15 K to ambient with tight temperature stability. The new shroud (36 tons of aluminum) can be cooled from room temperature to 20 K in 24 hours. This paper will outline the process design and commissioning results.

  1. 20 K Helium Refrigeration System for NASA-JSC Chamber-A

    Science.gov (United States)

    Homan, J.; Redman, R.; Ganni, V.; Sidi-Yekhelef, A.; Knudsen, P.; Norton, R.; Lauterbach, J.; Linza, R.; Vargas, G.

    2013-01-01

    A new 20 K helium refrigerator installed at NASA Johnson Space Center's Space Environment Simulation Laboratory (SESL) was successfully commissioned and tested in 2012. The refrigerator is used to create a deep space environment within SESL s Chamber A to perform ground testing of the James Webb Space Telescope. The chamber previously and currently still has helium cryopumping panels (CPP) and LN2 shrouds used to create Low Earth Orbit environments. Now with the new refrigerator and new helium shrouds (45 x 65 ) the chamber can create a deep space environment. The process design, system analysis, specification development, and commissioning oversight were performed by the cryogenics department at Jefferson Labs, while the contracts and system installation was performed by the ESC group at JSC. Commissioning data indicate a inverse coefficient of performance better than 70 W/W for a 18 KW load at 20 K (accounting for liquid nitrogen precooling power) that remains essentially constant down to 1/3 of this load. Even at 10 percent of the maximum capacity, the performance is better than 140 W/W at 20K. The refrigerator exceeded all design goals and demonstrated the ability to support a wide load range from 10kW at 15 K to 100 kW at 100K. The refrigerator is capable of operating at any load temperature from 15K to ambient with tight temperature stability. The new shroud (36 tons of aluminum) can be cooled from room temperature to 20 K in 24 hours. This paper will outline the process design and commissioning results.

  2. Evaluating the effectiveness of the use of fixed assets defense enterprises (by the example of JSC “Concern ‘Sozvezdie’”

    Directory of Open Access Journals (Sweden)

    A. I. Khorev

    2016-01-01

    Full Text Available Currently, the problem of sustainable development of enterprises of the Russian military-industrial complex has not only military, but economic importance. The article provides an analysis of the availability, scope, composition and structure of the basic production assets of JSC "Concern "Sozvezdie" for 2013-2015, and analysis of efficiency of use of the basic production assets in JSC "Concern "Sozvezdie" for 2013-2015. JSC "Concern "Sozvezdie" JSC approved the program of innovative development and technological modernization, the development objective of which is the proved choice of the list and content of activities, the implementation of which should ensure the development of the Concern as a scientific and industrial socio-economic system – a holistic entity. Assessment of the dynamics of the basic production assets has shown that the security of JSC "Concern "Sozvezdie" OPF for 2013-2015 increased by 89,81%. The degree of updating of production assets during the period was 50.7%. The analysis of the efficiency of the basic production assets in JSC "Concern "Sozvezdie" has shown that for every 1% increase in revenue major funds have grown by 0.65%. The rate of fondamenti decreased by 18.2%. The assessment of efficiency of use of the basic production assets of JSC "Concern "Sozvezdie" shows that the total technical re-equipment of scientific and technological, testing and production and technological base of the enterprises of the Concern is directed on creation of production capacities to ensure serial production of advanced weapons, military and special equipment in the framework of the state defense order, as the main activity of the majority of the companies of the Group, and reconstruction, the expansion and creation of production to the production of innovative civilian products.

  3. Complex biological testing of ground water quality in the area of sewage settler filtration fields of JSC 'Almaty Kanty'

    International Nuclear Information System (INIS)

    Vetrinskaya, N.I.; Goldobina, E.A.; Kosmukhambetov, A.R.; Kulikova, O.V.; Kozlova, N.V.; Ismailova, Zh.B.

    2001-01-01

    Results are given on the ground water ecological quality estimation of operating survey boreholes of JSC 'Almaty Kanty' industrial enterprise filtration fields using different methods of biological testing. Proved that various biological objects reacted differently onto the toxins present in the water. Concealment of toxic effect was performed at short-period testing at several testing objects (stimulation). Revealed during long period tests, that ground water from all the boreholes surveyed is not ecologically clean and pure, and can bring damage for ecosystem of water reservoirs adjacent and sources of drinking water if migration happens. (author)

  4. Additive Manufacturing, Design, Testing, and Fabrication: A Full Engineering Experience at JSC

    Science.gov (United States)

    Zusack, Steven

    2016-01-01

    I worked on several projects this term. While most projects involved additive manufacturing, I was also involved with two design projects, two testing projects, and a fabrication project. The primary mentor for these was Richard Hagen. Secondary mentors were Hai Nguyen, Khadijah Shariff, and fabrication training from James Brown. Overall, my experience at JSC has been successful and what I have learned will continue to help me in my engineering education and profession long after I leave. My 3D printing projects ranged from less than a 1 cubic centimeter to about 1 cubic foot and involved several printers using different printing technologies. It was exciting to become familiar with printing technologies such as industrial grade FDM (Fused Deposition Modeling), the relatively new SLA (Stereolithography), and PolyJet. My primary duty with the FDM printers was to model parts that came in from various sources to print effectively and efficiently. Using methods my mentor taught me and the Stratasys Insight software, I was able to minimize imperfections, hasten build time, improve strength for specific forces (tensile, shear, etc...), and reduce likelihood of a print-failure. Also using FDM, I learned how to repair a part after it was printed. This is done by using a special kind of glue that chemically melts the two faces of plastic parts together to form a fused interface. My first goal with SLA technology was to bring the printer back to operational readiness. In becoming familiar with the Pegasus SLA printer, I researched the leveling, laser settings, and different vats to hold liquid material. With this research, I was successfully able to bring the Pegasus back online and have successfully printed multiple sample parts as well as functional parts. My experience with PolyJet technology has been focused on an understanding of the abilities/limits, costs, and the maintenance for daily use. Still upcoming will be experience with using a composite printer that uses FDM

  5. Sustainable development through innovation (the example of JSC «Concern» Constellation»

    Directory of Open Access Journals (Sweden)

    T. I. Ovchinnikova

    2016-01-01

    Full Text Available In the article the «economic growth» theoretical approaches to the terms and «sustainable development». It is indicated that «sustainable development» is related to the introduction of new technologies and innovations, as well as the mechanisms of perfection economic activity. The concept of «sustainable development» includes the principles of sustainability and balanced-ness, while economic growth is associated with the dominant country economic policy objectives, including innovative factors, with the well-being of its population level: the development of the social structure, from the labor market level and other factors. Prospects of development of the country based on the justification of the socio-economic model of its translational movement in the world civilization. Excessive political risks and economic sanctions have shown that Russia should not rely on foreign imports of high-tech, and the need to develop import substitution. Change the vector of development of the Russian economy made their adjustments to the development of the Voronezh region economy slowed down the speed of displacements, of capital, the regional financial centers develop poorly, due to lack of investment has slowed the growth of innovational and information development. There is a growing dependence of the region on the processes taking place at the international and national levels. In the example of the Voronezh area are considered factors of sustainable development such as the coordination of organizational efforts and financial resources in order to achieve a new quality of the region's population lives, and necessity of formation of a new development paradigm of management in the region, based on the modernization of diversified bath economy and the introduction of mechanisms to ensure the implementation of sustainable development. In view of the innovative-investment activity of JSC «Concern» Constellation «steady growth

  6. Propulsion Systems Laboratory, Bldg. 125

    Data.gov (United States)

    Federal Laboratory Consortium — The Propulsion Systems Laboratory (PSL) is NASAs only ground test facility capable of providing true altitude and flight speed simulation for testing full scale gas...

  7. Dependence of the mean time to failure of a hydraulic balancing machine unit on different factors for sectional pumps of the Alrosa JSC

    Science.gov (United States)

    Ovchinnikov, N. P.; Portnyagina, V. V.; Sobakina, M. P.

    2017-12-01

    This paper presents factors that have a greater impact on the mean time to failure of a hydraulic balancing machine unit working in underground kimberlite mines of the Alrosa JSC, the hydraulic balancing machine unit being the least reliable structural elements in terms of error-free operation. In addition, a multifactor linear dependence of mean time to failure of a hydraulic balancing machine unit is shown regarding it being parts of stage sectional pumps in the underground kimberlite mines of the Alrosa JSC. In prospect, this diagram can allow us to predict the durability of the least reliable structural element of a sectional pump.

  8. Evaluating the Effectiveness of Internal Corporate Controls in Coal Mines Illustrated By the Example of JSC “SUEK-Kuzbass”

    Directory of Open Access Journals (Sweden)

    Kucherova Elena

    2017-01-01

    Full Text Available The article gives reasons for the need to develop the mechanism and tools of performance evaluation based on the implementation of specific management functions, as well as the integrated evaluation of the effectiveness of internal corporate controls. It presents the approbation of the proposed assessment methodology on the example of JSC “SUEK-Kuzbass”. The monitoring role as one of the functions of management is constantly increasing in the market economy. The participation of Russian companies in the international economy requires the organisation of internal company control. Moreover, with the enacting of the Law “On Accountings» № 402-FZ, for the majority of economic agents the organising of internal control became mandatory. Thus, the internal control means the process carried out by the Board of Directors and other staff of the organisation aimed at providing reasonable assurance that the objectives of the organisation such as ensuring the effectiveness and efficiency of operations, reliability of financial reporting and compliance with the legislation in force will be achieved.

  9. Assessment of business customers satisfaction with the products and service of Pnevmostroimashina, jsc, on the B2B market

    Directory of Open Access Journals (Sweden)

    L. M. Kapustina

    2010-12-01

    Full Text Available The paper is dedicated to development of a methodology for assessment of customer satisfaction with the products and services on the b2b market. The study of customer satisfaction is aimed at building strong and mutually beneficial supplier-customer relationship. The authors focus on the importance of customer satisfaction continuous monitoring intended for improvement of the company’s market performance. The research based on the works by Kano N., Lamben J.-J., Carter R., Parashuraman A., Zeitaml V. A., Berry L. L. and others, describes an algorithm study of consumers and offers a methodology to evaluate customer satisfaction with the industrial products. Based on the analysis of the economic crisis effects on the machine-building industry, the authors determine the performance of “Pnevmostroimashina”, JSC, on the road and construction equipment market and illustrate an example of practical use of the customer satisfaction assessment technique in the company. At the end of the paper some recommendations for development of an efficient customer satisfaction measurement procedure are introduced.

  10. Cultivation of Chlorella vulgaris JSC-6 with swine wastewater for simultaneous nutrient/COD removal and carbohydrate production.

    Science.gov (United States)

    Wang, Yue; Guo, Wanqian; Yen, Hong-Wei; Ho, Shih-Hsin; Lo, Yung-Chung; Cheng, Chieh-Lun; Ren, Nanqi; Chang, Jo-Shu

    2015-12-01

    Swine wastewater, containing a high concentration of COD and ammonia nitrogen, is suitable for the growth of microalgae, leading to simultaneous COD/nutrients removal from the wastewater. In this study, an isolated carbohydrate-rich microalga Chlorella vulgaris JSC-6 was adopted to perform swine wastewater treatment. Nearly 60-70% COD removal and 40-90% NH3-N removal was achieved in the mixotrophic and heterotrophic culture, depending on the dilution ratio of the wastewater, while the highest removal percentage was obtained with 20-fold diluted wastewater. Mixotrophic cultivation by using fivefold diluted wastewater resulted in the highest biomass concentration of 3.96 g/L. The carbohydrate content of the microalga grown on the wastewater can reach up to 58% (per dry weight). The results indicated that the microalgae-based wastewater treatment can efficiently reduce the nutrients and COD level, and the resulting microalgal biomass had high carbohydrate content, thereby having potential applications for the fermentative production of biofuels or chemicals. Copyright © 2015 Elsevier Ltd. All rights reserved.

  11. A novel marine bacterium Isoptericola sp. JS-C42 with the ability to saccharifying the plant biomasses for the aid in cellulosic ethanol production.

    Science.gov (United States)

    Santhi, Velayudhan Satheeja; Gupta, Ashutosh; Saranya, Somasundaram; Jebakumar, Solomon Robinson David

    2014-06-01

    The ever growing demands for food products such as starch and sugar produces; there is a need to find the sources for saccharification for cellulosic bioethanol production. This study provides the first evidence of the lignocellulolytic and saccharifying ability of a marine bacterium namely Isoptericola sp. JS-C42, a Gram positive actinobacterium with the cocci cells embedded on mycelia isolated from the Arabian Sea, India. It exhibited highest filter paper unit effect, endoglucanase, exoglucanase, cellobiohydrolase, β-glucosidase, xylanase and ligninase effect. The hydrolytic potential of the enzymes displayed the efficient saccharification capability of steam pretreated biomass. It was also found to degrade the paddy, sorghum, Acacia mangium and Ficus religiosa into simple reducing sugars by its efficient lignocellulose enzyme complex with limited consumption of sugars. Production of ethanol was also achieved with the Saccharomyces cerevisiae . Overall, it offers a great potential for the cellulosic ethanol production in an economically reliable and eco-friendly point-of-care.

  12. ASSESSMENT OF RELIABILITY AND RISK DEGREE FOR ACCIDENT INITIATION AT SLIME STORAGES OF 4th MINING ADMINISTRATION, JSC “BELARUSKALI”

    Directory of Open Access Journals (Sweden)

    P. M. Bohaslauchyk

    2016-01-01

    Full Text Available Definition of reliability for dams of slime storage embankment is given on the basis of reliability theory and characteristics of reliability and their analysis are presented in the paper. The paper specifies qualitative indices for earth dams which are subdivided in two groups: applicability factors and structural reliability factors. A short analysis of all possible causes for accident initiation at earth dams has been made and the analysis has permitted to pinpoint eleven main objects for diagnosis for slime storage dams. In order to assess risk degree of accident initiation at JSC “Belaruskali” slime storages all possible causes of emergency cases and their probability of occurrence have been analyzed in the paper. The paper acknowledges the fact that dam malfunction is possible, as a rule, due to violation of operational rules and regulations. Main parameters of slime storage state which are to be controlled regularly in the process of its operation have been noted in the paper. Observation results over slime storages, calculations of dam slope stability for normal operation (a principal calculation case and operating irregularities in water seals (a special calculation case. As a stability margin factor is close to 1.0 for a special calculation case, an extreme position of depression curve has been determined for all design sections. It has been recommended to carry out a constant control over its position, and in the case when it reaches its peak value it is necessary to undertake appropriate measures in order to reduce its value. Final expert estimations on probability of accident initiation at the investigated slime storage dams of the 4th Mining Administration, JSC “Belaruskali” have been prepared on the basis of the analysis comprising all the required factors. A conclusion has been made about low risk degree of their destruction.

  13. CERN Shop - Christmas Sale in Bldg. 33

    CERN Multimedia

    PH Department

    Looking for Christmas present ideas? The CERN Shop will give the CERN card holders a special reduction of 10 % on all CERN Shop articles from Friday 11.12.2009 to Thursday 17.12.2009. Come to visit the CERN Shop at the Reception, Building 33. PH-EDU-PO

  14. CERN Shop - Christmas Sale in Bldg. 33

    CERN Multimedia

    PH Department

    2010-01-01

    Looking for Christmas present ideas? The CERN Shop will give CERN card holders a special reduction of 10 % on all CERN Shop articles from Monday 13.12.2010 to Saturday 18.12.2010. Come and visit the CERN Shop in the Reception Building 33.

  15. A novel marine bacterium Isoptericola sp. JS-C42 with the ability to saccharifying the plant biomasses for the aid in cellulosic ethanol production

    Directory of Open Access Journals (Sweden)

    Velayudhan Satheeja Santhi

    2014-06-01

    Full Text Available The ever growing demands for food products such as starch and sugar produces; there is a need to find the sources for saccharification for cellulosic bioethanol production. This study provides the first evidence of the lignocellulolytic and saccharifying ability of a marine bacterium namely Isoptericola sp. JS-C42, a Gram positive actinobacterium with the cocci cells embedded on mycelia isolated from the Arabian Sea, India. It exhibited highest filter paper unit effect, endoglucanase, exoglucanase, cellobiohydrolase, β-glucosidase, xylanase and ligninase effect. The hydrolytic potential of the enzymes displayed the efficient saccharification capability of steam pretreated biomass. It was also found to degrade the paddy, sorghum, Acacia mangium and Ficus religiosa into simple reducing sugars by its efficient lignocellulose enzyme complex with limited consumption of sugars. Production of ethanol was also achieved with the Saccharomyces cerevisiae. Overall, it offers a great potential for the cellulosic ethanol production in an economically reliable and eco-friendly point-of-care.

  16. STUDY OF EFFECTIVENESS OF BREAKWATER STRUCTURES OF THE “EASTERN PETROCHEMICAL COMPANY” JSC OIL REFINERY AND PETROCHEMICAL PLANTS PORT COMPLEX

    Directory of Open Access Journals (Sweden)

    Prikhod’ko Oleg Alekseevich

    2017-05-01

    Full Text Available The article presents the research of MGSU Corporation for testing of design solutions of the “Eastern petrochemical company” JSC oil refinery and petrochemical plants port complex using the physical modeling method. Construction of the marine terminal of the oil refinery and petrochemical plants port complex is planned to be on the Eastern shore of the Vostok Bay which is the part of Peter the Great Bay in the Sea of Japan. The port area is created by means of an artificial land site. The water area of the terminal will be guarded against sea waves by a breakwater. Experiments on the study of wave propagation in the port model water area at the Eastern and Western breakwaters were performed in the laboratory wave basin in three-dimensional layout, with the aim of obtaining of data about wave heights at berthing facilities. Effectiveness of the breakwater designs was studied in two-dimensional layout in a wave flume. During the port model construction all the designed waterworks as well as the project bathymetry of the port water area were reproduced at a scale of 1:100. Analysis of the experiment results with the slope protection embodiment version demonstrates that this engineering solution is able to withstand waves of the design parameters.

  17. JSC Wireless Sensor Network Update

    Science.gov (United States)

    Wagner, Robert

    2010-01-01

    Sensor nodes composed of three basic components... radio module: COTS radio module implementing standardized WSN protocol; treated as WSN modem by main board main board: contains application processor (TI MSP430 microcontroller), memory, power supply; responsible for sensor data acquisition, pre-processing, and task scheduling; re-used in every application with growing library of embedded C code sensor card: contains application-specific sensors, data conditioning hardware, and any advanced hardware not built into main board (DSPs, faster A/D, etc.); requires (re-) development for each application.

  18. JSC Human Life Sciences Project

    Science.gov (United States)

    1998-01-01

    This section of the Life and Microgravity Spacelab (LMS) publication includes articles entitled: (1) E029 - Magnetic Resonance Imaging after Exposure to Microgravity; (2) E030 - Extended Studies of Pulmonary Function in Weightlessness; (3) E074 - Direct Measurement of the Initial Bone Response to Spaceflight in Humans; (4) E401 - The Effects of Microgravity on Skeletal Muscle Contractile Properties; (5) E407 - Effects of Microgravity on the Biochemical and Bioenergetic Characteristics of Human Skeletal Muscle; (6) E410 - Torso Rotation Experiment; (7) E920 - Effect of Weightlessness on Human Single Muscle Fiber Function; (8) E948 - Human Sleep, Circadian Rhythms and Performance in Space; (9) E963 - Microgravity Effects on Standardized Cognitive Performance Measures; and (10) E971 - Measurement of Energy Expenditures During Spaceflight Using the Doubly Labeled Water Method

  19. TRANSFER OF THE SHIPPING IMPORT & EXPORT SECTION (BLDG589)

    CERN Multimedia

    Division SPL, Groupe Logistique

    2000-01-01

    With effect from 14 August 2000, the Shipping Import & Export Section will occupy new premises: Building 73 - 1-013 (near Goods Entry D) The telephone numbers will be unchanged. We would like to take this opportunity to apologise for any disruption of services that may arise during the move. Thank you for your understanding.

  20. Operational test procedure for Bldg 241-A-701 air compressor

    International Nuclear Information System (INIS)

    Desantis, G.N.

    1995-01-01

    This document is an Operability Test Procedure (OTP) which will verify and record that the 241-A-701 air compressor and associated equipment operates within their intended design parameters. The activities defined in this OTP will be performed to ensure the daily operation of the new compressed air system can be reliable and efficient. The Compressed Air System (CAS) for 241-A-701 supplies process and instrument air to the A, AX, AY, and AZ tank farms. The primary use of the CAS is for tank farms instrumentation, air operated valves, and air lift circulators

  1. 1 Ft. x 1 Ft. Supersonic Wind Tunnel, Bldg. 37

    Data.gov (United States)

    Federal Laboratory Consortium — The 1- by 1-Foot Supersonic Wind Tunnel (1x), located in the Engine Research Building, is one of the most active test facilities at the Glenn Research Center. Used...

  2. STS-26 MS Hilmers on fixed based (FB) shuttle mission simulator (SMS) middeck

    Science.gov (United States)

    1988-01-01

    STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) David C. Hilmers prepares to ascend a ladder representing the interdeck access hatch from the shuttle middeck to the flight deck. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

  3. STS-26 crew on fixed based (FB) shuttle mission simulator (SMS) flight deck

    Science.gov (United States)

    1988-01-01

    STS-26 Discovery, Orbiter Vehicle (OV) 103, Commander Frederick H. Hauck (left) and Pilot Richard O. Covey review checklists in their respective stations on the foward flight deck. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

  4. STS-26 MS Lounge in fixed based (FB) shuttle mission simulator (SMS)

    Science.gov (United States)

    1988-01-01

    STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) John M. Lounge, wearing comunications kit assembly headset and crouched on the aft flight deck, performs checklist inspection during training session. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

  5. STS-32 Commander Brandenstein adjusts IMAX camera during training session

    Science.gov (United States)

    1989-01-01

    STS-32 Commander Daniel C. Brandenstein adjusts IMAX camera setting during briefing and training session as technician looks on. The session was conducted in the JSC Mockup and Integration Laboratory (MAIL) Bldg 9B. The IMAX camera will be used onboard Columbia, Orbiter Vehicle (OV) 102, during the STS-32 mission.

  6. SE83-9 'Chix in Space' student experimenter monitors STS-29 onboard activity

    Science.gov (United States)

    1989-01-01

    Student experimenter John C. Vellinger watches monitor in the JSC Mission Control Center (MCC) Bldg 30 Customer Support Room (CSR) during the STS-29 mission. Crewmembers are working with his Student Experiment (SE) 83-9 Chicken Embryo Development in Space or 'Chix in Space' onboard Discovery, Orbiter Vehicle (OV) 103. The student's sponsor is Kentucky Fried Chicken (KFC).

  7. Vitamin D: Spaceflight, Antarctic, and JSC

    Science.gov (United States)

    Smith, Scott M.; Locke, J.; Zwart, S. R.

    2009-01-01

    Obtaining vitamin D is critical for space travelers because they lack ultraviolet light exposure and have an insufficient dietary supply of vitamin D. Despite the provision of vitamin D supplements to International Space Station (ISS) crewmembers, vitamin D status is consistently lower after flight than before flight, and in several crewmembers has decreased to levels considered clinically significant. Vitamin D has long been known to play a role in calcium metabolism, and more recently its non-calcitropic functions have been recognized. According to the results of several recent studies, functionally relevant measures indicate that the lower limit of serum 25-hydroxyvitamin D (a marker of vitamin D status) should be raised from the current 25 nmol/L to 80 nmol/L. The sub-optimal pre- and postflight vitamin D status is an issue that needs to be addressed, to allow NASA to better define the appropriate amount of supplemental vitamin D to serve as a countermeasure against vitamin D deficiency in astronaut crews. This is very important for long-duration crewmembers, and is critical for exploration-class missions. Ground-based models with limited sunlight exposure could be valuable for evaluating vitamin D supplementation efficacy. One such model is subjects spending the winter in Antarctica, where UV-B radiation levels are zero during the winter. Data from a study of such subjects will enable us to provide long-duration space flight crewmembers with evidence-based recommendations for vitamin D supplementation to achieve optimal vitamin D status before, during, and after flight. We report here results from a vitamin D supplementation study conducted in 2007 in Antarctica at McMurdo Station, and plans for a study to be implemented over the course of 2009. Additionally, in 2008, a study was initiated (and is ongoing) to assess efficacy and safety of supplementing with 2000 IU daily, 10,000 IU weekly, or 50,000 IU weekly for a month and then monthly after that. The data from these studies will enable us to provide space crews with evidence-based recommendations for vitamin D supplementation. The findings also have implications for other persons with limited UV light exposure, including polar workers and the elderly.

  8. JSC Director's Discretionary Fund 1992 Annual Report

    Science.gov (United States)

    Jenkins, Lyle (Compiler)

    1993-01-01

    Annual report of the Johnson Space Center Director's Discretionary Fund documenting effective use of resources. The $1,694,000 funding for FY92 was distributed among 27 projects. The projects are an overall aid to the NASA mission, as well as providing development opportunities for the science and engineering staff with eventual spinoff to commercial uses. Projects described include space-based medical research such as the use of stable isotopes of deuterium and oxygen to measure crew energy use and techniques for noninvasive motion sickness medication. Recycling essentials for space crew support is conducted in the Regenerative Life Support and the Hybrid Regenerative Water Recovery test beds. Two-phase fluid flow simulated under low-gravity conditions, hypervelocity particle impact on open mesh bumpers, and microcalorimetry to measure the long-term hydrazine/material compatibility were investigated. A patent application was made on a shape-memory-alloy release nut. Computer estimate of crew accommodations for advanced concepts was demonstrated. Training techniques were evaluated using multimedia and virtual environment. Upgrades of an electronic still camera provide high resolution images from orbit are presented.

  9. STS-26 Commander Hauck in fixed based (FB) shuttle mission simulator (SMS)

    Science.gov (United States)

    1988-01-01

    STS-26 Discovery, Orbiter Vehicle (OV) 103, Commander Frederick H. Hauck, wearing comunications kit assembly headset and seated in the commanders seat on forward flight deck, looks over his shoulder toward the aft flight deck. A flight data file (FDF) notebook rests on his lap. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.

  10. 'Weightless' acrylic painting by Jack Kroehnke

    Science.gov (United States)

    1987-01-01

    'Weightless' acrylic painting by Jack Kroehnke depicts STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) David C. Hilmers participating in extravehicular activity (EVA) simulation in JSC Weightless Environment Training Facility (WETF) Bldg 29. In the payload bay (PLB) mockup, Hilmers, wearing extravehicular mobility unit (EMU), holds onto the mission-peculiar equipment support structure in foreground while SCUBA-equipped diver monitors activity overhead and camera operator records EVA procedures. Copyrighted art work for use by NASA.

  11. KSC Press Site Transformer Bldg. (K7-1205c) SWMU 074 Interim Measure Work Plan

    Science.gov (United States)

    Starr, A. Scott; Applegate, Joe

    2014-01-01

    This document presents and discusses the Interim Measure (IM) Work Plan for the Press Site Transformer Building (K7-1205C). The purpose of the proposed IM activities is to remove soil affected with polychlorinated biphenyls (PCBs) greater than the Florida Department of Environmental Protection (FDEP) residential direct-exposure Soil Cleanup Target Level (R-SCTL) of 0.5 milligrams per kilogram and encapsulate concrete exhibiting PCB concentration greater than the Toxic Substance Control Act (TSCA) threshold of 50 milligrams per kilogram.

  12. JSC Safety and Mission Assurance Data Analysis Overview

    Science.gov (United States)

    Roelant, Henk

    2010-01-01

    These slides describe the data analysis methods that are used to determine inputs for probabilistic risk models supporting the Space Shuttle Program. Other applications can follow a similar path probably using different data sources. Statistical approaches are different and not addressed here. Topics included here: 1) Prior Distribution; 2) Likelihood Data; 3) Bayesian Updating; and 4) Uncertainty and Error. Note: This is a high-level discussion and is not intended to be a tutorial.

  13. National Space Biomedical Research Institute (NSBRI) JSC Summer Projects

    Science.gov (United States)

    Dowdy, Forrest Ryan

    2014-01-01

    This project optimized the calorie content in a breakfast meal replacement bar for the Advanced Food Technology group. Use of multivariable optimization yielded the highest weight savings possible while simultaneously matching NASA Human Standards nutritional guidelines. The scope of this research included the study of shelf-life indicators such as water activity, moisture content, and texture analysis. Key metrics indicate higher protein content, higher caloric density, and greater mass savings as a result of the reformulation process. The optimization performed for this study demonstrated wide application to other food bars in the Advanced Food Technology portfolio. Recommendations for future work include shelf life studies on bar hardening and overall acceptability data over increased time frames and temperature fluctuation scenarios.

  14. Developing a successful marketing plan for HELP JSC

    OpenAIRE

    Nguyen, Ke Tuong

    2010-01-01

    Health care has become an extremely important issue during the economic development. Vietnamese rapid population growth has made the service sector become overloaded. Majority of people are absorbed at work and neither do take care of their health nor do have a proper health care programme. HELP, a health care service company, has discovered general ideas of its services: brings health, joy and happiness to people. It is no later than now to develop a marketing plan, which can enhance the bu...

  15. The STS-95 crew poses with a Mercury capsule model before returning to JSC

    Science.gov (United States)

    1998-01-01

    Before returning to the Johnson Space Center in Houston, Texas, members of the STS-95 crew pose with a model of a Mercury capsule following a media briefing at the Kennedy Space Center Press Site Auditorium . From left to right are Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA); Pilot Steven W. Lindsey; Mission Commander Curtis L. Brown Jr.; Friendship 7; Payload Specialist John H. Glenn Jr., a senator from Ohio and one of the original seven Project Mercury astronauts; Mission Specialist Scott E. Parazynski; and Mission Specialist Pedro Duque, with the European Space Agency (ESA). Also on the crew is Mission Specialist and Payload Commander Stephen K. Robinson (not shown). The STS-95 mission ended with landing at Kennedy Space Center's Shuttle Landing Facility at 12:04 p.m. EST on Nov. 7. The mission included research payloads such as the Spartan-201 solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as a SPACEHAB single module with experiments on space flight and the aging process.

  16. STS-95 Payload Specialist Glenn participates in a media briefing before returning to JSC

    Science.gov (United States)

    1998-01-01

    STS-95 Payload Specialist John H. Glenn Jr., a senator from Ohio and one of the original seven Project Mercury astronauts, participates in a media briefing at the Kennedy Space Center Press Site Auditorium before returning to the Johnson Space Center in Houston, Texas. The STS-95 mission ended with landing at Kennedy Space Center's Shuttle Landing Facility at 12:04 p.m. EST on Nov. 7. Also participating in the briefing were the other STS-95 crew members: Mission Commander Curtis L. Brown Jr.; Pilot Steven W. Lindsey; Mission Specialist and Payload Commander Stephen K. Robinson; Mission Specialist Scott E. Parazynski; Mission Specialist Pedro Duque, with the European Space Agency (ESA); and Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA). The mission included research payloads such as the Spartan-201 solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as a SPACEHAB single module with experiments on space flight and the aging process.

  17. The STS-95 crew participates in a media briefing before returning to JSC

    Science.gov (United States)

    1998-01-01

    The day after their return to Earth on board the orbiter Discovery, members of the STS-95 crew participate in a media briefing at the Kennedy Space Center Press Site Auditorium before returning to the Johnson Space Center in Houston, Texas. From left to right are Lisa Malone, moderator and chief of NASA Public Affairs' Media Services at Kennedy Space Center; Mission Commander Curtis L. Brown Jr.; Pilot Steven W. Lindsey; Mission Specialist and Payload Commander Stephen K. Robinson; Mission Specialist Scott E. Parazynski; Mission Specialist Pedro Duque, with the European Space Agency (ESA); Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA); and Payload Specialist John H. Glenn Jr., a senator from Ohio and one of the original seven Project Mercury astronauts. The STS-95 mission ended with landing at Kennedy Space Center's Shuttle Landing Facility at 12:04 p.m. EST on Nov. 7. The mission included research payloads such as the Spartan-201 solar- observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as a SPACEHAB single module with experiments on space flight and the aging process.

