ASTP crewmen in Apollo Command Module Trainer during training session at JSC
1975-01-01
The three members of the American ASTP prime crew are photographed inside the Apollo Command Module (CM) trainer in a water tank in bldg 260 during water egress training at JSC. They are, left to right, Astronauts Thomas P. Stafford, commander; Vance D. Brand, command module pilot; and Donald K. Slayton, docking module pilot (23430); Slayton attaches his life preserver as he egresses an Apollo Command Module trainer in a water tank in bldg 260 during water egresss training at JSC. Astronauts Brand (on left) and Stafford have already egressed the trainer and are seated in a three-man life raft.
STS-29 Commander Coats in JSC fixed base (FB) shuttle mission simulator (SMS)
1986-01-01
STS-29 Discovery, Orbiter Vehicle (OV) 103, Commander Michael L. Coats sits at commanders station forward flight deck controls in JSC fixed base (FB) shuttle mission simulator (SMS). Coats, wearing communications kit assembly headset and flight coveralls, looks away from forward control panels to aft flight deck. Pilots station seat back appears in foreground. FB-SMS is located in JSC Mission Simulation and Training Facility Bldg 5.
STS-30 crewmembers pose for informal portrait on JSC FB-SMS middeck
1988-01-01
STS-30 Atlantis, Orbiter Vehicle (OV) 104, crewmembers pause briefly from their training schedule to pose for informal portrait in JSC fixed base (FB) shuttle mission simulator (SMS). On FB-SMS middeck are (left to right) Commander David M. Walker, Mission Specialist (MS) Mark C. Lee, MS Mary L. Cleave, Pilot Ronald J. Grabe, and MS Norman E. Thagard. FB-SMS is located in JSC's Mission Simulation and Training Facility Bldg 5.
STS-49 Endeavour, Orbiter Vehicle (OV) 105, Planning Team in MCC Bldg 30 FCR
1992-01-01
STS-49 Endeavour, Orbiter Vehicle (OV) 105, Planning Team with Flight Director (FD) James M. Heflin, Jr (front right next to ship model) poses in JSC's Mission Control Center (MCC) Bldg 30 Flight Control Room (FCR). The group stands in front of visual displays projecting STS-49 data and ground track map.
STS-37 Mission Specialist (MS) Godwin during simulation in JSC's FB-SMS
1991-01-01
STS-37 Mission Specialist (MS) Linda M. Godwin rehearses some phases of her scheduled duties on the middeck of the fixed-based (FB) shuttle mission simulator (SMS) located in JSC's Mission Simulation and Training Facility Bldg 5. Godwin is inspecting supplies stowed in the middeck lockers during this unsuited simulation.
STS-30 Pilot Ronald J. Grabe during preflight press conference at JSC
1989-01-01
During preflight press conference, STS-30 Pilot Ronald J. Grabe answers a question from the news media. The event was held in the JSC Auditorium and Public Affairs Facility Bldg 2 briefing room. STS-30 mission will fly onboard Atlantis, Orbiter Vehicle (OV) 104, and is scheduled for an April 28 liftoff.
JSC technician checks STS-44 DSO 316 bioreactor and rotating wall vessel hdwr
1991-01-01
JSC technician Tacey Prewitt checks the progress on a bioreactor experiment in JSC's Life Sciences Laboratory Bldg 37 biotechnology laboratory. Similar hardware is scheduled for testing aboard Atlantis, Orbiter Vehicle (OV) 104, during STS-44. Detailed Supplementary Objective (DSO) 316 Bioreactor/Flow and Particle Trajectory in Microgravity will checkout the rotating wall vessel hardware and hopefully will confirm researchers' theories and calculations about how flow fields work in space. Plastic beads of various sizes rather than cell cultures are being flown in the vessel for the STS-44 test.
STS-37 Mission Specialist (MS) Ross during simulation in JSC's FB-SMS
1991-01-01
STS-37 Mission Specialist (MS) Jerry L. Ross 'borrows' the pilots station to rehearse some of his scheduled duties for his upcoming mission. He is on the flight deck of the fixed-based (FB) shuttle mission simulator (SMS) during this unsuited simulation. The SMS is part of JSC's Mission Simulation and Training Facility Bldg 5.
STS-31 crewmembers review checklist with instructor on JSC's FB-SMS middeck
1988-01-01
STS-31 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) Bruce McCandless II (left) and Pilot Charles F. Bolden (right) discuss procedures with a training instructor on the middeck of JSC's fixed-based (FB) Shuttle Mission Simulator (SMS). The three are pointing to a checklist during this training simulation in the Mission Simulation and Training Facility Bldg 5.
ASTP crewmen have a meal during training session at JSC
1975-01-01
Three ASTP crewmen have a meal in the Apollo Command Module trainer in bldg 35 during Apollo Soyuz Test Project (ASTP) joint crew training at JSC. They are, left to right, Cosmonaut Aleksay A. Leonov, commander of the Soviet ASTP first (prime) crew; Astronaut Donald K. Slayton, docking module pilot of the American ASTP prime crew; and Astronaut Thomas P. Stafford, commander of the American ASTP prime crew.
STS-31 crewmembers during simulation on the flight deck of JSC's FB-SMS
1988-01-01
On the flight deck of JSC's fixed based (FB) shuttle mission simulator (SMS), Mission Specialist (MS) Steven A. Hawley (left), on aft flight deck, looks over the shoulders of Commander Loren J. Shriver, seated at the commanders station (left) and Pilot Charles F. Bolden, seated at the pilots station and partially blocked by the seat's headrest (right). The three astronauts recently named to the STS-31 mission aboard Discovery, Orbiter Vehicle (OV) 103, go through a procedures checkout in the FB-SMS. The training simulation took place in JSC's Mission Simulation and Training Facility Bldg 5.
STS-37 crewmembers train in JSC's FB shuttle mission simulator (SMS)
1991-01-01
STS-37 Commander Steven R. Nagel (left) and Mission Specialist (MS) Jerry L. Ross rehearse some of their scheduled duties on the flight deck of JSC's fixed-based (FB) shuttle mission simulator (SMS) located in the Mission Simulation and Training Facility Bldg 5. During the unsuited simulation, Nagel reviews checklist while seated at the commanders station as Ross looks on from the pilots station.
STS-31 Pilot Bolden with beverages on the FB-SMS middeck during JSC training
1988-01-01
STS-31 Pilot Charles F. Bolden holds three beverage containers while in front of the galley on the middeck of the fixed based (FB) shuttle mission simulator (SMS) during a training simulation at JSC's Mission Simulation and Training Facility Bldg 5. From the middeck, Bolden, wearing lightweight headset, simulates a communications link with ground controllers and fellow crewmembers.
STS-44 Atlantis, OV-104, Pilot Henricks in FB-SMS training at JSC
1991-01-01
STS-44 Atlantis, Orbiter Vehicle (OV) 104, Pilot Terence T. Henricks, seated at the pilots station on the forward flight deck, reviews checklists before a flight simulation in the Fixed Base (FB) Shuttle Mission Simulator (SMS) located in JSC's Mission Simulation and Training Facility Bldg 5. Surrounding Henricks are the seat back, the overhead panels, forward panels, and forward windows.
STS-49 Endeavour, Orbiter Vehicle (OV) 105, Orbit Team O1 in MCC Bldg 30 FCR
1992-01-01
STS-49 Endeavour, Orbiter Vehicle (OV) 105, Orbit Team 1 (O1) poses in front of large display screens in JSC's Mission Control Center (MCC) Bldg 30 Flight Control Room (FCR) for group portrait. Lead Flight Director (FD) Granvil A. Pennington stands next to a model of the James Cook's ship, the Endeavour (left). Astronaut and Spacecraft Communicator (CAPCOM) John H. Casper stands at the right of the model.
STS-49 crew in JSC's FB Shuttle Mission Simulator (SMS) during simulation
1992-01-01
STS-49 Endeavour, Orbiter Vehicle (OV) 105, crewmembers participate in a simulation in JSC's Fixed Base (FB) Shuttle Mission Simulator (SMS) located in the Mission Simulation and Training Facility Bldg 5. Wearing launch and entry suits (LESs) and launch and entry helmets (LEH) and seated on the FB-SMS middeck are (left to right) Mission Specialist (MS) Thomas D. Akers, MS Kathryn C. Thornton, and MS Pierre J. Thuot.
STS-48 MS Buchli and MS Gemar on MB SMS middeck during JSC training session
1991-01-01
STS-48 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) James F. Buchli (left) and MS Charles D. Gemar listen to instructions while on the middeck of JSC's Motion Based (MB) Shuttle Mission Simulator (SMS). Buchli and Gemar are reviewing inflight procedures during this preflight familiarization session held in the Mission Simulation and Training Facility Bldg 5.
STS-44 Atlantis, OV-104, MS Musgrave on FB-SMS middeck during JSC training
1991-01-01
STS-44 Atlantis, Orbiter Vehicle (OV) 104, Mission Specialist (MS) F. Story Musgrave, wearing lightweight headset (HDST), adjusts controls on communications module mounted on a middeck overhead panel. Musgrave is on the middeck of the Fixed Base (FB) Shuttle Mission Simulator (SMS) located in JSC's Mission Simulation and Training Facility Bldg 5. The STS-44 crewmembers are participating in a flight simulation.
ASTP crewmen in Docking Module trainer during training session at JSC
1975-01-01
An interior view of the Docking Module trainer in bldg 35 during Apollo Soyuz Test Project (ASTP) joint crew training at JSC. Astronaut Thomas P. Stafford, commander of the American ASTP prime crew, is on the right. The other crewman is Cosmonaut Aleksey A. Leonov, commander of the Soviet ASTP prime crew. The training session simulated activities on the second day in Earth orbit. The Docking Module is designed to link the Apollo and Soyuz spacecraft.
STS-26 crew trains in JSC fixed-based (FB) shuttle mission simulator (SMS)
1987-01-01
STS-26 Discovery, Orbiter Vehicle (OV) 103, crewmembers (left to right) Commander Frederick H. Hauck, Pilot Richard O. Covey, Mission Specialist (MS) George D. Nelson, MS David C. Hilmers, and MS John M. Lounge pose on the middeck in fixed-based (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5. A simulation for their anticipated June 1988 flight began 10-20-87.
ASTP crewmen in Soyuz orbital module mock-up during training session at JSC
1975-01-01
An interior view of the Soyuz orbital module mock-up in bldg 35 during Apollo Soyuz Test Project (ASTP) joint crew training at JSC. The ASTP crewmen are Astronaut Vance D. Brand (on left), command module pilot of the American ASTP prime crew; and Cosmonaut Valeriy N. Kubasov, engineer on the Soviet ASTP first (prime) crew. The training session simulated activities on the second day in Earth orbit.
STS-46 crewmembers participate in Fixed Base (FB) SMS training at JSC
1992-01-01
STS-46 Atlantis, Orbiter Vehicle (OV) 104, Pilot Andrew M. Allen hands Mission Specialist (MS) and Payload Commander (PLC) Jeffrey A. Hoffman checklists from middeck locker MF43E during training session in JSC's fixed base (FB) shuttle mission simulator (SMS) located in Mission Simulation and Training Facility Bldg 5. European Space Agency (ESA) MS Claude Nicollier outfitted with communications kit assembly headset (HDST) and equipment looks beyond Hoffman to the opposite side of the middeck.
STS-44 Atlantis, OV-104, crewmembers participate in JSC FB-SMS training
1991-01-01
STS-44 Atlantis, Orbiter Vehicle (OV) 104, Commander Frederick D. Gregory and Pilot Terence T. Henricks are stationed at their appointed positions on the forward flight deck of the Fixed Base (FB) Shuttle Mission Simulator (SMS) in JSC's Mission Simulation and Training Facility Bldg 5. Gregory (left) in the commanders seat and Henricks (right) in the pilots seat look back toward aft flight deck and the photographer. Seat backs appear in the foreground and forward flight deck control panels in the background.
STS-48 MS Gemar uses laptop during training session in JSC's MB SMS
1991-01-01
STS-48 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) Charles D. Gemar, wearing lightweight headset, enters data into a portable laptop computer on the middeck of JSC's Motion Based (MB) Shuttle Mission Simulator (SMS). Gemar is participating in a preflight familiarization session in the MB-SMS located in the Mission Simulation and Training Facility Bldg 5. Visible to Gemar's right is a stowed extravehicular mobility unit (EMU) and on his left are forward locker mockups.
STS-57 crewmembers train in JSC's FB Shuttle Mission Simulator (SMS)
1993-01-01
STS-57 Endeavour, Orbiter Vehicle (OV) 105, Mission Specialist 2 (MS2) Nancy J. Sherlock, holding computer diskettes and procedural checklist, discusses equipment operation with Commander Ronald J. Grabe on the middeck of JSC's fixed based (FB) shuttle mission simulator (SMS). Payload Commander (PLC) G. David Low points to a forward locker location as MS3 Peter J.K. Wisoff switches controls on overhead panels MO42F and MO58F, and MS4 Janice E. Voss looks on. The FB-SMS is located in the Mission Simulation and Training Facility Bldg 5.
STS-44 Atlantis, OV-104, crewmembers participate in FB-SMS training at JSC
1991-01-01
STS-44 Atlantis, Orbiter Vehicle (OV) 104, Commander Frederick D. Gregory (left) and Pilot Terence T. Henricks, positioned at their appointed stations on the forward flight deck, are joined by Mission Specialist (MS) F. Story Musgrave (center) and MS James S. Voss (standing). The crewmembers are participating in a flight simulation in the Fixed Base (FB) Shuttle Mission Simulator (SMS) located in JSC's Mission Simulation and Training Facility Bldg 5. A maze of panel switches appear overhead and in the background.
48 CFR 1323.404-70 - DOC affirmative procurement program.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false DOC affirmative procurement program. 1323.404-70 Section 1323.404-70 Federal Acquisition Regulations System DEPARTMENT OF..., OCCUPATIONAL SAFETY, AND DRUG-FREE WORKPLACE Use of Recovered Materials 1323.404-70 DOC affirmative procurement...
6 CFR 13.23 - Subpoenas for attendance at hearing.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Subpoenas for attendance at hearing. 13.23 Section 13.23 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.23 Subpoenas for attendance at hearing. (a) A party wishing to procure the...
STS-37 crewmembers test CETA hand cart during training session in JSC's WETF
1989-01-01
STS-37 Atlantis, Orbiter Vehicle (OV) 104, Mission Specialist (MS) Jerry L. Ross and MS Jerome Apt test crew and equipment translation aid (CETA) manual hand over hand cart during underwater session in JSC's Weightless Environment Training Facility (WETF) Bldg 29. Wearing an extravehicular mobility unit (EMU), Ross pulls the CETA manual cart along the rail while Apt holds onto the back of the cart. The test will determine how difficult it is to maneuver cargo in such a manner when it is done in space on STS-37. The goal is to find the best method for astronauts to move around the exterior of Space Station Freedom (SSF).
Renovation of the outside lighting - Bldg. 112 zone
GS Department
2010-01-01
Due to the renovation of the outside lighting, the traffic will be disrupted along “Route Feynman”. From the water tower (Bldg. 227) to Restaurant Nr. 2 (Bldg. 504) between 18 and 30 August. We recommend great caution. Thank you for your understanding. SEM Group
7 CFR 51.1323 - Serious damage.
2010-01-01
... frost injury, 15 percent of the surface. (3) On Anjou, smooth solid or smooth netlike russeting when the... Standards for Winter Pears 1 Definitions § 51.1323 Serious damage. Serious damage means any injury or defect...) Drought spot when more than two in number, or where the external injury affects an aggregate area of more...
Mechanisms of microbial oil recovery by Clostridium acetobutylicum and Bacillus strain JF-2
Energy Technology Data Exchange (ETDEWEB)
Marsh, T.L.; Zhang, X.; Knapp, R.M.; McInerney, M.J.; Sharma, P.K.; Jackson, B.E.
1995-12-31
Core displacement experiments at elevated pressures were conducted to determine whether microbial processes are effective under conditions that simulate those found in an actual oil reservoir. The in-situ growth of Clostridium acetobutylicum and Bacillus strain JF-2 resulted in the recovery of residual oil. About 21 and 23% of the residual oil was recovered by C. acetobutylicum and Bacillus strain JF-2, respectively. Flooding cores with cell-free culture fluids of C. acetobutylicum with and without the addition of 50 mM acetone and 100 mM butanol did not result in the recovery of residual oil. Mathematical simulations showed that the amount of gas produced by the clostridial fermentation was not showed that the amount of gas produced by the clostridial fermentation was not sufficient to recover residual oil. Oil recovery by Bacillus strain JF-2 was highly correlated to surfactant production. A biosurfactant-deficient mutant of strain JF-2 was not capable of recovering residual oil. These data show that surfactant production is an important mechanism for microbially enhanced oil recovery. The mechanism for oil recovery by C. acetobutylicum is not understood at this time, but the production of acids, solvents, or gases alone cannot explain the observed increases in oil recovery by this organism.
NCBI nr-aa BLAST: CBRC-PCAP-01-1323 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-PCAP-01-1323 ref|YP_245505.1| NADH dehydrogenase subunit 4 [Haematobia irritans irrita...ns] gb|AAY56479.1| NADH dehydrogenase subunit 4 [Haematobia irritans irritans] YP_245505.1 0.55 26% ...
NCBI nr-aa BLAST: CBRC-CREM-01-1323 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-CREM-01-1323 ref|YP_955783.1| ABC transporter-related protein [Mycobacterium vanba...alenii PYR-1] gb|ABM15777.1| ABC transporter-related protein [Mycobacterium vanbaalenii PYR-1] YP_955783.1 2e-42 29% ...
NCBI nr-aa BLAST: CBRC-SARA-01-1323 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-SARA-01-1323 ref|NP_001008277.1| rhodopsin [Canis lupus familiaris] ref|XP_855...608.1| PREDICTED: rhodopsin [Canis familiaris] emb|CAA70209.1| unnamed protein product [Canis familiaris] NP_001008277.1 2e-62 94% ...
Center Innovation Fund: JSC CIF (also includes JSC IRAD) Program
National Aeronautics and Space Administration — JSC provides and applies its preeminent capabilities in science and technology to develop, operate, and integrate human exploration missions. The Center...
1993-01-01
The primary roles and missions of JSC incorporate all aspects of human presence in space. Therefore, the Center is involved in the development of technology that will allow humans to stay longer in Earth orbit, allow safe flight in space, and provide capabilities to explore the Moon and Mars. The Center's technology emphasis areas include human spacecraft development, human support systems and infrastructure, and human spacecraft operations. Safety and reliability are critical requirements for the technologies that JSC pursues for long-duration use in space. One of the objectives of technology development at the Center is to give employees the opportunity to enhance their technological expertise and project management skills by defining, designing, and developing projects that are vital to the Center's strategy for the future. This report is intended to communicate within and outside the Agency our research and technology (R&T) accomplishments, as well as inform Headquarters program managers and their constituents of the significant accomplishments that have promise for future Agency programs. While not inclusive of all R&T efforts, the report presents a comprehensive summary of JSC projects in which substantial progress was made in the 1992 fiscal year. At the beginning of each project description, names of the Principal Investigator (PI) and the Technical Monitor (TM) are given, followed by their JSC mail codes or their company or university affiliations. The funding sources and technology focal points are identified in the index.
Li, Gang; Liu, Keyu; Du, Xinhui
2018-03-01
Long non-coding RNA taurine upregulated gene 1 (TUG1) is reported to be a vital regulator of the progression of various cancers. This study aimed to explore the exact roles and molecular mechanisms of TUG1 in osteosarcoma (OS) development. Real-time quantitative PCR was applied to detect the expressions of TUG1 and microRNA-132-3p (miR-132-3p) in OS tissues and cells. Western blot was performed to measure protein levels of sex determining region Y-box 4 (SOX4). Cell viability was assessed using XTT assay. Cell apoptosis was evaluated using flow cytometry and caspase-3 activity detection assays. Bioinformatics analysis and luciferase reporter experiments were employed to confirm relationships among TUG1, miR-132-3p, and SOX4. TUG1 was highly expressed in human OS tissues, OS cell lines, and primary OS cells. TUG1 knockdown hindered proliferation and induced apoptosis in human OS cell lines and primary OS cells. Moreover, TUG1 inhibited miR-132-3p expression by direct interaction, and introduction of miR-132-3p inhibitor partly abrogated the effect of TUG1 knockdown on the proliferation and apoptosis of OS cells. Furthermore, SOX4 was validated as a target of miR-132-3p. Further functional analyses revealed that miR-132-3p inhibited proliferation and induced apoptosis of OS cells, while this effect was greatly abated following SOX4 overexpression. Moreover, TUG1 knockdown suppressed proliferation and promoted apoptosis by upregulating miR-132-3p and downregulating SOX4 in primary OS cells. TUG1 facilitated proliferation and suppressed apoptosis by regulating the miR-132-3p/SOX4 axis in human OS cell lines and primary OS cells. This finding provides a potential target for OS therapy. © Copyright: Yonsei University College of Medicine 2018
DEFF Research Database (Denmark)
Davies, Genna; Rolle, Anna-Maria; Maurer, Andreas
2017-01-01
and magnetic resonance imaging (immunoPET/MRI) using a [64Cu] DOTA-labeled mouse monoclonal antibody (mAb), mJF5, specific to Aspergillus. To enable translation of the tracer to the clinical setting, we report here the development of a humanised version of the antibody (hJF5), and pre-clinical imaging of lung...... of the fungus from invasive lung biopsy, considered the gold standard for IPA detection, is slow and often not possible in critically ill patients. In a previous study, we reported the development of a novel non-invasive procedure for IPA diagnosis based on antibody-guided positron emission tomography...... infection using a [64Cu] NODAGA-hJF5 tracer. The humanised antibody tracer shows a significant increase in in vivo biodistribution in A. fumigatus infected lungs compared to its radiolabeled murine counterpart [64Cu] NODAGA-mJF5. Using reverse genetics of the pathogen, we show that the antibody binds...