  18. The STS-95 crew and their families prepare for their return flight to JSC

    Science.gov (United States)

    1998-01-01

    At the Skid Strip at Cape Canaveral Air Station, STS-95 Pilot Steven W. Lindsey (left), Lindsey's daughter (front), and Payload Specialist John H. Glenn Jr. (right), a senator from Ohio and one of the original seven Project Mercury astronauts, give a thumbs up on the success of the mission. Members of the STS-95 crew and their families prepared for their return flight to the Johnson Space Center in Houston, Texas. The STS-95 mission ended with landing at Kennedy Space Center's Shuttle Landing Facility at 12:04 p.m. EST on Nov. 7. Others returning were Mission Commander Curtis L. Brown Jr.; Mission Specialist Scott E. Parazynski; Mission Specialist Stephen K. Robinson; Mission Specialist Pedro Duque, with the European Space Agency (ESA); and Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA). The mission included research payloads such as the Spartan-201 solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as a SPACEHAB single module with experiments on space flight and the aging process.

  19. STS-95 Payload Specialist Glenn and his wife pose before their return flight to JSC

    Science.gov (United States)

    1998-01-01

    At the Skid Strip at Cape Canaveral Air Station, STS-95 Payload Specialist John H. Glenn Jr., a senator from Ohio and one of the original seven Project Mercury astronauts, poses with his wife Annie before their return flight to the Johnson Space Center in Houston, Texas. The STS-95 mission ended with landing at Kennedy Space Center's Shuttle Landing Facility at 12:04 p.m. EST on Nov. 7. The STS-95 crew also includes Mission Commander Curtis L. Brown Jr.; Pilot Steven W. Lindsey; Mission Specialist Scott E. Parazynski; Mission Specialist Stephen K. Robinson; Mission Specialist Pedro Duque, with the European Space Agency (ESA); and Payload Specialist Chiaki Mukai, with the National Space Development Agency of Japan (NASDA). The mission included research payloads such as the Spartan-201 solar-observing deployable spacecraft, the Hubble Space Telescope Orbital Systems Test Platform, the International Extreme Ultraviolet Hitchhiker, as well as a SPACEHAB single module with experiments on space flight and the aging process.

  20. QC methods and means during pellets and fuel rods manufacturing at JSC 'MSZ'

    International Nuclear Information System (INIS)

    Kouznetsov, A.I.

    2000-01-01

    The report contains the description of the main methods and devices used in fabrication of pellets and fuel rods to prove their conformity to the requirements of technical specifications. The basic principals, range and accuracy of methods and devices are considered in detail, as well as system of metrological support of measurements. The latter includes the metrological certification and periodical verification of the devices, metrological qualification of measurement procedures, standard samples provision and checking the correctness of the analyses performance. If one makes an overall review of testing methods used in different fuel production plants he will find that most part of methods and devices are very similar. There are still some variations in methods which could be a subject for interesting discussions among specialists. This report contains a brief review of testing methods and devices used at our plant. More detailed description is given to methods which differ from those commonly used. (author)

  1. Experimental study of new generation WWER-1000 fuel assemblies at JSC NCCP

    International Nuclear Information System (INIS)

    Enin, A.; Rozhkov, V.; Sinikov, Y.; Ustimenko, A.; Shustov, M.

    2003-01-01

    An experimental program for the study of fuel assembly thermomechanical stability has been established together with RF SSC IPPE and Russian Scientific Center Kurchatov Institute. Assembly fragments and small dummy models of fuel assembly skeletons and fuel rod bundles have been used for the tests. The test results are used for the design selection, verification of the design codes and substantiation of operating capacity of fuel assemblies with a rigid skeleton. The mechanical characteristics of units make it possible to perform fuel assembly strength and rigidity calculations, including the cases of abnormal operation. The mechanical characteristics of the skeleton and fuel rod bundle dummy models make it possible to check for the adequacy of the fuel assembly design model. The mechanical characteristics obtained during fuel rods bundle push through experiments make it possible to substantiate the fuel assembly serviceability under the conditions of fuel rods bundle and skeleton interaction

  2. “Smart COPVs” - Continued Successful Development of JSC IR&D Acoustic Emissions (AE) SHM

    Data.gov (United States)

    National Aeronautics and Space Administration — Developed and applied promising quantitative pass/fail criteria to COPVs using acoustic emission (AE) and developed automated data analysis software. This lays the...

  3. Development of advanced types of fuel at JSC 'UMP'

    International Nuclear Information System (INIS)

    Gagarin, A.E.; Kuchkovskiy, A.; Bezhetskiy, S.V.; Vachnenko, V.V.; Manych, A.V.; Russin, Y.G.

    2009-01-01

    As compared with all acting today techniques of power generation only nuclear power engineering has the real reserve of fuel and contaminate the environment minimum. As IAEA expert assessments show, up to 130 new power generating units with total power 430 gigaWt and annual energy production up to 3000 billion kilowatt-hours will be built in the world to 2020 year. It can be up to 30% of the world power balance. Kazakhstan today has unprecedented positions for nuclear power engineering development in the Republic as well as possibility to have an influence on its development in the world. Actually for today National Atomic Company (NAC) 'Kazatomprom' has the 4th position in the world in satisfaction of world demand for uranium, but to 2010 Kazakhstan should be the world leader in uranium mining in accordance with the company strategy

  4. The influence of sales promotion elements on consumers (jsc „rimi lietuva“ sample)

    OpenAIRE

    Markovskaja, Ivona

    2016-01-01

    The influence of sales promotion elements on consumer is analyzed in the Bachelor‘s Thesis. The thesis examines the information published by various foreign and Lithuanian authors. The main aim of this paper is to analyze different theories of sales promotion effectiveness, sales promotion relevance and factors influencing consumer‘s behavior. This paper analyses the theoretical aspects of sales promotion. It has become more popular in the beginning of the sixth decade. The definition of conc...

  5. A new concept of wastes utilization on the JSC 'Ulba Metallurgical Plant' uranium manufacture

    International Nuclear Information System (INIS)

    Yashin, S.A.; Korobejnikov, I.V.; Manych, A.V.; Kombarov, V.A.

    2003-01-01

    A new concept of radioactive waste handling is developed. It is based on the following principals: 1. Reduce of the waste raffinates volumes at the expense of technological process optimization and extraction of valuable reactants with partially close cycle organization; 2. Imposition of limitation on amount of the incoming water-soluble radioisotopes in temporary disposal due to its concentration and co-precipitation with following additional-extraction and return into the technological process; 3. Combustion of wasted organics in the furnace, dissolution of produced ash, extraction of the radionuclides and its return into technologic process; 4. Refining remelting of radioactive stainless scrap with following re-cycling. A new concept is partially put into operation. The solution of a high-tech tasks is carrying out in co-operation with leading research institutions of Kazakhstan and Russia

  6. MODELING OF THE BASIC PARAMETERS OF ECONOMIC STABILITY (BY THE EXAMPLE OF JSC “BOGUCHAROVO”

    Directory of Open Access Journals (Sweden)

    N. A. Serebriakova

    2014-01-01

    Full Text Available Summary. The article describes the author's vision of the process of management of economic stability of the enterprise by means of simulation of the main parameters of its activity and justified the relevance of the theme of the study. Studied theoretical and methodical bases of economic stability of the enterprise in accordance with the Russian development of a market economy, as well as practical recommendations on modeling of the main parameters of the economic sustainability of the organization. Currently, management of economic stability is one of the most important factors of functioning and development of the enterprises in conditions of the global financial crisis. The relevance of this trend is increasing in line with the increasing complexity of economic ties, changing external environment. A comprehensive approach to the development of the most appropriate variants of the mechanism of management of economic sustainability taking into account the experience of developed countries, industry and sector of factors of external environment can become the basis for developing a common long-term economic development strategy of the enterprise. Problems of economic stability of enterprises caused by the fact that normally carried out in a changing environment operational measures allow for a short time to keep the state of the enterprise is stable, but not change the situation radically. That is, they are associated, on the one hand, with a lack of vision of development of the enterprises, with another - the narrowness of the approach applied to the diagnosis of the existing situation and forecasting of changes in external factors.

  7. Space Weathering in Houston: A Role for the Experimental Impact Laboratory at JSC

    Science.gov (United States)

    Cintala, M. J.; Keller, L. P.; Christoffersen, R.; Hoerz, F.

    2015-01-01

    The effective investigation of space weathering demands an interdisciplinary approach that is at least as diversified as any other in planetary science. Because it is a macroscopic process affecting all bodies in the solar system, impact and its resulting shock effects must be given detailed attention in this regard. Direct observation of the effects of impact is most readily done for the Moon, but it still remains difficult for other bodies in the solar system. Analyses of meteorites and precious returned samples provide clues for space weathering on asteroids, but many deductions arising from those studies must still be considered circumstantial. Theoretical work is also indispensable, but it can only go as far as the sometimes meager data allow. Experimentation, however, can permit near real-time study of myriad processes that could contribute to space weathering. This contribution describes some of the capabilities of the Johnson Space Center's Experimental Impact Laboratory (EIL) and how they might help in understanding the space weathering process.

  8. Ubiquitous Wireless Smart Sensing and Control. Pumps and Pipes JSC: Uniquely Houston

    Science.gov (United States)

    Wagner, Raymond

    2013-01-01

    Need new technologies to reliably and safely have humans interact within sensored environments (integrated user interfaces, physical and cognitive augmentation, training, and human-systems integration tools).Areas of focus include: radio frequency identification (RFID), motion tracking, wireless communication, wearable computing, adaptive training and decision support systems, and tele-operations. The challenge is developing effective, low cost/mass/volume/power integrated monitoring systems to assess and control system, environmental, and operator health; and accurately determining and controlling the physical, chemical, and biological environments of the areas and associated environmental control systems.

  9. Continuous Improvement in Battery Testing at the NASA/JSC Energy System Test Area

    Science.gov (United States)

    Boyd, William; Cook, Joseph

    2003-01-01

    The Energy Systems Test Area (ESTA) at the Lyndon B. Johnson Space Center in Houston, Texas conducts development and qualification tests to fulfill Energy System Division responsibilities relevant to ASA programs and projects. EST A has historically called upon a variety of fluid, mechanical, electrical, environmental, and data system capabilities spread amongst five full-service facilities to test human and human supported spacecraft in the areas of propulsion systems, fluid systems, pyrotechnics, power generation, and power distribution and control systems. Improvements at ESTA are being made in full earnest of offering NASA project offices an option to choose a thorough test regime that is balanced with cost and schedule constraints. In order to continue testing of enabling power-related technologies utilized by the Energy System Division, an especially proactive effort has been made to increase the cost effectiveness and schedule responsiveness for battery testing. This paper describes the continuous improvement in battery testing at the Energy Systems Test Area being made through consolidation, streamlining, and standardization.

  10. Pre-STS-3 press conference held at the JSC public affairs facility

    Science.gov (United States)

    1982-01-01

    Astronauts Jack R. Lousma, center, and C. Gordon Fullerton, left, respond to a visual display of the Columbia and its remote manipulator system in space during a pre-STS-3 press conference. Dr. John Lawrence, public information specialist, is at the far right (25903); Astronaut Lousma, listens as a newsman directs a question his way. In the background is the STS-3 mission logo (25904); Astronaut Fullerton uses an electronic pointer to localize an area on a prjected visual of the OSS payload package to be carried in the cargo bay of the Columbia on STS-3. On far right is Dr. Lawrence (25905).

  11. Calculation note - Consequences of a fire in the sorting and repackaging glovebox in room 636 of bldg 2736-ZB - Plutonium Finishing Plant

    International Nuclear Information System (INIS)

    JOHNSON, L.E.

    1999-01-01

    This Calculation Note provides a conservative estimate of the grams of plutonium released from Building 2736-ZB of the Plutonium Finishing Plant as a result of a fire within Glovebox 636, without consideration of mitigation

  12. The analysis of the economic and environmental effects of the application of a photovoltaic system to the EXCO (Ex. + Con. Bldg) in Daegu, South Korea

    International Nuclear Information System (INIS)

    Jang, M.H.; Hong, W.W.H.

    2004-01-01

    The aim of this thesis is to analyze the economic and environmental effects of the application of a photovoltaic system to the exhibition and convention building (EXCO). To determine the economic and environmental effects of the building, energy consumption data should be obtained. Three sides of the EXCO are assumed to be good places of a photovoltaic system. In order to understand the investment cost, the number of years required to recover the cost has to be calculated. In an environmental evaluation, the amount of carbon dioxide is also calculated over a period of time of 5,10,15 years. (author)

  13. 78 FR 47000 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2013-08-02

    ... for suitability for use to assist the homeless. The properties were reviewed using information... Wash Bldg.; Thrust Vector Control Deserving Bldg.; Robot Wash Bldg. Comments: Public access denied & no...

  14. Analysis of the process related to the operations management of the rail traction vehicles in JSC 'Serbian Railways'

    Directory of Open Access Journals (Sweden)

    Vukadinović Vojislav

    2016-01-01

    Full Text Available In the study, issues related to the operations management in railway were elaborated, with special emphasis on the operations management of rail vehicles and main parameters in its activities and in the railway functioning. The analysis of the current status, operation and functioning of the Serbian Railways was also provided, with a special focus on the study of the technical condition regarding exploitation, reliability, and availability of traction vehicles operation which is always actual and particularly important for ensuring the regular and safe functioning of train traffic in all railways in the world as well as in the railway of Serbia. The issue related to the exploitation reliability and availability regarding traction vehicles operation is also being analyzed which is reflected in development of the concept and creation of the methodology for assessment of the technical condition and indicators for determining the level of exploitation reliability, availability of the traction vehicle operation as well as functioning of train traffic and the models related to the operations management of rail traction vehicles.

  15. 77 FR 31434 - Finding That JSC CredexBank Is a Financial Institution of Primary Money Laundering Concern

    Science.gov (United States)

    2012-05-25

    ... CredexBank is a financial institution of primary money laundering concern. DATES: The finding made in... Law 107-56. Title III of the USA PATRIOT Act amends the anti- money laundering provisions of the Bank..., to promote prevention, detection, and prosecution of international money laundering and the financing...

  16. Product quality as the main factor of increase of competitiveness (on the example of JSC “Kazan helicopter plant”)

    Science.gov (United States)

    Khafizov, I. I.; Nurullin, I. G.

    2017-09-01

    Planning for effective development, and timely research perspectives and opportunities, States, markets, regulations, competition and competitiveness of its production, helps to achieve the stable business success in the market. The relevance of the study of the production of high quality products is that the quality of goods and services should always comply with the requirements established in state regulations, standards, regulations or conditions.

  17. Radiation Test Results on COTS and non-COTS Electronic Devices for NASA-JSC Space Flight Projects

    Science.gov (United States)

    Allums, Kimberly K.; O'Neill, P. M.; Reddell, B. D.; Nguyen, K. V.; Bailey, C. R.

    2012-01-01

    This presentation reports the results of recent proton and heavy ion Single Event Effect (SEE) testing on a variety of COTS and non-COTs electronic devices and assemblies tested for the Space Shuttle, International Space Station (ISS) and Multi-Purpose Crew Vehicle (MPCV).

  18. Behavioral Health and Performance at NASA JSC: Recent Successes and Future Plan for BHP Research and Operations

    Science.gov (United States)

    Leveton, L. B.; VanderArk, S. T.

    2014-01-01

    The Behavioral Health and Performance discipline at NASA Johnson Space Center is organized into two distinct Divisions (Biomedical Research and Environmental Science Division and Space and Clinical Operations Division) but is integrated and interrelated in its day-to-day work. Ongoing operations supporting NASA's spaceflight goals benefit from the research portfolios that address risks to mission success. Similarly, these research portfolios are informed by operations to ensure investigations stay relevant given the dynamic environment of spaceflight. There are many success stories that can be presented where initial work begun as a BHP Research project, and funded through the Human Research Program, was fully implemented in operations or addressed an operational need. Examples include improving effectiveness of the debriefings used within Mission Control by the Mission Operations Directorate and countermeasures for fatigue management. There is also ongoing collaboration with research and operations for developing selection methods for future generation astronauts, and to enhance and inform the current family support function. The objective of this panel is to provide examples of recent success stories, describe areas where close collaboration is benefitting ongoing research and operations, and summarize how this will come together as NASA plans for the one year ISS mission - a unique opportunity for both BHP operations and research to learn more about preparing and supporting crewmembers for extended missions in space. The proposed panel will be comprised of six presentations, each describing a unique aspect of research or operations and the benefits to current and future spaceflight.

  19. GEODESIC MONITORING OF VERTICAL MOVEMENT OF JSC «GRODNO AZOT» BUILDINGS USING DIGITAL DNA 03 LEVEL

    Directory of Open Access Journals (Sweden)

    V. I. Mikhailov

    2010-01-01

    Full Text Available The paper presents peculiar features and methodology pertaining to application of digital DNA 03 level for monitoring vertical movement of load-carrying structures in the workshops and foundations of various capacities, exhaust pipes and granulation towers having height from 100 to150 meters. The proposed methods presuppose usage of the results of engineering and geological investigations and highly accurate geodesic measurements considered in the process of hydro- and pneumatic tests of an isothermic storage of liquid ammonia and a production “Ammonia” shop taken as an example. 

  20. The influence of the executives’ leadership and managerial competencies expression on employees’ engagement. jsc “biok laboratorija” case analysis

    OpenAIRE

    Daujotaitė, Greta

    2016-01-01

    The main purpose: to reveal the leadership’s factors that affect employees’ engagement, as well as the employees’ engagement factors that affect leadership development and the success of the organization. Methods of this thesis: comparative analysis of different literature about leadership, leadership theories, managerial competencies and employee engagement, survey research in selected company, analysis and interpretation of its results. The performed research revealed that there’s strong co...

  1. Protein (Cyanobacteria): 497073171 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available pothetical protein Fischerella sp. JSC-11 MHYYVHPFQLELHKLENMIVHVQHVNNQEVKQIADSRLFTSQAIGEEGGDTVTTKAIGEEGGDTVTTQAIGEEGGDTVTTKAIGEEGGDTVTTQAIGEEGGDTVTTQAIGEEGGDTVTTKAIGEEGGDTVTTLAFGEEGGF

  2. STAFF MEETING

    CERN Document Server

    2003-01-01

    I should like to invite all members of the CERN Personnel to a meeting on Wednesday 25th June 2003 at 11.00 hrs - Auditorium, bldg. 500 to give a report on the outcome of the June Meetings of Council and its Committees. Closed-circuit transmission of the meeting will be available in the AB Auditorium (Prévessin), the AB Auditorium (Meyrin - bldg. 6), the IT Auditorium (bldg. 31) and the AT Auditorium (bldg. 30). Luciano Maiani Director General

  3. Summer season | Cafeteria closures

    CERN Multimedia

    2013-01-01

    Please note the following cafeteria closures over the summer season: Bldg. 54 closed from 29/07/2013 to 06/09/2013. Bldg. 13: closed from 13/07/2013 to 06/09/2013. Restaurant No. 2, table service (brasserie and restaurant): closed from 01/08/2013 to 06/09/2013. Bldg. 864: closed from 29/07/2013 to 06/09/2013. Bldg. 865: closed from 29/07/2013 to 06/09/2013.

  4. General Staff Meeting, 17 Dec 2002

    CERN Multimedia

    CERN. Geneva. Audiovisual Unit

    2002-01-01

    I would like to invite all members of the CERN Personnel to a meeting, to give a report on the outcome of the December Council Meetings. Closed-circuit transmission of the meeting will be available in the SL Auditorium (Prévessin), the IT Auditorium (bldg. 31), the LHC Auditorium (bldg. 30) and the PS Auditorium (bldg. 6).

  5. Description of the plasma diagnostics package (PDP) for the OSS-1 Shuttle mission and JSC plasma chamber test in conjunction with the fast pulse electron gun (FPEG)

    Science.gov (United States)

    Shawhan, S. D.

    1982-01-01

    The objectives, equipment, and techniques for the plasma diagnostics package (PDP) carried by the OSS-1 instrument payload of the STS-4 and scheduled for the Spacelab-2 mission are described. The goals of the first flight were to examine the Orbiter-magnetoplasma interactions by measuring the electric and magnetic field strengths, the ionized particle wakes, and the generated waves. The RMS was employed to lift the unit out of the bay in order to allow characterization of the fields, EM interference, and plasma contamination within 15 m of the Orbiter. The PDP will also be used to examine plasma depletion, chemical reaction rates, waves, and energized plasma produced by firing of the Orbiter thrusters. Operation of the PDP was carried out in the NASA Space Environment Simulation Laboratory test chamber, where the PDP was used to assay the fields, fluxes, wave amplitudes, and particle energy spectra. The PDP instrumentation is also capable of detecting thermal ions, thermal electrons suprathermal particles, VHF/UHF EMI levels, and the S-band field strength.

  6. Innovative Model of Practice-Oriented Training of Employees of the Town-Forming Enterprise in the Mining Region (by the Example of JSC "SUEK-Kuzbass")

    Science.gov (United States)

    Kulay, Svetlana; Kayachev, Gennady

    2017-11-01

    The article proposes to improve the system of training of employees of joint-stock company SUEK-Kuzbass in the educational institutions of the Kemerovo region according to the requirements of the company using practice-oriented training technology. The aim of the work is to substantiate the effectiveness of implementing practice-oriented training, identify priority directions and ways of its development. The main objectives of the study are: to identify the main advantages for the company and students; determine the criteria for the success and practical value of applying practice-oriented training for the company; conduct a comparative analysis of the target and practice-oriented model of training for the company. The real needs of the employer through the dual form of training were taking into account. The expansion of positive experience in training engineering personnel in higher education in technology-based training with the involvement of specialists from other regions of the company and expanding training in mining was also included.

  7. Status report: Nuclear fuel operating experience in implementing the program for power generation increase at VVER NPPs of JSC concern Rosenergoatom

    International Nuclear Information System (INIS)

    Ryabinin, Y.

    2015-01-01

    The power uprate program of operating WWER-1000 plants was performed by Rosenergoatom using FA-2M and FAA-PLUS for 18-month fuel cycles. Their operation was justified at 104% of the rated power, and extension to 18-month fuel cycles was carried out at WWER-1000 units (except for Kalinin NPP-1). The analysis of actual performance data confirmed the efficiency of the actions implemented, and issues addressed related to the introduction of new fuel type, extended fuel cycles and spent nuclear fuel storage and removal

  8. Application opportunities of systems of control and monitoring for engineering processes fading by JSC 'Instrumental plant 'Tenzor', for utilization and storage of radioactive waste

    International Nuclear Information System (INIS)

    Verbitsky, V.J.; Esaulkov, R.O.; Maslova, M.V.; Kujil, A.S.

    2005-01-01

    Full text: Use of unique automated technological process control systems (ATPCS) on objects of storage of radiation hazardous and nuclear materials is offered. The application opportunity of diagnostic complex consisting of specialized software 'Cruise' and infra-red detection system for control and diagnostics of utilization of nuclear waste products in subcritical thermonuclear equipment is considered

  9. SYSTEM OF THE AUTOMATED ACCOUNTING OF ENERGY RESOURCES ON JSC «BMZ — MANAGEMENT COMPANY OF HOLDING «BMK

    Directory of Open Access Journals (Sweden)

    S. Demyanov

    2015-01-01

    Full Text Available The system of the automated accounting of energy resources allows to quickly obtain the data on energy consumption, to analyze consumption of energy carriers, and to find possible ways of energy economy is presented in this article.

  10. Medium pressure boiler water chemistry optimization using neutralizing amines mixture reagent AMINAT™ PK-2 at CEPP “Borovichi Refractories Plant” of JSC “BKO”

    Science.gov (United States)

    Guseva, O. V.; Butakova, M. V.; Orlov, K. A.; Vinogradov, S. V.; Pavlenko, L. S.

    2017-11-01

    An overview of the neutralizing amine based reagent AMINAT PK-2 usage for water chemistry of steam boilers for medium pressure boiler was given. Long term experiment showed that new reagent allows to decrease corrosion rate comparing with old water chemistry based on ammonia only. Two dosage schemes in different cycle places discussed. Scheme with two points on injection showed better results. Results of corrosion rates experiments and photos of tubes inner surfaces are presented. Based on fuel savings due to reducing scale formation the total annual economy for last year was 5.1 million Russian roubles.

  11. IMPROVEMENT OF STRATEGIC MANIPULATED FEDERAL PROPERTY THE EXAMPLE NON-CORE ASSETS OF JSC «CENTER OF NUCLEAR INDUSTRY NONCORE ASSETS» STATE CORPORATION «ROSATOM»

    OpenAIRE

    Ilya I. Rodin

    2015-01-01

    The article describes the main measures to improve the management of assets, federally-owned or private of public corporations - an inventory of the property, the recognition of non-core assets, the organization of decision-making systems, the sale of non-core assets at market value. The article provides the rationale for the creation within the large state-owned corporations specialized management companies responsible for the restructuring of non-core assets and improve management of the pr...

  12. EXPERIMENTAL MEASUREMENTS OF TAILING UNDERWATER SEDIMENTS AND LIQUID INDUSTRIAL WASTES IN STORAGE TANK ON THE BASIS OF ECHOLOCATION AND GPS-SYSTEMS AT JSC “BELARUSKALI”

    Directory of Open Access Journals (Sweden)

    V. I. Mikhailov

    2016-01-01

    Full Text Available The paper presents a new approach to calculate volume of tailing underwater sediments and liquid industrial wastes on the basis of innovative technologies. Two theodolites which are set at various points and a boat with a load for measuring water depth have been traditionally used for topographic survey of slime storage bottom. Horizontal directions have been simultaneously measured on the boat marker while using theodolites. Water depth has been determined while using  a 2-kg circular load which was descended into brine solution with the help of rope. In addition to rather large time and labour costs such technology has required synchronization in actions on three participants involved in the work: operators of two theodolites and boat team in every depth measuring point. Methodology has been proposed for more efficient solution of the problem. It presupposes the use of echolocation together with space localization systems (GPS-systems which can be set on a boat with the purpose to measure depth of a storage tank bed. An echolocation transducer has been installed under the boat bottom at the depth of 10 cm from the brine solution level in the slime storage.  An aerial of GPS-receiver has been fixed over the echo-sounder transducer. Horizontal positioning of bottom depth measuring points have been carried out in the local coordinate system. Formation of digital model for slime storage bottom has been executed after data input of the coordinate positioning that corresponded to corrected depths in the software package LISCAD Plus SEE. The formation has been made on the basis of a strict triangulation method.  Creation of the digital model makes it rather easy to calculate a volume between a storage bottom and a selected level (height of filling material. In this context it is possible to determine a volume and an area not only above but also lower of the datum surface. For this purpose it is recommended to use digital models which are developed for various time periods of slime  storage operation. 

  13. IMPROVEMENT OF STRATEGIC MANIPULATED FEDERAL PROPERTY THE EXAMPLE NON-CORE ASSETS OF JSC «CENTER OF NUCLEAR INDUSTRY NONCORE ASSETS» STATE CORPORATION «ROSATOM»

    Directory of Open Access Journals (Sweden)

    Ilya I. Rodin

    2015-01-01

    Full Text Available The article describes the main measures to improve the management of assets, federally-owned or private of public corporations - an inventory of the property, the recognition of non-core assets, the organization of decision-making systems, the sale of non-core assets at market value. The article provides the rationale for the creation within the large state-owned corporations specialized management companies responsible for the restructuring of non-core assets and improve management of the property. Also calculated the cost-effectiveness of the proposed measures on the example of the State Atomic Energy Corporation «Rosatom».

  14. Restaurant closures: summer 2014

    CERN Multimedia

    2014-01-01

    Restaurant 2 Table service/brasserie: closed from Monday 28 July to Friday 12 September (open upon reservation for groups of 20+)   Snack bars Bldg. 54: closed from Monday 7 July to Friday 12 September (self-service Nespresso machine available) Bldg. 40: closed every day at 4.30 p.m instead of 5 p.m. from Monday 7 July to Friday 12 September   Jeûne Genevois Restaurant 2, Restaurant 3, Bldg. 6, Bldg. 13, Bldg. 30 and Bldg. 54 will all be closed 11 and 12 September 2014 Bldg. 40 and Restaurant 1 will remain open

  15. Effects of Physical Impairment on Grenade Throwing and Weapon Loading Tasks

    Science.gov (United States)

    2015-03-01

    1 GOVT PRINTG OFC (PDF) A MALHOTRA 1 ARMY RSCH LABORATORY – HRED (PDF) RDRL HRM D T DAVIS BLDG 5400 RM C242 REDSTONE ARSENAL...5002 1 ARMY RSCH LABORATORY – HRED (PDF) RDRL HRM DG J RUBINSTEIN BLDG 333 PICATINNY ARSENAL NJ 07806-5000 1 ARMY RSCH LABORATORY...HRED (PDF) ARMC FIELD ELEMENT RDRL HRM CH C BURNS THIRD AVE BLDG 1467B RM 336 FORT KNOX KY 40121 1 ARMY RSCH LABORATORY – HRED

  16. Information from the central stores

    CERN Multimedia

    GS Department

    2010-01-01

    All items sold in the CERN shop (Bldg. 33) are now available in the central stores (Bldg. 73) and can be purchased on-line via EDH “Material Request” or at the “Emergency Desk” of the stores on the ground floor of Bldg. 73. These items are visible in the CERN catalogue under the “SCEM” codes beginning with 92. Department of General Infrastructure Services (GS) GS-SEM Group

  17. Building Integrated Photovoltaic (BIPV) Roofs for Sustainability and Energy Efficiency

    Science.gov (United States)

    2013-09-10

    288 Enviromental 1 - Main Membrane 90000 9043 SqFt 472 Ft 94 98 None Real Estate Perimeter: 460Ft Rating: Excellent Rating: Excellent...Cost Index: $2.00 Section: Section Area: 288- Building 288 Enviromental 1 9043 Roof Replacement Cost: Insulation Replacement Cost: $8.00 per...Bldg NoJSec: 2881 Bldg Name: Bui ding 288 Enviromental Bldg Use: Ofice Inspection Date: Oct/2011 Membrane: SINGLE-PlY: PVC Area (SF): 9043

  18. Aural-Nondetectability Model Predictions for Night-Vision Goggles across Ambient Lighting Conditions

    Science.gov (United States)

    2015-12-01

    MALHOTRA 1 ARMY RSCH LAB – HRED (PDF) RDRL HRM D T DAVIS BLDG 5400 RM C242 REDSTONE ARSENAL AL 35898-7290 1 ARMY RSCH LAB – HRED... HRM DG K GUNN BLDG 333 PICATINNY ARSENAL NJ 07806-5000 1 ARMY RSCH LAB – HRED (PDF) ARMC FIELD ELEMENT RDRL HRM CH C BURNS...THIRD AVE BLDG 1467B RM 336 FORT KNOX KY 40121 1 ARMY RSCH LAB – HRED (PDF) AWC FIELD ELEMENT RDRL HRM DJ D DURBIN BLDG

  19. 75 FR 30847 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2010-06-02

    ... Price, Department of Energy, Office of Engineering & Construction Management, MA-50, 1000 Independence...: 41201020007 Status: Excess Reasons: Extensive deterioration Secured Area Indiana Bldg. 18 Grissom AFB Peru IN...

  20. Environmental Microbiology Laboratory

    Data.gov (United States)

    Federal Laboratory Consortium — The Environmental Microbiology Laboratory, located in Bldg. 644 provides a dual-gas respirometer for measurement of oxygen consumption and carbon dioxide evolution...

  1. DEVELOPMENT OF A METHOD OF IMPROVEMENT OF QUALITY OF MILL PRODUCTS AND WEAR RESISTANCE OF THE TOOL AT THE ROLLING MILL 150 JSC «BSW – MANAGING COMPANY OF HOLDING «BMC»

    Directory of Open Access Journals (Sweden)

    I. A. Zuyeu

    2016-01-01

    Full Text Available Enhancement of calibration of mill rolls of the rolling mill 150, to improve of the mill products quality characteristics and to increase efficiency of the whole production is described in the article.

  2. 76 FR 12227 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2011-03-04

    ...: Excess GSA Number: Comments: 2024 sq. ft. sq. ft., concrete, poor condition, off-site use only Bldg..., pres. of asbestos clean-up required of contamination, use of respirator required by those entering... (oil storage bldg.--training ctr.), repairs needed for buildings 5 Bldgs. Fort Riley Fort Riley KS...

  3. 77 FR 23813 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2012-04-20

    ... Number: Comments: 2024 sq. ft. sq. ft., concrete, poor condition, off-site use only Colorado Bldg. 00127...: 45,216 sq. ft. underground tunnel complex, pres. of asbestos clean-up required of contamination, use..., 07739, 8329 Comments: Off-site removal only, sq. ft. varies for each bldg., current use varies (oil...

  4. 75 FR 35810 - Registration Review; Pesticide Dockets Opened for Review and Comment

    Science.gov (United States)

    2010-06-23

    ...), Environmental Protection Agency, Rm. S-4400, One Potomac Yard (South Bldg.), 2777 S. Crystal Dr., Arlington, VA..., One Potomac Yard (South Bldg.), 2777 S. Crystal Dr., Arlington, VA. The hours of operation of this... Number, E-mail Address Bifenthrin (7402) EPA-HQ-OPP-2010-03 Jacqueline Guerry, 84 (215) 814-2184, guerry...

  5. 75 FR 53692 - Pesticide Products; Registration Applications

    Science.gov (United States)

    2010-09-01

    ...), Environmental Protection Agency, Rm. S-4400, One Potomac Yard (South Bldg.), 2777 S. Crystal Dr., Arlington, VA... (South Bldg.), 2777 S. Crystal Dr., Arlington, VA. The hours of operation of this Docket Facility are...: Bifenthrin. Proposed uses: Grass forage, fodder and hay group, grass grown for seed, pasture and rangeland...

  6. 75 FR 2555 - Homeland Security Science and Technology Advisory Committee

    Science.gov (United States)

    2010-01-15

    ... Technology Advisory Committee will meet January 26-28, 2010, at the Department of Homeland Security, 1120..., Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410... Burse, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410...

  7. 75 FR 65495 - Draft Guidance for Industry on Qualification Process for Drug Development Tools; Availability

    Science.gov (United States)

    2010-10-25

    ...] Draft Guidance for Industry on Qualification Process for Drug Development Tools; Availability AGENCY... Drug Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 51, rm... Drug Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 21, rm...

  8. 78 FR 63218 - Draft Guidance for Industry on Chronic Hepatitis C Virus Infection: Developing Direct-Acting...

    Science.gov (United States)

    2013-10-23

    ...: The Food and Drug Administration (FDA) is announcing the availability of a draft guidance for industry... Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 51, rm. 2201, Silver... and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 22, rm. 6360, Silver...

  9. 77 FR 69632 - Draft Guidance for Industry on Electronic Source Data in Clinical Investigations; Availability

    Science.gov (United States)

    2012-11-20

    ...., Bldg. 51, Rm. 2201, Silver Spring, MD 20993-0002; Office of Communication, Outreach and Development...., Bldg. 66, Rm. 4613, Silver Spring, MD 20993-0002; and Office of Critical Path Programs, Office of the... finalized, will represent the Agency's current thinking on capturing, using, and archiving electronic data...

  10. Users Office - Removal

    CERN Multimedia

    CERN Bulletin

    2010-01-01

    As of 8 December 2010 and until the end of February 2011, the Users Office will move from Bldg. 60. New Location : Bldg. 510-R-033 Opening Hours: Monday, Tuesday, Thursday, Friday : 08.30 – 12.30 Monday to Friday: 14.00 – 16.00 Closed Wednesday mornings.

  11. An X-Ray Source for Lithography Based on a Quasi-Optical Maser Undulator

    Science.gov (United States)

    1989-05-09

    18, 1986, Edited by J. B. Godel, W. Marcuse and G. P. Williams, Brookhaven National Laboratory Report 52046. 2. In preparing this and the following...90278 Dr. Herbert S. Bennett Dr. John Booske National Bureau of Standards Energy Research Bldg. Bldg. 225, Rm. A352 University of Maryland Washington

  12. Simple Computation of the Heat of Formation and Density from Theoretically Predicted Values

    Science.gov (United States)

    2012-09-01

    ARSENAL AL 35898-5249 2 US ARMY AVN & MIS CMND ATTN AMSRD AMR PS PT L PLEDGER ATTN AMSRD AMR PS PT M MORRISON BLDG 7120...REDSTONE ARSENAL AL 35898 2 US ARMY AVN & MIS CMND ATTN AMSRD ARL PS PT G DRAKE ATTN AMSRD ARL PS PT N MATHIS BLDG 7120

  13. Astronaut Anna Fisher practices control of the RMS in a trainer

    Science.gov (United States)

    1984-01-01

    Astronaut Anna Lee Fisher, mission specialist for 51-A, practices control of the remote manipulator system (RMS) at a special trainer at JSC. Dr. Fisher is pictured in the manipulator development facility (MDF) of JSC's Shuttle mockup and integration laboratory.

  14. 75 FR 60076 - Initiation of Antidumping and Countervailing Duty Administrative Reviews and Requests for...

    Science.gov (United States)

    2010-09-29

    ... as Anvifish JSC) Anvifish Co., Ltd Asia Commerce Fisheries Joint Stock Company (aka as Acomfish JSC... Trading Company Limited Qingdao Tiger Hardware Factory Co., Ltd Qingyuan County Hongyi Hardware Products...

  15. Safety Awareness & Communications Internship

    Science.gov (United States)

    Jefferson, Zanani

    2015-01-01

    The projects that I have worked on during my internships were updating the JSC Safety & Health Action Team JSAT Employee Guidebook, conducting a JSC mishap case study, preparing for JSC Today Close Call success stories, and assisting with event planning and awareness.

  16. 2000-2001 ACADEMIC TRAINING PROGRAMME

    CERN Multimedia

    2000-01-01

    2nd Term : 15 January to 30 March 2001 LECTURE SERIES       Experimentation in Space by M. Spiro, CEA, France 5, 6, 7, 8, 9 February 11:00-12:00 - Auditorium, bldg 500 Tracking at the LHC by K. Safarik, CERN-EP 5, 6, 7, 8, 9 March 11:00-12:00 - Auditorium, bldg 500 Issues in Arms Control by F. Calogero, Univ. Roma, It. 12. 13, 14, 15, 16 February 11:00-12:00 - Auditorium, bldg 500 Telecommunication for the future by R. Parker, CERN-IT 12, 13, 14, 15, 16 March 11:00-12:00 - Auditorium, bldg 500 Introduction to Cryogenic Engineering by J. G. Weisend, Stanford, USA 19, 20, 21, 22, 23 February 11:00-12:00 - Auditorium, bldg 500 ­ 19, 20, 21 February, Council Chamber 22, 23 February Heavy Ion Physics at the CERN SPS by M. Gonin, Ecole Polytechnique, Palaiseau, F. 19, 20, 21, 22, 23 March 11:00-12:00 - Auditorium, bldg 500 Recent Results on CP Violation and B Physics by P.F. Harrison, QMW, London, GB 26, 27, 28 February 1, 2 March 11:00-12:00 - Auditorium, bldg 500 ...

  17. Staff meeting

    CERN Document Server

    2006-01-01

    I would like to invite all members of the CERN Personnel to a meeting on Thursday 18 January 2007 at 3:00 p.m. Main Auditorium (bldg.. 500) to convey my best wishes for the new year, to review CERN's activities during 2006 and to present the perspectives for this special year of the LHC start-up. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (bldg.. 31) and the AT Auditorium (bldg.. 30). Simultaneous translation into English will be available in the main Auditorium. Robert AYMAR

  18. Staff meeting

    CERN Multimedia

    2007-01-01

    Dear Colleagues, 2007 is a very special year for CERN. I would like to review the status of our activities with you, and I invite you to a presentation on Wednesday 27 June 2007 at 3:00 p.m. Main Auditorium (bldg. 500) Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (bldg. 31) and the AT Auditorium (bldg. 30). Simultaneous translation into English will be available in the Main Auditorium. Robert AYMAR

  19. Wastewater Characterization and Hazardous Waste Survey, Hickam AFB, Hawaii.

    Science.gov (United States)

    1987-05-01

    5200 20 Jan Bldg 2178 7.6 26 4400 20 Jan Lift Station 1A 7.2 26 9000 2" Jan Bldg 2045 6.5 26 12000 2’ Jan Bldg 358A 7.4 24 27000 21 Jan Lift Station 12...8217679b Toluene n/a 6850-00- 281-2002 Alum Alodine n/a 8030-00-779-4699 Methyl Iso Ketone n/a 6810-00-286-3785 Thinner MIL 81772 8010-O0-181-8080 1055 15

  20. LIMITED RESTAURANT SERVICE: EASTER WEEKEND

    CERN Multimedia

    2003-01-01

    As Friday, April 18 and Monday, April 21, 2003 are CERN holidays, restaurants no. 1 (COOP : Bldg. 501- Meyrin) and no. 3 (AVENANCE : Bldg. 866 - Prévessin) will be closed and will remain so on Saturday and Sunday, April 19 - 20. They will reopen on Tuesday, April 22 at 7h00. During these four days, a limited service will be provided by restaurant no. 2 (DSR : Bldg. 504 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30.

  1. STAFF MEETING

    CERN Multimedia

    Robert Aymar

    2005-01-01

    I would like to invite all members of the CERN Personnel to a meeting on Thursday 12 January 2006 at 4:00 p.m. - Main Auditorium (bldg. 500) to convey my best wishes for the new year, to review CERN's activities during 2005 and to present the perspectives for this coming year. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (bldg. 31) and the AT Auditorium (bldg. 30). A simultaneous translation into English will be available in the main Auditorium. Best wishes for the festive season Robert AYMAR

  2. STAFF MEETING

    CERN Multimedia

    2004-01-01

    I would like to invite all members of the CERN Personnel to a meeting on Tuesday 13 January 2004 at 4:00 p.m. - Main Auditorium (bldg. 500) to convey my best wishes for the new year and to present a perspective of CERN's future activities. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (bldg. 31) and the AT Auditorium (bldg. 30). A simultaneous translation into English will be available in the main Auditorium. Robert AYMAR

  3. 77 FR 68805 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2012-11-16

    ... deficiencies; 50% of roof missing; trees fallen into bldg.--destroying the structural foundation; removal will... collapsed; floors/walls are caved in; removal of property will most likely result in complete collapse...

  4. 76 FR 38809 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2011-07-01

    ... Ave Motor pool Fort Rucker AL 36362 Landholding Agency: Army Property Number: 21201110019 Status... recent use-- barracks, off-site use only Bldg. 01516 Fort Carson El Paso CO 80913 Landholding Agency...

  5. 76 FR 55417 - In the Matter of Certain Dynamic Random Access Memory and Nand Flash Memory Devices and Products...

    Science.gov (United States)

    2011-09-07

    ... Bldg. 3F, 2-1 Yaesu 2- chome Chuo-ku, Tokyo 104-0028, Japan. Elpida Memory (USA) Inc., 1175 Sonora..., Round Rock, TX 78682. Hewlett-Packard Company, 3000 Hanover Street, Palo Alto, CA 94304. Kingston...

  6. System Requirements Document for the Molten Salt Reactor Experiment 233U conversion system

    International Nuclear Information System (INIS)

    Aigner, R.D.

    2000-01-01

    The purpose of the conversion process is to convert the 233 U fluoride compounds that are being extracted from the Molten Salt Reactor Experiment (MSRE) equipment to a stable oxide for long-term storage at Bldg. 3019

  7. 75 FR 51040 - Issuance of an Experimental Use Permit by the State of Florida

    Science.gov (United States)

    2010-08-18

    ... Docket in Rm. S- 4400, One Potomac Yard (South Bldg.), 2777 S. Crystal Dr., Arlington, VA. The hours of... determine if the addition of mosquito ovitrap strips (Trap-N-Kill\\TM\\), impregnated with bifenthrin to...

  8. 78 FR 11204 - Accreditation and Reaccreditation Process for Firms Under the Third Party Review Program: Part I...

    Science.gov (United States)

    2013-02-15

    ..., 10903 New Hampshire Ave., Bldg. 66, rm. 4613, Silver Spring, MD 20993-0002. Send one self-addressed... was conceived in February 2011 as a forum to discuss future directions in medical device regulatory...

  9. 75 FR 32658 - Change of Contact Information; Technical Amendment

    Science.gov (United States)

    2010-06-09

    ... Gorski, Office of Crisis Management, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 32, rm... contacting the FDA Office of Emergency Operations, Office of Crisis Management, Office of the Commissioner...

  10. 78 FR 22554 - Document to Support Submission of an Electronic Common Technical Document-Specifications for File...

    Science.gov (United States)

    2013-04-16

    ... New Hampshire Ave., Bldg. 51, rm. 2201, Silver Spring, MD 20993-0002 or Office of Communication... acceptance of advertising and promotional labeling in the eCTD format, it has become necessary to expand the...

  11. 76 FR 10610 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2011-02-25

    ... Force Property Number: 18200820001 Status: Unutilized Reasons: Secured Area Bldg. 3224 Eielson AFB Eielson AK 99702 Landholding Agency: Air Force Property Number: 18200820002 Status: Unutilized Reasons: Secured Area, Extensive deterioration Bldgs. 1437, 1190, 2375 Eielson AFB Eielson AK [[Page 10613...

  12. 76 FR 20689 - Guidance for Industry on Influenza: Developing Drugs for Treatment and/or Prophylaxis; Availability

    Science.gov (United States)

    2011-04-13

    ... Hampshire Ave., Bldg. 51, rm. 2201, Silver Spring, MD 20993-0002. Send one self-addressed adhesive label to... exploration and verification of drug effects under epidemic and pandemic conditions. A draft notice of...

  13. 32 CFR 725.6 - Authority to determine and respond.

    Science.gov (United States)

    2010-07-01

    ... Regs., art. 0327 (1990) 5 , shall be referred to the cognizant Command Counsel under, and subject to... Counsel, Navy Litigation Office, 720 Kennon Street SE, Bldg 36 Room 233, Washington Navy Yard, DC 20374...

  14. Caustic addition system operability test procedure

    Energy Technology Data Exchange (ETDEWEB)

    Parazin, R.E.

    1994-11-01

    This test procedure provides instructions for performing operational testing of the major components of the 241-AN-107 Caustic Addition System by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E).

  15. Caustic addition system operability test procedure

    International Nuclear Information System (INIS)

    Parazin, R.E.

    1994-11-01

    This test procedure provides instructions for performing operational testing of the major components of the 241-AN-107 Caustic Addition System by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E)

  16. 75 FR 65362 - Oncologic Drugs Advisory Committee; Notice of Meeting

    Science.gov (United States)

    2010-10-22

    ... Hampshire Ave., Silver Spring, MD 20993-0002. Information regarding special accommodations due to a... Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 31, rm. 2417, Silver...) Soft Gelatin Capsules, [[Page 65363

  17. 76 FR 58277 - Animal Generic Drug User Fee Act; Public Meeting; Request for Comments

    Science.gov (United States)

    2011-09-20

    ... support for lower-cost alternatives to brand drugs for consumers. Under AGDUFA, FDA agreed to meet review... Parklawn Dr., Element Bldg., Rockville, MD 20857. Dated: September 13, 2011. Leslie Kux, Acting Assistant...

  18. 77 FR 72359 - Animal Generic Drug User Fee Act; Public Meeting; Request for Comments

    Science.gov (United States)

    2012-12-05

    ... Parklawn Dr., Element Bldg., Rockville, MD 20857. Comments: Interested persons may submit either written... to brand name drugs for consumers. Under AGDUFA I, FDA agreed to meet review performance goals for...

  19. Astronaut John Young in Command Module Simulator during Apollo Simulation

    Science.gov (United States)

    1968-01-01

    Astronaut John W. Young, command module pilot, inside the Command Module Simulator in bldg 5 during an Apollo Simulation. Astronauts Thomas P. Stafford, commander and Eugene A. Cernan, lunar module pilot are out of the view.

  20. Three astronauts inside Command Module Simulator during Apollo Simulation

    Science.gov (United States)

    1968-01-01

    Three astronauts inside the Command Module Simulator in bldg 5 during an Apollo Simulation. Left to right are Astronauts Thomas P. Stafford, commander; John W. Young, command module pilot; and Eugene A. Cernan, lunar module pilot.

  1. 77 FR 44262 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2012-07-27

    ....; office; major repairs required; extensive mold & asbestos located beneath the bldg.; remediation required... Service Admin. complex; mold and lead identified; historic property. Utah 2 Buildings 9160 N. Hwy 83...

  2. 77 FR 52397 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2012-08-29

    ... the processing of applications, the reader is encouraged to refer to the interim rule governing this... paint, most recent use--dining, off-site use only Bldg. 90551 Fort Huachuca Cochise AZ 85613 Landholding...

  3. 78 FR 15127 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2013-03-08

    ... the processing of applications, the reader is encouraged to refer to the interim rule governing this... recent use--dining, off-site use only Bldg. 90551 Fort Huachuca Cochise AZ 85613 Landholding Agency: Army...

  4. System Requirements Document for the Molten Salt Reactor Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Aigner, R.D.

    2000-04-01

    The purpose of the conversion process is to convert the {sup 233}U fluoride compounds that are being extracted from the Molten Salt Reactor Experiment (MSRE) equipment to a stable oxide for long-term storage at Bldg. 3019.

  5. Astronaut Neil Armstrong participates in simulation of moon's surface

    Science.gov (United States)

    1969-01-01

    Astronaut Neil A. Armstrong, wearing an Extravehicular Mobility Unit, deploys a lunar surface television camera during lunar surface simulation training in bldg 9, Manned Spacecraft Center. Armstrong is the prime crew commander of the Apollo 11 lunar landing mission.

  6. 77 FR 50113 - ASTM International-Food and Drug Administration Workshop on Absorbable Medical Devices: Lessons...

    Science.gov (United States)

    2012-08-20

    ... disability, please contact Cindy Garris, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 66, rm... that the implant must withstand and perform. Moreover, the optimal preclinical/bench testing paradigm...

  7. 77 FR 75616 - Procurement List; Additions

    Science.gov (United States)

    2012-12-21

    .... 611, 1919 E Grange Ave., Milwaukee, WI NPA: Easter Seals Southeast Wisconsin, Inc., South Milwaukee... B, Bldg. 39, Wright-Patterson AFB, Dayton, OH NPA: Goodwill Easter Seals Miami Valley, Dayton, OH...

  8. 77 FR 35993 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2012-06-15

    ... identified in the floor Virginia Hampton Rds, Shore Patrol Bldg 811 East City Hall Ave Norfolk VA 23510... Reclamation Henderson NV 89011 Landholding Agency: GSA Property Number: 54201140004 Status: Surplus GSA Number...

  9. 78 FR 11429 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2013-02-15

    ...: Mr. Scott Whiteford, Army Corps of Engineers, Real Estate, CEMP-CR, 441 G Street NW., Washington, DC...., needs rehab, most recent use--chemistry lab, off-site use only Bldg. E3335 Property Number: 21200330144...

  10. Advanced Video Activity Analytics (AVAA): Human Factors Evaluation

    Science.gov (United States)

    2015-05-01

    HRM -A Aberdeen Proving Ground, MD 21005-5425 8. PERFORMING ORGANIZATION REPORT NUMBER ARL-TR-7286 9. SPONSORING/MONITORING AGENCY NAME(S) AND...A MALHOTRA 1 ARMY RSCH LABORATORY – HRED (PDF) RDRL HRM D T DAVIS BLDG 5400 RM C242 REDSTONE ARSENAL AL 35898-7290 1 ARMY RSCH...HRED (PDF) RDRL HRM DG J RUBINSTEIN BLDG 333 PICATINNY ARSENAL NJ 07806-5000 1 ARMY RSCH LABORATORY – HRED (PDF) ARMC FIELD

  11. VO2sim 0.1: Using Simulation to Understand Measurement Error in Indirect Calorimetry

    Science.gov (United States)

    2015-08-01

    RDRL CIO LL IMAL HRA MAIL & RECORDS MGMT 1 GOVT PRINTG OFC (PDF) A MALHOTRA 1 ARMY RSCH LAB – HRED (PDF) RDRL HRM D T DAVIS...GREELEY RD FORT SAM HOUSTON TX 78234-5002 1 ARMY RSCH LAB – HRED (PDF) RDRL HRM DG K GUNN BLDG 333 PICATINNY ARSENAL NJ...07806-5000 1 ARMY RSCH LAB – HRED (PDF) ARMC FIELD ELEMENT RDRL HRM CH C BURNS THIRD AVE BLDG 1467B RM 336 FORT KNOX KY 40121

  12. Forecasting Municipal and Industrial Water: IWR MAIN System User’s Guide for Interactive Processing and User’s Manual.

    Science.gov (United States)

    1983-07-01

    LAUNDROMATS LNDY LAUNDRY MEDL MEDICAL OFFICES MOTL MOTELS MOVI DRIVE-IN MOVIES NURS NURSING HOMES OFFN NEW OFFICE BLDG. OFFO OLD OFFICE BLDG. * JAIL...CHURCHES CLUB GOLF-SWIM CLUBS BOWL BOWLING ALLEYS COLG COLLEGES RESID. HOSP MED CENTERS HOTL HOTELS LNDM LAUNDROMATS LNDY LAUNDRY MEDL MEDICAL OFFICES... Laundromat data YMCA Type Facilities Data for YMCA, YWCA, etc. U.S. Census Bureau Many commercial parameters % "Census of Business" Department of Employment

  13. Forbidden Access

    CERN Multimedia

    C. Colloca TS/FM

    2004-01-01

    TS/FM group informs you that, for the replacement of the door of the main entrance at bldg. 500, the access will be closed to the public between 19 and 30 July 2004. Access to the Main Building complex will be assured at any time through both of the side doors and from bldg. 64. For more information, please contact 73273. C. Colloca TS/FM

  14. CERN Shuttle

    CERN Multimedia

    General Infrastructure Services Department

    2011-01-01

    As of Monday 21 February, a new schedule will come into effect for the Airport Shuttle (circuit No. 4) at the end of the afternoon: Last departure at 7:00 pm from Main Buildig, (Bldg. 500) to Airport (instead of 5:10 p.m.); Last departure from Airport to CERN, Main Buildig, (Bldg. 500), at 7:30 p.m. (instead of 5:40 p.m.). Group GS-IS

  15. Rare Presentation of a Primary Cutaneous well Differentiated Liposarcoma

    Science.gov (United States)

    2018-02-16

    Roberts, Capt Jared 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) 59th Clinical Research Division 1100 Willford Hall Loop, Bldg 4430 JBSA-Lackland...TX 78236-9908 210-292-7141 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES) 59th Clinical Research Division 1100 Willford Hall Loop, Bldg...been proposed to aid in identifying lipoblasts. Lipoblasts should have a hyperchromatic indented or sharply scalloped nucleus, a lipid -rich droplets

  16. Astronaut Ronald Evans is suited up for EVA training

    Science.gov (United States)

    1972-01-01

    Astronaut Ronald E. Evans, command module pilot of the Apollo 17 lunar landing mission, is assisted by technicians in suiting up for extravehicular activity (EVA) training in a water tank in bldg 5 at the Manned Spacecraft Center (49970); Evans participates in EVA training in a water tank in bldg 5 at the Manned Spacecraft Center. The structure in the picture simulates the Scientific Instrument Module (SIM) bay of the Apollo 17 Service Module (49971).

  17. CERN Infirmary closed for building work

    CERN Multimedia

    2013-01-01

    The CERN Infirmary (Bldg 57, ground floor) will be closed from 11 December 2013 to 19 January 2014 due to building work.   A minimum service will be provided during this period by nurses and doctors, on the first floor of the Medical Service, bldg. 57. For any questions, please contact the nurses (73802) or the secretariat (73186 / 78435). Note: no complementary examination (audio, visiotest, EFR, etc.) will be possible. Thank you for your understanding and seasons greetings! Medical Service Team

  18. 2002 - ACADEMIC TRAINING PROGRAMME

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    2nd Term : 14 January to 30 March 2002 LECTURE SERIES 14, 15, 16, 17, 18 January 11:00-12:00 - Auditorium, Bldg 500 Superconducting materials suitable for magnets by D.C. Larbalestier / Univ. of Wisconsin, USA 4, 5, 6, 7, 8 February 11:00-12:00 - Council room on 4 February Auditorium, Bldg 500 on 5, 6, 7, 8 February Reliability issues at the LHC by P. Kafka / RelConsult, D 11, 12, 13, 14, 15 February 11:00-12:00 - Auditorium, Bldg 500 Neutrino masses and oscillations by A. de Rujula / CERN-TH 18, 19, 20, 21, 22 February 11:00-12:00 - Auditorium, Bldg 500 Particle identification at the LHC by P. Eerola / Lund Univ. SE 25, 26, 27, 28 February and 1st March 11:00-12:00 - Auditorium, Bldg 500 on 25, 26, 27 February and 1st March, Council room on 28 February Cosmology and the origin of structure by E.W. Kolb / CERN-TH 4, 5, 6, 7, 8, March 11:00-12:00 - Auditorium, Bldg 500 on 4, 5, 6, 8, March Council room on 7 March Data Challenges for the LHC by P. Vande Vyvre / CERN-EP and B. Segal / CERN-IT 12, 13, 14 March 11...

  19. 2002-2003 ACADEMIC TRAINING PROGRAMME, 2nd Term : 20 January to 31 March 2003, LECTURE SERIES

    CERN Multimedia

    2003-01-01

    20, 21, 22, 23, 24 January High Performance Networking by A. Van Praag, CERN-IT 11:00-12:00 - Auditorium, Bldg 500 27, 28, 29, 30, 31 January Cosmology : The Homogeneous Universe and the Evolution of Structures by R. Durrer, Univ. of Geneva, CH 11:00-12:00 - Auditorium, Bldg 500 on 27, 28, 30, 31 January. Council Room on 29 January 3, 4, 5, 6, 7 February Searching for Supersymmetry at the LHC by F. Gianotti (CERN-EP) and G. Ridolfi, Univ. di Genova, I 10:00-12:00 - Auditorium, Bldg 500 10, 11, 12, 13, 14 February Introduction to General Relativity and Black Holes by T. Damour, IHES, Bures-su-Yvette, F 11:00-12:00 - Auditorium, Bldg 500 24, 25, 26 February Physics at a Future Collider beyond the LHC and TeV Class Linear Collider by M. Battaglia, (CERN-EP) 11:00-12:00 - Auditorium, Bldg 500 5, 6, 7 March Modern Project Management by R. Sauter, STS, CH 10:00-12:00 - Auditorium, Bldg 500 17, 18, 19 March Internet Networking Technologies by R. D. Cowles, SLAC 11:00-12:00 ...

  20. Police Communications

    Science.gov (United States)

    1981-01-01

    Oklahoma City Police Department developed a computerized communications system, based on Johnson Space Center's (JSC's) 1960-mission control knowledge. JSC furnished information on lighting and other fatigue reducing measures, and provided specifications for equipment and design layouts. JSC also advised OCPD how to avoid communications bottlenecks associated with simultaneous handling of telephone, radio and inner-office transmissions. Oklahoma City saved money in reduced design and engineering costs by utilizing the already developed NASA technology.

  1. Bio-detoxification of phorbol esters and other anti-nutrients of Jatropha curcas seed cake by fungal cultures using solid-state fermentation.

    Science.gov (United States)

    Sharath, B S; Mohankumar, B V; Somashekar, D

    2014-03-01

    Jatropha seed cake, a byproduct after biodiesel extraction, has several anti-nutrients and toxins. Solid-state fermentation was carried out for the detoxification of the Jatropha seed cake (JSC) using different fungal cultures. The reduction in the anti-nutritional components such as tannins, phytates, saponins, lectin and protease inhibitor, and phorbol esters on 6th, 9th, and 12th day of fermentation was analyzed. The phorbol ester content in the unfermented JSC was 0.83 mg/g, and the maximum degradation of phorbol esters to the extent of 75% was observed in the case of JSC fermented with Cunninghamella echinulata CJS-90. The phytate degradation in the fermented JSC was in the range of 65-96%. There was a gradual reduction of saponin content in the JSC from 6th to 12th day, and the reduction of saponin was in the range of 55-99% after solid-state fermentation. The trypsin inhibitor activity and lectin were 1,680 trypsin inhibitor units (TIU) per gram and 0.32 hemagglutinating unit in the unfermented JSC, respectively. Trypsin inhibitor activity and lectin could not be detected in JSC after 12th day of solid-state fermentation. Tannins accounted for 0.53% in unfermented JSC, and there was a marginal increase of tannins after solid-state fermentation. The results indicate that biological detoxification could be a promising method to reduce anti-nutritional compounds and toxins in the JSC.

  2. Taxonomy, Ontology and Semantics at Johnson Space Center

    Science.gov (United States)

    Berndt, Sarah Ann

    2011-01-01

    At NASA Johnson Space Center (JSC), the Chief Knowledge Officer has been developing the JSC Taxonomy to capitalize on the accomplishments of yesterday while maintaining the flexibility needed for the evolving information environment of today. A clear vision and scope for the semantic system is integral to its success. The vision for the JSC Taxonomy is to connect information stovepipes to present a unified view for information and knowledge across the Center, across organizations, and across decades. Semantic search at JSC means seemless integration of disparate information sets into a single interface. Ever increasing use, interest, and organizational participation mark successful integration and provide the framework for future application.

  3. Noninvasive Biosensor Algorithms for Continuous Metabolic Rate Determination

    Data.gov (United States)

    National Aeronautics and Space Administration — Our collaborators in the JSC Cardiovascular lab implemented a technique to determine stroke volume during exercise using ultrasound imaging. Data collection using...

  4. Removal action report on the Building 3001 canal at Oak Ridge National Laboratory, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1997-05-01

    Oak Ridge National Laboratory (ORNL) is a federal facility managed by Lockheed Martin C, Energy Research, Inc., for the U.S. Department of Energy (DOE). ORNL on the Oak Ridge Reservation in East Tennessee at the Anderson and Roane County lines, approximately 38 km (24 miles) west of Knoxville, Tennessee, and 18 km (11 miles) southwest of downtown Oak Ridge. The Oak Ridge Graphite Reactor and its storage and transfer canal are located in Bldg. 3001 in the approximate center of Waste Area Grouping I in the ORNL main complex. 4:1 The Bldg. 3001 Storage Canal is an L-shaped, underground, reinforced-concrete structure running from the back and below the Graphite Reactor in Bldg. 3001 to a location beneath a hot cell in the adjacent Bldg. 3019. The Graphite Reactor was built in 1943 to produce small quantities of plutonium and was subsequently used to produce other isotopes for medical research before it was finally shut down in 1963. The associated canal was used to transport, under water, spent fuel slugs and other isotopes from the back of the reactor to the adjacent Bldg. 31319 hot cell for further processing. During its operation and years subsequent to operation, the canal's concrete walls and floor became contaminated with radioisotopes from the water.This report documents the activities involved with replacing the canal water with a solid, controlled, low-strength material (CLSM) in response to a Comprehensive Environmental Response, Compensation, and Liability Act non-time-critical removal action

  5. Academic Training - 2nd Term: 08.01.2007 - 31.03.2007

    CERN Multimedia

    2006-01-01

    2006 - 2007 ACADEMIC TRAINING PROGRAMME 2nd Term : 08.01.2007 - 31.03.2007 LECTURE SERIES Applied Superconductivity by V. Palmieri, INFN, Padova, It. 17, 18, 19 January 11:00 -1200 - Auditorium, Bldg 500 String Theory for Pedestrians by B. Zwiebach, M.I.T. Cambridge, USA 29, 30, 31 January 11:00-12:00 - Auditorium, Bldg 500 on 29, 30 January TH Auditorium on 31 January Introduction to Supersymmetry by D. Kaplan, John Hopkins University, Baltimore, USA 12, 13, 14, 15 February 11:00-12:00 - Auditorium, Bldg 500 The Hunt for the Higgs Particle by F. Zwirner, University of Padova, It 27, 28 February, 1st March 11:00-12:00 - Auditorium, Bldg 500 From Evolution Theory to Parallel and Distributed Genetic by F. Fernandez de Vega 15, 16, March 11:00-12:00 - Auditorium, Bldg 500 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the CERN bulletin, the WWW, an...