Energy Technology Data Exchange (ETDEWEB)
M.J. McInerney; M. Folmsbee; D. Nagle
2004-05-31
Our work focuses on the use of microorganisms to recover petroleum hydrocarbons that remain entrapped after current recovery technologies reach their economic limit. Capillary forces between the hydrocarbon and aqueous phases are largely responsible for trapping the hydrocarbons in the pores of the rock and large reductions in the interfacial tension between the hydrocarbon and aqueous phases are needed for hydrocarbon mobilization (1-3, 10, 11). Microorganisms produce a variety of biosurfactants (4), several of which generate the ultra low interfacial tensions needed for hydrocarbon mobilization (4, 5, 8). In particular, the lipopeptide biosurfactant produced by Bacillus mojavensis strain JF-2 reduces the interfacial tension between hydrocarbon and aqueous phases to very low levels (<0.016 mN/m) (8) (9). B. mojavensis JF-2 grows under the environmental conditions found in many oil reservoirs, i. e., anaerobic, NaCl concentrations up to 80 g l{sup -1}, and temperatures up to 45 C (6, 7), making it ideally suited for in situ applications. However, anaerobic growth of B. mojavensis JF-2 was inconsistent and difficult to replicate, which limited its use for in situ applications. Our initial studies revealed that enzymatic digests, such as Proteose Peptone, were required for anaerobic growth of Bacillus mojavensis JF-2. Subsequent purification of the growth-enhancing factor in Proteose Peptone resulted in the identification of the growth-enhancing factor as DNA or deoxyribonucleosides. The addition of salmon sperm DNA, herring sperm DNA, E. coli DNA or synthetic DNA (single or double stranded) to Medium E all supported anaerobic growth of JF-2. Further, we found that JF-2 required all four deoxyribonucleosides (deoxyadeonosine, deoxyguanosine, deoxycytidine and thymidine) for growth under strict anaerobic conditions. The requirement for the deoxyribonucleosides did not occur under aerobic growth conditions. DNA was not used as a sole energy source; sucrose was required
Apollo Spacecraft 012 Command/Service Module being moved to Operations bldg
1967-01-01
Transfer of Apollo Spacecraft 012 Command/Service Module for mating to the Saturn Lunar Module Adapter No. 05 in the Manned Spacecraft Operations bldg. S/C 012 will be flown on the Apollo/Saturn 204 mission.
Quality assurance monitoring during nuclear fuel production in JSC 'TVEL'
International Nuclear Information System (INIS)
Filimonov, G.; Tchirkov, V.
2000-01-01
The paper describes Quality Assurance (QA) monitoring during fabrication of nuclear fuel in Russian Federation. Joint Stock Company 'TVEL', natural state monopoly of the type of holding that fabricates and supplies nuclear fuel for the NPPs of Russia, CIS and Europe, incorporates the major enterprises of the nuclear fuel cycle including JSC 'Mashinostroitelny zavod', Electrostal (fabrication of fuel pellets, rods and assemblies for different types of reactors), JSC 'Novosibirsky zavod khimconcentratov', Novosibirsk (fabrication of fuel rods and assemblies for WWER-440 and WWER-1000), JSC 'Tchepetsky mechanitchesky zavod', Tchepetsk (fabrication of Zr tubing). Monitoring of QA is an important element of Quality Management System (QMS) developed and implemented at the above-mentioned enterprises of the JSC 'TVEL' and it is performed on three levels including external and internal audits and author's supervision. Paper also describes short- and long-term policies of the JSC 'TVEL' in nuclear fuel quality field. (author)
STS-9 crewmembers in training session in bldg 9A
1983-01-01
Members of the STS-9 crew discuss flight procedures with a trainer in bldg 9A before the STS-9 mission. From left to right are Brewster Shaw, pilot; John Young, crew commander; Robert Parker, mission specialist; and unidentified trainer. They are reviewing procedures manuals on the shuttle mock-up hatch.
40 CFR 13.23 - Salary offset when EPA is not the creditor agency.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Salary offset when EPA is not the... CLAIMS COLLECTION STANDARDS Administrative Offset § 13.23 Salary offset when EPA is not the creditor... period. (4) Unless the employee has consented in writing to the salary deductions or signed a statement...
Notice of Proposed Assessment of Class II Clean Water Act Section 309(g)(2)(B) Administrative Penalties and Opportunity to Comment for J.F. White Contracting Co., Framingham, MA & Massachusetts Department of Transportation, Boston, MA, CWA-01-2016-0009
Overview of JSC “NIKIET” activity on ITER Procurement Arrangements
Energy Technology Data Exchange (ETDEWEB)
Leshukov, A.Yu., E-mail: leshu@nikiet.ru [Joint-Stock Company “N.A. Dollezhall Research and Development Institute of Power Engineering”, (JSC “NIKIET”), 107140, Malaya Krasnoselskaya 2/8, Moscow (Russian Federation); Dragunov, Yu. G.; Strebkov, Yu. S.; Kirillov, S.Yu.; Makarov, S.V.; Trofimovich, P.D.; Dubinin, G.V.; Maksimov, V.A.; Sviridenko, M.N.; Razmerov, A.V.; Parshutin, E.V.; Khomyakov, S.E.; Kolganov, V.Yu.; Zhmakin, A.V. [Joint-Stock Company “N.A. Dollezhall Research and Development Institute of Power Engineering”, (JSC “NIKIET”), 107140, Malaya Krasnoselskaya 2/8, Moscow (Russian Federation); Belyakov, V.A.; Mazul, I.V.; Gervash, A.A. [JSC “NIIEFA” (D.V. Efremov Institute), 189631, Doroga na Metallostroy, 3, S. Peterburg (Russian Federation); Safronov, V.M.; Romannikov, A.N. [Institution “Project Center ITER”,123182, Square of Academic Kurchatov 1, Moscow (Russian Federation); Eaton, R. [ITER Organization, Route de Vinon sur Verdon CS 90 046 − 13067 Saint Paul lez Durance (France); and others
2016-11-01
The two following ITER blanket-relevant Procurement Arrangements (PA) were signed by Russian Federation and ITER Organization in 2014: 1)1.6.P1ARF.01 “Blanket First Wall” (signed on 14-th of February, 2014); 2)1.6.P3.RF.01 “Blanket Module Connections” (signed on 19-th of December, 2014). The first PA is devoted to the development, manufacturing, testing and procuring to ITER site of 179 Enhanced Heat Flux (EHF) First Wall (FW) Panels. These FW panels are intended to withstand the heat flux from plasma up to 4.7 MW/m{sup 2}, and there are two institutions in Russian Federation responsible for the manufacturing, testing and delivering of these panels on the ITER site: JSC “NIIEFA” (Efremov Institute) and JSC “NIKIET”. JSC “NIIEFA” (Efremov Institute) will manufacture the plasma-facing components (PFC) of EHF FW Panels and perform the final assembling of the panels while JSC “NIKIET” will manufacture the FW beam structures, load-bearing structures of PFC and the all the elements of panel attachment system. As for the second PA (“Blanket Module Connectors”) the JSC “NIKIET” is the alone official Supplier and will manufacture and procure blanket flexible supports, electrical insulating key pads and shield block/vacuum vessel electrical connectors. This article briefly describes the joint activity of JSC “NIKIET” and Efremov Institute in the framework of 1.6.P1ARF.01 “Blanket First Wall” Procurement Arrangement and the material on the activity on the second PA. The main achievements on both PAs (during the period of 2014–2015) are presented and also critical issues and plans are underlined.
Directory of Open Access Journals (Sweden)
Ravely Casarotti Orlandelli
2016-06-01
Full Text Available Endophytic fungi have been described as producers of important bioactive compounds; however, they remain under-exploited as exopolysaccharides (EPS sources. Therefore, this work reports on EPS production by submerged cultures of eight endophytes isolated from Piper hispidum Sw., belonging to genera Diaporthe, Marasmius, Phlebia, Phoma, Phyllosticta and Schizophyllum. After fermentation for 96 h, four endophytes secreted EPS: Diaporthe sp. JF767000, Diaporthe sp. JF766998, Diaporthe sp. JF767007 and Phoma herbarum JF766995. The EPS from Diaporthe sp. JF766998 differed statistically from the others, with a higher percentage of carbohydrate (91% and lower amount of protein (8%. Subsequently, this fungus was grown under submerged culture for 72, 96 and 168 h (these EPS were designated EPSD1-72, EPSD1-96 and EPSD1-168 and the differences in production, monosaccharide composition and apparent molecular were compared. The EPS yields in mg/100 mL of culture medium were: 3.0 ± 0.4 (EPSD1-72, 15.4 ± 2.2 (EPSD1-96 and 14.8 ± 1.8 (EPSD1-168. The EPSD1-72 had high protein content (28.5% and only 71% of carbohydrate; while EPSD1-96 and EPSD1-168 were composed mainly of carbohydrate (≈95 and 100%, respectively, with low protein content (≈5% detected at 96 h. Galactose was the main monosaccharide component (30% of EPSD1-168. Differently, EPSD1-96 was rich in glucose (51%, with molecular weight of 46.6 kDa. It is an important feature for future investigations, because glucan-rich EPS are reported as effective antitumor agents.
Center Independent Research & Developments: JSC IRAD Program
National Aeronautics and Space Administration — JSC provides and applies its preeminent capabilities in science and technology to develop, operate, and integrate human exploration missions. The center...
Astronaut Ronald Sega with Wake Shield Facility on test stand at JSC
1991-01-01
The Wake Shield Facility is displayed on a test stand at JSC. Astronaut Ronald M. Sega, mission specialist for STS-60, is seen with the facility during a break in testing in the acoustic and vibration facility at JSC.
JSC Case Study: Fleet Experience with E-85 Fuel
Hummel, Kirck
2009-01-01
JSC has used E-85 as part of an overall strategy to comply with Presidential Executive Order 13423 and the Energy Policy Act. As a Federal fleet, we are required to reduce our petroleum consumption by 2 percent per year, and increase the use of alternative fuels in our vehicles. With the opening of our onsite dispenser in October 2004, JSC became the second federal fleet in Texas and the fifth NASA center to add E-85 fueling capability. JSC has a relatively small number of GSA Flex Fuel fleet vehicles at the present time (we don't include personal vehicles, or other contractor's non-GSA fleet), and there were no reasonably available retail E-85 fuel stations within a 15-minute drive or within five miles (one way). So we decided to install a small 1000 gallon onsite tank and dispenser. It was difficult to obtain a supplier due to our low monthly fuel consumption, and our fuel supplier contract has changed three times in less than five years. We experiences a couple of fuel contamination and quality control issues. JSC obtained good information on E-85 from the National Ethanol Vehicle Coalition (NEVC). We also spoke with Defense Energy Support Center, (DESC), Lawrence Berkeley Laboratory, and US Army Fort Leonard Wood. E-85 is a liquid fuel that is dispensed into our Flexible Fuel Vehicles identically to regular gasoline, so it was easy for our vehicle drivers to make the transition.
Overview of Power Quality and Integrated Testing at JSC
Davies, Francis
2018-01-01
This presentation describes the basic philosophy behind integrated testing and partially integrated testing. It lists some well known errors in space systems that were or could have been caught during integrated testing. Two examples of integrated testing at the Johnson Space Center (JSC) are mentioned, and then an overview of two test facilities that do power testing (partially integrated testing) at JSC are presented, with information on the capabilities of each. Finally a list of three projects that has problems caught during power quality or Electromagnetic Interference (EMI) testing is presented.
Astronaut Terry J. Hart in training session RMS for STS-2 bldg 29
1981-01-01
Astronaut Terry J. Hart in training session with the Remote Manipulator System (RMS) for STS-2 bldg 29. Views show Truly working at the command console while watching out the windows. Karen Ehlers, an RMS procedures specialist, can be seen at left side of frame while Astronaut Sally Ride waits on right for her time at the RMS.
STS-32 Commander Brandenstein adjusts IMAX camera during training session
1989-01-01
STS-32 Commander Daniel C. Brandenstein adjusts IMAX camera setting during briefing and training session as technician looks on. The session was conducted in the JSC Mockup and Integration Laboratory (MAIL) Bldg 9B. The IMAX camera will be used onboard Columbia, Orbiter Vehicle (OV) 102, during the STS-32 mission.
The need for health promotion in jsc „vilniaus baldai“
Melkūnaitė, Eglė
2017-01-01
The Need for Health Promotion in JSC „Vilniaus Baldai“ The relevance of the study. Health promotion in workplaces brings benefits to the employees, organizations, governments and society as a whole. In order to successfully implement the health promotion program in the workplace, it is important to evaluate facilities, demands and situation of the employer. The aim of the study. To measure the need of health promotion in the company JSC „Vilniaus baldai“. The objective of the study. Measure t...
STS-26 crew on fixed based (FB) shuttle mission simulator (SMS) flight deck
1988-01-01
STS-26 Discovery, Orbiter Vehicle (OV) 103, Commander Frederick H. Hauck (left) and Pilot Richard O. Covey review checklists in their respective stations on the foward flight deck. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.
Development of the CELSS Emulator at NASA JSC
Cullingford, Hatice S.
1989-01-01
The Controlled Ecological Life Support System (CELSS) Emulator is under development at the NASA Johnson Space Center (JSC) with the purpose to investigate computer simulations of integrated CELSS operations involving humans, plants, and process machinery. This paper describes Version 1.0 of the CELSS Emulator that was initiated in 1988 on the JSC Multi Purpose Applications Console Test Bed as the simulation framework. The run module of the simulation system now contains a CELSS model called BLSS. The CELSS Emulator makes it possible to generate model data sets, store libraries of results for further analysis, and also display plots of model variables as a function of time. The progress of the project is presented with sample test runs and simulation display pages.
Astronaut Richard H. Truly in training session RMS for STS-2 bldg 9A
1981-01-01
Astronaut Richard H. Truly in training session with the Remote Manipulator System (RMS) for STS-2 bldg 9A. Views show Truly working at the command console while watching out the windows. Karen Ehlers, an RMS procedures specialist, can be seen at left side of frame (34314); view from behind Truly as he trains at the RMS console (34315).
Yuan, W; Sui, C G; Ma, X; Ma, J
2018-05-23
Objective: To explore new multidrug resistant genes of pancreatic cancer by establishment and characterization of chemo-resistant cell lines. Methods: The cisplatin-resistant cell line JF305/CDDP and the gemcitabine-resistant cell line PANC-1/GEM were induced by high-dose intermittent treatment. CCK-8 assay was used to detect the 50% inhibiting concentration (IC(50)), drug resistance index (R), cross-resistance, and growth difference of different cells. The changes of cell cycle and migration ability of drug-resistant cells were determined by flow cytometry and transwell assay, respectively. And then real-time fluorescence quantitative PCR was used to detect the expression of multidrug resistance-related genes. Results: The drug resistance indexes of JF305/CDDP and PANC-1/GEM were 15.3 and 27.31, respectively, and there was cross-resistance. Compared with the parental cells, the proliferation rate of JF305/CDDP was decreased by 40% on the fourth day ( P PANC-1 cells upregulated MRP2 level ( P PANC-1/GEM, were successfully established. MSX2 might be a new drug resistance related gene in pancreatic cancer cells by up-regulation of MRP2 expression.
STS-26 MS Hilmers on fixed based (FB) shuttle mission simulator (SMS) middeck
1988-01-01
STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) David C. Hilmers prepares to ascend a ladder representing the interdeck access hatch from the shuttle middeck to the flight deck. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.
STS-26 MS Lounge in fixed based (FB) shuttle mission simulator (SMS)
1988-01-01
STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) John M. Lounge, wearing comunications kit assembly headset and crouched on the aft flight deck, performs checklist inspection during training session. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.
SE83-9 'Chix in Space' student experimenter monitors STS-29 onboard activity
1989-01-01
Student experimenter John C. Vellinger watches monitor in the JSC Mission Control Center (MCC) Bldg 30 Customer Support Room (CSR) during the STS-29 mission. Crewmembers are working with his Student Experiment (SE) 83-9 Chicken Embryo Development in Space or 'Chix in Space' onboard Discovery, Orbiter Vehicle (OV) 103. The student's sponsor is Kentucky Fried Chicken (KFC).
Improvement of Operational Reliability Resource for JSC “Beltransgaz” Main Pipelines
Directory of Open Access Journals (Sweden)
V. V. Mayorov
2013-01-01
Full Text Available The paper considers prospects for modernization of the operating linear portion of JSC “Beltransgaz” gas transportation system, various methods and materials which are used while implementing construction and installation works in the oil and gas sector. It has been shown that in the recent decade one of the most technically, technologically and economically efficient application of the material is double-composite polyurethane coating. The method for coating deposition has been tested and introduced by JSC “Beltransgaz” with significant economic efficiency.
International Nuclear Information System (INIS)
Regenspurg, Simona; Goessner, Anita; Peiffer, Stefan; Kuesel, Kirsten
2002-01-01
Schwertmannite, an iron(III)-oxyhydroxysulfate formed in acidic mining-impacted stream or lake waters often contaminated with toxic elements like arsenate or chromate, is able to incorporate high amounts of these oxyanions. Detoxification of the water might be achieved if precipitated arsenated or chromated schwertmannite is fixed in the sediment. However, under reduced conditions, reductive dissolution of iron oxides mediated by the activity of Fe(III)-reducing bacteria might mobilize arsenate and chromate again. In this study, the reduction of synthesized arsenated or chromated schwertmannite by the acidophilic Fe(III)-reducer Acidiphilium cryptum JF-5, isolated from an acidic mining-impacted sediment, was investigated. In TSB medium at pH 2.7 with glucose as electron donor, A. cryptum JF-5 reduced about 10% of the total Fe(III) present in pure synthetic schwertmannite but only 5% of Fe(III) present in arsenated schwertmannite. In contrast to sulfate that was released during the reductive dissolution of pure schwertmannite, arsenate was not released during the reduction of arsenated schwertmannite probably due to the high surface complexation constant of arsenate and Fe(III). In medium containing chromated schwertmannite, no Fe(II) was formed, and no glucose was consumed indicating that chromate might have been toxic to cells of A. cryptum JF-5. Both As(V) or Cr(VI) could not be utilized as electron acceptor by A. cryptum JF-5. A comparison between autoclaved (121 o C for 20 min) and non-autoclaved schwertmannite samples demonstrated that nearly 100%of the bound sulfate was released during heating, and FTIR spectra indicated a transformation of schwertmannite to goethite. This structural change was not observed with autoclaved arsenated or chromated schwertmannite. These results suggest that the mobility of arsenate and chromate is not enhanced by the activity of acidophilic Fe(III)-reducing bacteria in mining-impacted sediments. In contrast, the presence of
Den Ouden, G.
1994-01-01
This volume contains the papers presented at a seminar held in honour of Prof. J.F. Lancaster on 1 September 1993 in order to mark the occasion of his retirement as Chairman of Study Group 212 (Physics of Welding) of the International Institute of Welding. Prof. Lancaster was Chairman of Study Group
JSC “ALFA-BANK” marketing policy. problems and perspectives
Kirillov, A.; Kuznetcova, E.; Martirosian, M.
2013-01-01
The article is devoted to the results of JSC “Alfa-Bank” consumers’ segmentation and the following complex marketing research. The article suggests the ways of the bank’s marketing policy improvement.
MODERN RESOURCE-SAVING TECHNOLOGIES IN FOUNDRY PRODUCTION OF JSC «MINSK TRAKTOR PLANT»
Directory of Open Access Journals (Sweden)
F. A. Domotenko
2016-01-01
Full Text Available In article the main world tendencies of development of the production technology of sandy cores and value of this production in complex technology of manufacture of castings are considered. It is established that the most rational way of production technically and economically is manufacture of wafer sandy cores using the Cold-box-amin technology. Scientific, technical, technological and economic aspects of modernization of foundry production of JSC MTZ with complete transition to production of sandy cores on the resource-saving Cold-box-amin technology are provided. The main distinctive feature of this reequipment – all planned works are based on the domestic technological developments and the equipment created in the cooperation by specialists of JSC BELNIILIT and JSC MTZ. Within GNTP essential support to the provided works was given by the state.
International Nuclear Information System (INIS)
Senda, Miki; Hatta, Takashi; Kimbara, Kazuhide; Senda, Toshiya
2010-01-01
A thermostable manganese(II)-dependent 2,3-dihydroxybiphenyl-1,2-dioxygenase derived from Bacillus sp. JF8 was crystallized in two forms using the sitting-drop vapour-diffusion method. Both crystals diffracted to approximately 1.3 Å resolution. A thermostable manganese(II)-dependent 2,3-dihydroxybiphenyl-1,2-dioxygenase derived from Bacillus sp. JF8 was crystallized. The initial screening for crystallization was performed by the sitting-drop vapour-diffusion method using a crystallization robot, resulting in the growth of two crystal forms. The first crystal belonged to space group P1, with unit-cell parameters a = 62.7, b = 71.4, c = 93.6 Å, α = 71.2, β = 81.0, γ = 64.0°, and diffracted to 1.3 Å resolution. The second crystal belonged to space group I222, with unit-cell parameters a = 74.2, b = 90.8, c = 104.3 Å, and diffracted to 1.3 Å resolution. Molecular-replacement trials using homoprotocatechuate 2,3-dioxygenase from Arthrobacter globiformis (28% amino-acid sequence identity) as a search model provided a satisfactory solution for both crystal forms
Comparative MD Simulations Indicate a Dual Role for Arg1323.50 in Dopamine-Dependent D2R Activation.
Directory of Open Access Journals (Sweden)
Ralf C Kling
Full Text Available Residue Arg3.50 belongs to the highly conserved DRY-motif of class A GPCRs, which is located at the bottom of TM3. On the one hand, Arg3.50 has been reported to help stabilize the inactive state of GPCRs, but on the other hand has also been shown to be crucial for stabilizing active receptor conformations and mediating receptor-G protein coupling. The combined results of these studies suggest that the exact function of Arg3.50 is likely to be receptor-dependent and must be characterized independently for every GPCR. Consequently, we now present comparative molecular-dynamics simulations that use our recently described inactive-state and Gα-bound active-state homology models of the dopamine D2 receptor (D2R, which are either bound to dopamine or ligand-free, performed to identify the function of Arg1323.50 in D2R. Our results are consistent with a dynamic model of D2R activation in which Arg1323.50 adopts a dual role, both by stabilizing the inactive-state receptor conformation and enhancing dopamine-dependent D2R-G protein coupling.
Calaway, Michael J.
2013-01-01
In preparation for OSIRIS-REx and other future sample return missions concerned with analyzing organics, we conducted an Organic Contamination Baseline Study for JSC Curation Labsoratories in FY12. For FY12 testing, organic baseline study focused only on molecular organic contamination in JSC curation gloveboxes: presumably future collections (i.e. Lunar, Mars, asteroid missions) would use isolation containment systems over only cleanrooms for primary sample storage. This decision was made due to limit historical data on curation gloveboxes, limited IR&D funds and Genesis routinely monitors organics in their ISO class 4 cleanrooms.
Chemical constituents of Piptadenia gonoacantha (Mart. J.F. Macbr (pau jacaré
Directory of Open Access Journals (Sweden)
Mário G. de Carvalho
2010-09-01
Full Text Available The phytochemical investigation of Piptadenia gonoacantha (Mart. J.F. Macbr. (Leguminosae-Mimosoideae, commonly known as "pau jacaré" (alligator stick, afforded sitosterol, campesterol, stigmasterol, the N-benzoylphenylalanine-2-benzoylamide-3-phenylpropyl ester, known as asperphenamate, sitosterol-3-O-β-D-glucopyranoside, besides three flavonoids, apigenin, 5-O-methylapigenin and 7,4'-dihydroxy-3',5-dimethoxyflavone from its branches. From its leaves, the methyl gallate and two flavonoids, vitexin and isovitexin, were isolated. From its bark, a mixture of sitosterol, campesterol, and stigmasterol, besides a mixture of cycloartenone, cycloartan-25-en-3-one, and 24-methylene-cycloartenone, and the pure triterpenes 24-methylenecycloartanol, friedelin, lupeol and lupenone, were isolated. Their structures were established on the basis of spectral analysis, comparison with literature data and GC-MS analysis of the mixtures. The ester, flavonoids and the cycloartanes are been identified for first time in the genus Piptadenia.O estudo fitoquímico de galhos de Piptadenia gonoacantha (Mart. J.F. Macbr. (Leguminosae-Mimosoideae, comumente conhecida como "pau jacaré", forneceu sitosterol, estigmasterol, o éster N-benzoilfenilalaninato de 2-N-benzoil-3-fenilpropila, conhecido como asperfenamato, 3-O-β-D-glicopiranosil-sitosterol, além de três flavonóides, apigenina (5,7,4'-triidroxiflavona, apigenina-5-O-metil éter e 7,4'-dihidroxi-3' , 5-dimetoxiflavona. Das folhas isolaram-se galato de metila e dois flavonóides, 8-C-glicopiranosil-5,7,4' -trihidroxiflavona e 6-C-glicopiranosil-5,7,4'-trihidroxiflavona, conhecidas como vitexina e isovitexina. Das cascas desta planta isolaram-se uma mistura de sitosterol, campesterol e estigmasterol; mistura de cicloartenona, cicloartan-25,26-en-3-ona e 24-metileno-cicloartanona, além dos triterpenos, 24-metilenocicloartenol, fridelina, lupeol e lupenona. As estruturas foram estabelecidas através de análise de
Kang, Peng; Tang, Bihan; Liu, Yuan; Liu, Xu; Shen, Yan; Liu, Zhipeng; Yang, Hongyang; Zhang, Lulu
2016-11-01
The injuries caused by earthquakes are often complex and of various patterns. Our study included all fracture inpatients from the Yushu earthquake (1323 in total), to learn more about the incidence and distribution of fractures during earthquakes. A retrospective study of the clinical characteristics of hospitalized fracture patients after the 2010 Yushu earthquake was conducted from December 20 to 25, 2010.We reviewed medical records of hospitalized patients who had been evacuated from the Yushu earthquake area between April 14 and June 15, 2010, from 57 hospitals, and also reviewed more than 100 documents assembled from daily medical rescue and disease prevention reports submitted by the frontline rescue organizations. In total, 78.0% of fracture patients were admitted to the hospital within 3 days after the earthquake. There were 1323 patients who presented with 1539 fractures. The most common fracture occurred in the lower limbs, followed by spinal, pelvic, and shoulder-upper limb fractures. The end of the thoracic vertebra and the lumbar vertebra were the high-risk sites for vertebral fractures. A total of 38 patients became paraplegic. A 2-level spatial clustering was detected among the 193 patients presenting with 2 fractures. Analysis profiles of the injuries and clinical features of patients with earthquake-related fractures will positively impact rescue efforts and the treatment of fracture injuries caused by possible future natural disasters. We should assemble orthopedic-related medications and surgical equipment, and allocate them promptly after a major earthquake. Copyright © 2016 Elsevier Inc. All rights reserved.
Developing drug formularies for the "National Medical Holding" JSC.
Akhmadyar, N S; Khairulin, B E; Amangeldy-Kyzy, S; Ospanov, M A
2015-01-01
One of the main problems of drug provision of multidisciplinary hospitals is the necessity to improve the efficiency of budget spending. Despite the efforts undertaken in Kazakhstan for improving the mechanism of drug distribution (creation of the Kazakhstan National Formulary, Unified National Health System, the handbook of medicines (drugs) costs in the electronic register of inpatients (ERI), having a single distributor), the number of unresolved issues still remain."National Medical Holding" JSC (NMH) was established in 2008 and unites 6 innovational healthcare facilities with up to 1431 beds (700 children and 731 adults), located in the medical cluster - which are "National Research Center for Maternal and Child Health" JSC (NRCMC), "Republic Children's Rehabilitation Center" JSC (RCRC), "Republican Diagnostic Center" JSC (RDC), "National Centre for Neurosurgery" JSC (NCN), "National Research Center for Oncology and Transplantation" JSC (NRCOT) and "National Research Cardiac Surgery Center" JSC (NRCSC). The main purpose of NMH is to create an internationally competitive "Hospital of the Future", which will provide the citizens of Kazakhstan and others with a wide range of medical services based on advanced medical technology, modern hospital management, international quality and safety standards. These services include emergency care, outpatient diagnostic services, obstetrics and gynecology, neonatal care, internal medicine, neurosurgery, cardiac surgery, transplantation, cancer care for children and adults, as well as rehabilitation treatment. To create a program of development of a drug formulary of NMH and its subsidiaries. In order to create drug formularies of NMH, analytical, software and statistical methods were used.AII subsidiary organizations of NMH (5 out of 6) except for the NRCOT have been accredited by Joint Commission International (JCI) standards, which ensure the safety of patients and clinical staff, by improving the technological
Best Practices: Power Quality and Integrated Testing at JSC
Davis, Lydia
2018-01-01
This presentation discusses Best Practices for Power Quality and Integrated Testing at JSC in regards to electrical systems. These high-level charts include mostly generic information; however, a specific issue is discussed involving flight hardware that could have been discovered prior to flight with an integrated test.
STS-26 Commander Hauck in fixed based (FB) shuttle mission simulator (SMS)
1988-01-01
STS-26 Discovery, Orbiter Vehicle (OV) 103, Commander Frederick H. Hauck, wearing comunications kit assembly headset and seated in the commanders seat on forward flight deck, looks over his shoulder toward the aft flight deck. A flight data file (FDF) notebook rests on his lap. The STS-26 crew is training in the fixed base (FB) shuttle mission simulator (SMS) located in JSC Mission Simulation and Training Facility Bldg 5.
2012-05-30
...; Imposition of Special Measure Against JSC CredexBank as a Financial Institution of Primary Money Laundering... for concluding that JSC CredexBank is a financial institution of primary money laundering concern...- money laundering provisions of the Bank Secrecy Act (BSA), codified at 12 U.S.C. 1829b, 12 U.S.C. 1951...
The JSC Engineering Directorate Product Peer Review Process
Jenks, Kenneth C.
2009-01-01
The JSC Engineering Directorate has developed a Product Peer Review process in support of NASA policies for project management and systems engineering. The process complies with the requirements of NPR 7120.5, NPR 7123.1 and NPR 7150.2 and follows the guidance in NASA/SP-2007-6105. This presentation will give an overview of the process followed by a brief demonstration of an actual peer review, with audience participation.
Küsel, Kirsten; Dorsch, Tanja; Acker, Georg; Stackebrandt, Erko
1999-01-01
To evaluate the microbial populations involved in the reduction of Fe(III) in an acidic, iron-rich sediment, the anaerobic flow of supplemental carbon and reductant was evaluated in sediment microcosms at the in situ temperature of 12°C. Supplemental glucose and cellobiose stimulated the formation of Fe(II); 42 and 21% of the reducing equivalents that were theoretically obtained from glucose and cellobiose, respectively, were recovered in Fe(II). Likewise, supplemental H2 was consumed by acidic sediments and yielded additional amounts of Fe(II) in a ratio of approximately 1:2. In contrast, supplemental lactate did not stimulate the formation of Fe(II). Supplemental acetate was not consumed and inhibited the formation of Fe(II). Most-probable-number estimates demonstrated that glucose-utilizing acidophilic Fe(III)-reducing bacteria approximated to 1% of the total direct counts of 4′,6-diamidino-2-phenylindole-stained bacteria. From the highest growth-positive dilution of the most-probable-number series at pH 2.3 supplemented with glucose, an isolate, JF-5, that could dissimilate Fe(III) was obtained. JF-5 was an acidophilic, gram-negative, facultative anaerobe that completely oxidized the following substrates via the dissimilation of Fe(III): glucose, fructose, xylose, ethanol, glycerol, malate, glutamate, fumarate, citrate, succinate, and H2. Growth and the reduction of Fe(III) did not occur in the presence of acetate. Cells of JF-5 grown under Fe(III)-reducing conditions formed blebs, i.e., protrusions that were still in contact with the cytoplasmic membrane. Analysis of the 16S rRNA gene sequence of JF-5 demonstrated that it was closely related to an Australian isolate of Acidiphilium cryptum (99.6% sequence similarity), an organism not previously shown to couple the complete oxidation of sugars to the reduction of Fe(III). These collective results indicate that the in situ reduction of Fe(III) in acidic sediments can be mediated by heterotrophic Acidiphilium
Küsel, K; Dorsch, T; Acker, G; Stackebrandt, E
1999-08-01
To evaluate the microbial populations involved in the reduction of Fe(III) in an acidic, iron-rich sediment, the anaerobic flow of supplemental carbon and reductant was evaluated in sediment microcosms at the in situ temperature of 12 degrees C. Supplemental glucose and cellobiose stimulated the formation of Fe(II); 42 and 21% of the reducing equivalents that were theoretically obtained from glucose and cellobiose, respectively, were recovered in Fe(II). Likewise, supplemental H(2) was consumed by acidic sediments and yielded additional amounts of Fe(II) in a ratio of approximately 1:2. In contrast, supplemental lactate did not stimulate the formation of Fe(II). Supplemental acetate was not consumed and inhibited the formation of Fe(II). Most-probable-number estimates demonstrated that glucose-utilizing acidophilic Fe(III)-reducing bacteria approximated to 1% of the total direct counts of 4', 6-diamidino-2-phenylindole-stained bacteria. From the highest growth-positive dilution of the most-probable-number series at pH 2. 3 supplemented with glucose, an isolate, JF-5, that could dissimilate Fe(III) was obtained. JF-5 was an acidophilic, gram-negative, facultative anaerobe that completely oxidized the following substrates via the dissimilation of Fe(III): glucose, fructose, xylose, ethanol, glycerol, malate, glutamate, fumarate, citrate, succinate, and H(2). Growth and the reduction of Fe(III) did not occur in the presence of acetate. Cells of JF-5 grown under Fe(III)-reducing conditions formed blebs, i.e., protrusions that were still in contact with the cytoplasmic membrane. Analysis of the 16S rRNA gene sequence of JF-5 demonstrated that it was closely related to an Australian isolate of Acidiphilium cryptum (99.6% sequence similarity), an organism not previously shown to couple the complete oxidation of sugars to the reduction of Fe(III). These collective results indicate that the in situ reduction of Fe(III) in acidic sediments can be mediated by heterotrophic
Human Spaceflight Technology Needs - A Foundation for JSC's Technology Strategy
Stecklein, Jonette M.
2013-01-01
Human space exploration has always been heavily influenced by goals to achieve a specific mission on a specific schedule. This approach drove rapid technology development, the rapidity of which adds risks as well as provides a major driver for costs and cost uncertainty. The National Aeronautics and Space Administration (NASA) is now approaching the extension of human presence throughout the solar system by balancing a proactive yet less schedule-driven development of technology with opportunistic scheduling of missions as the needed technologies are realized. This approach should provide cost effective, low risk technology development that will enable efficient and effective manned spaceflight missions. As a first step, the NASA Human Spaceflight Architecture Team (HAT) has identified a suite of critical technologies needed to support future manned missions across a range of destinations, including in cis-lunar space, near earth asteroid visits, lunar exploration, Mars moons, and Mars exploration. The challenge now is to develop a strategy and plan for technology development that efficiently enables these missions over a reasonable time period, without increasing technology development costs unnecessarily due to schedule pressure, and subsequently mitigating development and mission risks. NASA's Johnson Space Center (JSC), as the nation s primary center for human exploration, is addressing this challenge through an innovative approach in allocating Internal Research and Development funding to projects. The HAT Technology Needs (TechNeeds) Database has been developed to correlate across critical technologies and the NASA Office of Chief Technologist Technology Area Breakdown Structure (TABS). The TechNeeds Database illuminates that many critical technologies may support a single technical capability gap, that many HAT technology needs may map to a single TABS technology discipline, and that a single HAT technology need may map to multiple TABS technology
Human spaceflight technology needs-a foundation for JSC's technology strategy
Stecklein, J. M.
Human space exploration has always been heavily influenced by goals to achieve a specific mission on a specific schedule. This approach drove rapid technology development, the rapidity of which added risks and became a major driver for costs and cost uncertainty. The National Aeronautics and Space Administration (NASA) is now approaching the extension of human presence throughout the solar system by balancing a proactive yet less schedule-driven development of technology with opportunistic scheduling of missions as the needed technologies are realized. This approach should provide cost effective, low risk technology development that will enable efficient and effective manned spaceflight missions. As a first step, the NASA Human Spaceflight Architecture Team (HAT) has identified a suite of critical technologies needed to support future manned missions across a range of destinations, including in cis-lunar space, near earth asteroid visits, lunar exploration, Mars moons, and Mars exploration. The challenge now is to develop a strategy and plan for technology development that efficiently enables these missions over a reasonable time period, without increasing technology development costs unnecessarily due to schedule pressure, and subsequently mitigating development and mission risks. NASA's Johnson Space Center (JSC), as the nation's primary center for human exploration, is addressing this challenge through an innovative approach in allocating Internal Research and Development funding to projects. The HAT Technology Needs (Tech Needs) Database has been developed to correlate across critical technologies and the NASA Office of Chief Technologist Technology Area Breakdown Structure (TABS). The TechNeeds Database illuminates that many critical technologies may support a single technical capability gap, that many HAT technology needs may map to a single TABS technology discipline, and that a single HAT technology need may map to multiple TABS technology disciplines. Th
'Weightless' acrylic painting by Jack Kroehnke
1987-01-01
'Weightless' acrylic painting by Jack Kroehnke depicts STS-26 Discovery, Orbiter Vehicle (OV) 103, Mission Specialist (MS) David C. Hilmers participating in extravehicular activity (EVA) simulation in JSC Weightless Environment Training Facility (WETF) Bldg 29. In the payload bay (PLB) mockup, Hilmers, wearing extravehicular mobility unit (EMU), holds onto the mission-peculiar equipment support structure in foreground while SCUBA-equipped diver monitors activity overhead and camera operator records EVA procedures. Copyrighted art work for use by NASA.
Directory of Open Access Journals (Sweden)
A. I. Khorev
2016-01-01
Full Text Available Currently, the problem of sustainable development of enterprises of the Russian military-industrial complex has not only military, but economic importance. The article provides an analysis of the availability, scope, composition and structure of the basic production assets of JSC "Concern "Sozvezdie" for 2013-2015, and analysis of efficiency of use of the basic production assets in JSC "Concern "Sozvezdie" for 2013-2015. JSC "Concern "Sozvezdie" JSC approved the program of innovative development and technological modernization, the development objective of which is the proved choice of the list and content of activities, the implementation of which should ensure the development of the Concern as a scientific and industrial socio-economic system – a holistic entity. Assessment of the dynamics of the basic production assets has shown that the security of JSC "Concern "Sozvezdie" OPF for 2013-2015 increased by 89,81%. The degree of updating of production assets during the period was 50.7%. The analysis of the efficiency of the basic production assets in JSC "Concern "Sozvezdie" has shown that for every 1% increase in revenue major funds have grown by 0.65%. The rate of fondamenti decreased by 18.2%. The assessment of efficiency of use of the basic production assets of JSC "Concern "Sozvezdie" shows that the total technical re-equipment of scientific and technological, testing and production and technological base of the enterprises of the Concern is directed on creation of production capacities to ensure serial production of advanced weapons, military and special equipment in the framework of the state defense order, as the main activity of the majority of the companies of the Group, and reconstruction, the expansion and creation of production to the production of innovative civilian products.
Directory of Open Access Journals (Sweden)
Makeli Garibotti Lusa
2011-06-01
Full Text Available Cuphea carthagenensis (Jacq. J.F. Macbr. é uma planta herbácea, que ocorre preferivelmente em locais úmidos. Dentre outras espécies do gênero, esta se destaca pelo grande potencial químico e emprego frequente na medicina popular. Neste estudo, descrevem-se aspectos morfológicos, a anatomia e as características histoquímicas dos órgãos vegetativos, na fase de desenvolvimento em que a espécie é comercializada. A partir de plantas adultas, foram coletadas amostras de raiz, caule e folhas. Esse material foi processado para análise anatômica e histoquímica em microscopia de luz e para análise morfológica, em microscopia eletrônica de varredura. Considerações morfoanatômicas importantes foram acrescentadas para C. carthagenensis, tais como: a ocorrência de felema aerenquimatoso com camadas suberificadas; a identificação dos tipos de tricomas ocorrentes nos órgãos vegetativos; e a caracterização do tricoma secretor, bem como do material secretado. Os grupos de metabólitos secundários presentes nos tecidos da raiz, do caule e da folha de C. carthagenensis que apresentaram reação histoquímica mais intensa foram: proantocianidinas, compostos fenólicos, polissacarídeos ácidos (especialmente mucilagem e lipídios totais.Cuphea carthagenensis (Jacq. J.F. Macbr. is an herb, which occurs preferably in wet places. Amongst other species of the genus, C. carthagenensis is distinguished for its great chemical potential and frequent use in popular medicine. In this study the morphological and anatomical structures were identified, as well as the histochemical characterization was done. Samples of root, stem and leaves were collected from adult plants. This material was processed for anatomical and histochemical analysis in light microscopy and for morphological analysis, in scanning electron microscopy. Important morphological and anatomical considerations were added for C. carthagenensis, such as: the occurrence of
Reducing Organic Contamination in NASA JSC Astromaterial Curation Facility
Calaway, M. J.; Allen, C. C.; Allton, J. H.