  6. Academic Training - 2nd Term: 08.01.2007 - 31.03.2007

    CERN Multimedia

    2006-01-01

    2006 - 2007 ACADEMIC TRAINING PROGRAMME 2nd Term : 08.01.2007 - 31.03.2007 LECTURE SERIES Applied Superconductivity by V. Palmieri, INFN, Padova, It. 17, 18, 19 January 11:00 -1200 - Auditorium, bldg. 500 String Theory for Pedestrians by B. Zwiebach, M.I.T. Cambridge, USA 29, 30, 31 January 11:00-12:00 - Auditorium, bldg. 500 on 29, 30 January TH Auditorium on 31 January Introduction to Supersymmetry by D. Kaplan, John Hopkins University, Baltimore, USA 12, 13, 14, 15 February 11:00-12:00 - Auditorium, bldg. 500 The Hunt for the Higgs Particle by F. Zwirner, University of Padova, It 27, 28 February, 1st March 11:00-12:00 - Auditorium, bldg. 500 From Evolution Theory to Parallel and Distributed Genetic Programming by F. Fernandez de Vega 15, 16, March 11:00-12:00 - Auditorium, bldg. 500 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the WWW, and ...

  7. Academic Training: 2nd Term - 09.01.2006 - 31.03.2006

    CERN Multimedia

    Françoise Benz

    2005-01-01

    2005 - 2006 ACADEMIC TRAINING PROGRAMME LECTURE SERIES The world quantum matter by M. Weidemüller, Univ. Freiburg, D 23, 24, 25, 26 January 11:00 -1200 - Auditorium, bldg 500 Deep space telescopes by G. Bignami, CNRS, Toulouse, F 13, 14, 15, 16, 17 February 11:00-12:00 - Auditorium, bldg 500 Bioinformatics: analysing the genome by V. Jongeneel, O. Michielin, S. Antonorakis A. Thomas and P. Descombes 27, 28 February, 1, 2, 3 March11:00-12:00 - Auditorium, bldg 500 LHC luminosity upgrade: detector challengesby A. de Roeck,CERN-PH, D. Bortoletto, Purdue Univ. USA R. Wigmans, Texas Tech. Univ. USA, W. Riegler, CERN-AT, W. Smith, Univ. of Wisconsin, USA 13, 14, 15, 16, March 11:00-12:00 - Auditorium, bldg 500 Supersymmetry and the LHC by M. Drees, Univ. of Bonn, D 20, 21, 22, 23, 24 March 11:00-12:00 - Auditorium, bldg 500 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be...

  8. 2005 - 2006 ACADEMIC TRAINING PROGRAMME From 1st of May to 30 June

    CERN Multimedia

    2006-01-01

    LECTURE SERIES Physics at the Tevatron by B. Heinemann Univ. of Liverpool - Fermilab 15, 16, 17, 18 May 11:00 -1200 - Auditorium, Bldg 500, 18 May - Council Chamber Pulsed SC Magnets by M. Wilson, 29, 30, 31 May, 1, 2 June 11:00-12:00 - Auditorium, Bldg 500 Exploring planets and moons in our solar system by H.O. Rucker / Academy of Sciences, Graz, A 6, 7, 8, 9 June 11:00-12:00 - Auditorium, Bldg 500 Technological challenges of CLIC by R. Corsini, S. Doebert, S. Redaelli, T. Lefevre / CERN-AB, G. Arnau Izquiedo, H. Mainaud / CERN-TS 12, 13, 14, 15, 16, June 11:00-12:00 - Auditorium, Bldg 500 The use of Monte Carlo radiation transport codes in radiation physics and dosimetry by A. Ferrari, CERN-AB, M. Silari, CERN-SC, F. Salvat, Facultat de Fisica, Univ. Barcelona, E. 26, 27, 28 June 11:00-12:00 - TH Auditorium, Bldg 4, room 3-006 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place ...

  9. Academic Training: 2005 - 2006 Academic Training Programme

    CERN Multimedia

    Françoise Benz

    2005-01-01

    1st Term : 03.10. 2005 - 16.12.2005 LECTURE SERIES Einstein's impact on the physics of the Twentieth Century by N. Straumann / Univ. Zürich, CH 3, 4, 5, 6, 7 October 11:00 -1200 - Auditorium, Bldg 500 Surviving in space: the challenges of a manned mission to Mars by L. S. Pinsky / Univ. Houston, USA 26, 27, 28 October 11:00-12:00 - Auditorium, Bldg 500 Climate change and challenges for the environment by C. Schluechter, Univ. Ber, CH 14, 15, 16 November 11:00-12:00 - TH Auditorium, Bldg 4, 3rd Floor Introduction to Cryogenic Engineering by Goran Perinic, CERN- AT 5, 6, 7, 8, 9 December 11:00-12:00 - Auditorium, Bldg 500 Predicting natural catastrophes by E. Okal, Northwestern Univ. , USA 12, 13, 14, 15, 16 December 11:00-12:00 - Auditorium, Bldg 500 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the CERN bulletin, the WWW, and by Notices before ea...

  10. Networking at NASA. Johnson Space Center

    Science.gov (United States)

    Garman, John R.

    1991-01-01

    A series of viewgraphs on computer networks at the Johnson Space Center (JSC) are given. Topics covered include information resource management (IRM) at JSC, the IRM budget by NASA center, networks evolution, networking as a strategic tool, the Information Services Directorate charter, and SSC network requirements, challenges, and status.

  11. Astronaut Wendy Lawrence participates in training session in the CCT

    Science.gov (United States)

    1994-01-01

    Seated in the pilot's seat of a JSC Shuttle trainer, astronaut Wendy B. Lawrence, STS-67 flight engineer, participates in a training session. The 1992 astronaut class graduate is in the crew compartment trainer (CCT) of JSC's Shuttle mockup and integration laboratory.

  12. Astronaut Tamara Jernigan in the CCT during a training session

    Science.gov (United States)

    1994-01-01

    Astronaut Tamara E. Jernigan, STS-67 payload commander, is shown here in the Shuttle Training Facility at JSC participating in a training session. Jernigan is training with the RMS controls in the Crew Compartment Trainer (CCT) of JSC's Shuttle mockup and integration laboratory.

  13. The Enigmatic Nature of the Israeli Legal System

    African Journals Online (AJOL)

    RV

    independent and shall not be subject to the control or direction of any person or authority". 11 ...... JSC should have a central role in the removal of judges. The JSC ...... Thomas JB Judicial Ethics in Australia (Law Book Company Sydney 1988).

  14. President Ronald Reagan speaks at STS 51-L Memorial service

    Science.gov (United States)

    1986-01-01

    President Ronald Reagan tells a large turnout of JSC employees and family and friends of the 51-L crewmembers about their accomplishments and sacrifices during memorial services held following the Challenger accident at Kennedy Space Center (KSC).'They slipped the surly bonds of earth to touch the face of God' the President told the thousands gathered on the central mall at JSC.

  15. National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1994, volume 1

    Science.gov (United States)

    Bannerot, Richard; Sickorez, Donn G.

    1995-01-01

    The JSC NASA/ASEE Summer Faculty Fellowship Program was conducted by Texas A&M University and JSC. The objectives of the program, which began nationally in 1964 and at JSC in 1965 are to: (1) further the professional knowledge of qualified engineering and science faculty members, (2) stimulate an exchange of ideas between participants and NASA, (3) enrich and refresh the research and teaching activities of participants' institutions, and (4) contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA JSC colleague. This document is a compilation of the final reports on the research projects completed by the faculty fellows during the summer of 1994.

  16. National Aeronautics and Space Administration (NASA) /American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program. Volume 1

    Science.gov (United States)

    Bannerot, Richard B. (Editor); Sickorez, Donn G. (Editor)

    1997-01-01

    The 1996 JSC NASA/ASEE Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The objectives of the program, which began nationally in 1964 and at JSC in 1965 are to (1) further the professional knowledge qualified engineering and science faculty members, (2) stimulate an exchange of ideas between participants and NASA, (3) refresh the research and teaching activities of participants' institutions, and (4) contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA JSC colleague. This document is a compilation of the final reports on the research projects completed by the faculty fellows during the summer of 1996.

  17. 2006 - 2007 ACADEMIC TRAINING PROGRAMME - 3rd Term: From 1st of May to 30 June 2007

    CERN Multimedia

    HR Department

    2007-01-01

    LECTURE SERIES QCD and high energy nuclear collisions D. Kharzeev / BNL, Upton, USA 7, 8, 9 May 11:00 -1200 - Auditorium, Bldg 500 9 May - Council Chamber Acceleration of particles in plasma J. Faure / Ecole Polytechnique ENSTA, Palaiseau, F. 21, 22, 23, 24, 25 May 11:00-12:00 - Auditorium, Bldg 500 Nanotechnologies by C. Bottani / Polytechnic of Milano, I., M. Ferrari, Univ. of Texas, Health Science Center, Houston, USA, A. Li Bassi, Polytechnic of Milano, I. 11, 12, 13 June 11:00-12:00 - Auditorium, Bldg 500 11 June - Council Chamber The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the CERN bulletin, the WWW, and by Notices before each term and for each series of lectures.

  18. 2007 2008 ACADEMIC TRAINING PROGRAMME

    CERN Multimedia

    2008-01-01

    LECTURE SERIES 18, 19, 20 & 21 February 2008 Main Auditorium, bldg. 500-1: 18, 19, 21 February 2008 - 11:00-12:00 Council Chamber, bldg 503-1-001: 20 February 2008 - 11:00-12:00 Council Chamber, bldg 503-1-001: 21 February 2008 - 14:00-15:00 QCD Phenomenology at High Energy Prof. Bryan WEBBER, Cambridge University, UK Whatever kind of physics may be found at the LHC, strongly-interacting particles will be involved and therefore quantum chromodynamics will play a crucial role. For processes at high energy scales, perturbation theory remains the most powerful approach. These lectures will review the foundations and limitations of perturbative QCD and its application to high-energy processes, including jet production and fragmentation, deep inelastic scattering, and heavy quark and Higgs boson production.

  19. 2007-2008 ACADEMIC TRAINING PROGRAMME

    CERN Multimedia

    2008-01-01

    LECTURE SERIES QCD Phenomenology at High Energy Prof. Bryan WEBBER, Cambridge University, UK18, 19, 20 & 21 February 2008 Main Auditorium, bldg. 500-1: 18, 19, 21 February 2008 - 11:00-12:00 Council Chamber, bldg 503-1-001: 20 February 2008 - 11:00-12:00 Council Chamber, bldg 503-1-001: 21 February 2008 - 14:00-15:00 Whatever kind of physics may be found at the LHC, strongly-interacting particles will be involved and therefore quantum chromodynamics will play a crucial role. For processes at high energy scales, perturbation theory remains the most powerful approach. These lectures will review the foundations and limitations of perturbative QCD and its application to high-energy processes, including jet production and fragmentation, deep inelastic scattering, and heavy quark and Higgs boson production.

  20. Staff meeting

    CERN Multimedia

    2007-01-01

    I would like to invite all members of the CERN Personnel to a meeting on Wednesday 16 January 2008 at 3:00 p.m. Main Auditorium (bldg 500) to convey my best wishes for the new year, to review CERN’s activities during 2007 and to present the perspectives for 2008, the year of the LHC start-up. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (Bldg. 31) and the AT Auditorium (Bldg. 30). Simultaneous translation into English will be available in the main Auditorium. Best wishes for the festive season! Robert AYMAR

  1. LIMITED RESTAURANT SERVICE : EASTER WEEKEND

    CERN Multimedia

    Restaurant Supervisory Committee

    2002-01-01

    As Friday 29 March and Monday 1st April 2002 are CERN holidays, restaurants no. 1 (COOP, bldg. 501- Meyrin) and no. 3 (Avenance, bldg. 866 - Prévessin) will be closed and will remain so on Saturday and Sunday 30-31 March. They will reopen on Tuesday 2 April at 7h00. During these four days, a limited service will be provided by restaurant no. 2 (DSR, bldg. 504 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. On Thursday 28 March, all three restaurants will operate according to the usual times except for restaurant no. 1 which will close at 21h00 instead of 1 o'clock in the morning. Restaurant Supervisory Committee Tel. 77551

  2. LIMITED RESTAURANT SERVICE : EASTER WEEKEND

    CERN Multimedia

    2003-01-01

    As Friday, April 18 and Monday, April 21, 2003 are CERN holidays, restaurants no. 1 (COOP : Bldg. 501- Meyrin) and no. 3 (AVENANCE : Bldg. 866 - Prévessin) will be closed and will remain so on Saturday and Sunday, April 19 - 20. They will reopen on Tuesday, April 22 at 7h00. During these four days, a limited service will be provided by restaurant no. 2 (DSR : Bldg. 504 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. On Thursday, April 17, all three restaurants will operate according to the usual times except for restaurant no. 1 which will close at 21h00 instead of 1 o'clock in the morning.

  3. LIMITED RESTAURANT SERVICE: EASTER WEEKEND

    CERN Multimedia

    Restaurant Supervisory Committee

    2001-01-01

    As Friday 13 and Monday 16 April 2001 are CERN holidays, restaurants no. 1 (COOP, bldg. 501- Meyrin) and no. 3 (Générale de Restauration, bldg. 866 - Prévessin) will be closed and will remain so on Saturday 14 and Sunday 15 April. They will reopen on Tuesday 17 April at 7h00. During these four days, a limited service will be provided by restaurant no. 2 (DSR, bldg. 504 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. On Thursday 12 April, all three restaurants will operate according to the usual times except for restaurant no 1, which will close at 21h00 instead of 1 o'clock in the morning.

  4. LIMITED RESTAURANT SERVICE : EASTER WEEKEND

    CERN Multimedia

    Restaurant Supervisory Committee

    2002-01-01

    As Friday, March 29 and Monday, April 1st, 2002 are CERN holidays, restaurants no. 1 (COOP : Bldg. 501- Meyrin) and no. 3 (Avenance : Bldg. 866 - Prévessin) will be closed and will remain so on Saturday and Sunday, March 30 - 31. They will reopen on Tuesday, April 2 at 7h00. During these four days, a limited service will be provided by restaurant no. 2 (DSR : Bldg. 504 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. On Thursday, March 28, all three restaurants will operate according to the usual times except for restaurant no. 1 which will close at 21h00 instead of 1 o'clock in the morning.   Restaurant Supervisory Committee, tel. 77551

  5. RESTAURANT AND CAFETERIA SERVICES ARRANGEMENTS FOR 1 MAY 2002

    CERN Document Server

    Restaurant Supervisory Committee

    2002-01-01

    1. Restaurants As Wednesday 1 May is an official CERN holiday, restaurants no. 2 (DSR: bldg. 504 - Meyrin) and no. 3 (Avenance: bldg. 866 - Prévessin) will be closed as from Tuesda 30 April at 18h00. They will reopen on Thursday 2 May at 6h30 (rest. no. 2) and at 7h00 (rest. no. 3). On 1 May, a limited service will be provided by restaurant no. 1 (COOP: bldg. 501 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. 2. Decentralised services No decentralised services (satellite cafétérias etc.) will operate. 3. Newspaper stand The newspaper kiosque in building 501 will be closed. Restaurant Supervisory Committee, tel. 77551

  6. LIMITED RESTAURANT SERVICE: EASTER WEEK-END

    CERN Multimedia

    2004-01-01

    As Friday April 9 and Monday April 12 2004 are CERN holidays, restaurants no. 1 (Bldg. 501- Meyrin) and no. 3 (Bldg. 866 - Prévessin) will be closed and will remain closed on Saturday and Sunday, April 10 - 11. They will reopen on Tuesday, April 13 at 7 a.m. During these four days, a limited service will be provided by restaurant no. 2 (Bldg. 504 - Meyrin): on Friday and Monday from 8 a.m. to 9 p.m. and on Saturday and Sunday from 9 a.m. to 8.30 p.m. Hot meals will be served from 11.30 a.m. to 2 p.m. and from 6 p.m. to 7.30 p.m.

  7. Closure Report for Corrective Action Unit 300: Surface Release Areas Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    NSTec Environmental Restoration

    2007-01-01

    Corrective Action Unit (CAU) 300 is located in Areas 23, 25, and 26 of the Nevada Test Site, which is located approximately 65 miles northwest of Las Vegas, Nevada. CAU 300 is listed in the Federal Facility Agreement and Consent Order of 1996 as Surface Release Areas and is comprised of the following seven Corrective Action Sites (CASs), which are associated with the identified Building (Bldg): (sm b ullet) CAS 23-21-03, Bldg 750 Surface Discharge (sm b ullet) CAS 23-25-02, Bldg 750 Outfall (sm b ullet) CAS 23-25-03, Bldg 751 Outfall (sm b ullet) CAS 25-60-01, Bldg 3113A Outfall (sm b ullet) CAS 25-60-02, Bldg 3901 Outfall (sm b ullet) CAS 25-62-01, Bldg 3124 Contaminated Soil (sm b ullet) CAS 26-60-01, Bldg 2105 Outfall and Decon Pad The Nevada Division of Environmental Protection (NDEP)-approved corrective action alternative for CASs 23-21-03, 23-25-02, and 23-25-03 is no further action. As a best management practice, approximately 48 feet of metal piping was removed from CAS 23-25-02 and disposed of as sanitary waste. The NDEP-approved corrective action alternative for CASs 25-60-01, 25-60-02, 25-62-01, and 26-60-01, is clean closure. Closure activities for these CASs included removing and disposing of soil impacted with total petroleum hydrocarbons-diesel range organics (TPH-DRO), polychlorinated biphenyls (PCBs), semivolatile organic compounds (SVOCs), and cesium (Cs)-137, concrete impacted with TPH-DRO, and associated piping impacted with TPH-DRO. CAU 300 was closed in accordance with the NDEP-approved CAU 300 Corrective Action Plan (CAP) (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2006). The closure activities specified in the CAP were based on the recommendations presented in the CAU 300 Corrective Action Decision Document (NNSA/NSO, 2005). This Closure Report documents CAU 300 closure activities. During closure activities, approximately 40 cubic yards (yd3) of low-level waste consisting of TPH

  8. Assessments of the probabilities of aircraft impact with the Sandia Pulsed Reactor and Building 836, Sandia Laboratories, Albuquerque

    International Nuclear Information System (INIS)

    Biringer, B.E.

    1976-11-01

    This report documents a study of the annual probabilities of aircraft impact with the Sandia Pulsed Reactor (SPR) and Bldg. 836 at Sandia Laboratories, Albuquerque. The probability of aircraft impact into each structure was estimated using total yearly operations, effective structure area, structure location relative to air activity, and accident rate per kilometer. The estimated probability for an aircraft impact with SPR is 1.1 x 10 -4 per year; the estimated probability for impact with Bldg. 836 is 1.0 x 10 -3 per year

  9. Final Programmatic Environmental Assessment for Base-Wide Military Construction Planning at Kirtland Air Force Base, New Mexico

    Science.gov (United States)

    2013-11-01

    landfills, sewage lagoons, radioactive holding tanks , oil/water separators, drainage areas, septic systems, spill areas, fire-training areas, and...Waste Acc. Area Bldg. 617 2,371 NFA 3 ST-351 10-21-B Building 635 Septic Tank 1,610 NFA 3 SS-063 10-02-E Jet Engine Cell (ST-336) 2,341 NFA 3 ST...349 10-21-B Building 626 Septic Tank 2,224 NFA 3 ST-350 10-21-X 600 Area Field Office Septic Tank 433 NFA 3 ST-296 10-21-D Septic System, Bldg.702

  10. Closure Report for Corrective Action Unit 300: Surface Release Areas Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    NSTec Environmental Restoration

    2007-07-01

    Corrective Action Unit (CAU) 300 is located in Areas 23, 25, and 26 of the Nevada Test Site, which is located approximately 65 miles northwest of Las Vegas, Nevada. CAU 300 is listed in the Federal Facility Agreement and Consent Order of 1996 as Surface Release Areas and is comprised of the following seven Corrective Action Sites (CASs), which are associated with the identified Building (Bldg): {sm_bullet} CAS 23-21-03, Bldg 750 Surface Discharge {sm_bullet} CAS 23-25-02, Bldg 750 Outfall {sm_bullet} CAS 23-25-03, Bldg 751 Outfall {sm_bullet} CAS 25-60-01, Bldg 3113A Outfall {sm_bullet} CAS 25-60-02, Bldg 3901 Outfall {sm_bullet} CAS 25-62-01, Bldg 3124 Contaminated Soil {sm_bullet} CAS 26-60-01, Bldg 2105 Outfall and Decon Pad The Nevada Division of Environmental Protection (NDEP)-approved corrective action alternative for CASs 23-21-03, 23-25-02, and 23-25-03 is no further action. As a best management practice, approximately 48 feet of metal piping was removed from CAS 23-25-02 and disposed of as sanitary waste. The NDEP-approved corrective action alternative for CASs 25-60-01, 25-60-02, 25-62-01, and 26-60-01, is clean closure. Closure activities for these CASs included removing and disposing of soil impacted with total petroleum hydrocarbons-diesel range organics (TPH-DRO), polychlorinated biphenyls (PCBs), semivolatile organic compounds (SVOCs), and cesium (Cs)-137, concrete impacted with TPH-DRO, and associated piping impacted with TPH-DRO. CAU 300 was closed in accordance with the NDEP-approved CAU 300 Corrective Action Plan (CAP) (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2006). The closure activities specified in the CAP were based on the recommendations presented in the CAU 300 Corrective Action Decision Document (NNSA/NSO, 2005). This Closure Report documents CAU 300 closure activities. During closure activities, approximately 40 cubic yards (yd3) of low-level waste consisting of TPH-DRO-, PCB

  11. 76 FR 19795 - Exelon Generation Company, LLC; Oyster Creek Nuclear Generating Station; Exemption

    Science.gov (United States)

    2011-04-08

    ... Manually open 7 Intake. valve (V) V-9- 2099 and V-11-49 and close V-11- 63 and V-11-41. Manually open V- 12...-FZ-6B Office Bldg. Manually open V-9- 7 ``B'' 480V SWGR 2099 and V-11-49 Room Elev. 23'- and close V...) FI-225-2 and close V-15-52. 5 OB-FZ-8A Office Bldg. Manually open V-9- 7 Reactor 2099 and V-11-49...

  12. Changes to the shuttle circuits

    CERN Multimedia

    GS Department

    2011-01-01

    To fit with passengers expectation, there will be some changes to the shuttle circuits as from Monday 10 October. See details on http://cern.ch/ShuttleService (on line on 7 October). Circuit No. 5 is cancelled as circuit No. 1 also stops at Bldg. 33. In order to guarantee shorter travel times, circuit No. 1 will circulate on Meyrin site only and circuit No. 2, with departures from Bldg. 33 and 500, on Prévessin site only. Site Services Section

  13. The influence of selected teacher inputs on students’ academic achievement in the junior secondary school certificate mathematics in Namibia

    Directory of Open Access Journals (Sweden)

    Simon E. Akpo

    2013-12-01

    Full Text Available This study explored the link between teachers’ inputs and students’ academic achievement in the JSC Mathematics for the period 2006 to 2010. One hundred and fifty secondary schools selected from 573 secondary schools in the country constituted the target population. One hundred and sixty-four JSC mathematics teachers from the 150 secondary schools participated in the study, with the final JSC Mathematics results of the students serving as the dependent variable of the study. Mathematics teachers’ input data (academic qualifications, teaching experience and subject specialisation were collected from a questionnaire developed by the researchers. Standard multiple regression was used to analyse the link between teachers’ inputs and students’ academic achievement in JSC Mathematics at P < 0.05and P < 0.10 respectively. The study found that teachers’ academic qualifications and subject specialisation had a significant and positive relationship with students’ academic achievement in JSC Mathematics. Teachers’ gender, however, was not significantly related to students’ academic achievement in JSC Mathematics. This is the first time within the Namibian context that we have empirically demonstrated the link between teachers’ inputs and students’ academic achievement in JSC Mathematics. The study therefore provides support for the policy initiatives that seek to link teachers’ academic qualifications, subject specialisation and teaching experience to employment and classroom allocation.

  14. Study on Utilization of Detoxified Jatropha curcas Seed Cake Subjected to Solid State Fermentation as a Dietary Supplement in Wistar Rats.

    Science.gov (United States)

    Sharath, Belame S; Muthukumar, Sevva P; Somashekar, Devappa

    2017-01-01

    The presence of anti-nutrients and toxins like phorbol esters in Jatropha curcas seed cake (JSC) limits its application in feeds. This study was done to assess the potential of detoxified JSC as rat feed. The rats were fed a diet containing 0-5 and 10% of detoxified fermented JSC for four weeks. For the group I, only casein diet was used in rat feed as a negative control. For the group II, untreated JSC was used in rat feed as a positive control. For the group III, fermented JSC using Saccharomyces cerevisiae MTCC-36 was used. For the group IV, the fermented JSC treated with 65% ethanol to remove the residual toxic phorbol esters was used as rat feed. The rats fed with untreated JSC showed increased levels of serum liver enzymes as an indication of the onset of liver disease resulting in mortality. In this group, rats died in week 2, confirming that the cake is not safe as feed until it is processed. The rats fed with detoxified JSC with 5 and 10% level survived with no adverse effects, and the performance was on par with the control groups, although the body weight was slightly less compared to control. Therefore, it was concluded that the detoxified JSC might be the potential and alternative source of protein in the animal feedstuffs up to 10% level. There are recent patents also suggesting the use of alternative feed supplements in the animal feed applications. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  15. Achieving Workplace Health through Application of Wellness Strategies

    Science.gov (United States)

    Robinson, Judith L.

    2008-01-01

    Purpose: 1) Understand and measure JSC workplace health: a) levels, sources, indicators & effects of negative, work-related stress; b) define leading indicators of emerging issues. 2 Provide linkage to outcomes: a) Focus application of wellness strategies & HR tools; b) Increase quality of work life and productivity. 3) Current effort will result in: a) Online assessment tool; b) Assessment of total JSC population (civil service & contractors); c) Application of mitigation tools and strategies. 4) Product of the JSC Employee Wellness Program. 5) Collaboration with Corporate Health Improvement Program/University of Arizona.

  16. Direct Analysis of JV-Curves Applied to an Outdoor-Degrading CdTe Module (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Jordan, D; Kurtz, S.; Ulbrich, C.; Gerber, A.; Rau, U.

    2014-03-01

    We present the application of a phenomenological four parameter equation to fit and analyze regularly measured current density-voltage JV curves of a CdTe module during 2.5 years of outdoor operation. The parameters are physically meaningful, i.e. the short circuit current density Jsc, open circuit voltage Voc and differential resistances Rsc, and Roc. For the chosen module, the fill factor FF degradation overweighs the degradation of Jsc and Voc. Interestingly, with outdoor exposure, not only the conductance at short circuit, Gsc, increases but also the Gsc(Jsc)-dependence. This is well explained with an increase in voltage dependent charge carrier collection in CdTe.

  17. A Practitioner's Perspective on Taxonomy, Ontology and Findability

    Science.gov (United States)

    Berndt, Sarah

    2011-01-01

    This slide presentation reviews the presenters perspective on developing a taxonomy for JSC to capitalize on the accomplishments of yesterday, while maintaining the flexibility needed for the evolving information of today. A clear vision and scope for the semantic system is integral to its success. The vision for the JSC Taxonomy is to connect information stovepipes to present a unified view for information and knowledge across the Center, across organizations, and across decades. Semantic search at JSC means seamless integration of disparate information sets into a single interface. Ever increasing use, interest, and organizational participation mark successful integration and provide the framework for future application.

  18. National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) summer faculty fellowship program, 1986, Volume 1

    International Nuclear Information System (INIS)

    Mcinnis, B.; Goldstein, S.

    1987-06-01

    The Johnson Space Center (JSC) NASA/ASEE Summer Faculty Fellowship Program was conducted by the University of Houston. The basic objectives of the program are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching objectives of participants' institutions; and (4) to contribute to the research objectives of the NASA Centers. Each faculty fellow spent ten weeks at JSC engaged in a research project commensurate with his interests and background and worked in collaboration with a NASA/JSC colleague. Volume 1 contains sections 1 through 14

  19. Solid Freeform Fabrication Symposium Proceedings Held in Austin, Texas on August 9-11, 1993

    Science.gov (United States)

    1993-09-01

    di Produzione 1611 Headway Circle, Bldg 2 Austin TX 78712 Ed Economia DeirAzienda Austin TX 78754 Corso Duca Abruzzi 24 512 339-2922J fax: 512 339...Street Aeronautical Engineering & Mechanics Ed Economia DellAzienda Tucson AZ 85713 Troy NY 12180 Corso Duca Abruzzi 24 602 792-2616/ fax: 602 792

  20. Change of offices for the FAP Department

    CERN Multimedia

    FAP Department

    2016-01-01

    The FAP Department would like to inform personnel that, due to office renovation work, a number of FAP services currently located on the third floor of building 4 and on the first floor of building 33 will move to temporary offices in building 653 as from late June.   The following services will be relocated to: Accounting services (J. Robinson): FAP-ACC-AP – Accounts Payable, to bldg 653-R-008 – C. Marme FAP-ACC-GA – General Accounting, to bldg 653-1-007 – C. Poncet FAP-ACC-PA – Salary Office, to bldg 653-R-011 – S. Baudat FAP-ACC-PA – Claims, to bldg 653-R-007 – S. Baudat   And the section FAP-TPR-MI - Monitoring and reporting (L. Lockwood) will be located in the office 653-1-016.   The removals will take place from Thursday 30 June until Tuesday 5 July 2016 inclusive and during this period, telephone and e-mail contact may be disrupted. Temporary office number...

  1. 75 FR 45130 - Guidance for Industry and Researchers on the Radioactive Drug Research Committee: Human Research...

    Science.gov (United States)

    2010-08-02

    ... and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 51, rm. 2201, Silver... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2009-D-0125] Guidance for Industry and Researchers on the Radioactive Drug Research Committee: Human Research Without an...

  2. 77 FR 41417 - Regulatory Science Considerations for Medical Countermeasure Radiation Biodosimetry Devices

    Science.gov (United States)

    2012-07-13

    ... scientific and technological challenges for performance validation of radiation biodosimetry devices. Date... participants (non-FDA employees) is through Bldg. 1 where routine security check procedures will be performed... this document. FDA will do its best to accommodate requests to make public comment. Individuals and...

  3. 76 FR 15952 - National Marine Fisheries Service (NMFS), National Oceanic and Atmospheric; Public Meeting

    Science.gov (United States)

    2011-03-22

    ... the data and discuss possible explanations; and (4) identify data gaps and future research.... or as necessary to complete business for the day. The Workshop will reconvene on Wednesday, April 6..., Newport Research Station--Bldg. 955, 2032 S.E. OSU Drive, Newport, OR 97365-5275; telephone: (541) 867...

  4. A Lifting Surface Theory for Wings Experiencing Leading-Edge Separation

    Science.gov (United States)

    1977-06-30

    CSR -CHCRÜ TO SPAN RATIO N-l N’SECIION NO. INDICAIOR FORM SCALES TO KURHALUt E0U»T|CNS Fl • 2.» ALEA /IP|»P| I fi ■ AIFA...Documentation Center Cameron Station, Bldg. 5 Alexandria, VA 22314 12 Nielsen Engineering & Research, Inc. 510 Clyde Avenue Mountain View, CA 94043 1 RASA

  5. 75 FR 13347 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2010-03-19

    ...: 21200130081 Status: Excess Comments: 2024 sq. ft., concrete, poor condition, off-site use only Bldg. 00052... required of contamination, use of respirator required by those entering property, use limitations Illinois... Number: 21199620666 Status: Unutilized Comments: 2000 sq. ft., most recent use--oil storage, needs repair...