2013-01-01
Future robotic and human spaceflight missions to the Moon, Mars, asteroids and comets will require handling and storing astromaterial samples with minimal inorganic and organic contamination to preserve the scientific integrity of each sample. Much was learned from the rigorous attempts to minimize and monitor organic contamination during Apollo, but it was not adequate for current analytical requirements; thus [1]. OSIRIS-REx, Hayabusa-2, and future Mars sample return will require better protocols for reducing organic contamination. Future isolation con-tainment systems for astromaterials, possibly nitrogen enriched gloveboxes, must be able to reduce organic and inorganic cross-contamination. In 2012, a baseline study established the current state of organic cleanliness in gloveboxes used by NASA JSC astromaterials curation labs that could be used as a benchmark for future mission designs [2, 3]. After standard ultra-pure water (UPW) cleaning, the majority of organic contaminates found were hydrocarbons, plasticizers, silicones, and solvents. Hydro-carbons loads (> C7) ranged from 1.9 to 11.8 ng/cm2 for TD-GC-MS wafer exposure analyses and 5.0 to 19.5 ng/L for TD-GC-MS adsorbent tube exposure. Plasticizers included peracetic acid sterilization were used in the atmospheric de-contamination (R) cabinets. Later, Lunar curation gloveboxes were degreased with a pressurized Freon 113 wash. Today, UPW has replaced Freon as the standard cleaning procedure, but does not have the degreasing solvency power of Freon. Future Cleaning Studies: Cleaning experiments are cur-rently being orchestrated to study how to degrease and reduce organics in a JSC curation glovebox lower than the established baseline. Several new chemicals in the industry have replaced traditional degreasing solvents such as Freon and others that are now federally restricted. However, these new suites of chemicals remain untested for lowering organics in curation gloveboxes. 3M's HFE-7100DL and Du
International Nuclear Information System (INIS)
Tetot, R.; Picard, C.; Gerdanian, P.
1987-01-01
The Tian-Calvet microcalorimetric method has been used at 1323 K in order to determine ΔH(O 2 ), the partial molar enthalpy of mixing of oxygen, for the vanadium-oxygen system with O/V ratios from 0 to 1.5. Comparison is made with earlier independent determinations from electromotive force measurements
Gas Phase Pressure Effects on the Apparent Thermal Conductivity of JSC-1A Lunar Regolith Simulant
Yuan, Zeng-Guang; Kleinhenz, Julie E.
2011-01-01
Gas phase pressure effects on the apparent thermal conductivity of a JSC-1A/air mixture have been experimentally investigated under steady state thermal conditions from 10 kPa to 100 kPa. The result showed that apparent thermal conductivity of the JSC-1A/air mixture decreased when pressure was lowered to 80 kPa. At 10 kPa, the conductivity decreased to 0.145 W/m/degree C, which is significantly lower than 0.196 W/m/degree C at 100 kPa. This finding is consistent with the results of previous researchers. The reduction of the apparent thermal conductivity at low pressures is ascribed to the Knudsen effect. Since the characteristic length of the void space in bulk JSC-1A varies over a wide range, both the Knudsen regime and continuum regime can coexist in the pore space. The volume ratio of the two regimes varies with pressure. Thus, as gas pressure decreases, the gas volume controlled by Knudsen regime increases. Under Knudsen regime the resistance to the heat flow is higher than that in the continuum regime, resulting in the observed pressure dependency of the apparent thermal conductivity.
STS-41 crew is briefed on camera equipment during training session at JSC
1990-01-01
STS-41 crewmembers are briefed on camera equipment during training session at JSC. Trainer Judy M. Alexander explains the use 16mm motion picture equipment to (left to right) Pilot Robert D. Cabana, Mission Specialist (MS) Bruce E. Melnick, and MS Thomas D. Akers.
STS-52 Mission Specialist (MS) Jernigan during food planning session at JSC
1992-01-01
STS-52 Columbia, Orbiter Vehicle (OV) 102, Mission Specialist (MS) Tamara E. Jernigan sips a beverage from a plastic container using a straw. She appears to be pondering what beverages she would like to have on her 10-day flight this coming autumn. Other crewmembers joined Jernigan for this food planning session conducted by JSC's Man-Systems Division.
Replacement/Refurbishment of JSC/NASA POD Specimens
Castner, Willard L.
2010-01-01
The NASA Special NDE certification process requires demonstration of NDE capability by test per NASA-STD-5009. This test is performed with fatigue cracked specimens containing very small cracks. The certification test results are usually based on binomial statistics and must meet a 90/95 Probability of Detection (POD). The assumption is that fatigue cracks are tightly closed, difficult to detect, and inspectors and processes passing such a test are well qualified for inspecting NASA fracture critical hardware. The JSC NDE laboratory has what may be the largest inventory that exists of such fatigue cracked NDE demonstration specimens. These specimens were produced by the hundreds in the late 1980s and early 1990s. None have been produced since that time and the condition and usability of the specimens are questionable.
STS-36 crewmembers train in JSC's FB shuttle mission simulator (SMS)
1989-01-01
STS-36 Mission Specialist (MS) David C. Hilmers, seated on the aft flight deck, discusses procedures with Commander John O. Creighton (left) and Pilot John H. Casper during a simulation in JSC's Fixed Based (FB) Shuttle Mission Simulator (SMS). Casper reviews a checklist at the pilots station on the forward flight deck. The crewmembers are rehearsing crew cabin activities for their upcoming Department of Defense (DOD) mission aboard Atlantis, Orbiter Vehicle (OV) 104.
The JSC Research and Development Annual Report 1993
1994-01-01
Issued as a companion to Johnson Space Center's Research and Technology Annual Report, which reports JSC accomplishments under NASA Research and Technology Operating Plan (RTOP) funding, this report describes 47 additional projects that are funded through sources other than the RTOP. Emerging technologies in four major disciplines are summarized: space systems technology, medical and life sciences, mission operations, and computer systems. Although these projects focus on support of human spacecraft design, development, and safety, most have wide civil and commercial applications in areas such as advanced materials, superconductors, advanced semiconductors, digital imaging, high density data storage, high performance computers, optoelectronics, artificial intelligence, robotics and automation, sensors, biotechnology, medical devices and diagnosis, and human factors engineering.
Coordinated Analysis 101: A Joint Training Session Sponsored by LPI and ARES/JSC
Draper, D. S.; Treiman, A. H.
2017-01-01
The Lunar and Planetary Institute (LPI) and the Astromaterials Research and Exploration Science (ARES) Division, part of the Exploration Integration and Science Directorate at NASA Johnson Space Center (JSC), co-sponsored a training session in November 2016 for four early-career scientists in the techniques of coordinated analysis. Coordinated analysis refers to the approach of systematically performing high-resolution and -precision analytical studies on astromaterials, particularly the very small particles typical of recent and near-future sample return missions such as Stardust, Hayabusa, Hayabusa2, and OSIRIS-REx. A series of successive analytical steps is chosen to be performed on the same particle, as opposed to separate subsections of a sample, in such a way that the initial steps do not compromise the results from later steps in the sequence. The data from the entire series can then be integrated for these individual specimens, revealing important in-sights obtainable no other way. ARES/JSC scientists have played a leading role in the development and application of this approach for many years. Because the coming years will bring new sample collections from these and other planned NASA and international exploration missions, it is timely to begin disseminating specialized techniques for the study of small and precious astromaterial samples. As part of the Cooperative Agreement between NASA and the LPI, this training workshop was intended as the first in a series of similar training exercises that the two organizations will jointly sponsor in the coming years. These workshops will span the range of analytical capabilities and sample types available at ARES/JSC in the Astromaterials Research and Astro-materials Acquisition and Curation Offices. Here we summarize the activities and participants in this initial training.
The 2015-2016 SEPMAP Program at NASA JSC: Science, Engineering, and Program Management Training
Graham, L.; Archer, D.; Bakalyar, J.; Berger, E.; Blome, E.; Brown, R.; Cox, S.; Curiel, P.; Eid, R.; Eppler, D.;
2017-01-01
The Systems Engineering Project Management Advancement Program (SEPMAP) at NASA Johnson Space Center (JSC) is an employee development program designed to provide graduate level training in project management and systems engineering. The program includes an applied learning project with engineering and integrated science goals requirements. The teams were presented with a task: Collect a representative sample set from a field site using a hexacopter platform, as if performing a scientific reconnaissance to assess whether the site is of sufficient scientific interest to justify exploration by astronauts. Four teams worked through the eighteen-month course to design customized sampling payloads integrated with the hexacopter, and then operate the aircraft to meet sampling requirements of number (= 5) and mass (= 5g each). The "Mars Yard" at JSC was utilized for this purpose. This project activity closely parallels NASA plans for the future exploration of Mars, where remote sites will be reconnoitered ahead of crewed exploration.
Directory of Open Access Journals (Sweden)
Mario Camacho Pinto
1999-12-01
Full Text Available
La International Association for Surgical Metabolism and Nutrition (IASMEN propuso a la Sociedad Internacional de cirugía la creación de la “José Félix Patiño Honorary Lecture”, para ser dada bienalmente por una personalidad escogida, como un evento importante de los Congresos Mundiales de Cirugía.
La primera “Conferencia J.F. Patiño” se hizo en el 38º Congreso Mundial de Cirugía de la International Society of Surgery/Societé Internationale of Chirurgie, celebrado en Viena, Austria, del 15 al 20 de agosto de 1999. La Conferencia estuvo a cargo del profesor Douglas Wilmore de la Universidad de Harvard, sobre el tema “Nutritional Metabolic Care of Surgical Patients in the 21st Century”.
Honoríficas condecoraciones a distinguidos Académicos con quienes la ACADEMIA y la Revista MEDICINA se congratulan y felicitan.
Doctor Roberto Serpa Flórez
La Universidad Autónoma de Bucaramanga y el Colegio Médico de Santander concedieron la “Cruz de Esculapio”, el 1º de septiembre de 1999 a este distinguido Académico Roberto Serpa Flórez quien ingresara a nuestra benemérita Academia como Correspondiente en 1982 para ascender a Miembro de Número en 1988 con un ejemplar trabajo sobre la destacada vida y obra de su ilustre progenitor, consagrado médico Académico Roberto Serpa Novoa (1888-1959 de grata memoria.
Roberto junior es cofundador y ex Decano de la Facultad de Salud de la Universidad Industrial de Santander, su profesor titular y luego emérito. Ha sido durante varios años Director de la Revista UIS MEDICINA. Es Miembro Fundador de la Sociedad Colombiana de Historia de la Medicina y de la Sociedad de Psiquiatría; Magistrado del Tribunal de Etica Médica de Santander y Miembro Correspondiente de la Academia de Medicina de Cartagena.
Ha escrito y publicado varios libros relacionados con la psiquiatría clásica y alrededor de 65 artículos sobre
Boundary Layer Transition Protuberance Tests at NASA JSC Arc-Jet Facility
Larin, Max E.; Marichalar, Jeremiah J.; Kinder, Gerald R.; Campbell, Charles H.; Riccio, Joseph R.; Nguyen, Tien Q.; Del Papa, Steven V.; Pulsonetti, Maria V.
2010-01-01
A series of tests conducted recently at the NASA JSC arc -jet test facility demonstrated that a protruding tile material can survive the exposure to the high enthalpy flows characteristic of the Space Shuttle Orbiter re-entry environments. The tests provided temperature data for the protuberance and the surrounding smooth tile surfaces, as well as the tile bond line. The level of heating needed to slump the protuberance material was achieved. Protuberance failure mode was demonstrated.
Leak Rate Performance of Silicone Elastomer O-Rings Contaminated with JSC-1A Lunar Regolith Simulant
Oravec, Heather Ann; Daniels, Christopher C.
2014-01-01
Contamination of spacecraft components with planetary and foreign object debris is a growing concern. Face seals separating the spacecraft cabin from the debris filled environment are particularly susceptible; if the seal becomes contaminated there is potential for decreased performance, mission failure, or catastrophe. In this study, silicone elastomer O-rings were contaminated with JSC- 1A lunar regolith and their leak rate performance was evaluated. The leak rate values of contaminated O-rings at four levels of seal compression were compared to those of as-received, uncontaminated, O-rings. The results showed a drastic increase in leak rate after contamination. JSC-1A contaminated O-rings lead to immeasurably high leak rate values for all levels of compression except complete closure. Additionally, a mechanical method of simulant removal was examined. In general, this method returned the leak rate to as-received values.
DEFF Research Database (Denmark)
Yin, Jiaoyang; Vogel, Ulla Birgitte; Ma, Yegang
2008-01-01
To evaluate the joint effect of nine single nucleotide polymorphisms for three DNA repair genes in the region of chromosome 19q13.2-3 on susceptibility of lung cancer in a Chinese population, we conducted a hospital-based case-control study consisting of 247 lung cancer cases and 253 cancer......-free controls matched on age, gender and ethnicity. Associations between the haplotypes and susceptibility of lung cancer were tested. The global test of haplotype association revealed a statistically significant difference in the haplotype distribution between cases and controls (global test: chi(2) = 60.45, d...
Organic Contamination Baseline Study on NASA JSC Astromaterial Curation Gloveboxes
Calaway, Michael J.; Allton, J. H.; Allen, C. C.; Burkett, P. J.
2013-01-01
Future planned sample return missions to carbon-rich asteroids and Mars in the next two decades will require strict handling and curation protocols as well as new procedures for reducing organic contamination. After the Apollo program, astromaterial collections have mainly been concerned with inorganic contamination [1-4]. However, future isolation containment systems for astromaterials, possibly nitrogen enriched gloveboxes, must be able to reduce organic and inorganic cross-contamination. In 2012, a baseline study was orchestrated to establish the current state of organic cleanliness in gloveboxes used by NASA JSC astromaterials curation labs that could be used as a benchmark for future mission designs.
Developing a Strategic Plan for NASA JSC's Technology Investments
Stecklein, Jonette M.
2012-01-01
Human space exploration has always been heavily influenced by goals to achieve a specific mission on a specific schedule. This approach drove rapid technology development, the rapidity of which adds risks as well as provides a major driver for costs. The National Aeronautics and Space Administration (NASA) is now approaching the extension of human presence throughout the solar system by balancing a proactive yet less schedule-driven development of technology with opportunistic scheduling of missions as the needed technologies are realized. This approach should provide cost effective, low risk technology development that will enable efficient and effective manned spaceflight missions. As a first step, the NASA Human Spaceflight Architecture Team (HAT) has identified a suite of critical technologies needed to support future manned missions across a range of destinations, including in cislunar space, near earth asteroid visits, lunar exploration, Mars space, and Mars exploration. The challenge now is to develop a strategy and plan for technology development that efficiently enables these missions over a reasonable time period, without increasing technology development costs unnecessarily due to schedule pressure, and subsequently mitigating development and mission risks. NASA fs Johnson Space Center (JSC), as the nation's primary center for human exploration, is addressing this challenge through an innovative approach allocating Internal Research and Development funding to projects that have been prioritized using four focus criteria, with appropriate importance weighting. These four focus criteria are the Human Space Flight Technology Needs, JSC Core Technology Competencies, Commercialization Potential, and Partnership Potential. The inherent coupling in these focus criteria have been captured in a database and have provided an initial prioritization for allocation of technology development research funding. This paper will describe this process and this database
Commissioning of the Liquid Nitrogen Thermo-Siphon System for NASA-JSC Chamber-A
Homan, J.; Montz, M.; Ganni, V.; Sidi-Yekhlef, A.; Knudsen, P.; Garcia, S.; Garza, J.
2013-01-01
NASA's Space Environment Simulation Laboratory's (SESL) Chamber A, located at the Johnson Space Center in Houston Texas has recently implemented major enhancements of its cryogenic and vacuum systems. The new liquid nitrogen (LN2) thermo-siphon system was successfully commissioned in August of 2012. Chamber A, which has 20 K helium cryo-panels (or shrouds ) which are shielded by 80 K nitrogen shrouds, is capable of simulating a deep space environment necessary to perform ground testing of NASA s James Webb Space Telescope (JWST). Chamber A s previous system used forced flow LN2 cooling with centrifugal pumps, requiring 200,000 liters of LN2 to cool-down and consuming 180,000 liters per day of LN2 in steady operation. The LN2 system did not have the reliability required to meet the long duration test of the JWST, and the cost estimate provided in the initial approach to NASA-JSC by the sub-contractor for refurbishment of the system to meet the reliability goals was prohibitive. At NASA-JSC's request, the JLab Cryogenics Group provided alternative options in 2007, including a thermo-siphon, or natural flow system. This system, eliminated the need for pumps and used one tenth of the original control valves, relief valves, and burst disks. After the thermo-siphon approach was selected, JLab provided technical assistance in the process design, mechanical design, component specification development and commissioning oversight, while the installation and commissioning operations of the system was overseen by the Jacobs Technology/ESC group at JSC. The preliminary commissioning data indicate lower shroud temperatures, 70,000 liters to cool-down and less than 90,000 liters per day consumed in steady operation. All of the performance capabilities have exceeded the design goals. This paper will outline the comparison between the original system and the predicted results of the selected design option, and the commissioning results of thermo-siphon system.
Commissioning of the Liquid Nitrogen Thermo-Siphon System for NASA-JSC Chamber A
Homan, J.; Montz, M.; Ganni, V.; Sidi-Yekhlef, A.; Knudsen, P.; Garcia, S.; Garza, J.
2013-01-01
NASA s Space Environment Simulation Laboratory s (SESL) Chamber A, located at the Johnson Space Center in Houston Texas has recently implemented major enhancements of its cryogenic and vacuum systems. The new liquid nitrogen (LN) thermo-siphon system was successfully commissioned in August of 2012. Chamber A, which has 20 K helium cryo-panels (or shrouds ) which are shielded by 80 K nitrogen shrouds, is capable of simulating a deep space environment necessary to perform ground testing of NASA s James Webb Space Telescope (JWST). Chamber A s previous system used forced flow LN cooling with centrifugal pumps, requiring 220,000 liters of LN to cool-down and consuming 180,000 liters per day of LN in steady operation. The LN system did not have the reliability required to meet the long duration test of the JWST, and the cost estimate provided in the initial approach to NASA-JSC by the subcontractor for refurbishment of the system to meet the reliability goals was prohibitive. At NASA-JSC s request, the JLab Cryogenics Group provided alternative options in 2007, including a thermo-siphon, or natural flow system. This system, eliminated the need for pumps and used one tenth of the original control valves, relief valves, and burst disks. After the thermo-siphon approach was selected, JLab provided technical assistance in the process design, mechanical design, component specification development and commissioning oversight, while the installation and commissioning operations of the system was overseen by the Jacobs Technology/ESC group at JSC. The preliminary commissioning data indicate lower shroud temperatures, 68,000 liters to cool-down and less than 91,000 liters per day consumed in steady operation. All of the performance capabilities have exceeded the design goals. This paper will outline the comparison between the original system and the predicted results of the selected design option, and the commissioning results of thermo-siphon system.
ANALYSIS OF TRAIN SHEET IN THE INFORMATION SYSTEM OF JSC «UKRZALIZNYTSIA»: PERSPECTIVE
Directory of Open Access Journals (Sweden)
S. M. Ovcharenko
2016-04-01
Full Text Available Purpose. The system of train sheet analysis (TSA in the information system of JSC «Ukrzaliznytsia» provides work with passenger and suburban trains and has considerable potential. Therefore it is necessary to establish the prospects of development of the system. Methodology. Departments’ setup and the train delay causes should be carried out at every station and span, where such delays took place. This requires the fixation of condition deviations of infrastructure from normal and other adverse factors. In the sector of freight transportations the train schedule analysis is insufficient, since this analysis does not account for deviations from the terms of delivery. Therefore it also is necessary to analyze the delivery graphs. The basis for monitoring the cargo delivery is the method of control time points (CTP of technological operations performed with cargo at railway stations. On the basis of CTP to assess the quality of the transport process one should calculate the values of the analysis of cargo delivery schedule (performance level of the cargo delivery schedule, the coefficient of ahead of schedule/delay delivery. Findings. The article proposes to develop the system TSA using the input and display of the train delay causes on-line by transportation service employees, expansion of statistical databases and processing of the input delay causes during its calculation train sheet analysis of freight trains and quality assessment of the delivery schedule fulfillment. It is also appropriate before the new operator companies had appeared to make changes in the instructions TSCHU-TSD-0002 on the list of departments, which include delayed trains, by adding «the department» «The fault of operator companies» and corresponding causes of delays. Originality. The scheme of automated TSA in the information system of JSC «Ukrzaliznytsia» was improved. The author proposes to determine the cargo delivery quality on the certain polygon using the
[Taylor and Hill, Incorporated's JSC Cryo Chamber A
Morales, Rito
2008-01-01
NASA commissioned construction of an environmental simulation test chamber which was completed in 1964 at Johnson Space Center (JSC) in Houston, Texas. The facility, Chamber A, was invaluable for testing spacecraft and satellites before deployment to space. By testing spacecraft in an environment similar to the one they would be functioning in, potential problems could be addressed before launch. A new addition to NASA's observatory inventory is called the James Webb Space Telescope (JWST), after a former Administrator of NASA. The new telescope will have 7 times the mirror area of the Hubble, with a target destination approximately one million miles from earth. Scheduled for launch in 2013, the JWST will allow scientists the ability to see, for the first time, the first galaxies that formed in the early Universe. Pre-launch testing of JWST must be performed in environments that approximate its final target space environment as closely as possible.
Ovchinnikov, N. P.; Portnyagina, V. V.; Sobakina, M. P.
2017-12-01
This paper presents factors that have a greater impact on the mean time to failure of a hydraulic balancing machine unit working in underground kimberlite mines of the Alrosa JSC, the hydraulic balancing machine unit being the least reliable structural elements in terms of error-free operation. In addition, a multifactor linear dependence of mean time to failure of a hydraulic balancing machine unit is shown regarding it being parts of stage sectional pumps in the underground kimberlite mines of the Alrosa JSC. In prospect, this diagram can allow us to predict the durability of the least reliable structural element of a sectional pump.
Yang, Jun; Zezas, Andreas; Coe, Malcolm J.; Drake, Jeremy J.; Hong, JaeSub; Laycock, Silas G. T.; Wik, Daniel R.
2018-05-01
We report the evidence for the anti-correlation between pulsed fraction (PF) and luminosity of the X-ray pulsar SXP 1323, found for the first time in a luminosity range 1035-1037 erg s-1 from observations spanning 15 years. The phenomenon of a decrease in X-ray PF when the source flux increases has been observed in our pipeline analysis of other X-ray pulsars in the Small Magellanic Cloud (SMC). It is expected that the luminosity under a certain value decreases as the PF decreases due to the propeller effect. Above the propeller region, an anti-correlation between the PF and flux might occur either as a result of an increase in the un-pulsed component of the total emission or a decrease of the pulsed component. Additional modes of accretion may also be possible, such as spherical accretion and a change in emission geometry. At higher mass accretion rates, the accretion disk could also extend closer to the neutron star (NS) surface, where a reduced inner radius leads to hotter inner disk emission. These modes of plasma accretion may affect the change in the beam configuration to fan-beam dominant emission.
Configuration Management (CM) Support for KM Processes at NASA/Johnson Space Center (JSC)
Cioletti, Louis
2010-01-01
Collection and processing of information are critical aspects of every business activity from raw data to information to an executable decision. Configuration Management (CM) supports KM practices through its automated business practices and its integrated operations within the organization. This presentation delivers an overview of JSC/Space Life Sciences Directorate (SLSD) and its methods to encourage innovation through collaboration and participation. Specifically, this presentation will illustrate how SLSD CM creates an embedded KM activity with an established IT platform to control and update baselines, requirements, documents, schedules, budgets, while tracking changes essentially managing critical knowledge elements.
Harris, Philip D.; Price, Jennifer B.; Khan, Ahmed; Severance, Mark T.
2011-01-01
Just 150 miles above us, the International Space Station (ISS) is orbiting. Each day, the astronauts on board perform a variety of activities from exercise, science experiments, and maintenance. Yet, many on the ground do not know about these daily activities. National Aeronautics Space Agency/ Johnson Space Center (NASA/JSC) innovation creation ISSLive! - an education project - is working to bridge this knowledge gap with traditional education channels such as schools, but also non-traditional channels with the non-technical everyday public. ISSLive! provides a website that seamlessly integrates planning and telemetry data, video feeds, 3D models, and iOS and android applications. Through the site, users are able to view astronauts daily schedules, in plain English alongside the original data. As an example, when an astronaut is working with a science experiment, a user will be able to read about the activity and for more detailed activities follow provided links to view more information all integrated into the same site. Live telemetry data from a predefined set can also be provided alongside the activities. For users to learn more, 3D models of the external and internal parts of the ISS are available, allowing users to explore the station and even select sensors, such as temperature, and view a real-time chart of the data. Even ground operations are modeled with a 3D mission control center, providing users information on the various flight control disciplines and showing live data that they would be monitoring. Some unique activities are also highlighted and have dedicated spaces to explore in more detail. Education is the focus of ISSLive!, even from the beginning when university students participated in the development process as part of their master s projects. Focus groups at a Houston school showed interest in the project and excitement towards including ISSLive! in their classroom. Through this inclusion, students' knowledge can be assessed with projects
Erikson, Jon D.
1994-01-01
This paper presents an overview of the proposed Lyndon B. Johnson Space Center (JSC) precompetitive, dual-use technology investment project in robotics. New robotic technology in advanced robots, which can recognize and respond to their environments and to spoken human supervision so as to perform a variety of combined mobility and manipulation tasks in various sectors, is an obejective of this work. In the U.S. economy, such robots offer the benefits of improved global competitiveness in a critical industrial sector; improved productivity by the end users of these robots; a growing robotics industry that produces jobs and profits; lower cost health care delivery with quality improvements; and, as these 'intelligent' robots become acceptable throughout society, an increase in the standard of living for everyone. In space, such robots will provide improved safety, reliability, and productivity as Space Station evolves, and will enable human space exploration (by human/robot teams). The proposed effort consists of partnerships between manufacturers, universities, and JSC to develop working production prototypes of these robots by leveraging current development by both sides. Currently targeted applications are in the manufacturing, health care, services, and construction sectors of the U.S. economy and in the inspection, servicing, maintenance, and repair aspects of space exploration. But the focus is on the generic software architecture and standardized interfaces for custom modules tailored for the various applications allowing end users to customize a robot as PC users customize PC's. Production prototypes would be completed in 5 years under this proposal.
Measurement of Apparent Thermal Conductivity of JSC-1A Under Ambient Pressure
Yuan, Zeng-Guang; Kleinhenz, Julie E.
2011-01-01
The apparent thermal conductivity of JSC-1A lunar regolith simulant was measured experimentally using a cylindrical apparatus. Eleven thermocouples were embedded in the simulant bed to obtain the steady state temperature distribution at various radial, axial, and azimuthal locations. The high aspect ratio of a cylindrical geometry was proven to provide a one-dimensional, axisymmetric temperature field. A test series was performed at atmospheric pressure with varying heat fluxes. The radial temperature distribution in each test fit a logarithmic function, indicating a constant thermal conductivity throughout the soil bed. However, thermal conductivity was not constant between tests at different heat fluxes. This variation is attributed to stresses created by thermal expansion of the simulant particles against the rigid chamber wall. Under stress-free conditions (20 deg C), the data suggest a temperature independent apparent conductivity of 0.1961 +/- 0.0070 W/m/ deg C
Osiris-Rex and Hayabusa2 Sample Cleanroom Design and Construction Planning at NASA-JSC
Righter, Kevin; Pace, Lisa F.; Messenger, Keiko
2018-01-01
Final Paper and not the abstract is attached. The OSIRIS-REx asteroid sample return mission launched to asteroid Bennu September 8, 2016. The spacecraft will arrive at Bennu in late 2019, orbit and map the asteroid, and perform a touch and go (TAG) sampling maneuver in July 2020. After confirma-tion of successful sample stowage, the spacecraft will return to Earth, and the sample return capsule (SRC) will land in Utah in September 2023. Samples will be recovered from Utah and then transported and stored in a new sample cleanroom at NASA Johnson Space Center in Houston. All curation-specific ex-amination and documentation activities related to Ben-nu samples will be conducted in the dedicated OSIRIS-REx sample cleanroom to be built at NASA-JSC.
International Nuclear Information System (INIS)
Vetrinskaya, N.I.; Goldobina, E.A.; Kosmukhambetov, A.R.; Kulikova, O.V.; Kozlova, N.V.; Ismailova, Zh.B.
2001-01-01
Results are given on the ground water ecological quality estimation of operating survey boreholes of JSC 'Almaty Kanty' industrial enterprise filtration fields using different methods of biological testing. Proved that various biological objects reacted differently onto the toxins present in the water. Concealment of toxic effect was performed at short-period testing at several testing objects (stimulation). Revealed during long period tests, that ground water from all the boreholes surveyed is not ecologically clean and pure, and can bring damage for ecosystem of water reservoirs adjacent and sources of drinking water if migration happens. (author)
Gugusheff, J R; Vithayathil, M; Ong, Z Y; Muhlhausler, B S
2013-10-01
Exposure to a maternal junk food (JF) diet in utero and during the suckling period has been demonstrated to increase the preference for palatable food and increase the susceptibility to diet-induced obesity in adult offspring. We aimed to determine whether the effects of prenatal exposure to JF could be ameliorated by cross-fostering offspring onto dams consuming a standard rodent chow during the suckling period. We report here that when all offspring were given free access to the JF diet for 7 weeks from 10 weeks of age, male offspring of control (C) or JF dams that were cross-fostered at birth onto JF dams (C-JF, JF-JF), exhibited higher fat (C-C: 12.3 ± 0.34 g/kg/day; C-JF: 14.7 ± 1.04 g/kg/day; JF-C: 11.5 ± 0.41 g/kg/day; JF-JF: 14.0 ± 0.44 g/kg/day; P food intake, had increased fat mass as percentage of body weight (C-C: 19.9 ± 1.33%; C-JF: 22.8 ± 1.57%; JF-C: 17.4 ± 1.03%; JF-JF: 22.0 ± 1.0%; P food preferences in females and susceptibility to diet-induced obesity in males can be prevented by improved nutrition during the suckling period.
Human Thermal Model Evaluation Using the JSC Human Thermal Database
Bue, Grant; Makinen, Janice; Cognata, Thomas
2012-01-01
Human thermal modeling has considerable long term utility to human space flight. Such models provide a tool to predict crew survivability in support of vehicle design and to evaluate crew response in untested space environments. It is to the benefit of any such model not only to collect relevant experimental data to correlate it against, but also to maintain an experimental standard or benchmark for future development in a readily and rapidly searchable and software accessible format. The Human thermal database project is intended to do just so; to collect relevant data from literature and experimentation and to store the data in a database structure for immediate and future use as a benchmark to judge human thermal models against, in identifying model strengths and weakness, to support model development and improve correlation, and to statistically quantify a model s predictive quality. The human thermal database developed at the Johnson Space Center (JSC) is intended to evaluate a set of widely used human thermal models. This set includes the Wissler human thermal model, a model that has been widely used to predict the human thermoregulatory response to a variety of cold and hot environments. These models are statistically compared to the current database, which contains experiments of human subjects primarily in air from a literature survey ranging between 1953 and 2004 and from a suited experiment recently performed by the authors, for a quantitative study of relative strength and predictive quality of the models.
Directory of Open Access Journals (Sweden)
Mansour S. Al-Said
2017-11-01
Full Text Available Suaeda monoica Forssk. ex J.F. Gmel (Chenopodiaceae, a mangrove herb, is distributed in tropical Africa, Arabian Peninsula, India, Pakistan, Palestine and Jordan. The plant parts are used to treat sore throat, hepatitis, wounds, rheumatism, paralysis, asthma, snakebites, skin disease and ulcer. Two new phytoconstituents characterized as 13,17-octahydropentalene-4,4,10,23-tetramethyl-17,21-diisopropyl-tetradecahydrocyclo-[a]-phenanthrene-(14, 20(23, 21(30-trien-5α-ol (SMC-3 and [1,4,4-trimethyl-cyclopent-1(5-enyl]-9,10,17,21-tetramethyl-9α-ol-16α (17α-epoxy heptadecan-6,10-dione (SMC-4 belong to the class norsesquaterpenol and monocyclic triterpenoid, respectively, along with two known compounds 3-epi-lupeol (SMC-1 and 4-cyclopentylpyrocatechol (SMC-2 have been isolated from the ethanol extract of aerial parts of S. monoica using normal and reverse phase column as well as planar chromatography. The spectroscopic studies including 1D, 2D NMR (DEPT, COSY, HMBC and HSQC aided by EIMS mass and IR spectra were used to establish their structures. All the four compounds were tested for cytotoxicity on cultured HepG2 cells and for cell proliferation activities. The results revealed no cytotoxicity even at highest (6.25–50 μg/ml dose of all the four compounds. The compound SMC-1 showed prominent cell proliferative activity as compared to other SMC compounds.
20 K Helium Refrigeration System for NASA-JSC Chamber-A
Homan, J.; Redman, R.; Ganni, V.; Sidi-Yekhelef, A.; Knudsen, P.; Norton, R.; Lauterbach, J.; Linza, R.; Vargas, G.
2013-01-01
A new 20 K helium refrigerator installed at NASA Johnson Space Center's Space Environment Simulation Laboratory (SESL) was successfully commissioned and tested in 2012. The refrigerator is used to create a deep space environment within SESL s Chamber A to perform ground testing of the James Webb Space Telescope. The chamber previously and currently still has helium cryopumping panels (CPP) and LN2 shrouds used to create Low Earth Orbit environments. Now with the new refrigerator and new helium shrouds (45 x 65 ) the chamber can create a deep space environment. The process design, system analysis, specification development, and commissioning oversight were performed by the cryogenics department at Jefferson Labs, while the contracts and system installation was performed by the ESC group at JSC. Commissioning data indicate a inverse coefficient of performance better than 70 W/W for a 18 KW load at 20 K (accounting for liquid nitrogen precooling power) that remains essentially constant down to 1/3 of this load. Even at 10 percent of the maximum capacity, the performance is better than 140 W/W at 20K. The refrigerator exceeded all design goals and demonstrated the ability to support a wide load range from 10kW at 15 K to 100 kW at 100K. The refrigerator is capable of operating at any load temperature from 15K to ambient with tight temperature stability. The new shroud (36 tons of aluminum) can be cooled from room temperature to 20 K in 24 hours. This paper will outline the process design and commissioning results.
Restaurant closures: summer 2014
2014-01-01
Restaurant 2 Table service/brasserie: closed from Monday 28 July to Friday 12 September (open upon reservation for groups of 20+) Snack bars Bldg. 54: closed from Monday 7 July to Friday 12 September (self-service Nespresso machine available) Bldg. 40: closed every day at 4.30 p.m instead of 5 p.m. from Monday 7 July to Friday 12 September Jeûne Genevois Restaurant 2, Restaurant 3, Bldg. 6, Bldg. 13, Bldg. 30 and Bldg. 54 will all be closed 11 and 12 September 2014 Bldg. 40 and Restaurant 1 will remain open
Directory of Open Access Journals (Sweden)
P. M. Bohaslauchyk
2016-01-01
Full Text Available Definition of reliability for dams of slime storage embankment is given on the basis of reliability theory and characteristics of reliability and their analysis are presented in the paper. The paper specifies qualitative indices for earth dams which are subdivided in two groups: applicability factors and structural reliability factors. A short analysis of all possible causes for accident initiation at earth dams has been made and the analysis has permitted to pinpoint eleven main objects for diagnosis for slime storage dams. In order to assess risk degree of accident initiation at JSC “Belaruskali” slime storages all possible causes of emergency cases and their probability of occurrence have been analyzed in the paper. The paper acknowledges the fact that dam malfunction is possible, as a rule, due to violation of operational rules and regulations. Main parameters of slime storage state which are to be controlled regularly in the process of its operation have been noted in the paper. Observation results over slime storages, calculations of dam slope stability for normal operation (a principal calculation case and operating irregularities in water seals (a special calculation case. As a stability margin factor is close to 1.0 for a special calculation case, an extreme position of depression curve has been determined for all design sections. It has been recommended to carry out a constant control over its position, and in the case when it reaches its peak value it is necessary to undertake appropriate measures in order to reduce its value. Final expert estimations on probability of accident initiation at the investigated slime storage dams of the 4th Mining Administration, JSC “Belaruskali” have been prepared on the basis of the analysis comprising all the required factors. A conclusion has been made about low risk degree of their destruction.
Lee, Dong-Sung; Jang, Jae-Hyuk; Ko, Wonmin; Kim, Kyoung-Su; Sohn, Jae Hak; Kang, Myeong-Suk; Ahn, Jong Seog; Kim, Youn-Chul; Oh, Hyuncheol
2013-01-01
Protein tyrosine phosphatase 1B (PTP1B) plays a major role in the negative regulation of insulin signaling, and is thus considered as an attractive therapeutic target for the treatment of diabetes. Bioassay-guided investigation of the methylethylketone extract of marine-derived fungus Penicillium sp. JF-55 cultures afforded a new PTP1B inhibitory styrylpyrone-type metabolite named penstyrylpyrone (1), and two known metabolites, anhydrofulvic acid (2) and citromycetin (3). Compounds 1 and 2 inhibited PTP1B activity in a dose-dependent manner, and kinetic analyses of PTP1B inhibition suggested that these compounds inhibited PTP1B activity in a competitive manner. In an effort to gain more biological potential of the isolated compounds, the anti-inflammatory effects of compounds 1–3 were also evaluated. Among the tested compounds, only compound 1 inhibited the production of NO and PGE2, due to the inhibition of the expression of iNOS and COX-2. Penstyrylpyrone (1) also reduced TNF-α and IL-1β production, and these anti-inflammatory effects were shown to be correlated with the suppression of the phosphorylation and degradation of IκB-α, NF-κB nuclear translocation, and NF-κB DNA binding activity. In addition, using inhibitor tin protoporphyrin (SnPP), an inhibitor of HO-1, it was verified that the inhibitory effects of penstyrylpyrone (1) on the pro-inflammatory mediators and NF-κB DNA binding activity were associated with the HO-1 expression. Therefore, these results suggest that penstyrylpyrone (1) suppresses PTP1B activity, as well as the production of pro-inflammatory mediators via NF-κB pathway, through expression of anti-inflammatory HO-1. PMID:23612372
Directory of Open Access Journals (Sweden)
Youn-Chul Kim
2013-04-01
Full Text Available Protein tyrosine phosphatase 1B (PTP1B plays a major role in the negative regulation of insulin signaling, and is thus considered as an attractive therapeutic target for the treatment of diabetes. Bioassay-guided investigation of the methylethylketone extract of marine-derived fungus Penicillium sp. JF-55 cultures afforded a new PTP1B inhibitory styrylpyrone-type metabolite named penstyrylpyrone (1, and two known metabolites, anhydrofulvic acid (2 and citromycetin (3. Compounds 1 and 2 inhibited PTP1B activity in a dose-dependent manner, and kinetic analyses of PTP1B inhibition suggested that these compounds inhibited PTP1B activity in a competitive manner. In an effort to gain more biological potential of the isolated compounds, the anti-inflammatory effects of compounds 1–3 were also evaluated. Among the tested compounds, only compound 1 inhibited the production of NO and PGE2, due to the inhibition of the expression of iNOS and COX-2. Penstyrylpyrone (1 also reduced TNF-α and IL-1β production, and these anti-inflammatory effects were shown to be correlated with the suppression of the phosphorylation and degradation of IκB-α, NF-κB nuclear translocation, and NF-κB DNA binding activity. In addition, using inhibitor tin protoporphyrin (SnPP, an inhibitor of HO-1, it was verified that the inhibitory effects of penstyrylpyrone (1 on the pro-inflammatory mediators and NF-κB DNA binding activity were associated with the HO-1 expression. Therefore, these results suggest that penstyrylpyrone (1 suppresses PTP1B activity, as well as the production of pro-inflammatory mediators via NF-κB pathway, through expression of anti-inflammatory HO-1.
JSC Orbital Debris Website Description
Johnson, Nicholas L.
2006-01-01
Purpose: The website provides information about the NASA Orbital Debris Program Office at JSC, which is the lead NASA center for orbital debris research. It is recognized world-wide for its leadership in addressing orbital debris issues. The NASA Orbital Debris Program Office has taken the international lead in conducting measurements of the environment and in developing the technical consensus for adopting mitigation measures to protect users of the orbital environment. Work at the center continues with developing an improved understanding of the orbital debris environment and measures that can be taken to control its growth. Major Contents: Orbital Debris research is divided into the following five broad efforts. Each area of research contains specific information as follows: 1) Modeling - NASA scientists continue to develop and upgrade orbital debris models to describe and characterize the current and future debris environment. Evolutionary and engineering models are described in detail. Downloadable items include a document in PDF format and executable software. 2) Measurements - Measurements of near-Earth orbital debris are accomplished by conducting ground-based and space-based observations of the orbital debris environment. The data from these sources provide validation of the environment models and identify the presence of new sources. Radar, optical and surface examinations are described. External links to related topics are provided. 3) Protection - Orbital debris protection involves conducting hypervelocity impact measurements to assess the risk presented by orbital debris to operating spacecraft and developing new materials and new designs to provide better protection from the environment with less weight penalty. The data from this work provides the link between the environment defined by the models and the risk presented by that environment to operating spacecraft and provides recommendations on design and operations procedures to reduce the risk as
Directory of Open Access Journals (Sweden)
Eleuterio Yáñez
2009-01-01
Full Text Available Seamounts are vulnerable marine ecosystems. In Chile, information on these ecosystems is quite scarce; thus, a compilation of information on their geographical distribution and biodiversity is presented herein. A total of 118 seamounts distributed in the Chilean EEZ are identified and characterized. Additionally, an in situ assessment was carried out on the Juan Fernandez seamounts 1 and 2 (JF1 and JF2, which were also oceanographically characterized. Phytoplankton, zooplankton, and marine invertebrate samples were collected and an exploratory fishing survey was executed using different gears. According to the bibliographical review, a total of 82 species have been collected on the JF1 and JF2 seamounts, highlighting fmdings of black coral species caught in lobster traps at the Juan Fernandez Archipelago. Submarine images of the marine substrate at JF1 and JF2 reveal characteristics attributable to the impact of bottom dredges, coinciding with the information obtained from the trawling fleet. The fishing activity was carried out primarily at JF2 (4,667 km of trawling. The monthly fishing effort increased considerably in 2002, 2003, and 2005, reaching values above 500 km of trawling and, thus, modifying the spatial structure of the resource aggregates on the JF2 seamount.Los montes submarinos constituyen ecosistemas marinos vulnerables. Chile presenta una escasa información acerca de estos ecosistemas, por lo que este trabajo recopila información sobre distribución geográfica y biodiversidad. Se identifican y caracterizan 118 montes en la ZEE de Chile. Adicionalmente, una evaluación in situ se desarrolló sobre los montes Juan Fernández 1 y 2 (JF1, JF2, caracterizándolos oceanógraficamente. Se recolectaron muestras de fitoplancton, zooplancton e invertebrados marinos, y se realizó pesca exploratoria con diversos artes. La revisión bibliográfica establece que en JF1 y JF2, se han capturado un total de 82 especies, destacándose la
African Journals Online (AJOL)
impo
delayed-onset muscle soreness (DOMS) which peaks after. 24 - 48 hours and subsides after ... As the evidence regarding the effect of vitamin C (VC) supple- mentation on systemic ..... Pederson EW, Ostowski K, Ibfedt T, et al. Effect of vitamin ...