  6. 76 FR 19488 - Exelon Generation Company, LLC, Oyster Creek Nuclear Generating Station; Exemption

    Science.gov (United States)

    2011-04-07

    ... origin Area name Actions 1 CW-FA-14 Circulatory Water Intake. Provide makeup control 17 air to the... loss of instrument air. 8 OB-FZ-10A Office Bldg. Monitor and Provide makeup control 18 Change Room Area... due to the loss of instrument air. 10 RB-FZ-1E Reactor Building Elev. Provide makeup control 17 23'-6...

  7. ETT Seminar

    CERN Multimedia

    2002-01-01

    Monday 4 March, at 10h00 - SL Auditorium, Prévessin, bldg. 864 Radioisotopes in Medicine: Requirements, Production and Application by Gerd-J.BEYER / University Hospital of Geneva, Department of Radiology (see details at page 7 of the Weekly Bulletin nr 10/2002).  

  8. Detection of Aberrant Response Patterns and Their Effect on Dimensionality.

    Science.gov (United States)

    1980-04-01

    diagnostic testing system which utilizes network theory for routing examinees through a set of problems In the addition and subtraction of positive...22333 Brooks AFB. TZ 78235 12 Defense Documentation Center Cameron Station, Bldg. 5 COL F. A. Nerone . Director 1 Dr. Marty Ilockwey (AFHRL/TT

  9. Consistency Checking in Hypothesis Generation,

    Science.gov (United States)

    1979-07-01

    In a semantic network model of memory (Col l ins and Loftu s , 1975) , concepts are repr~~ented as nodes inter connected by re lational pathw ays...fornia 90007 Defense Dooinentation Center: C~ neron Stat ion , Bldg . 5 Dr. Kenneth I lain~ondAlexandria , Vi rg ir& a 22314 (i~ c>r ;) Institt~to of

  10. Marine Microbial Production of Dimethylsulfide From Dissolved Dimethylsulfoniopropionate

    Science.gov (United States)

    1993-02-01

    Kirst. 1990. The P3-dimethylsulphonio- propionate (DMSP) content of macroalgae from Antarctica and Southern Chile. Botanica Mar. 33:143-146. 85. Karsten...Oceanography Teaching Bldg. Gifts & Exchanges University of Washington Library Seattle, WA 98195 Bedford Institute of Oceanography Library P.O. Box 1006

  11. 75 FR 50902 - Mancozeb; Pesticide Tolerances

    Science.gov (United States)

    2010-08-18

    ... . Although listed in the index, some information is not publicly available, e.g., Confidential Business... Potomac Yard (South Bldg.), 2777 S. Crystal Dr., Arlington, VA. The Docket Facility is open from 8:30 a.m... Research Project Number 4 (IR-4), 681 US Highway No. 1 South, North Brunswick, NJ 08902-3390. The petitions...

  12. Employee Turnover and Absenteeism: A Future Research Agenda.

    Science.gov (United States)

    1981-08-01

    Department (NMPC-6) Washington, DC 20350 Naval Training Analysis and Evaluation Group Orlando, FL 32813 Commanding Officer ATTN: TIC , Bldg. 2068 Naval...RD-i Washington, DC 20380 Educacion Advisor Education Center (E031) MCDEC Quantico, VA 22134 Commanding Officer Education Center (E031) MCDZC Quantico

  13. 78 FR 45260 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2013-07-26

    ... bldg., good conditions, contact AF for more info. Land New York FAA Radio Communication Link Adjacent... Landholding Agency: Navy Property Number: 77201330005 Status: Excess Comments: Due to anti-terrorism force... Agency: Navy Property Number: 77201330006 Status: Excess Comments: Due to anti-terrorism/force protection...

  14. 77 FR 34056 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2012-06-08

    ....; communication facility; no utilities; possible ground contamination; need repairs and remediation Bldg. 500 Plum...: Unutilized Comments: 3,519 sf.; communication facility; no utilities; possible contamination; needs repairs... denied due to anti- terrorism & no alternative method to gain access w/out comprising nat'l security...

  15. On the Use of a Cumulative Distribution as a Utility Function in Educational or Employment Selection.

    Science.gov (United States)

    1981-02-01

    economic applications. LI In the previous section, we discussed some properties of the TNU function. A GBU with a> 1 and b> 1 has similar characteristics...76/443 1 Dir :ctor, Office of Manpower Utilization Maxwell AFB, AL 36112 HQ, Marine Corps ( MPU ) BCB, Bldg. 2009 1 Dr. Earl A. Alluisi Quantico, VA

  16. 75 FR 36062 - Availability of Conservation Seat and Diving Operations Seat for the Flower Garden Banks National...

    Science.gov (United States)

    2010-06-24

    ... Conservation Seat and Diving Operations Seat for the Flower Garden Banks National Marine Sanctuary Advisory... Flower Garden Banks National Marine Sanctuary Advisory Council: Conservation and Diving Operations... Jennifer Morgan, NOAA--Flower Garden Banks National Marine Sanctuary, 4700 Avenue U, Bldg. 216, Galveston...

  17. Cancer Biotechnology | Center for Cancer Research

    Science.gov (United States)

    Biotechnology advances continue to underscore the need to educate NCI fellows in new methodologies. The Cancer Biotechnology course will be held on the NCI-Frederick campus on January 29, 2016 (Bldg. 549, Main Auditorium) and the course will be repeated on the Bethesda campus on February 9, 2016 (Natcher Balcony C). The latest advances in DNA, protein and image analysis will

  18. Interfon

    CERN Multimedia

    Interfon

    2017-01-01

    Cooperative open to international civil servants. We welcome you to discover the advantages and discounts negotiated with our suppliers either on our website www.interfon.fr accueil or at our information office located at CERN, on the ground floor of bldg. 504, Monday through Friday from 12.30 to 15.30

  19. Interfon

    CERN Multimedia

    Interfon

    2018-01-01

    Cooperative open to international civil servants. We welcome you to discover the advantages and discounts negotiated with our suppliers either on our website www.interfon.fr or at our information office located at CERN, on the ground floor of bldg. 504, open Monday through Friday from 12.30 to 15.30.

  20. Interfon

    CERN Multimedia

    Interfon

    2017-01-01

    Cooperative open to international civil servants. We welcome you to discover the advantages and discounts negotiated with our suppliers either on our website www.interfon.fr or at our information office located at CERN, on the ground floor of bldg. 504, open Monday through Friday from 12.30 to 15.30.

  1. Interfon

    CERN Multimedia

    Interfon

    2017-01-01

    Cooperative open to international civil servants. We welcome you to discover the advantages and discounts negotiated with our suppliers either on our website www.interfon.fr accueil or at our information office located at CERN, on the ground floor of bldg. 504, Monday through Friday from 12.30 to 15.30.

  2. Interfon

    CERN Multimedia

    Interfon

    2017-01-01

    Cooperative open to international civil servants. We welcome you to discover the advantages and discounts negotiated with our suppliers either on our website http://www.interfon.fr/accueil or at our information office located at CERN, on the ground floor of bldg. 504, Monday through Friday from 12.30 to 15.30

  3. 76 FR 25310 - Notice of Intent To Grant a Partially Exclusive Patent License to videoNEXT Network Solutions, Inc.

    Science.gov (United States)

    2011-05-04

    ... place of business at 3852 Dulles South Court, Unit I, Chantilly, VA 20151, a partially exclusive license relative to U.S. Patent No. 7,460,689 B1, issued on Dec. 2, 2008 entitled, ``System and Method of Detecting..., U.S. Army Research Laboratory, Office of Research and Technology Applications, Attn: RDRL-DB/Bldg...

  4. 75 FR 28275 - Homeland Security Science and Technology Advisory Committee

    Science.gov (United States)

    2010-05-20

    ...: The Homeland Security Science and Technology Advisory Committee met on April 20, 2010 from 8:30 a.m... and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410, Washington... for the Under Secretary of Homeland Security for Science and Technology. The Homeland Security Science...

  5. 75 FR 39955 - Homeland Security Science and Technology Advisory Committee

    Science.gov (United States)

    2010-07-13

    ... Homeland Security Science and Technology Advisory Committee meeting will be open to the public on July 20th... Burse, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410... Protection programs in Science & Technology and updates on homeland security sensitive Federally Funded...

  6. 76 FR 8571 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2011-02-14

    .... SUPPLEMENTARY INFORMATION: In accordance with 24 CFR part 581 and section 501 of the Stewart B. McKinney..., off-site use only Bldg. 00001 Property Number: 21200710051 Holy Cross Armory High Cross AK 99602... California Air Force Facility 1 Property Number: 18200830012 OTHB Radar Site Tulelake CA 91634 Status...

  7. 76 FR 5144 - Notice of Intent To Prepare an Environmental Impact Statement for U.S. Navy F-35C West Coast...

    Science.gov (United States)

    2011-01-28

    ... CONTACT: U.S. Navy F-35C West Coast Homebasing EIS Project Manager; Naval Facilities Engineering Command... (from January 28, 2011 through March 14, 2011). All comments will receive the same attention and... Facilities Engineering Command, Southwest (Code EV21/AK); 1220 Pacific Highway, Bldg. 1, San Diego, CA 92132...

  8. 76 FR 18226 - Guidance for Industry on Postmarketing Studies and Clinical Trials-Implementation of Section 505...

    Science.gov (United States)

    2011-04-01

    ... and Development (HFM-40), Center for Biologics Evaluation and Research (CBER), Food and Drug... Drug Information, Center for Drug Evaluation and Research, Food and Drug Administration, 10903 New..., Center for Drug Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 51...

  9. 77 FR 61417 - Guidance for Industry on Acute Bacterial Sinusitis: Developing Drugs for Treatment; Availability

    Science.gov (United States)

    2012-10-09

    ... of Drug Information, Center for Drug Evaluation and Research, Food and Drug Administration, 10903 New..., Center for Drug Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 22... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2007-D-0375...

  10. 78 FR 15955 - Draft Guidance for Industry and Review Staff on Formal Dispute Resolution: Appeals Above the...

    Science.gov (United States)

    2013-03-13

    ... and Development (HFM-40), Center for Biologics Evaluation and Research, Food and Drug Administration... Drug Information, Center for Drug Evaluation and Research, Food and Drug Administration, 10903 New..., Center for Drug Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 22...

  11. 75 FR 60129 - Draft Guidance for Industry and Investigators on Safety Reporting Requirements for...

    Science.gov (United States)

    2010-09-29

    ...., Bldg. 51, rm. 2201, Silver Spring, MD 20993-0002; or the Office of Communication, Outreach, and...'s ability to review critical safety information, improve safety monitoring of human drug and..., will represent the Agency's current thinking on safety reporting requirements for INDs and BA/BE...

  12. 76 FR 41506 - Draft Guidance for Industry and FDA Staff on In Vitro Companion Diagnostic Devices; Availability

    Science.gov (United States)

    2011-07-14

    ...., Bldg. 51, rm. 2201, Silver Spring, MD 20993- 0002, or Office of Communication, Outreach and Development... help make critical treatment decisions. FDA oversight of companion diagnostics will protect patients... current thinking on companion diagnostic devices. It does not create or confer any rights for or on any...

  13. Quantification of Forecasting and Change-Point Detection Methods for Predictive Maintenance

    Science.gov (United States)

    2015-08-19

    University of Tokyo 7-3-1 Hongo , Bunkyo-ku, Ttokyo 113-8645, Japan 3 Air Force Research Laboratory, 2977 Hobson Way, Bldg 653 Rm 427 Wright...AFB OH 45433-7734 *** University of Tokyo 7-3-1 Hongo , Bunkyo-ku, Tokyo 113-8645, Japan Abstract This work investigates the application of the

  14. Conceptual design report for immobilized high-level waste interim storage facility (Phase 1)

    International Nuclear Information System (INIS)

    Burgard, K.C.

    1998-01-01

    The Hanford Site Canister Storage Building (CSB Bldg. 212H) will be utilized to interim store Phase 1 HLW products. Project W-464, Immobilized High-Level Waste Interim Storage, will procure an onsite transportation system and retrofit the CSB to accommodate the Phase 1 HLW products. The Conceptual Design Report establishes the Project W-464 technical and cost basis

  15. 78 FR 63970 - Proposed Collection; Comment Request

    Science.gov (United States)

    2013-10-25

    ... information is necessary for the proper performance of the functions of the agency, including whether the... proposed information collection; (c) ways to enhance the quality, utility, and clarity of the information... Deployment and Distribution Command, 709 Ward Drive, Bldg. 1990, [[Page 63971

  16. Associateship | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Fellowship; Associateship. Associate Profile. Period: 2016–2019. Thapa, Dr Ranjit Ph.D. (Jadavpur). Date of birth: 17 September 1982. Specialization: Density Functional Theory, Metal-free Catalyst, Hydrogen Storage, Catalysis & CO Oxidation Address: SRM Research Institute, 13th Floor, Central Lib. Bldg., SRM ...

  17. 75 FR 60113 - Pesticide Science Policy; Notice of Withdrawal

    Science.gov (United States)

    2010-09-29

    ... anticipates working collaboratively with the European Union, through the European Food Safety Authority (EFSA... Docket in Rm. S-4400, One Potomac Yard (South Bldg.), 2777 S. Crystal Dr., Arlington, VA. The hours of... resulting from single-units (i.e., decomposited results). III. International Interest in Working Together on...

  18. 2006 - 2007 ACADEMIC TRAINING PROGRAMME

    CERN Multimedia

    2006-01-01

    1st Term: 02.10. 2006 - 15.12.2006 LECTURE SERIES Practical statistics for particle physicists by L. Lyons, Univ. Oxford, GB 9, 10, 11, 12, 13 October 11:00 -12:00 - Main Auditorium, Bldg 500 Gravitational waves by M. Landry, LIGO Hanford Observatory, Richland, USA 16, 17, 18 October 11:00-12:00 - Main Auditorium, Bldg 500 Neutrino physics, past and future by B. Kayser, FERMILAB, Batavia, USA 27, 28, 29, 30 November, 1 December 11:00-12:00 - TH Auditorium, Bldg 4, 3rd Floor QCD: are we ready for the LHC by S. Frixione, INFN, Genoa, It 4, 5, 6, 7 December 11:00-12:00 - Auditorium, Bldg 500 The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the CERN bulletin, the WWW, and by Notices before each term and for each series of lectures. ENSEIGNEMENT ACADEMIQUE ACADEMIC TRAINING Françoise Benz 73127 academic.training@cern.ch

  19. 75 FR 14612 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2010-03-26

    ... Reasons: Secured Area Bldg. 3224 Eielson AFB Eielson, AK 99702 Landholding Agency: Air Force Property.... 1437, 1190, 2375 Eielson, AFB Eielson AK Landholding Agency: Air Force Property Number: 18200830001 Status: Unutilized Reasons: Secured Area Extensive deterioration 5 Bldgs. Eielson, AFB Eielson AK...

  20. 75 FR 54236 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2010-09-03

    ...: Secured Area Bldg. 3224 Eielson AFB Eielson AK 99702 Landholding Agency: Air Force Property Number: 18200820002 Status: Unutilized Reasons: Extensive deterioration, Secured Area Bldgs. 1437, 1190, 2375 Eielson AFB Eielson AK Landholding Agency: Air Force Property Number: 18200830001 Status: Unutilized Reasons...

  1. 75 FR 17645 - Polychlorinated Biphenyls (PCBs); Reassessment of Use Authorizations

    Science.gov (United States)

    2010-04-07

    ... Office (DCO), EPA East Bldg., Rm. 6428, 1201 Constitution Ave., NW., Washington, DC. Attention: Docket ID... action or selective metabolism of individual congeners. Noteworthy impacts on fish, birds, and mammals... have taken or planned to take and how these measures will help to safely manage their PCBs. EPA also is...

  2. 77 FR 14411 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2012-03-09

    ... Energy, Office of Engineering & Construction Management, MA-50, 1000 Independence Ave. SW., Washington... Landholding Agency: Air Force Property Number: 18201210016 Status: Underutilized Directions: 1076 Jack's...: 1077 Jack's Valley Rd. Comments: 512 sq. ft.; current use: vacant; bldg. has no heat Kitchen Center...

  3. EDITORIAL PSYCHIATRIC ILLNESS AMONG JUVENILES AND ...

    African Journals Online (AJOL)

    Kateee

    2003-06-01

    Jun 1, 2003 ... Bickel, R. and Campbell, A. Mental health of adolescents in custody: ... aged 8 to 18 years classified as criminal offenders, group I (60), and those for protection ... with poor socio-economic support (15). ..... Chief Residents' Office, The Miriam Hospital, 164 Summit Ave., Main Bldg, Room 344 Providence, RI.

  4. 75 FR 4401 - Guidance for Industry on the Use of Mechanical Calibration of Dissolution Apparatus 1 and 2...

    Science.gov (United States)

    2010-01-27

    ... Hampshire Ave., Bldg. 51, rm. 2201, Silver Spring, MD 20993-0002. Send one self-addressed adhesive label to... verification test (PVT) using USP Reference Standard tablets. In the Federal Register of October 19, 2007 (72... ``Performance Verification Test, Apparatus 1 and 2.'' In making these revisions, USP has explicitly stated...

  5. 76 FR 79173 - Registration Review; Pesticide Dockets Opened for Review and Comment, and Notice of Availability...

    Science.gov (United States)

    2011-12-21

    ... placed on the Internet and will be publicly available only in hard copy form. Publicly available docket... available in hard copy, at the OPP Regulatory Public Docket in Rm. S-4400, One Potomac Yard (South Bldg.... Section 3(g) of FIFRA provides, among other things, that the registrations of pesticides are to be...

  6. 76 FR 60822 - Registration Review; Pesticide Dockets Opened for Review and Comment and Other Docket Actions

    Science.gov (United States)

    2011-09-30

    ... placed on the Internet and will be publicly available only in hard copy form. Publicly available docket... available in hard copy, at the OPP Regulatory Public Docket in Rm. S-4400, One Potomac Yard (South Bldg... 155, subpart C. Section 3(g) of FIFRA provides, among other things, that the registrations of...

  7. 76 FR 39399 - Chlorpyrifos Registration Review; Preliminary Human Health Risk Assessment; Notice of Availability

    Science.gov (United States)

    2011-07-06

    ... placed on the Internet and will be publicly available only in hard copy form. Publicly available docket... available in hard copy, at the OPP Regulatory Public Docket in Rm. S-4400, One Potomac Yard (South Bldg... 40 CFR part 155, subpart C. Section 3(g) of FIFRA provides, among other things, that the...

  8. 76 FR 23324 - Endocrinologic and Metabolic Drugs Advisory Committee; Notice of Meeting

    Science.gov (United States)

    2011-04-26

    ... for Drug Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 31, rm... Cardiovascular Risk in Diabetes-Lipid (ACCORD Lipid) trial as they relate to the efficacy and safety of the... cholesterol goal. The ACCORD Lipid study was a randomized, double-blind, placebo- controlled add-on trial...

  9. Disaster Analysis: Police and Fire Departments. Phase 2.

    Science.gov (United States)

    1989-03-01

    and G. 0. W. Mueller (eds.) Politics, Crime, and the International Scene: A Focus. San Juan : North-South Center Press. Caplow, T., H. Bahr, and B...20550 Gelman Bldg. #714 George Washington University John Christiansen Washington, DC 20052 Dept. of Sociology 834 SWKT George Rogers Brigham Young

  10. Test Procedure - pumping system for caustic addition project

    International Nuclear Information System (INIS)

    Leshikar, G.A.

    1994-01-01

    This test procedure provides the requirements for sub-system testing and integrated operational testing of the submersible mixer pump and caustic addition equipment by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E)

  11. ACADEMIC TRAINING

    CERN Multimedia

    Françoise Benz

    2002-01-01

    12, 13, 14, March LECTURE SERIES from 11.00 to 12.00 hrs - Auditorium, bldg. 500 POSTPONED! - Modern Project Management Methods - POSTPONED! By G. Vallet / Ed. Highware, Paris, F. Academic Training Françoise Benz Secretariat Tel. 73127 francoise.benz@cern.ch

  12. FERMI: A Flexible Expert Reasoner with Multi-Domain Inferencing.

    Science.gov (United States)

    1985-07-29

    for Life Sciences University of Leyden AFOSR Education Research Center Boiling AFB Boerhaavelaan 2 Washington. DC 20032-6448 2334 EN Leyden The... Kathleen McKeown Columbia University Dr. Michael Levine Department of Computer Science Educational Psychology New York, NY 10027 210 Education Bldg

  13. Academic Training: The cosmic microwave background - Lecture series

    CERN Multimedia

    Françoise Benz

    2004-01-01

    ACADEMIC TRAINING LECTURE REGULAR PROGRAMME 14, 15, 16, 17 and 18 June From 11:00 hrs to 12:00 hrs - Main Auditorium bldg. 500 The cosmic microwave background M. Zaldarriaga / Harvard University, USA ENSEIGNEMENT ACADEMIQUE ACADEMIC TRAINING Françoise Benz 73127 academic.training@cern.ch

  14. 75 FR 10347 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2010-03-05

    ... plan, existing sanitary facilities, exact street address), providers should contact the appropriate... story stone structure, no sanitary or heating facilities, Natl Register of Historic Places Bldg. 10 VA..., State Hwy 52 Celina Co: Clay TN 38551 Landholding Agency: COE Property Number: 31199140006 Status...

  15. 78 FR 48173 - Guidance for Industry on Oversight of Clinical Investigations-A Risk-Based Approach to Monitoring...

    Science.gov (United States)

    2013-08-07

    ... 200N, Rockville, MD 20852-1448; or the Office of Communication and Education, Division of Small... Administration, 10903 New Hampshire Ave., Bldg. 66, Rm. 4613, Silver Spring, MD 20993-0002. Send one self... to http://www.regulations.gov . Submit written comments to the Division of Dockets Management (HFA...

  16. Disruption of Methicillin-resistant Staphylococcus aureus Biofilms with Enzymatic Therapeutics

    Science.gov (United States)

    2015-04-29

    cultures grown in 50% plasma appeared to form gelatinous clots in the media (data not shown), suggesting FOR OFFICIAL USE ONLY 11 bacteria...Bldg. 500 Silver Spring, MD 20910 10. SPONSOR/MONITOR’S ACRONYM(S) BUMED 11. SPONSOR/MONITOR’S REPORT NUMBER(s) 12. DISTRIBUTION

  17. Views of STS-4 crew during a training session in the SMS

    Science.gov (United States)

    1982-01-01

    Views of STS-4 crew during a training session in the Shuttle Mission Simulator (SMS) in bldg 5. Astronauts Thomas K. Mattingly, II. (left) and Henry W. Hartsfield, Jr., commander and pilot respectively for STS-4 get in some training time in the SMS.

  18. 78 FR 34398 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2013-06-07

    .... vacant; very poor conditions; contact Interior for more details Montana Abbott Bay Toilet [[Page 34400... Comments: 768 sf; plant genetics lab; good condition; located in NM State University. New York Building 240... Status: Excess GSA Number: ny0938 Comments: 134,855 sf; military office & lab bldg.; 10 plus years vacant...

  19. 77 FR 16039 - Abbott Laboratories et al.; Withdrawal of Approval of 35 New Drug Applications and 64 Abbreviated...

    Science.gov (United States)

    2012-03-19

    ...] Abbott Laboratories et al.; Withdrawal of Approval of 35 New Drug Applications and 64 Abbreviated New... Tablets... Abbott Laboratories, PA77/Bldg. AP30-1E, 200 Abbott Park Rd., Abbott Park, IL 60064-6157. NDA... (diphenhydramine Healthcare. HCl)) Injection Preservative Free. NDA 010021 Placidyl Abbott Laboratories...

  20. Commercial Maritime Information: A Critical Appraisal.

    Science.gov (United States)

    1981-01-01

    Arthur Howard, Chief Inspector U.S. Customs Service, 555 Battery Street, San Francisco, CA 94111 Peter Mel Hughes , Traffic Manager, Port of Richmond...832, Federal Bldg. 10-A, Washington, DC 20591 Perla Londers, Trans-America Realco, 175 W. Jackman Blvd., Chicago, IL 60604 Edward M. MacCutcheon

  1. Ion Acoustic Microscopy

    Science.gov (United States)

    1985-07-01

    Thermal and Related Sciences, L’ Esterel, Quebec (1985), to be published in Can. J. Phys.; H. I. Ringermacher and L. Jackman , "Deep Thermoacoustic Imaging...Research System Bldg. 860 Vandenburg AFB, CA 93437 Dr. Robert V. Ieth, Chief Scientist Div. 76 Hughes Aircraft P.O. Box 902 El Segundo, CA 90245 Dr. Thomas

  2. 77 FR 31858 - Draft Guidance for Industry on Pathologic Complete Response in Neoadjuvant Treatment of High-Risk...

    Science.gov (United States)

    2012-05-30

    ... of the drug. This draft guidance is intended to assist applicants in designing trials to support...., Bldg. 51, Rm. 2201, Silver Spring, MD 20993-0002. Send one self-addressed adhesive label to assist that... Administration, 5630 Fishers Lane, Rm. 1061, Rockville, MD 20852. FOR FURTHER INFORMATION CONTACT: Tatiana...

  3. Academic Training: Climate change and challenges for the environment / POSTPONED!!!

    CERN Multimedia

    Françoise Benz

    2005-01-01

    2004-2005 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 20, 21, 22 June 20, 21, 22 June, from 11:00 to 12:00 – Main Auditorium, bldg. 500 Climate change and challenges for the environment C. SCHLUECHTER / Univ. Bern, CH The Academic Training is postponed.

  4. 77 FR 26566 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2012-05-04

    ....; vacant; poor conditions; need repairs; asbestos & lead; remediation needed; secured area; contact Army re...; usage varies; need repairs; lead and asbestos identified; need remediation Maryland Bldg. 724B Aberdeen...; asbestos & lead identified; need remediation Utah 4 Bldgs. Tooele Army Depot Tooele UT 84074 Landholding...

  5. The Effects of Corona on Current Surges Induced on Conducting Lines by EMP (Electromagnetic Pulse): A Comparison of Experiment Data with Results of Analytic Corona Models

    Science.gov (United States)

    1987-09-01

    196. M. Schechter, A.D.A., P. 0. Box 2250 (81), Haifa, 31021, ISRAEL 197. D. Serafin, Cente d’Etudes de Gramat , 46500 Gramst, FRANCE 198. Peter Sevat...Managing Director, GERAC, B.P. 19 - 46500 Gramat FRANCE 202. Carol Smeerdon, Royal Aircraft Establishment, Flight Systems, BLdg. Q153, Farnborough

  6. Conceptual design report for immobilized high-level waste interim storage facility (Phase 1)

    Energy Technology Data Exchange (ETDEWEB)

    Burgard, K.C.

    1998-04-09

    The Hanford Site Canister Storage Building (CSB Bldg. 212H) will be utilized to interim store Phase 1 HLW products. Project W-464, Immobilized High-Level Waste Interim Storage, will procure an onsite transportation system and retrofit the CSB to accommodate the Phase 1 HLW products. The Conceptual Design Report establishes the Project W-464 technical and cost basis.

  7. The Structure of Analogical Models in Science.

    Science.gov (United States)

    1980-07-01

    mapping M of the nodes b1 , b2 ,...,bn of system B into the (different) nodes t1, t2,...,tm of system T. (2) The mapping is such that substantial parts... Rugby Avenue Livingstone Road Bethesda, MD 20014 Stratford London E15 2LJ 1 Dr. A. J. Eschenbrenner ENGLAND Dept. E422, Bldg. 81 McDonnell Douglas

  8. Astronaut Neil Armstrong participates in lunar surface siumlation training

    Science.gov (United States)

    1969-01-01

    Suited Astronaut Neil A. Armstrong, wearing an Extravehicular Mobility Unit, participates in lunar surface simulation training on April 18, 1969, in bldg 9, Manned Spacecraft Center (MSC). Armstrong is the prime crew commander of the Apollo 11 lunar landing mission. Here, he simulates scooping up a lunar surface sample.

  9. Astronaut Neil Armstrong participates in lunar surface simulation training

    Science.gov (United States)

    1969-01-01

    Astronaut Neil A. Armstrong, wearing an Extravehicular Mobility Unit (EMU), participates in lunar surface simulation training on April 18, 1969 in bldg 9, Manned Spacecraft Center. Armstrong is the prime crew commander of the Apollo 11 lunar landing mission. Here, he is standing on Lunar Module mockup foot pad preparing to ascend steps.

  10. 75 FR 29431 - Coat Protein of Plum Pox Virus; Exemption from the Requirement of a Tolerance

    Science.gov (United States)

    2010-05-26

    ... Office of Pesticide Programs (OPP) Regulatory Public Docket in Rm. S-4400, One Potomac Yard (South Bldg..., please submit a copy of the filing that does not contain any CBI for inclusion in the public docket... Chile, have, to the knowledge of EPA, experienced hypersensitivity or other adverse effects. Therefore...

  11. ACADEMIC TRAINING LECTURE SERIES: Introduction to General Relativity and Black Holes

    CERN Multimedia

    2003-01-01

    10, 11, 12, 13, 14 February ACADEMIC TRAINING LECTURE SERIES from 11.00 to 12.00 hrs - Auditorium, bldg. 500 Introduction to General Relativity and Black Holes by T.DAMOUR, IHES, Bures-sur-Yvette, F - Physical motivation behind Einstein's theory. - Mathematical formalism of General Relativity. - Experimental confirmations of Einstein's theory. - Introduction to Black Holes physics.

  12. Dollar Summary of Federal Supply Classification and Service Category by Company, FY83, Part 6 (W061-Z299).

    Science.gov (United States)

    1983-01-01

    RENT OF FAC /FUEL SUPPLY 29 X299 AUTO TECHNIQUE BELGIQUE S A BELGIUM ARMY LEASE-RENT OF FAC /OTHER NON-BLDG STRUCT 31 HOFFMAN CO VIRGINIA ARMY LEASE...HARRISON & PALMI RIDGE ELECTRICAL E INC MISSOURI ARMY CONSTR: CONSTRUCTION/PARFING FACILITIES $ 123 SUSSEX ELECTRICO C MARYLAND ARMY CONSTR: CONSTRUCTION

  13. Energy Assessment at Army Installations in Germany: Campbell Barracks - Heidelberg, Coleman Barracks - Manheim, Katterbach Barracks - Ansbach, Storch Barracks - Illesheim, and U.S. Depot - Germersheim

    Science.gov (United States)

    2009-06-01

    report are not to be used for advertising , publication, or promotional purposes. Citation of trade names does not constitute an official endorsement or... Locations where the energy assessments were done..........................................................23 22 Grid feed-in in different locations ...113 75 Positioning of modules in an open space – PV-system ......................................................113 76 Large door at old Nike Bldg

  14. 21 CFR 5.1110 - FDA public information offices.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false FDA public information offices. 5.1110 Section 5.1110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL...) Press Relations Staff. Press offices are located in White Oak Bldg. 1, 10903 New Hampshire Ave., Silver...

  15. 78 FR 30317 - Science Board to the Food and Drug Administration; Notice of Meeting

    Science.gov (United States)

    2013-05-22

    ... 24, 2013, from approximately 1 p.m. to 3:45 p.m. Location: Food and Drug Administration, White Oak..., Office of the Chief Scientist, Office of the Commissioner, Food and Drug Administration, White Oak Bldg... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration [Docket No. FDA-2013-N-0001...

  16. 75 FR 6997 - Federal Property Suitable as Facilities To Assist the Homeless

    Science.gov (United States)

    2010-02-12

    ... 22202; (703) 601-2545; Corps of Engineers: Scott Whiteford, Director of Real Estate, CEMP-CR, 441 G... Comments: 44,352 sq. ft., needs rehab, most recent use--chemistry lab, off-site use only Bldg. E3335...