Consumption of junk foods by school-aged children in rural Himachal Pradesh, India.
Gupta, Aakriti; Kapil, Umesh; Singh, Gajendra
2018-01-01
There has been an increase in the consumption of junk food (JF) among school-aged children (SAC) possibly leading to obesity and diet-related diseases among them. We do not have evidence on consumption of JF in rural areas; hence, we conducted a study to assess the consumption of JF by SAC in rural, Himachal Pradesh. A total of 425 children in the age group of 12-18 years studying in 30 government schools (clusters) were included. The clusters were selected using population proportionate to size sampling methodology. We found high prevalence (36%) of consumption of JF among SAC during the last 24 h. Efforts should be taken to reduce the consumption of JF by promotion of healthy dietary habits and educating children about the ill effects of JF.
78 FR 47000 - Federal Property Suitable as Facilities To Assist the Homeless
2013-08-02
... for suitability for use to assist the homeless. The properties were reviewed using information... Wash Bldg.; Thrust Vector Control Deserving Bldg.; Robot Wash Bldg. Comments: Public access denied & no...
Monks, P D D; Connor, J N L; Bouakline, F
2009-04-23
We investigate methods for filtering reaction mechanisms in the angular scattering of the state-to-state reaction, H + D(2)(v(i) = 0, j(i) = 0, m(i) = 0) --> HD(v(f) = 3, j(f) = 0, m(f) = 0) + D, where v(i), j(i), and m(i) and v(f), j(f), and m(f) are initial and final vibrational, rotational, and helicity quantum numbers, respectively. The input to our filtrations is a new set of accurate quantum scattering matrix elements for total energies in the range 1.52-2.50 eV (in steps of 0.01 eV) and for total angular momentum quantum numbers in the range, 0-40, in steps of unity. We filter reaction mechanisms in both the energy domain and the time domain. The time-domain calculations employ the plane wave packet formulation of time-dependent scattering. The theoretical tools used are nearside-farside (NF) analysis of partial wave series for scattering amplitudes, together with NF local angular momentum (LAM) theory. An energy-domain LAM analysis reveals the existence of an important dynamical feature in the N scattering, a "trench" which bisects the (energy, angle) plane. We use the location of this trench to approximately filter two reaction mechanisms. Transformation to the time domain demonstrates that the two reaction mechanisms correspond to direct and delayed (by about 25 fs) scattering. Further analysis, including filtration in the time domain, shows that the pronounced LAM trench arises from the interference of the energy-domain analogues of the time-direct and time-delayed scattering. Our theory and results provide the first successful demonstration of reaction mechanism filtering carried out directly in the (energy, angle) domain. The calculations and results in this paper extend and complement earlier research reported by Monks, Connor, and Althorpe (Monks, P. D. D.; Connor, J. N. L.; Althorpe, S. C. J. Phys. Chem. A 2006, 110, 741; J. Phys. Chem. A 2007, 111, 10302).
Summer season | Cafeteria closures
2013-01-01
Please note the following cafeteria closures over the summer season: Bldg. 54 closed from 29/07/2013 to 06/09/2013. Bldg. 13: closed from 13/07/2013 to 06/09/2013. Restaurant No. 2, table service (brasserie and restaurant): closed from 01/08/2013 to 06/09/2013. Bldg. 864: closed from 29/07/2013 to 06/09/2013. Bldg. 865: closed from 29/07/2013 to 06/09/2013.
Maity, Tanushree; Bawa, A S; Raju, P S
2014-01-01
The effect of frying temperatures and durations on the quality of vacuum fried jackfruit (JF) chips was evaluated. Moisture content and breaking force of JF chips decreased with increase in frying temperature and time during vacuum frying whereas the oil content increased. The frying time for JF chips was found to be 30, 25, and 20 minutes at 80, 90, and 100°C, respectively. JF chips fried at higher temperature resulted in maximum shrinkage (48%). The lightness in terms of hunter L (*) value decreased significantly (P < 0.05) during frying. Sensory evaluation showed maximum acceptability for JF chips fried at 90°C for 25 min. Frying under vacuum at lower temperatures was found to retain bioactive compounds such as total phenolics, total flavonoids, and total carotenoids in JF chips. Almost 90% of carotenoids were lost from the samples after 30 min of frying at 100°C.
Wang, Yue; Guo, Wanqian; Yen, Hong-Wei; Ho, Shih-Hsin; Lo, Yung-Chung; Cheng, Chieh-Lun; Ren, Nanqi; Chang, Jo-Shu
2015-12-01
Swine wastewater, containing a high concentration of COD and ammonia nitrogen, is suitable for the growth of microalgae, leading to simultaneous COD/nutrients removal from the wastewater. In this study, an isolated carbohydrate-rich microalga Chlorella vulgaris JSC-6 was adopted to perform swine wastewater treatment. Nearly 60-70% COD removal and 40-90% NH3-N removal was achieved in the mixotrophic and heterotrophic culture, depending on the dilution ratio of the wastewater, while the highest removal percentage was obtained with 20-fold diluted wastewater. Mixotrophic cultivation by using fivefold diluted wastewater resulted in the highest biomass concentration of 3.96 g/L. The carbohydrate content of the microalga grown on the wastewater can reach up to 58% (per dry weight). The results indicated that the microalgae-based wastewater treatment can efficiently reduce the nutrients and COD level, and the resulting microalgal biomass had high carbohydrate content, thereby having potential applications for the fermentative production of biofuels or chemicals. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Tanushree Maity
2014-01-01
Full Text Available The effect of frying temperatures and durations on the quality of vacuum fried jackfruit (JF chips was evaluated. Moisture content and breaking force of JF chips decreased with increase in frying temperature and time during vacuum frying whereas the oil content increased. The frying time for JF chips was found to be 30, 25, and 20 minutes at 80, 90, and 100°C, respectively. JF chips fried at higher temperature resulted in maximum shrinkage (48%. The lightness in terms of hunter L* value decreased significantly (P<0.05 during frying. Sensory evaluation showed maximum acceptability for JF chips fried at 90°C for 25 min. Frying under vacuum at lower temperatures was found to retain bioactive compounds such as total phenolics, total flavonoids, and total carotenoids in JF chips. Almost 90% of carotenoids were lost from the samples after 30 min of frying at 100°C.
Fries, M. D.; Allen, C. C.; Calaway, M. J.; Evans, C. A.; Stansbery, E. K.
2015-01-01
Curation of NASA's astromaterials sample collections is a demanding and evolving activity that supports valuable science from NASA missions for generations, long after the samples are returned to Earth. For example, NASA continues to loan hundreds of Apollo program samples to investigators every year and those samples are often analyzed using instruments that did not exist at the time of the Apollo missions themselves. The samples are curated in a manner that minimizes overall contamination, enabling clean, new high-sensitivity measurements and new science results over 40 years after their return to Earth. As our exploration of the Solar System progresses, upcoming and future NASA sample return missions will return new samples with stringent contamination control, sample environmental control, and Planetary Protection requirements. Therefore, an essential element of a healthy astromaterials curation program is a research and development (R&D) effort that characterizes and employs new technologies to maintain current collections and enable new missions - an Advanced Curation effort. JSC's Astromaterials Acquisition & Curation Office is continually performing Advanced Curation research, identifying and defining knowledge gaps about research, development, and validation/verification topics that are critical to support current and future NASA astromaterials sample collections. The following are highlighted knowledge gaps and research opportunities.
2000-2001 ACADEMIC TRAINING PROGRAMME
2000-01-01
2nd Term : 15 January to 30 March 2001 LECTURE SERIES Experimentation in Space by M. Spiro, CEA, France 5, 6, 7, 8, 9 February 11:00-12:00 - Auditorium, bldg 500 Tracking at the LHC by K. Safarik, CERN-EP 5, 6, 7, 8, 9 March 11:00-12:00 - Auditorium, bldg 500 Issues in Arms Control by F. Calogero, Univ. Roma, It. 12. 13, 14, 15, 16 February 11:00-12:00 - Auditorium, bldg 500 Telecommunication for the future by R. Parker, CERN-IT 12, 13, 14, 15, 16 March 11:00-12:00 - Auditorium, bldg 500 Introduction to Cryogenic Engineering by J. G. Weisend, Stanford, USA 19, 20, 21, 22, 23 February 11:00-12:00 - Auditorium, bldg 500 19, 20, 21 February, Council Chamber 22, 23 February Heavy Ion Physics at the CERN SPS by M. Gonin, Ecole Polytechnique, Palaiseau, F. 19, 20, 21, 22, 23 March 11:00-12:00 - Auditorium, bldg 500 Recent Results on CP Violation and B Physics by P.F. Harrison, QMW, London, GB 26, 27, 28 February 1, 2 March 11:00-12:00 - Auditorium, bldg 500 ...
Aural-Nondetectability Model Predictions for Night-Vision Goggles across Ambient Lighting Conditions
2015-12-01
MALHOTRA 1 ARMY RSCH LAB – HRED (PDF) RDRL HRM D T DAVIS BLDG 5400 RM C242 REDSTONE ARSENAL AL 35898-7290 1 ARMY RSCH LAB – HRED... HRM DG K GUNN BLDG 333 PICATINNY ARSENAL NJ 07806-5000 1 ARMY RSCH LAB – HRED (PDF) ARMC FIELD ELEMENT RDRL HRM CH C BURNS...THIRD AVE BLDG 1467B RM 336 FORT KNOX KY 40121 1 ARMY RSCH LAB – HRED (PDF) AWC FIELD ELEMENT RDRL HRM DJ D DURBIN BLDG
2003-01-01
I should like to invite all members of the CERN Personnel to a meeting on Wednesday 25th June 2003 at 11.00 hrs - Auditorium, bldg. 500 to give a report on the outcome of the June Meetings of Council and its Committees. Closed-circuit transmission of the meeting will be available in the AB Auditorium (Prévessin), the AB Auditorium (Meyrin - bldg. 6), the IT Auditorium (bldg. 31) and the AT Auditorium (bldg. 30). Luciano Maiani Director General
Commissioning of a 20 K Helium Refrigeration System for NASA-JSC Chamber A
Homan, J.; Redman, R.; Ganni, V.; Sidi-Yekhlef, A.; Knudsen, P.; Norton, R.; Lauterbach, J.; Linza, R.; Vargas, G.
2013-01-01
A new 20 K helium refrigerator installed at NASA Johnson Space Center s Space Environment Simulation Laboratory (SESL) was successfully commissioned and tested in 2012. The refrigerator is used to create a deep space environment within SESL s Chamber A to perform ground testing of the James Webb Space Telescope (JWST). The chamber previously and currently still has helium cryo-pumping panels (CPP) and liquid nitrogen shrouds used to create low earth orbit environments. Now with the new refrigerator and new helium shrouds the chamber can create a deep space environment. The process design, system analysis, specification development, and commissioning oversight were performed by the cryogenics department at Jefferson Lab, while the contracts and system installation was performed by the ESC group at JSC. Commissioning data indicate an inverse coefficient of performance better than 70 W/W for a 18 kW load at 20 K (accounting for liquid nitrogen pre-cooling power) that remains essentially constant down to one third of this load. Even at 10 percent of the maximum capacity, the performance is better than 150 W/W at 20 K. The refrigerator exceeded all design goals and demonstrated the ability to support a wide load range from 10 kW at 15 K to 100 kW at 100 K. The refrigerator is capable of operating at any load temperature from 15 K to ambient with tight temperature stability. The new shroud (36 tons of aluminum) can be cooled from room temperature to 20 K in 24 hours. This paper will outline the process design and commissioning results.
Lifescience Database Archive (English)
Full Text Available 39 tr|B5JF10|B5JF10_9BACT Lipase family OS=Verrucomicrobiae bacteri... 36 1.8 tr|B6LB31|B6LB31_BRAFL Putativ...10|B5JF10_9BACT Lipase family OS=Verrucomicrobiae bacterium DG1235 GN=VDG1235_4260 PE=4 SV=1 Length = 338 Sc
Enhanced removal of Zn(2+) or Cd(2+) by the flocculating Chlorella vulgaris JSC-7.
Alam, Md Asraful; Wan, Chun; Zhao, Xin-Qing; Chen, Li-Jie; Chang, Jo-Shu; Bai, Feng-Wu
2015-05-30
Microalgae are attracting attention due to their potentials in mitigating CO2 emissions and removing environmental pollutants. However, harvesting microalgal biomass from diluted cultures is one of the bottlenecks for developing economically viable processes for this purpose. Microalgal cells can be harvested by cost-effective sedimentation when flocculating strains are used. In this study, the removal of Zn(2+) and Cd(2+) by the flocculating Chlorella vulgaris JSC-7 was studied. The experimental results indicated that more than 80% Zn(2+) and 60% Cd(2+) were removed by the microalgal culture within 3 days in the presence up to 20.0mg/L Zn(2+) and 4.0mg/L Cd(2+), respectively, which were much higher than that observed with the culture of the non-flocculating C. vulgaris CNW11. Furthermore, the mechanism underlying this phenomenon was explored by investigating the effect of Zn(2+) and Cd(2+) on the growth and metabolic activities of the microalgal strains. It was found that the flocculation of the microalga improved its growth, synthesis of photosynthetic pigments and antioxidation activity under the stressful conditions, indicating a better tolerance to the heavy metal ions for a potential in removing them more efficiently from contaminated wastewaters, together with a bioremediation of other nutritional components contributed to the eutrophication of aquatic ecosystems. Copyright © 2015 Elsevier B.V. All rights reserved.
2010-06-01
... Region Recreation RAC, 1323 Club Drive, Vallejo, CA 94592, 707-562-8856 or [email protected] . FOR... Recreation RAC, 1323 Club Drive, Vallejo, CA 94592. SUPPLEMENTARY INFORMATION: The meeting is open to the...
General Staff Meeting, 17 Dec 2002
CERN. Geneva. Audiovisual Unit
2002-01-01
I would like to invite all members of the CERN Personnel to a meeting, to give a report on the outcome of the December Council Meetings. Closed-circuit transmission of the meeting will be available in the SL Auditorium (Prévessin), the IT Auditorium (bldg. 31), the LHC Auditorium (bldg. 30) and the PS Auditorium (bldg. 6).
Frank, Milan; Jelínek, Michal; Kubeček, Václav; Ivleva, Lyudmila I.; Zverev, Petr G.; Smetanin, Sergei
2017-12-01
A lot of attention is currently focused on synchronously pumped, extra-cavity crystalline Raman lasers generating one or two Stokes Raman components in KGW or diamond Raman-active crystals, and also generating additional components of stimulated polariton scattering in lithium niobate crystal having both cubic and quadratic nonlinearities. In this contribution we report on generation of more than two Stokes components of stimulated Raman scattering with different Raman shifts in the all-solid-state, synchronously pumped, extra-cavity Raman laser based on the Raman-active a-cut BaWO4 crystal excited by a mode-locked, 220 nJ, 36 ps, 150 MHz diode sidepumped Nd:GdVO4 laser generating at the wavelength of 1063 nm. Excitation by the pumping radiation polarized along the BaWO4 crystal optical axis resulted in the Raman generation with not only usual (925cm - 1), but also additional (332cm - 1) Raman shift. Besides the 1180-nm first and 1323 nm second Stokes components with the Raman shift of 925cm - 1 from the 1063nm fundamental laser wavelength, we have achieved generation of the additional 1227 nm Raman component with different Raman shift of 332cm - 1 from the 1180nm component. At the 1227 nm component the strongest 12-times pulse shortening from 36ps down to 3ps was obtained due to shorter dephasing time of this additional Raman line (3ps for the 332-cm - 1 line instead of 6.5ps for the 925cm - 1 line). It has to be also noted that the 1225 nm generation is intracavity pumped by the 1179 nm first Stokes component resulting in the strongest pulse shortening close to the 332cm -1 line dephasing time (3ps). Slope efficiency of three Stokes components generation exceeded 20%.
Directory of Open Access Journals (Sweden)
Kucherova Elena
2017-01-01
Full Text Available The article gives reasons for the need to develop the mechanism and tools of performance evaluation based on the implementation of specific management functions, as well as the integrated evaluation of the effectiveness of internal corporate controls. It presents the approbation of the proposed assessment methodology on the example of JSC “SUEK-Kuzbass”. The monitoring role as one of the functions of management is constantly increasing in the market economy. The participation of Russian companies in the international economy requires the organisation of internal company control. Moreover, with the enacting of the Law “On Accountings» № 402-FZ, for the majority of economic agents the organising of internal control became mandatory. Thus, the internal control means the process carried out by the Board of Directors and other staff of the organisation aimed at providing reasonable assurance that the objectives of the organisation such as ensuring the effectiveness and efficiency of operations, reliability of financial reporting and compliance with the legislation in force will be achieved.
Directory of Open Access Journals (Sweden)
L. M. Kapustina
2010-12-01
Full Text Available The paper is dedicated to development of a methodology for assessment of customer satisfaction with the products and services on the b2b market. The study of customer satisfaction is aimed at building strong and mutually beneficial supplier-customer relationship. The authors focus on the importance of customer satisfaction continuous monitoring intended for improvement of the company’s market performance. The research based on the works by Kano N., Lamben J.-J., Carter R., Parashuraman A., Zeitaml V. A., Berry L. L. and others, describes an algorithm study of consumers and offers a methodology to evaluate customer satisfaction with the industrial products. Based on the analysis of the economic crisis effects on the machine-building industry, the authors determine the performance of “Pnevmostroimashina”, JSC, on the road and construction equipment market and illustrate an example of practical use of the customer satisfaction assessment technique in the company. At the end of the paper some recommendations for development of an efficient customer satisfaction measurement procedure are introduced.
Volume reduction of the jugular foramina in Cavalier King Charles Spaniels with syringomyelia
Directory of Open Access Journals (Sweden)
Schmidt Martin
2012-09-01
Full Text Available Abstract Background Understanding the pathogenesis of the chiari-like malformation in the Cavalier King Charles Spaniel (CKCS is incomplete, and current hypotheses do not fully explain the development of syringomyelia (SM in the spinal cords of affected dogs. This study investigates an unconventional pathogenetic theory for the development of cerebrospinal fluid (CSF pressure waves in the subarachnoid space in CKCS with SM, by analogy with human diseases. In children with achondroplasia the shortening of the skull base can lead to a narrowing of the jugular foramina (JF between the cranial base synchondroses. This in turn has been reported to cause a congestion of the major venous outflow tracts of the skull and consequently to an increase in the intracranial pressure (ICP. Amongst brachycephalic dog breeds the CKCS has been identified as having an extremely short and wide braincase. A stenosis of the JF and a consequential vascular compromise in this opening could contribute to venous hypertension, raising ICP and causing CSF jets in the spinal subarachnoid space of the CKCS. In this study, JF volumes in CKCSs with and without SM were compared to assess a possible role of this pathologic mechanism in the development of SM in this breed. Results Computed tomography (CT scans of 40 CKCSs > 4 years of age were used to create three-dimensional (3D models of the skull and the JF. Weight matched groups (7–10 kg of 20 CKCSs with SM and 20 CKCSs without SM were compared. CKCSs without SM presented significantly larger JF -volumes (median left JF: 0.0633 cm3; median right JF: 0.0703 cm3; p 3; median right JF: 0.0434 cm3; p Conclusion A stenosis of the JF and consecutive venous congestion may explain the aetiology of CSF pressure waves in the subarachnoid space, independent of cerebellar herniation, as an additional pathogenetic factor for the development of SM in this breed.
Alam, Md Asraful; Wan, Chun; Guo, Suo-Lian; Zhao, Xin-Qing; Huang, Zih-You; Yang, Yu-Liang; Chang, Jo-Shu; Bai, Feng-Wu
2014-07-01
High cost of biomass recovery is one of the bottlenecks for developing cost-effective processes with microalgae, particularly for the production of biofuels and bio-based chemicals through biorefinery, and microalgal biomass recovery through cell flocculation is a promising strategy. Some microalgae are naturally flocculated whose cells can be harvested by simple sedimentation. However, studies on the flocculating agents synthesized by microalgae cells are still very limited. In this work, the cell flocculation of a spontaneously flocculating microalga Chlorella vulgaris JSC-7 was studied, and the flocculating agent was identified to be cell wall polysaccharides whose crude extract supplemented at low dosage of 0.5 mg/L initiated the more than 80% flocculating rate of freely suspended microalgae C. vulgaris CNW11 and Scenedesmus obliquus FSP. Fourier transform infrared (FTIR) analysis revealed a characteristic absorption band at 1238 cm(-1), which might arise from PO asymmetric stretching vibration of [Formula: see text] phosphodiester. The unique cell wall-associated polysaccharide with molecular weight of 9.86×10(3) g/mol, and the monomers consist of glucose, mannose and galactose with a molecular ratio of 5:5:2. This is the first time to our knowledge that the flocculating agent from C. vulgaris has been characterized, which could provide basis for understanding the cell flocculation of microalgae and breeding of novel flocculating microalgae for cost-effective biomass harvest. Copyright © 2013 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Volume reduction of the jugular foramina in Cavalier King Charles Spaniels with syringomyelia.
Schmidt, Martin Jürgen; Ondreka, Nele; Sauerbrey, Maren; Volk, Holger Andreas; Rummel, Christoph; Kramer, Martin
2012-09-06
Understanding the pathogenesis of the chiari-like malformation in the Cavalier King Charles Spaniel (CKCS) is incomplete, and current hypotheses do not fully explain the development of syringomyelia (SM) in the spinal cords of affected dogs. This study investigates an unconventional pathogenetic theory for the development of cerebrospinal fluid (CSF) pressure waves in the subarachnoid space in CKCS with SM, by analogy with human diseases. In children with achondroplasia the shortening of the skull base can lead to a narrowing of the jugular foramina (JF) between the cranial base synchondroses. This in turn has been reported to cause a congestion of the major venous outflow tracts of the skull and consequently to an increase in the intracranial pressure (ICP). Amongst brachycephalic dog breeds the CKCS has been identified as having an extremely short and wide braincase. A stenosis of the JF and a consequential vascular compromise in this opening could contribute to venous hypertension, raising ICP and causing CSF jets in the spinal subarachnoid space of the CKCS. In this study, JF volumes in CKCSs with and without SM were compared to assess a possible role of this pathologic mechanism in the development of SM in this breed. Computed tomography (CT) scans of 40 CKCSs > 4 years of age were used to create three-dimensional (3D) models of the skull and the JF. Weight matched groups (7-10 kg) of 20 CKCSs with SM and 20 CKCSs without SM were compared. CKCSs without SM presented significantly larger JF -volumes (median left JF: 0.0633 cm3; median right JF: 0.0703 cm3; p stenosis of the JF and consecutive venous congestion may explain the aetiology of CSF pressure waves in the subarachnoid space, independent of cerebellar herniation, as an additional pathogenetic factor for the development of SM in this breed.
2002-2003 ACADEMIC TRAINING PROGRAMME, 2nd Term : 20 January to 31 March 2003, LECTURE SERIES
2003-01-01
20, 21, 22, 23, 24 January High Performance Networking by A. Van Praag, CERN-IT 11:00-12:00 - Auditorium, Bldg 500 27, 28, 29, 30, 31 January Cosmology : The Homogeneous Universe and the Evolution of Structures by R. Durrer, Univ. of Geneva, CH 11:00-12:00 - Auditorium, Bldg 500 on 27, 28, 30, 31 January. Council Room on 29 January 3, 4, 5, 6, 7 February Searching for Supersymmetry at the LHC by F. Gianotti (CERN-EP) and G. Ridolfi, Univ. di Genova, I 10:00-12:00 - Auditorium, Bldg 500 10, 11, 12, 13, 14 February Introduction to General Relativity and Black Holes by T. Damour, IHES, Bures-su-Yvette, F 11:00-12:00 - Auditorium, Bldg 500 24, 25, 26 February Physics at a Future Collider beyond the LHC and TeV Class Linear Collider by M. Battaglia, (CERN-EP) 11:00-12:00 - Auditorium, Bldg 500 5, 6, 7 March Modern Project Management by R. Sauter, STS, CH 10:00-12:00 - Auditorium, Bldg 500 17, 18, 19 March Internet Networking Technologies by R. D. Cowles, SLAC 11:00-12:00 ...
Energy Technology Data Exchange (ETDEWEB)
Lu, Jun; Wu, Ruiying; Adkins, Joshua N.; Joachimiak, Andrzej; Glover, Mark
2014-09-16
In the F-family of conjugative plasmids, TraJ is an essential transcriptional activator of the tra operon that encodes most of the proteins required for conjugation. Here we report for the first time the X-ray crystal structures of the TraJ N-terminal regions from the prototypic F plasmid (TraJF11-130) and from the Salmonella virulence plasmid pSLT (TraJpSLT 1-128). Both proteins form similar homodimeric Per-ARNT-Sim (PAS) fold structures. Mutational analysis reveals that the observed dimeric interface is critical for TraJF transcriptional activation, indicating that dimerization of TraJ is required for its in vivo function. An artificial ligand (oxidized dithiothreitol) occupies a cavity in the TraJF dimer interface, while a smaller cavity in corresponding region of the TraJpSLT structure lacks a ligand. Gas chromatography/mass spectrometry-electron ionization analysis of dithiothreitol-free TraJF suggests indole may be the natural TraJ ligand; however, disruption of the indole biosynthetic pathway does not affect TraJF function. Heterologous PAS domains from pSLT and R100 TraJ can functionally replace the TraJF PAS domain, suggesting that TraJ allelic specificity is mediated by the region C-terminal to the PAS domain.
Additive Manufacturing, Design, Testing, and Fabrication: A Full Engineering Experience at JSC
Zusack, Steven
2016-01-01
I worked on several projects this term. While most projects involved additive manufacturing, I was also involved with two design projects, two testing projects, and a fabrication project. The primary mentor for these was Richard Hagen. Secondary mentors were Hai Nguyen, Khadijah Shariff, and fabrication training from James Brown. Overall, my experience at JSC has been successful and what I have learned will continue to help me in my engineering education and profession long after I leave. My 3D printing projects ranged from less than a 1 cubic centimeter to about 1 cubic foot and involved several printers using different printing technologies. It was exciting to become familiar with printing technologies such as industrial grade FDM (Fused Deposition Modeling), the relatively new SLA (Stereolithography), and PolyJet. My primary duty with the FDM printers was to model parts that came in from various sources to print effectively and efficiently. Using methods my mentor taught me and the Stratasys Insight software, I was able to minimize imperfections, hasten build time, improve strength for specific forces (tensile, shear, etc...), and reduce likelihood of a print-failure. Also using FDM, I learned how to repair a part after it was printed. This is done by using a special kind of glue that chemically melts the two faces of plastic parts together to form a fused interface. My first goal with SLA technology was to bring the printer back to operational readiness. In becoming familiar with the Pegasus SLA printer, I researched the leveling, laser settings, and different vats to hold liquid material. With this research, I was successfully able to bring the Pegasus back online and have successfully printed multiple sample parts as well as functional parts. My experience with PolyJet technology has been focused on an understanding of the abilities/limits, costs, and the maintenance for daily use. Still upcoming will be experience with using a composite printer that uses FDM
Information from the central stores
GS Department
2010-01-01
All items sold in the CERN shop (Bldg. 33) are now available in the central stores (Bldg. 73) and can be purchased on-line via EDH “Material Request” or at the “Emergency Desk” of the stores on the ground floor of Bldg. 73. These items are visible in the CERN catalogue under the “SCEM” codes beginning with 92. Department of General Infrastructure Services (GS) GS-SEM Group
Building Integrated Photovoltaic (BIPV) Roofs for Sustainability and Energy Efficiency
2013-09-10
288 Enviromental 1 - Main Membrane 90000 9043 SqFt 472 Ft 94 98 None Real Estate Perimeter: 460Ft Rating: Excellent Rating: Excellent...Cost Index: $2.00 Section: Section Area: 288- Building 288 Enviromental 1 9043 Roof Replacement Cost: Insulation Replacement Cost: $8.00 per...Bldg NoJSec: 2881 Bldg Name: Bui ding 288 Enviromental Bldg Use: Ofice Inspection Date: Oct/2011 Membrane: SINGLE-PlY: PVC Area (SF): 9043
2002 - ACADEMIC TRAINING PROGRAMME
Academic Training; Tel. 73127
2001-01-01
2nd Term : 14 January to 30 March 2002 LECTURE SERIES 14, 15, 16, 17, 18 January 11:00-12:00 - Auditorium, Bldg 500 Superconducting materials suitable for magnets by D.C. Larbalestier / Univ. of Wisconsin, USA 4, 5, 6, 7, 8 February 11:00-12:00 - Council room on 4 February Auditorium, Bldg 500 on 5, 6, 7, 8 February Reliability issues at the LHC by P. Kafka / RelConsult, D 11, 12, 13, 14, 15 February 11:00-12:00 - Auditorium, Bldg 500 Neutrino masses and oscillations by A. de Rujula / CERN-TH 18, 19, 20, 21, 22 February 11:00-12:00 - Auditorium, Bldg 500 Particle identification at the LHC by P. Eerola / Lund Univ. SE 25, 26, 27, 28 February and 1st March 11:00-12:00 - Auditorium, Bldg 500 on 25, 26, 27 February and 1st March, Council room on 28 February Cosmology and the origin of structure by E.W. Kolb / CERN-TH 4, 5, 6, 7, 8, March 11:00-12:00 - Auditorium, Bldg 500 on 4, 5, 6, 8, March Council room on 7 March Data Challenges for the LHC by P. Vande Vyvre / CERN-EP and B. Segal / CERN-IT 12, 13, 14 March 11...
International Nuclear Information System (INIS)
Sato, Kaoru; Manabe, Kentaro; Endo, Akira
2012-01-01
Average adult Japanese male (JM-103) and female (JF-103) voxel (volume pixel) phantoms newly constructed at the Japan Atomic Energy Agency (JAEA) have average characteristics of body sizes and organ masses in adult Japanese. In JM-103 and JF-103, several organs and tissues were newly modeled for dose assessments based on tissue weighting factors of the 2007 Recommendations of the International Commission on Radiological Protection(ICRP). In this study, SAFs for thyroid, stomach, lungs and lymphatic nodes of JM-103 and JF-103 phantoms were calculated, and were compared with those of other adult Japanese phantoms based on individual medical images. In most cases, differences in SAFs between JM-103, JF-103 and other phantoms were about several tens percent, and was mainly attributed to mass differences of organs, tissues and contents. Therefore, it was concluded that SAFs of JM-103 and JF-103 represent those of average adult Japanese and that the two phantoms are applied to dose assessment for average adult Japanese on the basis of the 2007 Recommendations. (author)
Functional analyses of a flavonol synthase–like gene from Camellia ...
Indian Academy of Sciences (India)
ACAATCCAGGGCAAGGTC 172-190. ACAATCAGGGCATTAGGG 815-833. CLoning (JF343560). CnFLS-FL. AGGAGTGAGAAGGGGAAAAA 43-62. CAAGACAATGAAACGAGTGAGT. 1106-1127. Full Length cloing. (JF343560). CnFLS-Q. TGGAAGGCAAGAAAGGATGGG. 407-427. CCACCGGAACAACTTGTCTGC 566-585.
Void formation in ODS EUROFER produced by hot isostatic pressing
International Nuclear Information System (INIS)
Ortega, Y.; Monge, M.A.; Castro, V. de; Munoz, A.; Leguey, T.; Pareja, R.
2009-01-01
Positron annihilation experiments were performed on oxide dispersion strengthened (ODS) and non-ODS EUROFER prepared by mechanical alloying and hot isostatic pressing. The results revealed the presence of small voids in these materials in the as-HIPed conditions. Their evolution under isochronal annealing experiments was investigated. The coincidence Doppler broadening spectra of ODS EUROFER exhibited a characteristic signature attributed to positron annihilation in Ar-decorated voids at the oxide particle/matrix interfaces. The variation of the positron annihilation parameters with the annealing temperature showed three stages: up to 623 K, between 823 and 1323 K, and above 1323 K. In the temperature range 823-1323 K void coarsening had effect. Above 1323 K some voids annealed out, but others, associated to oxide particles and small precipitates, survived to annealing at 1523 K. Transmission electron microscopy observations were also performed to verify the characteristics of the surviving defects after annealing at 1523 K.
Void formation in ODS EUROFER produced by hot isostatic pressing
Energy Technology Data Exchange (ETDEWEB)
Ortega, Y. [Departamento de Fisica, Universidad Carlos III de Madrid, 28911 Leganes (Spain)], E-mail: yanicet@fis.ucm.es; Monge, M.A. [Departamento de Fisica, Universidad Carlos III de Madrid, 28911 Leganes (Spain); Castro, V. de [Department of Materials, University of Oxford, Oxford OX1 3PH (United Kingdom); Munoz, A.; Leguey, T.; Pareja, R. [Departamento de Fisica, Universidad Carlos III de Madrid, 28911 Leganes (Spain)
2009-04-30
Positron annihilation experiments were performed on oxide dispersion strengthened (ODS) and non-ODS EUROFER prepared by mechanical alloying and hot isostatic pressing. The results revealed the presence of small voids in these materials in the as-HIPed conditions. Their evolution under isochronal annealing experiments was investigated. The coincidence Doppler broadening spectra of ODS EUROFER exhibited a characteristic signature attributed to positron annihilation in Ar-decorated voids at the oxide particle/matrix interfaces. The variation of the positron annihilation parameters with the annealing temperature showed three stages: up to 623 K, between 823 and 1323 K, and above 1323 K. In the temperature range 823-1323 K void coarsening had effect. Above 1323 K some voids annealed out, but others, associated to oxide particles and small precipitates, survived to annealing at 1523 K. Transmission electron microscopy observations were also performed to verify the characteristics of the surviving defects after annealing at 1523 K.
Hormazabal, Samuel; Morales, Carmen; Cornejo, Marcela; Bento, Joaquim; Valencia, Luis; Auger, Pierre; Rodriguez, Angel; Correa, Marco; Anabalón, Valeria; Silva, Nelson
2016-04-01
In the Southeast Pacific, oceanographic processes that sustain the biological production necessary to maintain the ecosystems associated to seamounts and oceanic islands are still poorly understood. Recent studies suggest that the interaction of mesoscale and submesoescale eddies with oceanic islands and seamounts could be playing an important role in the time-space variability of primary production. In this work, research cruises, satellite data and Regional Ocean Modeling System (ROMS) results have been used to describe the main characteristics of intrathermocline eddies (ITE) and their impact on the Juan Fernández archipelago (JFA), off central Chile. The JFA is located off the coast of central Chile (33°S), and is composed of three main islands: Robinson Crusoe (RC), Alejandro Selkirk (AS) and Santa Clara (SC). Between the RC and AS are located the westernmost seamounts (JF6 and JF5) of the Juan Fernández archipelago. Satellite altimetry data (sea surface height from AVISO) were used to detect and track mesoscale eddies through eddy-tracking algorithm. Physical, chemical and biological parameters as temperature, salinity, dissolved oxygen and fluorescence were measured in the water column at JF5 and JF6, and along the coast off central Chile (30-40°S). Results from the research cruise exhibit the interaction between an ITE and the seamount JF6. Eddy-tracking results showed that the ITE observed at the JF6 was formed at the coast off central-southern Chile, traveled ~900 km seaward and after ~9 months reached the JF5 and JF6 region. Observations along the Chilean coast confirmed that the coast corresponds to the formation area of the observed ITE. In this region, ITEs are represented by subsurface lenses (~100 km diameter; 400 m thickness) of homogeneous salinity, nutrient rich and oxygen-poor equatorial subsurface water mass (ESSW) which is transported poleward by the Peru-Chile undercurrent in the coastal band and seaward by ITEs. The effect of ITEs on the
Directory of Open Access Journals (Sweden)
Michael D. Kendig
2016-11-01
Full Text Available The high prevalence of obesity and related metabolic diseases calls for greater understanding of the factors that drive excess energy intake. Calorie-dense palatable foods are readily available and often are paired with highly salient environmental cues. These cues can trigger food-seeking and consumption in the absence of hunger. Here we examined the effects of palatable food-paired environmental cues on control of instrumental food-seeking behaviour. In Experiment 1, adult male rats received exposures to one context containing three ‘junk’ foods (JF context and another containing chow (Chow context. Next, rats were food-deprived and trained to perform instrumental responses (lever-press for two novel food rewards in a third, distinct context. Contextual influences on flexible control of food-seeking behaviour were then assessed by outcome devaluation tests held in the JF, chow, and training contexts. Devaluation was achieved using specific satiety and test order was counterbalanced. Rats exhibited goal-directed control over behaviour when tested in the training and chow-paired contexts. Notably, performance was habitual (insensitive to devaluation when tested in the JF context. In Experiment 2 we tested whether the impairment found in the JF context could be ameliorated by the presentation of a discrete auditory cue paired with the chow context, relative to a second cue paired with the JF context. Consistent with the results of Experiment 1, the devaluation effect was not significant when rats were tested in the JF context with the JF cue. However, presenting the chow cue increased the impact of the devaluation treatment leading to a robust devaluation effect. Further tests confirmed that performance in the chow context was goal-directed and that sensory-specific satiety in the JF context was intact. These results show that environments paired with palatable foods can impair goal-directed control over food-seeking behaviour, but that this
Effects of Physical Impairment on Grenade Throwing and Weapon Loading Tasks
2015-03-01
1 GOVT PRINTG OFC (PDF) A MALHOTRA 1 ARMY RSCH LABORATORY – HRED (PDF) RDRL HRM D T DAVIS BLDG 5400 RM C242 REDSTONE ARSENAL...5002 1 ARMY RSCH LABORATORY – HRED (PDF) RDRL HRM DG J RUBINSTEIN BLDG 333 PICATINNY ARSENAL NJ 07806-5000 1 ARMY RSCH LABORATORY...HRED (PDF) ARMC FIELD ELEMENT RDRL HRM CH C BURNS THIRD AVE BLDG 1467B RM 336 FORT KNOX KY 40121 1 ARMY RSCH LABORATORY – HRED
Wastewater Characterization and Hazardous Waste Survey, Hickam AFB, Hawaii.
1987-05-01
5200 20 Jan Bldg 2178 7.6 26 4400 20 Jan Lift Station 1A 7.2 26 9000 2" Jan Bldg 2045 6.5 26 12000 2’ Jan Bldg 358A 7.4 24 27000 21 Jan Lift Station 12...8217679b Toluene n/a 6850-00- 281-2002 Alum Alodine n/a 8030-00-779-4699 Methyl Iso Ketone n/a 6810-00-286-3785 Thinner MIL 81772 8010-O0-181-8080 1055 15
Academic Training: 2nd Term - 09.01.2006 - 31.03.2006
Françoise Benz
2005-01-01
2005 - 2006 ACADEMIC TRAINING PROGRAMME LECTURE SERIES The world quantum matter by M. Weidemüller, Univ. Freiburg, D 23, 24, 25, 26 January 11:00 -1200 - Auditorium, bldg 500 Deep space telescopes by G. Bignami, CNRS, Toulouse, F 13, 14, 15, 16, 17 February 11:00-12:00 - Auditorium, bldg 500 Bioinformatics: analysing the genome by V. Jongeneel, O. Michielin, S. Antonorakis A. Thomas and P. Descombes 27, 28 February, 1, 2, 3 March11:00-12:00 - Auditorium, bldg 500 LHC luminosity upgrade: detector challengesby A. de Roeck,CERN-PH, D. Bortoletto, Purdue Univ. USA R. Wigmans, Texas Tech. Univ. USA, W. Riegler, CERN-AT, W. Smith, Univ. of Wisconsin, USA 13, 14, 15, 16, March 11:00-12:00 - Auditorium, bldg 500 Supersymmetry and the LHC by M. Drees, Univ. of Bonn, D 20, 21, 22, 23, 24 March 11:00-12:00 - Auditorium, bldg 500 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be...
Academic Training - 2nd Term: 08.01.2007 - 31.03.2007
2006-01-01
2006 - 2007 ACADEMIC TRAINING PROGRAMME 2nd Term : 08.01.2007 - 31.03.2007 LECTURE SERIES Applied Superconductivity by V. Palmieri, INFN, Padova, It. 17, 18, 19 January 11:00 -1200 - Auditorium, Bldg 500 String Theory for Pedestrians by B. Zwiebach, M.I.T. Cambridge, USA 29, 30, 31 January 11:00-12:00 - Auditorium, Bldg 500 on 29, 30 January TH Auditorium on 31 January Introduction to Supersymmetry by D. Kaplan, John Hopkins University, Baltimore, USA 12, 13, 14, 15 February 11:00-12:00 - Auditorium, Bldg 500 The Hunt for the Higgs Particle by F. Zwirner, University of Padova, It 27, 28 February, 1st March 11:00-12:00 - Auditorium, Bldg 500 From Evolution Theory to Parallel and Distributed Genetic by F. Fernandez de Vega 15, 16, March 11:00-12:00 - Auditorium, Bldg 500 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the CERN bulletin, the WWW, an...
Academic Training - 2nd Term: 08.01.2007 - 31.03.2007
2006-01-01
2006 - 2007 ACADEMIC TRAINING PROGRAMME 2nd Term : 08.01.2007 - 31.03.2007 LECTURE SERIES Applied Superconductivity by V. Palmieri, INFN, Padova, It. 17, 18, 19 January 11:00 -1200 - Auditorium, bldg. 500 String Theory for Pedestrians by B. Zwiebach, M.I.T. Cambridge, USA 29, 30, 31 January 11:00-12:00 - Auditorium, bldg. 500 on 29, 30 January TH Auditorium on 31 January Introduction to Supersymmetry by D. Kaplan, John Hopkins University, Baltimore, USA 12, 13, 14, 15 February 11:00-12:00 - Auditorium, bldg. 500 The Hunt for the Higgs Particle by F. Zwirner, University of Padova, It 27, 28 February, 1st March 11:00-12:00 - Auditorium, bldg. 500 From Evolution Theory to Parallel and Distributed Genetic Programming by F. Fernandez de Vega 15, 16, March 11:00-12:00 - Auditorium, bldg. 500 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the WWW, and ...