  17. 77 FR 20574 - Notice of Meeting for the Indian Oil Valuation Negotiated Rulemaking Committee

    Science.gov (United States)

    2012-04-05

    ... representatives from Indian Tribes, individual Indian mineral owner organizations, the oil and gas industry, and... Federal Center, 6th Ave and Kipling, Bldg. 85 Auditorium, Lakewood, Colorado 80225. FOR FURTHER... Lakewood, Colorado. These meetings are conducted under the authority of the Federal Advisory Committee Act...

  18. 75 FR 59610 - Implantation and Injectable Dosage Form New Animal Drugs; Firocoxib

    Science.gov (United States)

    2010-09-28

    ...) filed by Merial Ltd. The NADA provides for the veterinary prescription use of firocoxib injectable... Veterinary Medicine (HFV-110), Food and Drug Administration, 7500 Standish Pl., Rockville, MD 20855, 240-276...., Bldg. 500, Duluth, GA 30096-4640 filed NADA 141-313 that provides for veterinary prescription use of...

  19. 78 FR 14803 - Ag-Mark, Inc., et al.; Withdrawal of Approval of New Animal Drug Applications

    Science.gov (United States)

    2013-03-07

    ... the legal status of the drug products. Therefore, the Director, Center for Veterinary Medicine, is... Veterinary Medicine (HFV-212), Food and Drug Administration, 7519 Standish Pl., Rockville, MD 20855, 240-453... Pharmaceuticals, LLC, Bldg. 31, 24 Olney Ave., Cherry Hill, NJ 08034. The Director, Center for Veterinary Medicine...

  20. Advanced Modeling Tools for Controlling Complex Assets Across Time Delay, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — The proposed innovation is a hybrid simulation module to replace the current "Behavioral Sim" in JSC's Predictive Interactive Graphical Interface (PIGI). PIGI helps...

  1. Autonomous Operations Design Guidelines for Flight Hardware

    Data.gov (United States)

    National Aeronautics and Space Administration — SSC experimentally modified an autonomous operations flexible system suite developed for a ground application for a flight system under development by JSC. The...

  2. Sensorimotor Displays and Controls to Enhance the Safety of Human/Machine Cooperation During Lunar Landing

    Data.gov (United States)

    National Aeronautics and Space Administration — In the previous year, we have performed three separate experiments. At NASA JSC, the tilt-translation sled (TTS) was used to study the effect of our advanced...

  3. Astronaut Dale Gardner rehearses control of MMU during EVA practice

    Science.gov (United States)

    1984-01-01

    Astronaut Dale A. Gardner, 51-A mission specialist, rehearses control of manned maneuvering unit (MMU) during a practice for an extravehicular activity (EVA). Gardner is in the Shuttle mockup and integration laboratory at JSC.

  4. Sensors and Systems for Spacesuits

    Science.gov (United States)

    Chullen, Cinda

    2017-01-01

    An AdvancedExtravehicular Mobility Unit (EMU) is being developed and tested in house at JSC. Multiple programs over the last decade have contributed to the success thus far including the SBIR/STTR program.

  5. A jumping spark counter for various applications; rapid determination of its counting parameters

    International Nuclear Information System (INIS)

    Varnagy, M.; Vasvary, L.; Gyarmati, E.; Juhasz, S.; Scharbert, T.; Sztaricskai, T.

    1977-01-01

    On the basis of the method proposed by Cross and Tommasino a jumping spark counter (JSC) has been constructed which is applicable for the counting (continuously or 'step by step') of the perforations in thin (5-20μm) polymer foils. The JSC was combined with a DIDAC 4000 multichannel pulse-height analyser and multiscaler to determine automatically the best parameters and procedures for spark counting as well as to study the working mechanism of the JSC. Investigations were performed on etched Markrofol GK foils irradiated with fission fragments and exposed to 0.35 MRad gamma-rays. The track density interval studies was 0-50000 tracks/cm 2 . The possibility of the adoption of JSC for neutron dosimetric application, evaluation of angular distribution and for safegaurd purposes was tested. The possible consequences of the results are discussed. (Auth.)

  6. 75 FR 61777 - Notice of Information Collection

    Science.gov (United States)

    2010-10-06

    ... employees. This information is collected from public citizens (landlords) in and around the JSC area, who may have rooms, residences, or apartments available for rent by the co-ops and interns. Contact...

  7. Resin Infusion Rigidized Inflatable Concept Development and Demonstration

    Data.gov (United States)

    National Aeronautics and Space Administration — A novel concept utilizing resin infusion to rigidize inflatable structures was developed at JSC ES. This ICA project intends to complete manufacturing of a prototype...

  8. Earth/Mars Landing Impact Attenuation Using Foam

    Data.gov (United States)

    National Aeronautics and Space Administration — Used results from extensive foam testing performed on a previous JSC Innovation Charge Account (ICA) project to develop material models in MSC/Marc commercial finite...

  9. NASA Johnson Space Center Aircraft Operations Division

    Science.gov (United States)

    Bakalyar, John A.

    2018-01-01

    This presentation provides a high-level overview of JSC aircraft and missions. The capabilities, including previous missions and support team, for the Super Guppy Transport (SGT) aircraft are highlighted.

  10. Predicting Students' Performance in the Senior Secondary ...

    African Journals Online (AJOL)

    cce

    correlation design. ... the JSC examinations were a good predictor of performance at SSC ..... Table 12: Effects of the Independent Variables (JSCE 2000) on the .... JAMB Brochure, Abuja: Joint Admissions and Matriculation Examinations, 2-3.

  11. CONTROLLING AS A MECHANISM TO INCREASE THE EFFICIENCY OF MANAGEMENT ENTERPRISES OF FUEL-ENERGY COMPLEX

    Directory of Open Access Journals (Sweden)

    M. A. Ostashkin

    2013-01-01

    Full Text Available This article discusses the possibility of application of controlling as mechanism of increasing the efficiency of management of enterprises of fuel- energy complex. The research was conducted on the materials of the JSC «Gazprom».

  12. Planning Related to the Curation and Processing of Returned Martian Samples

    Science.gov (United States)

    McCubbin, F. M.; Harrington, A. D.

    2018-04-01

    Many of the planning activities in the NASA Astromaterials Acquisition and Curation Office at JSC are centered around Mars Sample Return. The importance of contamination knowledge and the benefits of a mobile/modular receiving facility are discussed.

  13. High Efficiency Refrigeration Process, Phase II

    Data.gov (United States)

    National Aeronautics and Space Administration — It has been proposed by NASA JSC studies, that the most mass efficient (non-nuclear) method of Lunar habitat cooling is via photovoltaic (PV) direct vapor...

  14. Astronauts and cosmonauts during emergency bailout training session

    Science.gov (United States)

    1994-01-01

    Using small life rafts, several cosmonauts and astronauts participating in joint Russia - United States space missions take part in an emergency bailout training session in the JSC Weightless Environment Training Facility (WETF) 25-feet-deep pool. In the

  15. Targeting Absolute Salinity for Earth and Space

    Data.gov (United States)

    National Aeronautics and Space Administration — As part of a grant through a NASA Johnson Space Center (JSC) 2011 Innovation Charge Account (ICA), a novel optical sensor was developed and early feasibility...

  16. National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1989, volume 2

    Science.gov (United States)

    Jones, William B., Jr. (Editor); Goldstein, Stanley H. (Editor)

    1989-01-01

    The 1989 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by Texas A and M University and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers.

  17. National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1998. Volume 1

    Science.gov (United States)

    Bannerot, Richard B. (Editor); Sickorez, Donn G. (Editor)

    1999-01-01

    JSC NASA/ASEE Summer Faculty Fellowship Program was conducted by the University of Houston and JSC, under ASEE. The objectives of the program are to further the professional knowledge of qualified engineering and science members; stimulate an exchange of ideas between participants and NASA; enrich and refresh the research and teaching activities of participants; and contribute to the research objectives of the NASA Centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project commensurate with his/her interests and background and worked in collaboration with a NASA/JSC colleague. This document is a compilation of the final reports on the fellows' research projects performed during the summer of 1998. Volume 1, current volume, contains the first reports, and volume 2 contains the remaining reports.

  18. National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1989, volume 1

    Science.gov (United States)

    Jones, William B., Jr. (Editor); Goldstein, Stanley H. (Editor)

    1989-01-01

    The 1989 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by Texas A and M University and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers.

  19. National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program 1988, volume 1

    Science.gov (United States)

    Bannerot, Richard B. (Editor); Goldstein, Stanley H. (Editor)

    1989-01-01

    The 1988 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began in 1965 at JSC and in 1964 nationally, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objectives of the NASA Centers.

  20. National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1992, volume 2

    Science.gov (United States)

    Bannerot, Richard B. (Editor); Goldstein, Stanley H. (Editor)

    1992-01-01

    The 1992 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters Washington, DC. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers. This document contains reports 13 through 24.

  1. National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1992, volume 1

    Science.gov (United States)

    Bannerot, Richard B. (Editor); Goldstein, Stanley H. (Editor)

    1992-01-01

    The 1992 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, Washington, DC. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers. This document is a compilation of the final reports 1 through 12.

  2. Developing Tools and Techniques to Increase Communication Effectiveness

    Science.gov (United States)

    Hayes, Linda A.; Peterson, Doug

    1997-01-01

    The Public Affairs Office (PAO) of the Johnson Space Center (JSC) is responsible for communicating current JSC Space Program activities as well as goals and objectives to the American Public. As part of the 1996 Strategic Communications Plan, a review of PAO' s current communication procedures was conducted. The 1996 Summer Faculty Fellow performed research activities to support this effort by reviewing current research concerning NASA/JSC's customers' perceptions and interests, developing communications tools which enable PAO to more effectively inform JSC customers about the Space Program, and proposing a process for developing and using consistent messages throughout PAO. Note that this research does not attempt to change or influence customer perceptions or interests but, instead, incorporates current customer interests into PAO's communication process.

  3. STS-71 astronauts and cosmonauts during egress training

    Science.gov (United States)

    1994-01-01

    Astronaut Robert L. Gibson (arms folded, near center) STS-71 mission commander, joins several crew mates during a briefing preceding emergency egress training in the Systems Integration Facility at JSC. Astronauts Bonnie J. Dunbar and Gregory J. Harbaugh

  4. STS-71 astronauts before egress training

    Science.gov (United States)

    1994-01-01

    Astronaut Robert L. Gibson (left), STS-71 mission commander, converses with two crew mates prior to emergency egress training in the Systems Integration Facility at JSC. Astronaut Bonnie J. Dunbar and Gregory J. Harbaugh are attired in training versions o

  5. Astronauts Allen and Gemar during extravehicular activity (EVA) training in CCT

    Science.gov (United States)

    1994-01-01

    Astronauts Charles D. (Sam) Gemar, and Andrew M. Allen participate in a training exercise at JSC's Crew Compartment Trainer (CCT), located in the Space Vehicle Mockup Facility. Gemar sits inside the airlock as Allen reviews procedures for EVA.

  6. Assimilating Thor: How Airmen Integrate Weather Prediction

    Science.gov (United States)

    2010-06-01

    President Thomas Jefferson, recorded weather observations on his trek across the Continental Divide to the Pacific and back from 1804 to 1806. 13 Army...Vanguard: A History, The NASA Historical Series no. SP-4202 (Washington, D.C.: National Aeronautics and Space Administration, 1970), also available online...still fly with NASA , http://jsc-aircraft- ops.jsc.nasa.gov/wb57/history.html (accessed 30 March 2010). 52 Brandli, ―The Use of Meteorological

  7. High performance computing in science and engineering '09: transactions of the High Performance Computing Center, Stuttgart (HLRS) 2009

    National Research Council Canada - National Science Library

    Nagel, Wolfgang E; Kröner, Dietmar; Resch, Michael

    2010-01-01

    ...), NIC/JSC (J¨ u lich), and LRZ (Munich). As part of that strategic initiative, in May 2009 already NIC/JSC has installed the first phase of the GCS HPC Tier-0 resources, an IBM Blue Gene/P with roughly 300.000 Cores, this time in J¨ u lich, With that, the GCS provides the most powerful high-performance computing infrastructure in Europe alread...

  8. Apollo Lunar Sample Photographs: Digitizing the Moon Rock Collection

    Science.gov (United States)

    Lofgren, Gary E.; Todd, Nancy S.; Runco, S. K.; Stefanov, W. L.

    2011-01-01

    The Acquisition and Curation Office at JSC has undertaken a 4-year data restoration project effort for the lunar science community funded by the LASER program (Lunar Advanced Science and Exploration Research) to digitize photographs of the Apollo lunar rock samples and create high resolution digital images. These sample photographs are not easily accessible outside of JSC, and currently exist only on degradable film in the Curation Data Storage Facility

  9. Structural vascular disease in Africans: performance of ethnic-specific waist circumference cut points using logistic regression and neural network analyses: the SABPA study

    OpenAIRE

    Botha, J.; De Ridder, J.H.; Potgieter, J.C.; Steyn, H.S.; Malan, L.

    2013-01-01

    A recently proposed model for waist circumference cut points (RPWC), driven by increased blood pressure, was demonstrated in an African population. We therefore aimed to validate the RPWC by comparing the RPWC and the Joint Statement Consensus (JSC) models via Logistic Regression (LR) and Neural Networks (NN) analyses. Urban African gender groups (N=171) were stratified according to the JSC and RPWC cut point models. Ultrasound carotid intima media thickness (CIMT), blood pressure (BP) and fa...

  10. Astronaut John Grunsfeld during EVA training in the WETF

    Science.gov (United States)

    1995-01-01

    Astronaut John M. Grunsfeld, STS-67 mission specialist, gives a salute as he is about to be submerged in a 25-feet deep pool in JSC's Weightless Environment Training Facility (WETF). Wearing a special training version of the Extravehicular Mobility Unit (EMU) space suit and assisted by several JSC SCUBA-equipped divers, Grunsfeld was later using the pool to rehearse contingency space walk chores.

  11. National Aeronautics and Space Administration (NASA)/American Society of Engineering Education (ASEE) Summer Faculty Fellowship Program - 2000

    Science.gov (United States)

    Bannerot, Richard B. (Editor); Sickorez, Donn G. (Editor)

    2003-01-01

    The 2000 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began in 1965 at JSC and 1964 nationally, are to (1) further the professional knowledge of qualified engineering and science faculty, (2) stimulate an exchange of ideas between participants and NASA, (3) enrich and refresh the research and teaching activities of participants' institutions, and (4) contribute to the research objectives of the NASA Centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project commensurate with her/his interests and background, and worked in collabroation with a NASA/JSC colleague. This document is a compilation of the final reports on the research projects done by the faculty fellows during the summer of 2000.

  12. National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program: 1995.. Volume 2

    Science.gov (United States)

    Hyman, William A. (Editor); Sickorez, Donn G. (Editor)

    1996-01-01

    The JSC NASA/ASEE Summer Faculty Fellowship Program was conducted at JSC, including the White Sands Test Facility, by Texas A&M University and JSC. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of the participants' institutions; and (4) to contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA/JSC colleague. In addition to the faculty participants, the 1995 program included five students. This document is a compilation of the final reports on the research projects completed by the faculty fellows and visiting students during the summer of 1995. The reports of two of the students are integral with that of the respective fellow. Three students wrote separate reports.

  13. 2007-2008 ACADEMIC TRAINING PROGRAMME

    CERN Multimedia

    2008-01-01

    LECTURE SERIES 10 & 11 March 2008 10 March 2008, 11:00-12:00 - Main Auditorium, bldg. 500-1 11 March 2008, 11:00-12:00, 14:00-15:00 - Main Auditorium, bldg. 500-1 Warped Extra-Dimensional Opportunities and Signatures Prof. Lisa RANDALL, Harvard University, USA I plan to discuss ways of searching for warped geometry and other extra-dimensional scenarios, with emphasis on the general lessons for search strategies. We will consider RS geometry on the brane and in the bulk, as well as possible black hole or quantum gravity signatures. If time permits, we will also consider fermion masses and/or precision Higgs measurements.

  14. 2002 - 2003 ACADEMIC TRAINING PROGRAMME

    CERN Multimedia

    Françoise Benz

    2002-01-01

    1st TERM : November - December 2002   LECTURE SERIES FOR POSTGRADUATE STUDENTS 18, 19, 20, 21, 22 November 2002 Telling the Truth with Statistics by R. Barlow / Univ. of Manchester, UK 11:00-12:00 - Auditorium, bldg. 500     REGULAR LECTURE PROGRAMME 2, 3, 4, 5 December 2002 Introduction to String Theory by W. Lerche / CERN-TH 11:00-12:00 - Auditorium, bldg. 500 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the CERN bulletin, the WWW, and by Notices before each term and for each series of lectures. Françoise Benz Tel. 73127 francoise.benz@cern.ch

  15. Information for pensioners

    CERN Document Server

    Ph. Bernard

    2004-01-01

    Dear Colleagues, Many of you have accepted the Director-General's invitation to the fête on October 15. We are very pleased to be able to welcome all those who have replied to this invitation. The meeting will take place in the Main Auditorium and will be transmitted by television to the Council Chamber and to the four meeting rooms of bldg. 40 (40-S2-A01, 40-S2-B01, 40-SS-C01, 40-SS-D01). It will start promptly at 9 a.m. and we ask you to come very early so that all may find their seats in the various rooms. The reception offered by the Director-General will take place in bldg. 40 at around 12 o'clock. Ph. Bernard Chairman, GAC Committee

  16. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    21, 22, 23 November LECTURES FOR POSTGRADUATE STUDENTS From 11:00 hrs - Council Chamber bldg. 503 on 21 November Auditorium, bldg 500 on 22, 23 November Introduction to symmetry breaking phenomena in physics E. Brezin / ENS, Paris, F. The notion of broken symmetries started slowly to emerge in the 19th century. The early studies of Pasteur on the parity asymmetry of life, the studies of Curie on piezoelectricity and on the symmetries of effects versus the symmetry of causes (which clearly excluded spontaneous symmetry breaking), are important historical landmarks. However the possibility of spontaneous symmetry breaking within the usual principles of statistical mechanics, waited for the work of Peierls and Onsager. The whole theory of phase transitions and critical phenomena, as well as the construction of field theoretic models as long distance limit of yet unknown physics, relies nowadays on the concept of criticality associated to spontaneous symmetry breaking. The phenomena of Goldstone bosons, of Meissn...

  17. ACADEMIC TRAINING

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    21, 22, 23 November LECTURES FOR POSTGRADUATE STUDENTS From 11:00 hrs - Council Chamber bldg. 503 on 21 November Auditorium, bldg 500 on 22, 23 November Introduction to symmetry breaking phenomena in physics E. Brezin / ENS, Paris, F. The notion of broken symmetries started slowly to emerge in the 19th century. The early studies of Pasteur on the parity asymmetry of life, the studies of Curie on piezoelectricity and on the symmetries of effects versus the symmetry of causes (which clearly excluded spontaneous symmetry breaking), are important historical landmarks. However the possibility of spontaneous symmetry breaking within the usual principles of statistical mechanics, waited for the work of Peierls and Onsager. The whole theory of phase transitions and critical phenomena, as well as the construction of field theoretic models as long distance limit of yet unknown physics, relies nowadays on the concept of criticality associated to spontaneous symmetry breaking. The phenomena of Goldstone bosons, of Meissn...

  18. ACADEMIC TRAINING

    CERN Multimedia

    Françoise Benz

    2002-01-01

    25, 26, 27, 28 February and 1st March from 11.00 to 12.00 hrs - 25, 26, 27 February and 1 March at Main Auditorium, bldg. 500, 28 February at Council Chamber, bldg. 503 LECTURE SERIES Neutrino masses and oscillations by A. de Rujula / CERN-TH This course will not cover its subject in the customary way. The emphasis will be on the simple theoretical concepts (helicity, handedness, chirality, Majorana masses) which are obscure in most of the literature, and on the quantum mechanics of oscillations, that ALL books get wrong. Which, hopefully, will not deter me from discussing some of the most interesting results from the labs and from the cosmos.

  19. Academic Training: Practical Statistics for Particle Physicists

    CERN Multimedia

    2006-01-01

    2006-2007 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 9, 10, 11, 12, 13 October from 11:00 to 12:00 - Main Auditorium, bldg. 500, TH Auditorium, bldg 4, 3rd floor, on 13 October Practical Statistics for Particle Physicists L. LYONS, University of Oxford, GB Lecture 1: Learning to love the errror matrix Introductory remarks. Conditional probability. Statistical and systematic errors. Combining results Binomial, Poisson and 1-D Gaussian 2-D Gaussian and the error matrix. Understanding the covariance. Using the error matrix. Estimating the error matrix. Combining correlated measurements Lecture 2: Parameter determination by likelihood: Do's and don'ts Introduction to likelihood. Error estimate. Simple examples: (1) Breit Wigner (2) Lifetime binned and unbinned likelihood several parameters extended maximum likelihood. Common misapprehensions: Normalisation delta(lnL) = 1/2 rule and coverage Integrating the likelihood Unbinned L_max as goodness of fit Punzi effect Lecture 3: Chi-squared and hypothesis test...

  20. Cern Academic Training programme 2011 - Flavour Physics and CP Violation

    CERN Multimedia

    PH Department

    2011-01-01

    LECTURE SERIES   4, 5, 6 and 7 April 2011 Flavour Physics and CP Violation Dr. Yosef Nir (Weizmann Institute of Science, Rehovot, Israel 11:00-12:00 - 4, 6 and 7 April - Bldg. 222-R-001 - Filtration Plant 5 April - Bldg. 80-1-001 - Globe 1st Floor   The B-factories have led to significant progress in our understanding of CP violation and of flavour physics. Yet, two flavour puzzles remain. The standard model flavour puzzle is the question of why there is smallness and hierarchy in the flavour parameters. The new physics flavour puzzle is the question of why TeV-scale new physics was not signalled in flavour changing neutral current processes. The high pT experiments, ATLAS and CMS, are likely to shed light on these puzzles. As concerns CP violation, the LHC will lead to progress on the puzzle of the baryon asymmetry as well.  

  1. Academic Training: QCD: are we ready for the LHC

    CERN Multimedia

    2006-01-01

    2006-2007 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 4, 5, 6, 7 December, from 11:00 to 12:00 4, 5, 6 December - Main Auditorium, bldg. 500, 7 December - TH Auditorium, bldg. 4 - 3-006 QCD: are we ready for the LHC S. FRIXIONE / INFN, Genoa, Italy The LHC energy regime poses a serious challenge to our capability of predicting QCD reactions to the level of accuracy necessary for a successful programme of searches for physics beyond the Standard Model. In these lectures, I'll introduce basic concepts in QCD, and present techniques based on perturbation theory, such as fixed-order and resummed computations, and Monte Carlo simulations. I'll discuss applications of these techniques to hadron-hadron processes, concentrating on recent trends in perturbative QCD aimed at improving our understanding of LHC phenomenology.

  2. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    19, 20, 21, 22 and 23 February REGULAR LECTURE PROGRAMME From 11:00 hrs - 19, 20 and 21 February Main Auditorium bldg. 500, 22 and 23 February Council Chamber, bldg 503 Introduction to Cryogenic Engineering J.G. Weisend / SLAC, Stanford, USA Cryogenic engineering is an important speciality at CERN. With the construction of LHC, this technology will have an even greater impact on machine operations. The goal of the course is to give people not working in cryogenics an appreciation of the basic principals and problems associated with the field. The course will also provide a foundation for future learning in cryogenics. Topics to be covered will include: properties of cryogenic fluids and materials, refrigeration, cryostat design, instrumentation, safety and propertiesof He II. Examples of working cryogenic systems, many of them from high energy physics, will be presented.

  3. Production and Characterization of Organic Fertilizer from Tubang-Bakod (Jatrophacurcas Seed Cake and Chicken Manure

    Directory of Open Access Journals (Sweden)

    Maylen G. Eroa

    2015-11-01

    Full Text Available The processing of Jatrophacurcas (tubang-bakod to produce biodiesel entails wastes in the form of seedcake which can be converted into valuable product that can help nurture and improve soil properties. The College of Industrial Technology and the Chemical Engineering Department of Batangas State University (BatstateU conducted an experimental study which includes the composting of the combination of Jatropha Seed-Cake(JSC and Chicken Manure(CM , formulating ratios of JSC and CM andcharacterization of the organic fertilizer produced. Generally, this study aimed to promote proper waste disposal by producing an organic fertilizer from the waste of biodiesel production which uses Jatropha plant and proving the feasibility of making the fertilizer as the main source of nutrient for plants. Specifically, the nutrients that were considered were Nitrogen (N, Phosphorus (P, Potassium (K and the Carbon: Nitrogen (C:N ratio. Composting lasted for 6 weeks, three formulations were used, 30(CM:70(JSC, 50(CM:50(JSC and 70(CM:30(JSC. The result implies that theorganic fertilizers produced can be a good substitute to the commercially available fertilizers.

  4. Optical effects of shadow masks on short circuit current of organic photovoltaic devices.

    Science.gov (United States)

    Lin, Chi-Feng; Lin, Bing-Hong; Liu, Shun-Wei; Hsu, Wei-Feng; Zhang, Mi; Chiu, Tien-Lung; Wei, Mau-Kuo; Lee, Jiun-Haw

    2012-03-21

    In this paper, we have employed different shadow masks attached on top of organic photovoltaic (OPV) devices to study the optical effects of the former on the short circuit current (J(SC)). To rule out possible lateral electrical conduction and simplify the optical effects inside the device, a small-molecular heterojunction OPV device with a clear donor/acceptor interface was employed with a hole extraction layer exhibiting high resistance intentionally. Careful calibration with a shadow mask was employed. By attaching two layers of opaque masks in combination with a suitable holder design to shield the light from the edges and backside, the value of J(SC) approached that of the dark current, even under 1-sun radiation. With different illumination areas, we found that the photons illuminating the non-active region of the device contributed to 40% of the J(SC) by optical effect within the width of about 1 mm around the active region. When illuminating the non-active area with 12 mm to the active area, a 5.6 times improvement in the J(SC) was observed when the incident angle was 75°. With the introduction of a microstructured film onto the OPV device and an increase in the reflection from the non-active region, a 15% enhancement of the J(SC) compared to the control device was achieved.

  5. Intranasal Insulin for Improving Cognitive Function in Multiple Sclerosis

    Science.gov (United States)

    2017-10-01

    HOPKINS UNIVERSITY, THE 3400 N CHARLES ST W400 WYMAN PARK BLDG BALTIMORE MD 21218-2680 9. SPONSORING / MONITORING AGENCY NAME(S) AND ADDRESS(ES) 10...people with MS. The study will also evaluate the impact of intranasal insulin on measures of oxidative stress, axonal injury, cellular stress...and energy metabolism in MS. The design of this phase I/II, randomized, double-blind, placebo-controlled trial is as follows; 105participants will be

  6. A Memorial Gathering

    CERN Multimedia

    2004-01-01

    Bob Dobinson (1943-2004) Bob's friends and colleagues are warmly invited to join in a memorial gathering on Thursday 15th April 2004 at 11:00 hours in the CERN Council Chamber/ Salle de Conseil (Bldg 503 1st floor) Some colleagues will pay tribute to Bob's lifetime achievements and his contributions to past and present experiments. The gathering will conclude with refreshments in the Salle des Pas Perdus.

  7. Pension Fund

    CERN Multimedia

    2004-01-01

    Amendment No 20 to the Rules and Regulations of the Pension Fund has just been published and can be obtained from Department/Unit secretariats or, in the case of pensioners, directly from the Administration of the Fund (tel. 767-91 94/27 38), bldg 5, 1-030. This Amendment, which entered into force on 1.1.2004, concerns the fixed sums and allowances adjusted at same date (Annex B).

  8. CERN Multimedia

    HR Department

    2010-01-01

    LECTURE SERIES 9, 10 11 & 12 March 2010 11:00-12:00 - Main Auditorium, Bldg. 500 The Dark Side of the Universe: Dark Matter and Dark Energy by Prof. Michael Turner Tuesday 9 June 2009 Lecture 1 : State of Cosmology Today Wednesday 10 June 2009 Lecture 2: Particle Dark Matter Thursday 11 June 2009 Lecture 3: Cosmic Acceleration and Dark Energy Friday 12 June 2009 Lecture 4: Future Direction and Challenges Organiser: Maureen Prola-Tessaur/PH-EDU

  9. Design and Analysis of an Attitude Determination and Control Subsystem (ADCS) for AFIT’s 6U Standard Bus

    Science.gov (United States)

    2014-03-27

    solenoid in Eq. 3.2 [49]. M = nIA (3.2) where n is the number of turns of the wire, I is the current going through the wire, and A is the cross...Bldg 497 Kirtland AFB, NM 87117 Timothy J. Shuck, Capt, USAF, ( 505 ) 853-4513, timothy.shuck@kirtland.af.mil AFRL/RVES 12. DISTRIBUTION / AVAILABILITY

  10. Intravenous versus intramuscular cobinamide compared to intravenous saline (control) in the treatment of acute, survivable, mitochondrial toxins in swine (Sus Scrofa): a pilot study

    Science.gov (United States)

    2018-04-10

    336-4407 59th Medical Wing Institutional Animal Care and Use Committee (IACUC) 59 Clinical Research Division/SGVUS 1100 Wilford Hall Loop , Bldg... administratively closed on 15 Sept 2017. A final report will be requested of the PI. FOLLOW- UP: OPEN 14 Nov 17: The PI submitted a final report and...study was funded by the AF SGR. We had no budget deviations and all funds have been allocated for. 12. Reason for Closure: Our study is closing

  11. Experimental Extinguishment of Fires by Blast.

    Science.gov (United States)

    1982-05-01

    Attn: Technical Library Office of Science and Technology Policy Watertown, Massachusetts 02172 Executive Office Bldg. Washington, D. C. 20500 Civil ...ST CHART NATIONAL BURFAU OF SIANDARDS 193 -A Mr. Donald A. Bettge Mr. Ed L. Hill Office of Civil Preparedness Research Triangle Institute National...Suite 104 Attn: ENGENE -RD Palo Alto, California 94303 Washington, D. C. 20314 Director, Defense Nuclear Agency Mr. Walser (Jerry) Strops Attn: Tom

  12. Energetic Materials Laboratory

    Science.gov (United States)

    2015-04-30

    University of Texas at El Paso 500 W. University Ave. Admin Bldg, room 209 El Paso , TX 79968 -0697 31-Jan-2015 ABSTRACT Number of Papers published in...Shafirovich Department of Mechanical Engineering The University of Texas at El Paso , El Paso , TX 79968 Objective The objective of this project was to...Co-PI), “HAN Based Advanced Hybrid Rocket Motor Technologies,” Missile Defense Agency, 36 months, $600,000, contract pending Pending: o E

  13. CERN WoMen's club

    CERN Multimedia

    CERN WoMen's club

    2014-01-01

    Coffee Morning Tuesday 14th October 2014, 9:30 – 11:30 Bldg 504 (Restaurant No 2 – DSR) 1st Floor, Club Room 3 Christmas Sale preparation Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch/Club-WomensClub

  14. SIAM Conference of Optimization Theory and Applications (4th) Held in Chicago, Illinois on May 11-13, 1992

    Science.gov (United States)

    1992-08-31

    Tokyo 107 Chiyodaku Tokyo 100 Japan Japan -4 - Rheozhong, Tan Richard A, Tapia Pablo , larazaga i University of Cincinnati Rice University University...GeraLdo, Veiga Jose A, Ventura 5256 Lynd Ave Apt 215 Penn State University Lyndhurst OH 44124-1031 2000 Durant Ave 207 Hammond Bldg (216) 581-5493 Berkeley...G.C. Resende, AT&T Bell University of Wisconsin, Madison Laboratories and Geraldo Veiga . 5:00 Robust Optimization. Masvely University of California

  15. Proceedings of the Conference on the Standardization of Safety and Performance Tests for Energetic Materials. Volume 1

    Science.gov (United States)

    1977-09-01

    EE Dover, NJ 07801 DEXTER, Robert F. Bureau of Alcohol , Tobacco and Firearms 12th and Penna. Ave, N.W. Federal Bldg. RM 8233 Washington, DC...the digestion in alcoholic KOH. This point should be further investigated by developing a quantitative TLC or high performance liquid...the anti- oxydant neutralizes most of the oxidizing gas, then when the antioxydant is completely depleted, all the samples similarly began showing an

  16. 59th Medical Wing Clinical Research Division Clinical Investigations Program Pathology Poster

    Science.gov (United States)

    2017-04-28

    59 MDW/SGVU SUBJECT: Professional Presentation Approval 1. Your paper, entitled 59th Medical Wing Clinical Research Division Clinical Investigations...Program Pathology Poster presented at/published to For hanging in a hallway of the 591h Medical Wing Clinical Research Division, Bldg 4430 in...Graduate Health Sciences Education student and your department has told you they cannot fund your publication, the 59th Clinical Research Division may

  17. Women's Club

    CERN Multimedia

    CERN Women's Club

    2012-01-01

     Coffee Morning Tuesday 7th February 2012, 9:00 – 11:00 Bldg 504 (Restaurant n°2 – DSR) 1st Floor, Club Room 3 Presentation of cheque to Terre des Hommes Those interested in helping should come along. New arrivals and all members are cordially invited.You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch/Club-WomensClub/

  18. Inpatient Obstetric Care at Irwin Army Community Hospital: A Study to Determine the Most Efficient Organization

    Science.gov (United States)

    2001-03-01

    Reese’s new birthing suites may curb maternity malpractice suits. Modern Healthcare, 16 (11), 48. Clark, L., & Stewart, R. (1982). Nurse-midwifery...Davis Highway, Suite 1204, Arlington VA 22202-4302. Respondents should be aware that notwithstanding any other provision of law , no person shall be...US Army Medical Department Center and School Bldg 2841 MCCS-HRA (US Army-Baylor Program in HCA) 3151 Scott Road, Suite 1412 Fort Sam Houston, TX 78234

  19. Army Airspace Command and Control (A2C2): Action Plan for Issue Resolution

    Science.gov (United States)

    1993-09-01

    INFO Information INTEL Intelligence IPR In-Process Review IVIS Inter-Vehicular Information System JACC Joint Airspace Control Center JAOC Joint Air...base, centralized such as intelligence at Fort Huachuca and combat service support at Fort Lee , or a combination of both. It is no longer efficient to...Regiment (ATS) Ft. Bragg, NC 28307 ATTN: AFZF-ATS-C (LTC Ledbetter ) (919) 396-8899/7649 Bldg 87009, 16th Street Ft. Hood, TX 76544 Commander, 1st

  20. KSC technician installs rows of experiment racks in IML-1 spacelab module

    Science.gov (United States)

    1991-01-01

    Kennedy Space Center (KSC) technician installs rows of experiment racks in the International Microgravity Laboratory 1 (IML-1) in the KSC Operations and Checkout (O and C) Bldg. The IML-1 is scheduled to fly on STS-42 in early 1992, and will turn the shuttle into a laboratory dedicated to investigating the effects of microgravity on materials and life processes. View provided by KSC with alternate number KSC-91P-169.

  1. Workload Analysis of the Crew of the Abrams V2 SEP: Phase I Baseline IMPRINT Model

    Science.gov (United States)

    2009-09-01

    PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) U.S. Army Research Laboratory ATTN: RDRL- HRM -B Aberdeen Proving Ground, MD 21005-5425 8...running a stop sign or a deer darting across the road, the high workload demands of driving become more apparent. The frequency of automobile accidents...OF COPIES ORGANIZATION COPIES ORGANIZATION 29 1 ARMY RSCH LABORATORY – HRED RDRL HRM A J MARTIN MYER CENTER BLDG 2700 RM 2D311

  2. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    9, 10 and 11 May REGULAR LECTURE PROGRAMME From 10:00 to 12:00 hrs on 9 and 10 May and on 11 May from 11:00 to 12:00 hrs - Main Auditorium bldg. 500 Cosmology and Particle Physics K. Olive / CERN-TH A general overview of the standard big bang model will be presented with special emphasis on astro-particle physics. Specific topics will include: Inflation, Baryoogenesis, Nucleosynthesis and Dark Matter.

  3. De Plein Fouet: Is Strategy Dead?

    Science.gov (United States)

    2015-06-01

    PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES...Air Force Research Institute,Air & Space Power Journal,155 N. Twining St., Bldg. 693,Maxwell AFB,AL,36112 8. PERFORMING ORGANIZATION REPORT NUMBER 9...strategies for every lofty and mundane human endeavor. Hundreds of millions of dollars—maybe billions—are spent annually on crafting visions and

  4. Cern Women's Club

    CERN Document Server

    Club des cernoises

    2013-01-01

    Coffee MorningTuesday 14th May 2013, 9:30 Bldg 504 (Restaurant No 2 – DSR) 1st Floor, Club Room 3 Annual General Meeting Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch

  5. Cern Women's Club

    CERN Multimedia

    Club des cernoises

    2012-01-01

    Coffee MorningTuesday 15th January 2013, 9:00 – 11:00 Bldg 504 (Restaurant No 2 – DSR) 1st Floor, Club Room 3 Epiphany (French tradition – “Tirer les rois”) Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch/Club-WomensClub/

  6. Cern Women's club

    CERN Multimedia

    Club des Cernoises

    2013-01-01

    Coffee Morning Tuesday 5th  February 2013, 9:00 – 11:00 Bldg 504 (Restaurant No 2 – DSR) 1st  Floor, Club Room 3 Presentation of cheque to Nous Aussi Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch/Club-WomensClub/    

  7. CERN Women's Club

    CERN Multimedia

    Club des cernoises

    2011-01-01

    Coffee Morning Tuesday 11th October, 9:00 – 11:00 Bldg 504 (Restaurant No 2) 1st Floor, Club Room 3 Presentation of the charity to benefit from the Christmas Sale TERRE DES HOMMES New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch/Club-WomensClub/

  8. Cern Women's Club

    CERN Multimedia

    Club des cernoises

    2013-01-01

    Coffee MorningTuesday 9th April 2013, 9:00 – 14:00 Bldg 504 (Restaurant No 2 – DSR) Ground Floor Spring Jumble Sale Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch/Club-WomensClub/

  9. CERN Women's Club

    CERN Multimedia

    CERN Women's Club

    2011-01-01

    Coffee Morning Tuesday 10th January 2012, 9:00 – 11:00 Bldg 504 (Restaurant No 2 – DSR) 1st Floor, Club Room 3 Epiphany (French tradition – “Tirer les rois”) Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch/Club-WomensClub/

  10. Women's club

    CERN Multimedia

    Club des cernoises

    2012-01-01

    Coffee MorningTuesday 9th October 2012, 9:00 – 11:00 Bldg 504 (Restaurant No 2 – DSR) 1st Floor, Club Room 3 Presentation of the charity to benefit from the Christmas Sale “Nous aussi”. Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://cern.ch/Club-WomensClub/

  11. Cern Women's Club

    CERN Multimedia

    Club des Cernoises

    2011-01-01

    Coffee Morning Tuesday 8th November 2011, 9:00 - 11:00 Bldg 504 (Restaurant No 2 - DSR) 1st Floor, Club Room 3 Organization of our Christmas Sale In favour of “Terre des Hommes” Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch/Club-WomensClub/

  12. Tests of the Royce ultrasonic interface level analyzer

    International Nuclear Information System (INIS)

    WITWER, K.S.

    1999-01-01

    This document describes testing carried out in 1995 on the Royce Interface Level Analyzer. The testing was carried out in the 305 Bldg., Engineering Testing Laboratory, 300 Area. The Level Analyzer was shown to be able to effectively locate the solid liquid interface layer of two different simulants under various conditions and was able to do so after being irradiated with over 5 million RADS gamma from a Cobalt 60 source

  13. Final deactivation report on the tritium target facility, Building 7025, at Oak Ridge National Laboratory, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1997-08-01

    This report includes a history and profile of Bldg. 7025 before and after completion of deactivation. It also discusses turnover items, such as the Postdeactivation Surveillance ampersand Maintenance Plan, remaining hazardous materials, radiological controls, Safeguards and Security, quality assurance, facility operations, and supporting documentation in the EM-60 Turnover package. Other than minimal S ampersand M activities, the building will be unoccupied and the exterior doors locked (access only for the required S ampersand M)

  14. SUMMER STUDENT LECTURE PROGRAMME

    CERN Multimedia

    2004-01-01

    Main Auditorium, bldg. 500 DATE TIME LECTURER TITLE Monday 16 August 09:15 - 10:00 Student sessions (1/6) 10:15 - 11:00 Student sessions (2/6 11:15 - 12:00 Student sessions (3/6) Tuesday 17 August 09:15 - 10:00 Student sessions (4/6) 10:15 - 11:00 Student sessions (5/6) 11:15 - 12:00 Student sessions (6/6

  15. Cern Women's Club

    CERN Multimedia

    Club des cernoises

    2013-01-01

    Coffee MorningTuesday 14th January 2014, from 9 : 00 to 11: 00 Bldg 504 (Restaurant No 2 – DSR) 1st Floor, Club Room 3 Epiphany (French tradition - "Tirer les rois")   Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch.

  16. ACADEMIC TRAINING LECTURE

    CERN Multimedia

    Academic Training; Tel. 73127

    2001-01-01

    2, 3, 4, 5 and 6 April REGULAR LECTURE PROGRAMME From 11:00 hrs - Main Auditorium bldg. 500 New Developments in Supersymmetry S. Raby / CERN-TH Introduction to supersymmetric grand unified theories. An introduction to the MSSM and different mechanisms for supersymmetry breaking. Then the details of SU(5) and SO(10) unification, the new gauge sector beyond the standard model, representations of quarks and leptons. Gauge and Yukawa coupling unification and some predictions.

  17. Cross Validated Temperament Scale Validities Computed Using Profile Similarity Metrics

    Science.gov (United States)

    2017-04-27

    ORGANIZATION NAME(S) AND ADDRESS(ES) U. S. Army Research Institute for the Behavioral & Social Sciences 6000 6TH Street (Bldg. 1464 / Mail...AGENCY NAME(S) AND ADDRESS(ES) 10. SPONSOR/MONITOR’S ACRONYM(S) U. S. Army Research Institute for the Behavioral & Social Sciences 6000 6TH...respondent’s scale score is equal to the mean of the non-reversed and recoded-reversed items. Table 1 portrays the conventional scoring algorithm on

  18. Women's Club

    CERN Multimedia

    Women's Club

    2014-01-01

        CERN WOMEN’S CLUB Coffee Morning Tuesday 8th Avril 2014, 9:30 – 14:00 Bldg 504 (Restaurant No 2 – DSR) Ground Floor Spring Jumble Sale   Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://cern.ch/Club-WomensClub/

  19. Cern Women's Club

    CERN Multimedia

    Club des cernoises

    2013-01-01

    Coffee MorningTuesday 12th November 2013, from 9:00 to 11:00 Bldg 504 (Restaurant No 2 – DSR) 1st Floor, Club Room 3 Organisation of Christmas Sale Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch.

  20. CERN Women's Club

    CERN Multimedia

    CERN Women's Club

    2013-01-01

    Coffee Morning Tuesday 10th September 2013, 9:00 Bldg 504, (Restaurant No 2 – DSR) 1st Floor, Club Room 3 Registration Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch/Club-WomensClub/

  1. Cern women's club

    CERN Multimedia

    Club des cernoises

    2014-01-01

    CERN WOMEN’S CLUB Coffee Morning Tuesday 13th  May 2014, 9:30 Bldg 504,  (Restaurant No 2 – DSR) 1st Floor, Club Room 3   Annual General Meeting Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://cern.ch/Club-WomensClub/

  2. Women's Club

    CERN Document Server

    Club des Cernoises

    2012-01-01

    Coffee Morning   Tuesday 24th  April 2012, 9:00 – 14:00 Bldg 504, Ground Floor Spring Jumble Sale   Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch/Club-WomensClub/

  3. Cern Women's Club

    CERN Document Server

    Club des cernoises

    2013-01-01

    Coffee MorningTuesday 12th March 2013, 9:00 – 11:00 Bldg 504 (Restaurant No 2 – DSR) 1st Floor, Club Room 3 Eastern Tradition Those interested in helping should come along. New arrivals and all members are cordially invited. You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://club-womensclub.web.cern.ch/Club-WomensClub/

  4. Proceedings: 1995 SERDP Symposium (Abstracts)

    Science.gov (United States)

    1995-04-01

    Clays Compliance-l0 Development of Hydrothermal Reduction of Energetic Wastes Compliance-ll Metal Perovskite Catalysts for NOx Reduction Compliance-12... Perovskite Catalysts for NOx Reduction Dr. Joseph Wander Air Force Armstrong Laboratory, Environics Directorate 139 Barnes Drive, Suite 2 Bldg. 1120...processes involved in facility design, construction, and operation and, 2) to place on the Internet a life cycle assessment database ( LCA ) for building

  5. Academic Training Lecture - Regular Programme

    CERN Multimedia

    PH Department

    2010-01-01

    Tuesday 25 & Wednesday 26 May 2010 from 11:00 to 12:30 - Main Auditorium, Bldg. 500-1-001 Baryon Asymmetry of the Universe by Prof. Hitoshi Murayama (University of California, Berkeley) In two lectures, the following topics will be discussed: (1) Why baryon asymmetry is a problem at all (2) Review of the Sakharov's conditions (3) Why old models based on GUT did not work (4) Electroweak baryogenesis (5) Leptogenesis (6) Connections to the near-future experiments

  6. CERN car stickers 2005

    CERN Multimedia

    Reception and Access Control Service - TS Department

    2004-01-01

    Please note that the car stickers for 2005 are now available. If you have not received the new one by internal mail, you should go along in person to the Registration Service (bldg. 55 - 1st floor), open non-stop from 7:30 to 16:30, taking with you your 2004 sticker and the log-book of your vehicle. Thank you for your collaboration. Reception and Access Control Service - TS Department.

  7. ANTIMATTER - THE ULTIMATE MIRROR

    CERN Multimedia

    Gordon FRASER - ETT

    2000-01-01

    This new 200-page popular science book by CERN Courier Editor Gordon Fraser, published by Cambridge University Press, focuses on the 1995 synthesis of antihydrogen atoms at CERN and the implications of this physics. It is now available from the Reception Shop, Building 33, price SFr 30,and from the User Support Bookshop in Bldg 513 1-022, http://consult.cern.ch/service/bookshop/, for purchase via tid, edh or cash.

  8. Respiratory Highlights, 2016 - 2017 Influenza Season (2 October 2016 - 31 September 2017)

    Science.gov (United States)

    2018-02-21

    Medicine Public Health and Preventive Medicine Dept/PHR 2510 Fifth St., Bldg. 840 Wright-Patterson AFB, OH 45433-7913 8. PERFORMING ORGANIZATION...Surveillance Program Cleared, 88PA, Case # 2018-1051, 5 Mar 2018. 1 USAF School of Aerospace Medicine & Defense Health Agency...influenza from an infected child with a history of swine contact at an agricultural event in Texas. The HA gene from select influenza positives was

  9. Information from the Registration Service

    CERN Multimedia

    GS Department

    2011-01-01

    Please note that the Registration Service (Bldg 55-1st floor) will be exceptionally open during the annual end of year closure from 10:00 to 12:00 on the following days: 22, 23, 26, 27,28, 29 et 30 December 2011 and 2,3, et 4 January 2012. All the activities related to the Registration Service will be operational: registration for contractors’ personnel; registrations for professional visits; access cards; car stickers; biometric registration. The Registration Service

  10. Shielded analytical laboratory activities supporting waste isolation programs

    International Nuclear Information System (INIS)

    McCown, J.J.

    1985-08-01

    The Shielded Analytical Laboratory (SAL) is a six cell manipulator-equipped facility which was built in 1962 as an addition to the 325 Radiochemistry Bldg. in the 300 Area at Hanford. The facility provides the capability for handling a wide variety of radioactive materials and performing chemical dissolutions, separations and analyses on nuclear fuels, components, waste forms and materials from R and D programs

  11. Crash Lethality Model

    Science.gov (United States)

    2012-06-06

    of Death from Burn Injuries, New England Journal of Medicine. Massachusetts, Feb 1998. 11. Crull, Michelle. Tatom, John. Conway, Robert . SPIDER 2... Raymer , Daniel P. Aircraft Design: A Conceptual Approach. Washington DC: American Institute of Aeronautics and Astronautics, Inc., 1992. ISBN 0-930403...Patuxent River, MD 20670 NAVAIRSYSCOM (AIR-5.1G - Roberts ), Bldg. 8010 (1) 47320 Priests Point Loop, St. Inigoes, MD 20684-4017 NAVAIRSYSCOM (UASTD

  12. CERN WOMEN’S CLUB

    CERN Multimedia

    CWC

    2013-01-01

    Tuesday 9th April 2013, 9:00 – 14:00 Bldg 504 (Restaurant No 2 – DSR) Ground Floor Spring Jumble Sale Those interested in helping should come along. New arrivals and all members are cordially invited.You can enrol for membership, renew membership, find out about and sign up for our activities. Visit our website: http://web.cern.ch/club-womensclub

  13. Evaluation of closure alternatives for the Building 3001 Storage Canal at Oak Ridge National Laboratory, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1992-02-01

    The Bldg. 3001 Storage Canal at ORNL is leaking approximately 400 gal of water per day. This report presents the Bechtel National Inc. (BNI) Team's evaluation of plans and presents recommendations for interim closure alternatives to stop the release of radionuclides and potential release of heavy metals into the environment. This is a conceptual evaluation and does not include detailed engineering of physical mitigation methods. The alternatives address only interim closure measures and not final decommissioning of the canal

  14. Formation of the U.S. Air Force Aviator Post Traumatic Stress Disorder Study Group

    Science.gov (United States)

    2016-11-15

    Wood, III, John Heaton, Mark Hubner, Nicole Rhodes 5d. PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION... Questionnaire -9 PIQ performance intelligence quotient PTSD post-traumatic stress disorder RPA remotely piloted aircraft USAF U.S. Air Force VIQ verbal intelligence quotient ...Human Performance Wing U.S. Air Force School of Aerospace Medicine Aerospace Medicine Department 2510 Fifth St., Bldg. 840 Wright-Patterson AFB, OH

  15. Import/Export Service of Radioactive Material and Radioactive Sources Service

    CERN Multimedia

    2004-01-01

    Please note that the Import/Export Service of radioactive material (http://cern.ch/service-rp-shipping/ - e-mail : service-rp-shipping@cern.ch) and the Radioactive Sources Service (http://cern.ch/service-radioactive-sources - e-mail : service-radioactive-sources@cern.ch) at bldg. 24/E-024 will be closed on FRIDAY 10 SEPTEMBER 2004. Tel. 73171

  16. Molecular Verification of Cryptops hortensis (Scolopendromorpha: Cryptopidae) in theNearctic Region

    Science.gov (United States)

    2018-01-29

    Journal Article 3. DATES COVERED (From – To) March – April 2016 4. TITLE AND SUBTITLE Molecular Verification of Cryptops hortensis...PROJECT NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) USAF School of Aerospace Medicine ...Public Health and Preventive Medicine Dept/PHR 2510 Fifth St., Bldg. 840 Wright-Patterson AFB, OH 45433-7913 8. PERFORMING ORGANIZATION REPORT

  17. The Shock and Vibration Digest. Volume 13, Number 10

    Science.gov (United States)

    1981-10-01

    shells when they impact rigid barriers. Such behavior is of interest in the protection of nuclear power plants . Progress on the MENTOR finite...pipewhip restraints during a postulated pipe break in a nuclear power plant . Other experimental work [124] also provioes valuable information on the...World Congr. Space Enclosures, Bldg. Res. Ctr., Con- cordia Univ., Montreal, pp 321-327 (July 1976). 48. Stolarski, H., "Assessment of Large Displace

  18. Final deactivation report on the Radioisotope Production Lab-E, Building 3032, at Oak Ridge National Laboratory, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1997-09-01

    The purpose of this report is to document the condition of Bldg. 3032, after completion of deactivation activities as outlined by the Department of Energy (DOE) Office of Nuclear Materials and Facility Stabilization Program (EM-60) guidance documentation. This report outlines the activities conducted to place the facility in a safe and environmentally sound condition for transfer to the DOE Office of Environmental Restoration Program (EM-40). This report provides a history and profile of Bldg. 3032 prior to commencing deactivation activities and a profile of the building after completion of deactivation activities. Turnover items, such as the Postdeactivation Surveillance ampersand Maintenance Plan, remaining hazardous materials, radiological controls, Safeguards and Security, quality assurance, facility operations, and supporting documentation provided in the EM-60 turnover package are discussed. Building 3032 will be used as the Health Physics Office for the Isotopes Facilities Deactivation Program area and will require access for these offices and to facilitate required surveillance and maintenance (S ampersand M) activities to maintain the building safety envelope. Bldg. 3032 was stabilized during deactivation so that when transferred to the EM-40 program, only a minimal S ampersand M effort would be required to maintain the building safety envelope. All materials have been removed from the building, and all utility systems, piping, and alarms have been deactivated except electricity and steam needed for the office areas

  19. 2007 2008 ACADEMIC TRAINING PROGRAMME

    CERN Multimedia

    2008-01-01

    LECTURE SERIES 6 & 8 May 2008 11:00 -12:00 – Main Auditorium, bldg. 500-1 Energy isn’t Everything: CERN’s Fixed Target Niche Prof. John DAINTON / Cockcroft Institute & Liverpool University, UK Fixed target physics at CERN remains an essential part of the Laboratory’s scientific programme and horizon. In recent years fixed target and decay physics using CERN’s unique accelerator and beam facilities has continued to enable unique experiments to be undertaken. An overview is presented of the status of this physics and, wherever appropriate, of its future. LECTURE SERIES 7 May 2008 11:00 -12:00 – TH Auditorium – Bldg. 4-3-006 A rich revenue from the use of radioactive beams and radioactive targets: recent highlights from the nTOF and ISOLDE facilities 9 May 2008 11:00 -12:00 – Main Auditorium, bldg. 500-1 The fifth decade of ISOLDE: HIE-ISOLDE Professor Mark HUYSE, Leuven University, BE The On-Line Isotope Mass Separator ISOLDE is a facility dedicated to the production of a...

  20. CERN Academic Training Programme 2008/2009

    CERN Multimedia

    HR Department

    2009-01-01

    LECTURE SERIES 9-10 February 2009 Monday 9 February 2009 11:00-12:00, 16:00-17:00. Tuesday 10 February 2009 11:00-12:00, 14:00-15:00. Council Chamber, Bldg 503-1-001 Understanding Cross Sections at the LHC Dr. Stephen MRENNA / Fermi National Accelerator Laboratory, USA My lectures will focus on the theoretical and phenomenological tools that will be needed to understand the Standard Model at the LHC. Emphasis will be placed on parton shower event generators and the methodology for tuning them to data. 5-6 March 2009 Thursday, 5 March 2009: 11:00-12:00, 14:00-15:00 Main Auditorium, Bldg. 500-1-001 Friday, 6 March 2009: 10:00-12:00, Main Auditorium, Bldg. 500-1-001 Recent developments at 3rd generation storage ring light sources Jean-Marc FILHOL, Deputy Director-General SOLEIL, France Over the last decade, many 3rd generation storage ring light sources have been built and put into operation. Progressively, significant improvements have been brought to the machine performances and experiences developed at...

  1. Limited restaurant service over the Easter weekend

    CERN Multimedia

    2005-01-01

    As Friday, 25 March and Monday, 28 March 2005 are CERN holidays, restaurants no. 1 (Bldg. 501- Meyrin) and no. 3 (Bldg. 866 - Prévessin) will be closed and will remain closed on Saturday, 26 March and Sunday, 27 March. They will re-open on Tuesday, 29 March. During these four days, a limited service will be provided by restaurant no. 2 (Bldg. 504 - Meyrin): on Friday and Monday from 8 a.m. to 8.30 p.m. and on Saturday and Sunday from 9 a.m. to 8.00 p.m. Hot meals will be served from 12.00 p.m. to 2 p.m. and from 6 p.m. to 7.30 p.m. They will be served at the self-service restaurant on the first floor on Friday and at the cafeteria on the ground floor on Saturday, Sunday and Monday. On Thursday, March 24, all three restaurants will operate according to their usual opening times except for restaurant no. 1 which will close at 9 p.m. instead of 1 a.m.

  2. LIMITED RESTAURANT SERVICE : ASCENSION AND WHITSUNTIDE WEEKENDS

    CERN Multimedia

    Restaurant Supervisory Committee

    2002-01-01

    Details of the arrangements to ensure the provision of a restaurant service during the Ascension and Whitsuntide weekends are given below. On all the days indicated, hot meals will be served from 11h30 to 14h00 and 18h00 to 19h30.   RESTAURANT SATELLITE CAFETERIAS KIOSQUE No. Opening times Usual opening times ASCENSION Thursday 9 May 1 2 3 08h00 - 21h00 Friday 10 May 1 2 3   07h00 - 21h00 07h00 - 18h00 Bldg. 40 Bldg. 30, 54 Bldg. 864 08h00 - 17h00     Saturday 11 May 1 2 3 07h00 - 23h00     Sunday 12 May 1 2 3 07h00 - 23h00     WHITSUNTIDE Saturday 18 May 1 2 3 08h00 - 21h00     Sunday 19 May 1 2 3 08h00 - 21h00     Monday 20 May 1 2 3 08h00 - 21h00     Restaurant Supervisory Committee Tel. 77551

  3. LIMITED RESTAURANT SERVICE: EASTER WEEK-END

    CERN Multimedia

    2004-01-01

    As Friday April 9 and Monday April 12 2004 are CERN holidays, restaurants no. 1 (Bldg. 501- Meyrin) and no. 3 (Bldg. 866 - Prévessin) will be closed and will remain closed on Saturday and Sunday, April 10 - 11. They will reopen on Tuesday, April 13 at 7 a.m. During these four days, a limited service will be provided by restaurant no. 2 (Bldg. 504 - Meyrin): on Friday and Monday from 8 a.m. to 9 p.m. and on Saturday and Sunday from 9 a.m. to 8.30 p.m. Hot meals will be served from 11.30 a.m. to 2 p.m. and from 6 p.m. to 7.30 p.m. On Thursday, April 8, all three restaurants will operate according to the usual times except for restaurant no. 1 which will close at 9 p.m. instead of 1 a.m.

  4. Limited restaurant service over the Easter weekend

    CERN Multimedia

    2005-01-01

    As Friday, 25 March and Monday, 28 March 2005 are CERN holidays, restaurants No. 1 (Bldg. 501- Meyrin) and No. 3 (Bldg. 866 - Prévessin) will be closed and will remain closed on Saturday, 26 March and Sunday, 27 March. They will re-open on Tuesday, 29 March at 7.00 a.m. During these four days, a limited service will be provided by restaurant No. 2 (Bldg. 504 - Meyrin): on Friday and Monday from 8 a.m. to 8.30 p.m. and on Saturday and Sunday from 9 a.m. to 8.00 p.m. Hot meals will be served from 12.00 p.m. to 2 p.m. and from 6 p.m. to 7.30 p.m. They will be served at the self-service restaurant on the first floor on Friday and at the cafeteria on the ground floor on Saturday, Sunday and Monday. On Thursday, March 24, all three restaurants will operate according to their usual opening times except for restaurant No. 1, which will close at 9 p.m. instead of 1 a.m.

  5. RESTAURANT and CAFETERIA SERVICES: ARRANGEMENTS for MAY 1st, 2003

    CERN Document Server

    2003-01-01

    1. Restaurants As Thursday, May 1st, is an official CERN holiday, restaurants no. 2 (DSR : Bldg. 504 - Meyrin) and no. 3 (Avenance : Bldg. 866 - Prévessin) will be closed as from Wednesday, April 30 at 18h00. They will reopen on Friday, May 2nd at 6h30 (rest. no. 2) and at 7h00 (rest. no. 3). On May 1st, a limited service will be provided by restaurant no. 1 (COOP : Bldg. 501 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. 2. Newspaper stand The newspaper kiosque run by restaurant no. 1 in building 501 will be closed. 3. Decentralised services No decentralised services (satellite cafétérias etc.) will operate on May 1st, but will resume their normal activites on Friday, May 2nd, except for those dependent on restaurant no. 3 (Prévessin site) which will not reopen until Monday, May 5, 2003.

  6. RESTAURANT AND CAFETERIA SERVICES ARRANGEMENTS FOR MAY 1ST, 2001

    CERN Multimedia

    Restaurant Supervisory Committee

    2001-01-01

    1. Restaurants As Tuesday, May 1st, is an official CERN holiday, restaurants no 2 (DSR : Bldg. 504 - Meyrin) and no 3 (Avenance : Bldg. 866 - Prévessin) will be closed as from Monday, April 30 at 18h00. They will reopen on Wednesday, May 2nd at 6h30 (rest. no 2) and at 7h00 (rest. no 3). On May 1st, a limited service will be provided by restaurant no. 1 (COOP : Bldg. 501 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. 2. Satellite cafétérias All satellite cafétérias will be closed on May 1st. They will all operate normally on Monday, April 30, except for buildings 17 (Meyrin), 865 and 892 (Prévessin) which will be closed. 3. Newspaper stand The newspaper kiosque in building 501 will be closed on May 1st.

  7. CERN Academic Training Programme 2008/2009

    CERN Multimedia

    HR Department

    2009-01-01

    LECTURE SERIES 23, 24 , 25 February 2009 11:00-12:00 - Main Auditorium, Bldg. 500-1-001 String Theory for Pedestrians Prof. Constantin Bachas / École normale supérieure, Paris, France This is a rapid non-technical course on string theory. Lecture 1 is an introduction to the basics of the subject: classical and quantum strings, D(irichlet) branes and string-string dualities. In lecture 2 I will discuss string unification of the fundamental forces, covering both its successes and failures. Finally in lecture 3 I will review string models of black hole microstates, the holographic gauge/gravity duality and, if time permits, potential applications to the physics of the strong interactions.. 5-6 March 2009 Thursday, 5 March 2009: 11:00-12:00, 14:00-15:00, Main Auditorium, Bldg. 500-1-001. Friday, 6 March 2009: 10:00-12:00, Main Auditorium, Bldg. 500-1-001 Recent developments at 3rd generation storage ring light sources Jean-Marc FILHOL, Deputy Director-General SOLEIL, France Over the last decade, many 3rd ge...

  8. Software Engineering for Human Spaceflight

    Science.gov (United States)

    Fredrickson, Steven E.

    2014-01-01

    The Spacecraft Software Engineering Branch of NASA Johnson Space Center (JSC) provides world-class products, leadership, and technical expertise in software engineering, processes, technology, and systems management for human spaceflight. The branch contributes to major NASA programs (e.g. ISS, MPCV/Orion) with in-house software development and prime contractor oversight, and maintains the JSC Engineering Directorate CMMI rating for flight software development. Software engineering teams work with hardware developers, mission planners, and system operators to integrate flight vehicles, habitats, robotics, and other spacecraft elements. They seek to infuse automation and autonomy into missions, and apply new technologies to flight processor and computational architectures. This presentation will provide an overview of key software-related projects, software methodologies and tools, and technology pursuits of interest to the JSC Spacecraft Software Engineering Branch.

  9. US/Russian Joint Film Test

    Science.gov (United States)

    Slater, Richard

    1996-01-01

    A joint U.S./Russian film test was conducted during MIR Mission 18 to evaluate the effects of radiation on photographic film during long-duration space flights. Two duplicate sets of film were flown on this MIR mission: one set was processed and evaluated by the NASA/JSC Photographic Laboratory, and the other by the RKK Energia's Photographic Laboratory in Moscow. This preliminary report includes only the results of the JSC evaluation (excluding the SN-10 film which was not available for evaluation at the time this report was written). The final report will include an evaluation by JSC of the SN-10 film and an evaluation of the test data by the RKK Energia. ISC's evaluation of the test data showed the positive film flown was damaged very little when exposed to approximately 8 rads of radiation. Two of the three negative films were significantly damaged and the third film was damaged only moderately.

  10. Plugging criteria for WWER SG tubes

    Energy Technology Data Exchange (ETDEWEB)

    Papp, L.; Wilam, M. [Vitkovice NPP Services (Switzerland); Herman, M. [Vuje, Trnava (Slovakia)

    1997-12-31

    At operated Czech and Slovak nuclear power plants the 80 % criteria for crack or other bulk defect depth is used for steam generator heat exchanging tubes plugging. This criteria was accepted as the recommendation of designer of WWER steam generators. Verification of this criteria was the objective of experimental program performed by Vitkovice, J.S.C., UJV Rez, J.S.C. and Vuje Trnava, J.S.C .. Within this program the following factors were studied: (1) Influence of secondary water chemistry on defects initiation and propagation, (2) Statistical evaluation of corrosion defects progression at operated SG, and (3) Determination of critical pressure for tube rupture as a function of eddy current indications. In this presentation items (2) and (3) are considered.

  11. Role and Place of the Joint-Stock Company -ECOMET-S- in the System of Solid Radioactive Waste Treatment Generated at the Nuclear Power Plants of the Russian Federation

    International Nuclear Information System (INIS)

    Gelbutovski, A.B.; Troshev, A.V.; Cheremisin, P.I.

    2009-01-01

    In this work the existing situation and ways of solving the problem of solid radioactive waste (SRW) management, resulting from the nuclear power industry are considered. It is shown, that one of the ways to manage SRW is transferring the task to a specialized enterprise. Such an enterprise in Russia is the Joint-Stock Company (JSC) 'ECOMET-S', whose main activity is providing services for processing and disposal of radioactive metal waste. They reduce the volume of SRW, ship it for burial and return metal return to industry for unlimited use. The basic provisions of the system of radioactive metal waste (hereinafter RMW) management developed by JSC 'ECOMET-S' are given. Information referring to technology and enterprise industrial capacity is represented. The results of the JSC 'ECOMET-S' activity for processing and disposal of low-activity radioactive metal waste from the Nuclear Power Plant (hereinafter NPP) of the Russian Federation are shown. (authors)

  12. Curation of US Martian Meteorites Collected in Antarctica

    Science.gov (United States)

    Lindstrom, M.; Satterwhite, C.; Allton, J.; Stansbury, E.

    1998-01-01

    To date the ANSMET field team has collected five martian meteorites (see below) in Antarctica and returned them for curation at the Johnson Space Center (JSC) Meteorite Processing Laboratory (MPL). ne meteorites were collected with the clean procedures used by ANSMET in collecting all meteorites: They were handled with JSC-cleaned tools, packaged in clean bags, and shipped frozen to JSC. The five martian meteorites vary significantly in size (12-7942 g) and rock type (basalts, lherzolites, and orthopyroxenite). Detailed descriptions are provided in the Mars Meteorite compendium, which describes classification, curation and research results. A table gives the names, classifications and original and curatorial masses of the martian meteorites. The MPL and measures for contamination control are described.

  13. Exploratory research for the development of a computer aided software design environment with the software technology program

    Science.gov (United States)

    Hardwick, Charles

    1991-01-01

    Field studies were conducted by MCC to determine areas of research of mutual interest to MCC and JSC. NASA personnel from the Information Systems Directorate and research faculty from UHCL/RICIS visited MCC in Austin, Texas to examine tools and applications under development in the MCC Software Technology Program. MCC personnel presented workshops in hypermedia, design knowledge capture, and design recovery on site at JSC for ISD personnel. The following programs were installed on workstations in the Software Technology Lab, NASA/JSC: (1) GERM (Graphic Entity Relations Modeler); (2) gIBIS (Graphic Issues Based Information System); and (3) DESIRE (Design Recovery tool). These applications were made available to NASA for inspection and evaluation. Programs developed in the MCC Software Technology Program run on the SUN workstation. The programs do not require special configuration, but they will require larger than usual amounts of disk space and RAM to operate properly.

  14. National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program 1988, volume 2

    Science.gov (United States)

    Bannerot, Richard B.; Goldstein, Stanley H.

    1989-01-01

    The 1988 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JCS. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began in 1965 at JSC and in 1964 nationally, are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objectives of the NASA Centers.

  15. Energy Systems Test Area (ESTA) Pyrotechnic Operations: User Test Planning Guide

    Science.gov (United States)

    Hacker, Scott

    2012-01-01

    The Johnson Space Center (JSC) has created and refined innovative analysis, design, development, and testing techniques that have been demonstrated in all phases of spaceflight. JSC is uniquely positioned to apply this expertise to components, systems, and vehicles that operate in remote or harsh environments. We offer a highly skilled workforce, unique facilities, flexible project management, and a proven management system. The purpose of this guide is to acquaint Test Requesters with the requirements for test, analysis, or simulation services at JSC. The guide includes facility services and capabilities, inputs required by the facility, major milestones, a roadmap of the facility s process, and roles and responsibilities of the facility and the requester. Samples of deliverables, facility interfaces, and inputs necessary to define the cost and schedule are included as appendices to the guide.

  16. Plugging criteria for WWER SG tubes

    Energy Technology Data Exchange (ETDEWEB)

    Papp, L; Wilam, M [Vitkovice NPP Services (Switzerland); Herman, M [Vuje, Trnava (Slovakia)

    1998-12-31

    At operated Czech and Slovak nuclear power plants the 80 % criteria for crack or other bulk defect depth is used for steam generator heat exchanging tubes plugging. This criteria was accepted as the recommendation of designer of WWER steam generators. Verification of this criteria was the objective of experimental program performed by Vitkovice, J.S.C., UJV Rez, J.S.C. and Vuje Trnava, J.S.C .. Within this program the following factors were studied: (1) Influence of secondary water chemistry on defects initiation and propagation, (2) Statistical evaluation of corrosion defects progression at operated SG, and (3) Determination of critical pressure for tube rupture as a function of eddy current indications. In this presentation items (2) and (3) are considered.

  17. Improving the efficiency of copper indium gallium (Di-selenide (CIGS solar cells through integration of a moth-eye textured resist with a refractive index similar to aluminum doped zinc oxide

    Directory of Open Access Journals (Sweden)

    M. Burghoorn

    2014-12-01

    Full Text Available Textured transparent conductors are widely used in thin-film silicon solar cells. They lower the reflectivity at interfaces between different layers in the cell and/or cause an increase in the path length of photons in the Si absorber layer, which both result in an increase in the number of absorbed photons and, consequently, an increase in short-circuit current density (Jsc and cell efficiency. Through optical simulations, we recently obtained strong indications that texturing of the transparent conductor in copper indium gallium (di-selenide (CIGS solar cells is also optically advantageous. Here, we experimentally demonstrate that the Jsc and efficiency of CIGS solar cells with an absorber layer thickness (dCIGS of 0.85 μm, 1.00 μm and 2.00 μm increase through application of a moth-eye textured resist with a refractive index that is sufficiently similar to AZO (nresist = 1.792 vs. nAZO = 1.913 at 633 nm to avoid large optical losses at the resist-AZO interface. On average, Jsc increases by 7.2%, which matches the average reduction in reflection of 7.0%. The average relative increase in efficiency is slightly lower (6.0%. No trend towards a larger relative increase in Jsc with decreasing dCIGS was observed. Ergo, the increase in Jsc can be fully explained by the reduction in reflection, and we did not observe any increase in Jsc based on an increased photon path length.

  18. Review of current activities to model and measure the orbital debris environment in low-earth orbit

    Science.gov (United States)

    Reynolds, R. C.

    A very active orbital debris program is currently being pursued at the NASA/Johnson Space Center (JSC), with projects designed to better define the current environment, to project future environments, to model the processes contributing to or constraining the growth of debris in the environment, and to gather supporting data needed to improve the understanding of the orbital debris problem and the hazard it presents to spacecraft. This paper is a review of the activity being conducted at JSC, by NASA, Lockheed Engineering and Sciences Company, and other support contractors, and presents a review of current activity, results of current research, and a discussion of directions for future development.

  19. Current enhancement in crystalline silicon photovoltaic by low-cost nickel silicide back contact

    KAUST Repository

    Bahabry, R. R.; Gumus, A.; Kutbee, A. T.; Wehbe, N.; Ahmed, S. M.; Ghoneim, M. T.; Lee, K. -T.; Rogers, J. A.; Hussain, M. M.

    2016-01-01

    We report short circuit current (Jsc) enhancement in crystalline silicon (C-Si) photovoltaic (PV) using low-cost Ohmic contact engineering by integration of Nickel mono-silicide (NiSi) for back contact metallization as an alternative to the status quo of using expensive screen printed silver (Ag). We show 2.6 mA/cm2 enhancement in the short circuit current (Jsc) and 1.2 % increment in the efficiency by improving the current collection due to the low specific contact resistance of the NiSi on the heavily Boron (B) doped Silicon (Si) interface.

  20. Curating NASA's Past, Present, and Future Extraterrestrial Sample Collections

    Science.gov (United States)

    McCubbin, F. M.; Allton, J. H.; Evans, C. A.; Fries, M. D.; Nakamura-Messenger, K.; Righter, K.; Zeigler, R. A.; Zolensky, M.; Stansbery, E. K.

    2016-01-01

    The Astromaterials Acquisition and Curation Office (henceforth referred to herein as NASA Curation Office) at NASA Johnson Space Center (JSC) is responsible for curating all of NASA's extraterrestrial samples. Under the governing document, NASA Policy Directive (NPD) 7100.10E "Curation of Extraterrestrial Materials", JSC is charged with "...curation of all extra-terrestrial material under NASA control, including future NASA missions." The Directive goes on to define Curation as including "...documentation, preservation, preparation, and distribution of samples for research, education, and public outreach." Here we describe some of the past, present, and future activities of the NASA Curation Office.

  1. Curating NASA's Future Extraterrestrial Sample Collections: How Do We Achieve Maximum Proficiency?

    Science.gov (United States)

    McCubbin, Francis; Evans, Cynthia; Zeigler, Ryan; Allton, Judith; Fries, Marc; Righter, Kevin; Zolensky, Michael

    2016-01-01

    The Astromaterials Acquisition and Curation Office (henceforth referred to herein as NASA Curation Office) at NASA Johnson Space Center (JSC) is responsible for curating all of NASA's extraterrestrial samples. Under the governing document, NASA Policy Directive (NPD) 7100.10E "Curation of Extraterrestrial Materials", JSC is charged with "The curation of all extraterrestrial material under NASA control, including future NASA missions." The Directive goes on to define Curation as including "... documentation, preservation, preparation, and distribution of samples for research, education, and public outreach." Here we describe some of the ongoing efforts to ensure that the future activities of the NASA Curation Office are working towards a state of maximum proficiency.

  2. NASA/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program, 1985. [Space Stations and Their Environments

    Science.gov (United States)

    Chilton, R. G. (Editor); Williams, C. E. (Editor)

    1986-01-01

    The 1985 NASA/ASEE Summer Faculty Fellowship Research Program was conducted by Texas A&M University and the Johnson Space Center. The ten week program was operated under the auspices of the American Society for Engineering Education (ASEE). The faculty fellows spent the time at JSC engaged in research projects commensurate with their interests and background and worked in collaboration with NASA/JSC colleagues. This document is a compilation of the final reports of their research during the summer of 1985.

  3. A perfect fuel supplier

    International Nuclear Information System (INIS)

    Terasvirta, R.

    2008-01-01

    WWER fuel market is dominated by the Russian fuel vendor JSC TVEL. There have been attempts to open up the market also for other suppliers, such as BNFL/Westinghouse for Finland, Czech Republic, and Ukraine. However, at the moment it seems that JSC TVEL is the only real alternative to supply fuel to WWER reactors. All existing fuel suppliers have certified quality management systems which put a special emphasis on the customer satisfaction. This paper attempts to define from the customer's point of view, what are the important issues concerning the customer satisfaction. (author)

  4. Johnson Space Center Health and Medical Technical Authority

    Science.gov (United States)

    Fogarty, Jennifer A.

    2010-01-01

    1.HMTA responsibilities: a) Assure program/project compliance with Agency health and medical requirements at identified key decision points. b) Certify that programs/projects comply with Agency health and medical requirements prior to spaceflight missions. c) Assure technical excellence. 2. Designation of applicable NASA Centers for HMTA implementation and Chief Medical Officer (CMO) appointment. 3. Center CMO responsible for HMTA implementation for programs and projects at the center. JSC HMTA captured in "JSC HMTA Implementation Plan". 4. Establishes specifics of dissenting opinion process consistent with NASA procedural requirements.

  5. Current enhancement in crystalline silicon photovoltaic by low-cost nickel silicide back contact

    KAUST Repository

    Bahabry, R. R.

    2016-11-30

    We report short circuit current (Jsc) enhancement in crystalline silicon (C-Si) photovoltaic (PV) using low-cost Ohmic contact engineering by integration of Nickel mono-silicide (NiSi) for back contact metallization as an alternative to the status quo of using expensive screen printed silver (Ag). We show 2.6 mA/cm2 enhancement in the short circuit current (Jsc) and 1.2 % increment in the efficiency by improving the current collection due to the low specific contact resistance of the NiSi on the heavily Boron (B) doped Silicon (Si) interface.

  6. STS-65 crewmembers participate in bench review at Boeing Building

    Science.gov (United States)

    1994-01-01

    Attired in clean suits, STS-65 Payload Commander (PLC) Richard J. Hieb (left) and Payload Specialist Chiaki Mukai examine the contents of a stowage locker during a bench review at Boeing's Flight Equipment Processing Facility (FEPF) near the Johnson Space Center (JSC). In the background, Commander Robert D. Cabana inspects additional equipment to be carried aboard the Space Shuttle Columbia, Orbiter Vehicle (OV) 102, for the scheduled July flight of the second International Microgravity Laboratory (IML-2) mission. Mukai represents Japan's National Space Development Agency (NASDA). Photo taken by NASA JSC contract photographer Scott A. Wickes.

  7. Astronaut Dale Gardner rehearses during EVA practice

    Science.gov (United States)

    1984-01-01

    Astronaut Dale A. Gardner, 51-A mission specialist, rehearses control of manned maneuvering unit (MMU) during a practice for an extravehicular activity (EVA). Gardner is in the Shuttle mockup and integration laboratory at JSC. Gardner handles a stinger device to make initial contact with one of the two satellites they will be working with.

  8. Atomic layer deposited ZnO:B as transparent conductive oxide for silicon heterojunction solar cells

    NARCIS (Netherlands)

    Gatz, H.A.; Koushik, D.; Rath, J.K.; Kessels, W.M.M.; Schropp, R.E.I.

    A key factor to improve the performance of silicon heterojunction solar cells (SHJ) is increasing their short circuit density (Jsc) by reducing the parasitic absorption of light in the front side of the cell. Therefore, we have investigated the replacement of the conventional sputtered ITO on the

  9. First ever full size CdTE luminescent down-shifting module

    NARCIS (Netherlands)

    Ross, D.; Alonso-Alvarez, D.; Fritsche, J.; Bauer, M.; Debije, M.G.; Fifield, R.M.; Richards, B.S.

    2012-01-01

    For the first time a luminescent down-shifting (LDS) layer has been applied to a full size PV module to improve its short-wavelength response. An average 4.3% relative increase in the short-circuit current density (JSC) was recorded for the Calyxo cadmium telluride (CdTe) modules after the best LDS

  10. 19 CFR Appendix to Part 102 - Textile and Apparel Manufacturer Identification

    Science.gov (United States)

    2010-04-01

    ... Morich Indo Fashion.” In Russia, other prefixes are used, such as “JSC,” “OAO,” “OOO,” and “ZAO.” These..., Sidney, Australia; AUCARJON88SID N. MINAMI & CO., LTD., 2-6, 8-Chome Isogami-Dori, Fukiai-Ku, Kobe, Japan...

  11. AN ENTERPRISE COMPETITIVE STRATEGY DEFINITION ON THE EXAMPLE OFJSC “CONFECTORY ENTERPRISE “PERMSKAYA

    OpenAIRE

    Pyankov, V.; Akimova, S.

    2013-01-01

    The article is devoted to the JSC “Confectionary enterprise “Permskaya” competitive strategy analysis. The article includes the enterprise’s function strategies, the drawbacks of strategic planning are singled out and the ways of its improvement are suggested.

  12. Латвия обсуждает будущее airBaltic

    Index Scriptorium Estoniae

    2011-01-01

    Läti valitsus peab lähiajal otsustama lennufirma airBaltic likiviidsuse küsimuse. Bookinghouse'i valdav firma JSC Interno Partners teatas, et lennufirma Air Baltic segane finantsseis sunnib neid ettevõtte piletimüügi peatama

  13. Long-term Service (O&M) Contract

    International Nuclear Information System (INIS)

    Salkov, E.

    2016-01-01

    The companies of State Corporation have the highest competencies in servicing VVER based NPPs. Rusatom Service JSC is a specialized service company, a single point of contact for maintenance of foreign NPPs. The company performs orders in seven countries and is a leader of service market in three countries. Its value of orders is about $500 million

  14. International Aerospace and Ground Conference on Lightning and Static Electricity (ICOLSE) (10th) and the Congres International Aeronautiq (17th) Held in Paris (France) on 10-13 June 1985

    Science.gov (United States)

    1985-06-13

    It is a function of the primary energy and for dielectrics and metal oxydes it may exceed unity. For a given primary energy, Jsc. = o(Ep)Jp...treatment, and this was the mounting procedure used at SRI in the past.) The samples were then cleaned with pure ethyl alcohol , rinsed with

  15. Mode of Action of Shigella Toxin: Effects on Ribosome Structure and Function

    Science.gov (United States)

    1988-05-01

    1974. Sindrome hemolitico uremico: reporte de 60 casos asociados a una epidemia de enterocolitis hemorragica. Revista Colombiana de Ped. Puericult. 28...1518-1521. 34. Fong, J.S.C., J-P de Chadarevian and B.S. Kaplan. 1982. Hemolytic-uremic syndrome: current concepts and management. Ped. Clin. North Am

  16. EVA Training and Development Facilities

    Science.gov (United States)

    Cupples, Scott

    2016-01-01

    Overview: Vast majority of US EVA (ExtraVehicular Activity) training and EVA hardware development occurs at JSC; EVA training facilities used to develop and refine procedures and improve skills; EVA hardware development facilities test hardware to evaluate performance and certify requirement compliance; Environmental chambers enable testing of hardware from as large as suits to as small as individual components in thermal vacuum conditions.

  17. Experience in developing control integrated multilevel systems for gas transport; Developpement de systemes integres de gestion multi-niveaux pour le transport du gaz

    Energy Technology Data Exchange (ETDEWEB)

    Kostyukov, V.Y. [NIIIS, (Russian Federation); Bityukov, V.S. [Gasprom, (Russian Federation)

    2000-07-01

    This report describes the experience of the integrated control multilevel system (IACS) development and implementation for gas transport at the regional enterprises of JSC 'Gasprom', specificity of IACS creation by the Russian enterprises on the basis of the technical and licensed basic software SCADA Geamatics purchased from AEG company under the contract. (authors)

  18. The Johnson Space Center Management Information Systems (JSCMIS): An interface for organizational databases

    Science.gov (United States)

    Bishop, Peter C.; Erickson, Lloyd

    1990-01-01

    The Management Information and Decision Support Environment (MIDSE) is a research activity to build and test a prototype of a generic human interface on the Johnson Space Center (JSC) Information Network (CIN). The existing interfaces were developed specifically to support operations rather than the type of data which management could use. The diversity of the many interfaces and their relative difficulty discouraged occasional users from attempting to use them for their purposes. The MIDSE activity approached this problem by designing and building an interface to one JSC data base - the personnel statistics tables of the NASA Personnel and Payroll System (NPPS). The interface was designed against the following requirements: generic (use with any relational NOMAD data base); easy to learn (intuitive operations for new users); easy to use (efficient operations for experienced users); self-documenting (help facility which informs users about the data base structure as well as the operation of the interface); and low maintenance (easy configuration to new applications). A prototype interface entitled the JSC Management Information Systems (JSCMIS) was produced. It resides on CIN/PROFS and is available to JSC management who request it. The interface has passed management review and is ready for early use. Three kinds of data are now available: personnel statistics, personnel register, and plan/actual cost.

  19. Improving efficiency (optimization) of CIGS thin film solar cell using ...

    African Journals Online (AJOL)

    Jsc ,Voc , FF and Quantum efficiency (QE) decrease due to absorption of electrons of electrons to the surface of back connection and their participation in recomposition. Efficiency increases from 20.3399% to 21.3721% by increasing impurity density of absorbent layer and efficiency increases to 28.9266% and the quantum ...

  20. SOLID BIOFUEL UTILIZATION IN VEGETABLE OIL PRODUCTION

    Directory of Open Access Journals (Sweden)

    Slusarenko V.

    2016-08-01

    Full Text Available The paper deals with questions of creating at JSC “Alimentarmash "in the last 20 years the technological equipment for the production of vegetable oils from oilseeds: from the press for the final spin to mini oilfactory, using as an energy source for heating the liquid coolant (Thermal oil "Arian" of solid biofuels - husk of sunflower seeds.

  1. Astronaut C. Michael Foale is briefed on use of Sky Genie

    Science.gov (United States)

    1994-01-01

    Astronaut C. Michael Foale, STS-63 mission specialist, is briefed on the use of Sky Genie device by Karin L. Porter. The device would aid in emergency egress operations aboard a troubled Space Shuttle. Porter, an employee of Rockwell International, helps train astronauts in egress procedures at JSC's Shuttle mockup and integration laboratory.

  2. ASSESSMENT OF MERCURY POLLUTION TO THE IRTYSH RIVER IN PAVLODAR, KAZAKHSTAN

    Science.gov (United States)

    The threat of polluting the river Irtysh by mercury was caused by high losses of Hg during 1975-1993 during chlor-alkali production at the former PO "Khimprom", Pavlodar, North-East Kazakhstan (at present JSC "Pavlodar Chemical Plant"). These losses were the highest among simila...

  3. Large-scale production of PWO scintillation elements for CMS ECAL

    International Nuclear Information System (INIS)

    Annenkov, A.; Auffray, E.; Drobychev, G.; Korzhik, M.; Kostylev, V.; Kovalev, O.; Lecoq, P.; Ligoun, V.; Missevitch, O.; Zouevski, R.

    2005-01-01

    JSC Bogoroditsk Technical Chemical Plant, BTCP, has produced up to date more than 20,000 lead tungstate scintillation elements for the electromagnetic calorimeter of CMS Collaboration. Here we report on the status of the crystal production and results of the quality insurance program, which is performed by the Collaboration in cooperation with BTCP to keep crystal properties within specifications

  4. Multi-Purpose Crew Vehicle Camera Asset Planning: Imagery Previsualization

    Science.gov (United States)

    Beaulieu, K.

    2014-01-01

    Using JSC-developed and other industry-standard off-the-shelf 3D modeling, animation, and rendering software packages, the Image Science Analysis Group (ISAG) supports Orion Project imagery planning efforts through dynamic 3D simulation and realistic previsualization of ground-, vehicle-, and air-based camera output.

  5. 76 FR 55872 - Certain Frozen Fish Fillets From the Socialist Republic of Vietnam: Preliminary Results and...

    Science.gov (United States)

    2011-09-09

    ... concludes that there is a significant potential for the manipulation of price or production. For further... 29, 2010) (``Initiation''). \\6\\ This includes: (1) An Giang Fisheries Import and Export Joint Stock...) Anvifish Joint Stock Company (aka Anvifish JSC); (4) Asia Commerce Fisheries Joint Stock Company...

  6. The short circuit current improvement in P3HT:PCBM based polymer solar cell by introducing PSBTBT as additional electron donor.

    Science.gov (United States)

    Sun, Lu; Shen, Liang; Mengd, Fanxu; Xu, Peng; Guo, Wenbin; Ruan, Shengping

    2014-05-01

    Here we demonstrate the influence of electron-donating polymer addition on the performance of poly(3-hexylthiophene) (P3HT):1 -(3-methoxycarbonyl)-propyl-1-phenyl-(6,6) C61 (PCBM) solar cells. Poly[(4,42-bis(2-ethylhexyl) dithieno [3,2-b:22,32-d] silole)-2,6-diylalt-(2,1,3-benzothiadiazole)-4,7-diyl] (PSBTBT) was chosen as the electron-donating polymer to improve the short circuit current (J(sc)) due to its distinct absorption in the near-IR range and similar HOMO level with that of P3HT. In the study, we found that J(sc) was improved for ternary blend (P3HT:PSBTBT:PCBM) solar cells. The dependence of device performance was investigated. J(sc) got decreased with increasing the ratio of PSBTBT. Result showed that J(sc) of ternary blend solar cells was improved greatly after thermal annealing at 150 degrees C, close to that of the binary blend (PSBTBT:PCBM) solar cells.

  7. Regulation of major cultural components for designing a cost ...

    African Journals Online (AJOL)

    acer

    2015-04-22

    Apr 22, 2015 ... protein) synthesis by Bacillus thuringiensis (Bt) kurstaki HD-73 and indigenous Bt JSc1 harboring potential ... The cost of raw materials is one of the principal costs involved .... t- test analysis, the final formulation of the medium was 10% ..... ratio interacts with initial concentration of total solids on insecticidal.

  8. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... College Station, TX 77843. Present address: Barrens Consulting Co., 273 Pepe's Farm Road, Milford, CT 06470. Department of Physics, Sam Houston State University, Huntsville, TX 77341. Present address: SN4, NASA-JSC, Houston, TX 77858. Shell Development Corporation, P.O. Box 481, Houston, Texas 77001.

  9. 77 FR 15053 - Manual for Courts-Martial; Proposed Amendments

    Science.gov (United States)

    2012-03-14

    ..., harassment of a victim. c. Commenter recommended renaming the title of M.R.E. 412(c)(3) from ``Privacy'' to... definition of ``sexual behavior'' in M.R.E. 412 to give practitioners specific guidance on what behavior is intended by the rule. The JSC rejected this proposal in recognition that the term ``sexual behavior...

  10. STS-71 astronauts and cosmonauts listen to briefing during training session

    Science.gov (United States)

    1994-01-01

    A number of Russian cosmonauts and an American astronaut listen to a briefing on launch and landing emergency situations during a training session in the Systems Integration Facility at JSC. Scheduled to launch aboard the Space Shuttle Atlantis with the S

  11. STS-9 payload specialists and backup in training session

    Science.gov (United States)

    1983-01-01

    Two Spacelab 1 payload specialists and a backup for that flight prepare for a training session in the JSC mockup and integration laboratory. Fully decked out in the Shuttle constant wear garments (foreground) are Ulf Merbold, left, and Byron K. Licktenberg, prime crewmembers on the STS-9 team. In civilian clothes is payload specialist backup Michael L. Lampton.

  12. STS-9 payload specialist Merbold and backup Ockels in training session

    Science.gov (United States)

    1983-01-01

    STS-9 payload specialist Ulf Merbold, right, a West German physicist and backup Wubbo Ockels, a Dutch scientist, are pictured in a training session in JSC's Shuttle mockup and integration laboratory. In this view Ockels appears to be showing Merbold how to operate a camera.

  13. DEVELOPMENT OF THE REFERENCE MATERIALS PRODUCTION BRANCH IN THE JOINT STOCK COMPANY "THE GULIDOV KRASNOYARSK NON-FERROUS METALS PLANT"

    Directory of Open Access Journals (Sweden)

    K. A. Shatnykh

    2015-01-01

    Full Text Available The article deals with the development of the branch for the reference materials production in the Joint Stock Company "The Gulidov Krasnoyarsk Non-Ferrous Metals Plant" (JSC "Krastsvetmet". Here the most important workings for reference materials including the work for the London precious metal exchange, current and future works are stated.

  14. RESULTS OF THE FIRST MI-171A2 FLYING LABORATORY TEST PHASE

    Directory of Open Access Journals (Sweden)

    V. A. Ivchin

    2014-01-01

    Full Text Available The present publication describes the results of the first stage of the flying laboratory (Mi-171 helicopter flight tests performed at Mil Moscow Helicopter Plant, JSC facilities. Main rotor components with blades made of polymer composite materials and X-type tail rotor were tested on the Mi-171 № 14987, flying laboratory, under Mi-171A Helicopter Retrofit Program.

  15. RESULTS OF THE FIRST MI-171A2 FLYING LABORATORY TEST PHASE

    OpenAIRE

    V. A. Ivchin; K. Y. Samsonov

    2014-01-01

    The present publication describes the results of the first stage of the flying laboratory (Mi-171 helicopter) flight tests performed at Mil Moscow Helicopter Plant, JSC facilities. Main rotor components with blades made of polymer composite materials and X-type tail rotor were tested on the Mi-171 № 14987, flying laboratory, under Mi-171A Helicopter Retrofit Program.

  16. Orbiter Entry Aerothermodynamics Practical Engineering and Applied Research

    Science.gov (United States)

    Campbell, Charles H.

    2009-01-01

    The contents include: 1) Organization of the Orbiter Entry Aeroheating Working Group; 2) Overview of the Principal RTF Aeroheating Tools Utilized for Tile Damage Assessment; 3) Description of the Integrated Tile Damage Assessment Team Analyses Process; 4) Space Shuttle Flight Support Process; and 5) JSC Applied Aerosciences and CFD Branch Applied Research Interests.

  17. Rational design of tetraphenylethylene-based luminescent down-shifting molecules: photophysical studies and photovoltaic applications in a CdTe solar cell from small to large units.

    Science.gov (United States)

    Li, Yilin; Li, Zhipeng; Ablekim, Tursunjan; Ren, Tianhui; Dong, Wen-Ji

    2014-12-21

    A rational design strategy of novel fluorophores for luminescent down-shifting (LDS) application was proposed and tested in this paper. Three new fluorophores (1a-c) with specific intramolecular charge transfer (ICT) and aggregation-induced emission (AIE) characteristics were synthesized as LDS molecules for increasing the output short circuit current density (Jsc) of a CdTe solar cell. Photophysical studies of their solution and solid states, and photovoltaic measurements of their PMMA solid films applied on a CdTe solar cell suggested that the specific spectroscopic properties and Jsc enhancement effects of these molecules were highly related to their chemical structures. The Jsc enhancement effects of these fluorophores were measured on both a CdTe small cell and a large panel. An increase in the output Jsc by as high as 5.69% for a small cell and 8.88% for a large panel was observed. Compared to a traditional LDS molecule, Y083, these fluorophores exhibited more superior capabilities of LDS.

  18. 32 CFR 152.3 - Policy.

    Science.gov (United States)

    2010-07-01

    ... Department of Defense OFFICE OF THE SECRETARY OF DEFENSE REGULATIONS PERTAINING TO MILITARY JUSTICE REVIEW OF... Defense shall review the Manual for Courts-Martial annually, and, as appropriate, propose legislation... body of military criminal law and procedure. The role of the JSC furthers these responsibilities. Under...

  19. National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program: 1995. Volume 1

    Science.gov (United States)

    Hyman, William A. (Editor); Sickorez, Donn G. (Editor)

    1996-01-01

    The objectives of the JSC NASA/ASEE Summer Faculty Fellowship Program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of the participants' institutions; and (4) to contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA/JSC colleague. In addition to the faculty participants, the 1995 program included five students. This document is a compilation of the first fifteen of twenty-seven final reports on the research projects completed by the faculty fellows and visiting students during the summer of 1995. The reports of two of the students are integral with that of the respective fellow. Three students wrote separate reports included in Volume 2.

  20. Information Operations

    Science.gov (United States)

    2006-02-13

    restricted frequency list (JRFL). This list specifies protected, guarded, and taboo frequencies that should not normally be disrupted without prior... frequency list JROC Joint Requirement Oversight Council JSC Joint Spectrum Center JTCB joint targeting coordination board JTF joint task force JWAC joint