Academic Training: 2005 - 2006 Academic Training Programme
Françoise Benz
2005-01-01
1st Term : 03.10. 2005 - 16.12.2005 LECTURE SERIES Einstein's impact on the physics of the Twentieth Century by N. Straumann / Univ. Zürich, CH 3, 4, 5, 6, 7 October 11:00 -1200 - Auditorium, Bldg 500 Surviving in space: the challenges of a manned mission to Mars by L. S. Pinsky / Univ. Houston, USA 26, 27, 28 October 11:00-12:00 - Auditorium, Bldg 500 Climate change and challenges for the environment by C. Schluechter, Univ. Ber, CH 14, 15, 16 November 11:00-12:00 - TH Auditorium, Bldg 4, 3rd Floor Introduction to Cryogenic Engineering by Goran Perinic, CERN- AT 5, 6, 7, 8, 9 December 11:00-12:00 - Auditorium, Bldg 500 Predicting natural catastrophes by E. Okal, Northwestern Univ. , USA 12, 13, 14, 15, 16 December 11:00-12:00 - Auditorium, Bldg 500 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the CERN bulletin, the WWW, and by Notices before ea...
African Journals Online (AJOL)
Science
2013-04-03
cultured rice plants. Plant Soil 148:107-113. Ma JF, Takahashi E (2002). Soil, Fertilizer, and Plant Silicon Research in Japan. Elsevier Science, Amsterdam. Ma JF, Yamaji N (2006). Silicon uptake and accumulation in higher plants ...
Harray, Amelia J; Boushey, Carol J; Pollard, Christina M; Panizza, Chloe E; Delp, Edward J; Dhaliwal, Satvinder S; Kerr, Deborah A
2017-09-01
To determine perception v. actual intakes of energy-dense nutrient-poor 'junk food' (JF) and sugar-sweetened beverages (SSB) in young adults, using the mobile food record (mFR). Before-and-after eating images using a 4 d mFR were assessed for standardised 600 kJ (143 kcal) servings of JF and SSB (excluding diet drinks). Participants reported their concern about the health aspects of their diet, perceptions and intentions regarding JF and SSB. Perth, Western Australia. Adults (n 246) aged 18-30 years. The mean (sd) intake of JF+SSB was 3·7 (2·0) servings/d. Women thinking about drinking less SSB consumed more SSB servings/d (1·5 (1·2)) than men (0·7 (0·5); P<0·05) who were thinking about drinking less. Men not thinking about cutting down JF consumed more servings/d (4·6 (2·4)) than women (2·5 (0·7); P<0·01) who were not thinking about cutting down. Those who paid a lot of attention to the health aspects of their diet consumed less JF+SSB than those who took only a bit of notice (P<0·001), were not really thinking much about it (P<0·001) or who didn't think at all about the health aspects of food (P<0·01). Perceptions and attitudes regarding JF and SSB were associated with level of consumption. Those not thinking about cutting down their intake of these foods represent an important target group as they consume more than their peers. Further research is needed to identify how amenable young adults are to changing their intake, particularly given the lack of attention paid to the health aspects of their diet.
Sustainable development through innovation (the example of JSC «Concern» Constellation»
Directory of Open Access Journals (Sweden)
T. I. Ovchinnikova
2016-01-01
Full Text Available In the article the «economic growth» theoretical approaches to the terms and «sustainable development». It is indicated that «sustainable development» is related to the introduction of new technologies and innovations, as well as the mechanisms of perfection economic activity. The concept of «sustainable development» includes the principles of sustainability and balanced-ness, while economic growth is associated with the dominant country economic policy objectives, including innovative factors, with the well-being of its population level: the development of the social structure, from the labor market level and other factors. Prospects of development of the country based on the justification of the socio-economic model of its translational movement in the world civilization. Excessive political risks and economic sanctions have shown that Russia should not rely on foreign imports of high-tech, and the need to develop import substitution. Change the vector of development of the Russian economy made their adjustments to the development of the Voronezh region economy slowed down the speed of displacements, of capital, the regional financial centers develop poorly, due to lack of investment has slowed the growth of innovational and information development. There is a growing dependence of the region on the processes taking place at the international and national levels. In the example of the Voronezh area are considered factors of sustainable development such as the coordination of organizational efforts and financial resources in order to achieve a new quality of the region's population lives, and necessity of formation of a new development paradigm of management in the region, based on the modernization of diversified bath economy and the introduction of mechanisms to ensure the implementation of sustainable development. In view of the innovative-investment activity of JSC «Concern» Constellation «steady growth
Charlton, Bruce G
2008-11-01
Perhaps the earliest authoritative measurement of a social class gradient in IQ, with a stratification of occupations among the parents of children with different IQs, is seen in two fascinating papers published in 1923 and 1929 in the British Journal of Psychology. The authors were GH Thomson and JF Duff (both of whom were later knighted) and the papers' main findings were confirmed by later researchers. Results of an intelligence test administered to 13419 children aged 11-12 were analyzed according to parent's occupation. The average children's IQ at extremes of social class among their parents included clergymen-121, teachers-116 and bankers and managers-112 at the upper end; while at the lower end there were 'cripples and invalids'-94, cattlemen-93, hawkers and chimneysweeps-91, and the 'insane, criminal'-88. More than 100 specific categories of parental occupations were then combined into 13 social classes, with their children's average IQ as follows: Professional-112; Managers-110; Higher Commercial-109; Army, Navy, Police, Postmen-106; Shopkeeping-105; Engineers [ie. apprenticed craftsmen, such as mining engineers]-103; Foremen-103; Building trades-102; Metal workers, shipbuilders-101; Miscellaneous industrial workers-101; Miners and quarrymen-98; Agriculture-98; Labourers-96. A follow-up study compared an 'intelligent' group (IQ 136 plus) with a matched IQ 95-105 'control' group. IQ testing at age 11-12 was predictive of teacher's reports of higher levels of intelligence and health at age 16; and better performance in official examinations. The occupations of fathers, grandfathers and uncles were consistent with occupation being indicative of 'an inherited quality' (i.e. IQ) and there was regression from parents to grandparents and uncles among the 'intelligent' but not among controls. Other findings included a wider variance in intelligence among boys than girls, and descriptions of the predictive value of IQ in estimating future education, examinations
2005 - 2006 ACADEMIC TRAINING PROGRAMME From 1st of May to 30 June
2006-01-01
LECTURE SERIES Physics at the Tevatron by B. Heinemann Univ. of Liverpool - Fermilab 15, 16, 17, 18 May 11:00 -1200 - Auditorium, Bldg 500, 18 May - Council Chamber Pulsed SC Magnets by M. Wilson, 29, 30, 31 May, 1, 2 June 11:00-12:00 - Auditorium, Bldg 500 Exploring planets and moons in our solar system by H.O. Rucker / Academy of Sciences, Graz, A 6, 7, 8, 9 June 11:00-12:00 - Auditorium, Bldg 500 Technological challenges of CLIC by R. Corsini, S. Doebert, S. Redaelli, T. Lefevre / CERN-AB, G. Arnau Izquiedo, H. Mainaud / CERN-TS 12, 13, 14, 15, 16, June 11:00-12:00 - Auditorium, Bldg 500 The use of Monte Carlo radiation transport codes in radiation physics and dosimetry by A. Ferrari, CERN-AB, M. Silari, CERN-SC, F. Salvat, Facultat de Fisica, Univ. Barcelona, E. 26, 27, 28 June 11:00-12:00 - TH Auditorium, Bldg 4, room 3-006 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place ...
Directory of Open Access Journals (Sweden)
Velayudhan Satheeja Santhi
2014-06-01
Full Text Available The ever growing demands for food products such as starch and sugar produces; there is a need to find the sources for saccharification for cellulosic bioethanol production. This study provides the first evidence of the lignocellulolytic and saccharifying ability of a marine bacterium namely Isoptericola sp. JS-C42, a Gram positive actinobacterium with the cocci cells embedded on mycelia isolated from the Arabian Sea, India. It exhibited highest filter paper unit effect, endoglucanase, exoglucanase, cellobiohydrolase, β-glucosidase, xylanase and ligninase effect. The hydrolytic potential of the enzymes displayed the efficient saccharification capability of steam pretreated biomass. It was also found to degrade the paddy, sorghum, Acacia mangium and Ficus religiosa into simple reducing sugars by its efficient lignocellulose enzyme complex with limited consumption of sugars. Production of ethanol was also achieved with the Saccharomyces cerevisiae. Overall, it offers a great potential for the cellulosic ethanol production in an economically reliable and eco-friendly point-of-care.
Santhi, Velayudhan Satheeja; Gupta, Ashutosh; Saranya, Somasundaram; Jebakumar, Solomon Robinson David
2014-06-01
The ever growing demands for food products such as starch and sugar produces; there is a need to find the sources for saccharification for cellulosic bioethanol production. This study provides the first evidence of the lignocellulolytic and saccharifying ability of a marine bacterium namely Isoptericola sp. JS-C42, a Gram positive actinobacterium with the cocci cells embedded on mycelia isolated from the Arabian Sea, India. It exhibited highest filter paper unit effect, endoglucanase, exoglucanase, cellobiohydrolase, β-glucosidase, xylanase and ligninase effect. The hydrolytic potential of the enzymes displayed the efficient saccharification capability of steam pretreated biomass. It was also found to degrade the paddy, sorghum, Acacia mangium and Ficus religiosa into simple reducing sugars by its efficient lignocellulose enzyme complex with limited consumption of sugars. Production of ethanol was also achieved with the Saccharomyces cerevisiae . Overall, it offers a great potential for the cellulosic ethanol production in an economically reliable and eco-friendly point-of-care.
2007-01-01
Dear Colleagues, 2007 is a very special year for CERN. I would like to review the status of our activities with you, and I invite you to a presentation on Wednesday 27 June 2007 at 3:00 p.m. Main Auditorium (bldg. 500) Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (bldg. 31) and the AT Auditorium (bldg. 30). Simultaneous translation into English will be available in the Main Auditorium. Robert AYMAR
Rondón-Barragán, Iang; Nozaki, Reiko; Hirono, Ikuo; Kondo, Hidehiro
2017-08-01
DNA vaccination is one method to protect farmed fish from viral and bacterial diseases. Chimeric antigens encoded by DNA vaccines have been shown to increase the resistance to viral diseases. Here, we sequenced the gene encoding lysosome-associated membrane protein-1 from Japanese flounder, Paralichthys olivaceus, (JfLAMP-1) and assessed its use in a chimeric DNA vaccine fused with the major capsule protein (MCP) from red seabream iridovirus (RSIV). JfLAMP-1 cDNA has a length of 1248 bp encoding 415 aa, which contains transmembrane and cytoplasmic domains. JfLAMP-1 is constitutively expressed in several tissues and its expression in spleen was upregulated following injection of formalin-killed cells (FKC) of Edwardsiella tarda. Immunofluorescence analysis showed that JfLAMP-1 is distributed in the small and large granules in the cytoplasm and groups close to the nucleus. The DNA encoding the luminal domain of JfLAMP-1 was replaced with the gene for the RSIV MCP, and the construct was cloned in an expression vector (pCIneo). Fish vaccinated with pCLAMP-MCP had significantly higher antibody levels than fish vaccinated with pCIneo vector harboring the MCP gene (p day 30 post-vaccination. Copyright © 2017 Elsevier Ltd. All rights reserved.
2010-10-25
...] Draft Guidance for Industry on Qualification Process for Drug Development Tools; Availability AGENCY... Drug Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 51, rm... Drug Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 21, rm...
75 FR 2555 - Homeland Security Science and Technology Advisory Committee
2010-01-15
... Technology Advisory Committee will meet January 26-28, 2010, at the Department of Homeland Security, 1120..., Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410... Burse, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410...
Directory of Open Access Journals (Sweden)
Prikhod’ko Oleg Alekseevich
2017-05-01
Full Text Available The article presents the research of MGSU Corporation for testing of design solutions of the “Eastern petrochemical company” JSC oil refinery and petrochemical plants port complex using the physical modeling method. Construction of the marine terminal of the oil refinery and petrochemical plants port complex is planned to be on the Eastern shore of the Vostok Bay which is the part of Peter the Great Bay in the Sea of Japan. The port area is created by means of an artificial land site. The water area of the terminal will be guarded against sea waves by a breakwater. Experiments on the study of wave propagation in the port model water area at the Eastern and Western breakwaters were performed in the laboratory wave basin in three-dimensional layout, with the aim of obtaining of data about wave heights at berthing facilities. Effectiveness of the breakwater designs was studied in two-dimensional layout in a wave flume. During the port model construction all the designed waterworks as well as the project bathymetry of the port water area were reproduced at a scale of 1:100. Analysis of the experiment results with the slope protection embodiment version demonstrates that this engineering solution is able to withstand waves of the design parameters.
Kendig, Michael D; Cheung, Ambrose M K; Raymond, Joel S; Corbit, Laura H
2016-01-01
The high prevalence of obesity and related metabolic diseases calls for greater understanding of the factors that drive excess energy intake. Calorie-dense palatable foods are readily available and often are paired with highly salient environmental cues. These cues can trigger food-seeking and consumption in the absence of hunger. Here we examined the effects of palatable food-paired environmental cues on control of instrumental food-seeking behavior. In Experiment 1, adult male rats received exposures to one context containing three "junk" foods (JFs context) and another containing chow (Chow context). Next, rats were food-deprived and trained to perform instrumental responses (lever-press) for two novel food rewards in a third, distinct context. Contextual influences on flexible control of food-seeking behavior were then assessed by outcome devaluation tests held in the JF, chow and training contexts. Devaluation was achieved using specific satiety and test order was counterbalanced. Rats exhibited goal-directed control over behavior when tested in the training and chow-paired contexts. Notably, performance was habitual (insensitive to devaluation) when tested in the JF context. In Experiment 2 we tested whether the impairment found in the JF context could be ameliorated by the presentation of a discrete auditory cue paired with the chow context, relative to a second cue paired with the JF context. Consistent with the results of Experiment 1, the devaluation effect was not significant when rats were tested in the JF context with the JF cue. However, presenting the chow cue increased the impact of the devaluation treatment leading to a robust devaluation effect. Further tests confirmed that performance in the chow context was goal-directed and that sensory-specific satiety in the JF context was intact. These results show that environments paired with palatable foods can impair goal-directed control over food-seeking behavior, but that this deficit was improved by
1323-IJBCS-Article-Gaudence Djego
African Journals Online (AJOL)
KODJIO NORBERT
Les stratégies intégrées de conservation des forêts dans lesquelles la sauvegarde des ressources forestières en général et de la biodiversité en particulier, nécessitent en premier lieu un bon état des lieux. Au moment où la préservation de l'environnement et la sauvegarde de la diversité biologique sont prônées de par le.
2004-01-01
I would like to invite all members of the CERN Personnel to a meeting on Tuesday 13 January 2004 at 4:00 p.m. - Main Auditorium (bldg. 500) to convey my best wishes for the new year and to present a perspective of CERN's future activities. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (bldg. 31) and the AT Auditorium (bldg. 30). A simultaneous translation into English will be available in the main Auditorium. Robert AYMAR
LIMITED RESTAURANT SERVICE: EASTER WEEKEND
2003-01-01
As Friday, April 18 and Monday, April 21, 2003 are CERN holidays, restaurants no. 1 (COOP : Bldg. 501- Meyrin) and no. 3 (AVENANCE : Bldg. 866 - Prévessin) will be closed and will remain so on Saturday and Sunday, April 19 - 20. They will reopen on Tuesday, April 22 at 7h00. During these four days, a limited service will be provided by restaurant no. 2 (DSR : Bldg. 504 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30.
Noble, David J; Scoffings, Daniel; Ajithkumar, Thankamma; Williams, Michael V; Jefferies, Sarah J
2016-11-01
There is no consensus approach to covering skull base meningeal reflections-and cerebrospinal fluid (CSF) therein-of the posterior fossa cranial nerves (CNs VII-XII) when planning radiotherapy (RT) for medulloblastoma and ependymoma. We sought to determine whether MRI and specifically fast imaging employing steady-state acquisition (FIESTA) sequences can answer this anatomical question and guide RT planning. 96 posterior fossa FIESTA sequences were reviewed. Following exclusions, measurements were made on the following scans for each foramen respectively (left, right); internal acoustic meatus (IAM) (86, 84), jugular foramen (JF) (83, 85) and hypoglossal canal (HC) (42, 45). A protocol describes measurement procedure. Two observers measured distances for five cases and agreement was assessed. One observer measured all the remaining cases. IAM and JF measurement interobserver variability was compared. Mean measurement difference between observers was -0.275 mm (standard deviation 0.557). IAM and JF measurements were normally distributed. Mean IAM distance was 12.2 mm [95% confidence interval (CI) 8.8-15.6]; JF was 7.3 mm (95% CI 4.0-10.6). The HC was difficult to visualize on many images and data followed a bimodal distribution. Dural reflections of posterior fossa CNs are well demonstrated by FIESTA MRI. Measuring CSF extension into these structures is feasible and robust; mean CSF extension into IAM and JF was measured. We plan further work to assess coverage of these structures with photon and proton RT plans. Advances in knowledge: We have described CSF extension beyond the internal table of the skull into the IAM, JF and HC. Oncologists planning RT for patients with medulloblastoma and ependymoma may use these data to guide contouring.
International Nuclear Information System (INIS)
Miyahara, Makoto; Sugi, Eriko; Katoh, Takashi; Hironiwa, Takayuki; Sunaga, Hiromi; Luo, Ling Z.
2012-01-01
In the thermoluminescence (TL) detection method for irradiated foods, accurate standards have been developed for detecting irradiated foods. The standard method describes that emission maximum temperature (T1i) and TL ratio for non-heated or non-mixed sample can be in the range of 150–250 °C and more than 0.1, respectively, when it was irradiated food. But when irradiated food is heated up to 200 °C, or mixed up with non-irradiated stuffs, T1i and TL ratio would not drop in the range. Here we examined the effects of the two processes, heating and mixing with non-irradiated food, on T1i and G1/G1k ratio (ratio of G1 and average G1 for 1-kGy-irradiated JF2, this value is modeled after TL ratio) using a model consisting of irradiated and non-irradiated geochemical standards of feldspar (JF1, JF2, PF, etc.). T1i temperatures for irradiated JF1, JF2, and PF ranged from 163 to 175 °C, while those for the non-irradiated JF2 ranged from 253 to 263 °C. T1i temperatures for 5-kGy-irradiated and preheated JF2 for 10 s, 20 s, and 30 s at 180 °C were 215, 225, and 231 °C, respectively. When JF2 was irradiated from 100 Gy to 5 kGy, the T1i was almost constant at any doses. G1/G1k ratios at 100, 200, and 500 Gy were 0.15, 0.23, and 0.60, respectively. G1/G1k ratio was proportional to the given dose at the integration temperature ranges. The TS sample, which originated from farm soil in Tanegashima Island, gave the same results as JF2. T1is for 5-kGy-irradiated and preheated JF2 for 20 s at 150, 180, and 200 °C were 197, 225, and 246 °C, respectively. Longer and higher preheating resulted in higher T1i. Longer and higher preheating extremely reduced the G1/G1k ratio, and in some cases the ratio was less than 0.1. This means TL ratio is useless in determination of the standard for irradiated food. Peak temperatures for JF2 in mixture of 5-kGy-irradiated to non-irradiated (1.25–5%) were 261–263 °C (non-irradiated portion, T1n) and 177–180 °C (irradiated portion T1i
Explicit Bounds and Sharp Results for the Composition Operators Preserving the Exponential Class
Directory of Open Access Journals (Sweden)
Fernando Farroni
2016-01-01
Full Text Available Let f:Ω⊂Rn→Rn be a quasiconformal mapping whose Jacobian is denoted by Jf and let EXP(Ω be the space of exponentially integrable functions on Ω. We give an explicit bound for the norm of the composition operator Tf: u∈EXP(Ω↦u∘f-1∈EXP(f(Ω and, as a related question, we study the behaviour of the norm of logJf in the exponential class. The A∞ property of Jf is the counterpart in higher dimensions of the area distortion formula due to Astala in the plane and it is the key tool to prove the sharpness of our results.
2013-10-23
...: The Food and Drug Administration (FDA) is announcing the availability of a draft guidance for industry... Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 51, rm. 2201, Silver... and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 22, rm. 6360, Silver...
2012-11-20
...., Bldg. 51, Rm. 2201, Silver Spring, MD 20993-0002; Office of Communication, Outreach and Development...., Bldg. 66, Rm. 4613, Silver Spring, MD 20993-0002; and Office of Critical Path Programs, Office of the... finalized, will represent the Agency's current thinking on capturing, using, and archiving electronic data...
2006 - 2007 ACADEMIC TRAINING PROGRAMME
2006-01-01
1st Term: 02.10. 2006 - 15.12.2006 LECTURE SERIES Practical statistics for particle physicists by L. Lyons, Univ. Oxford, GB 9, 10, 11, 12, 13 October 11:00 -12:00 - Main Auditorium, Bldg 500 Gravitational waves by M. Landry, LIGO Hanford Observatory, Richland, USA 16, 17, 18 October 11:00-12:00 - Main Auditorium, Bldg 500 Neutrino physics, past and future by B. Kayser, FERMILAB, Batavia, USA 27, 28, 29, 30 November, 1 December 11:00-12:00 - TH Auditorium, Bldg 4, 3rd Floor QCD: are we ready for the LHC by S. Frixione, INFN, Genoa, It 4, 5, 6, 7 December 11:00-12:00 - Auditorium, Bldg 500 The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the CERN bulletin, the WWW, and by Notices before each term and for each series of lectures. ENSEIGNEMENT ACADEMIQUE ACADEMIC TRAINING Françoise Benz 73127 academic.training@cern.ch
76 FR 12227 - Federal Property Suitable as Facilities To Assist the Homeless
2011-03-04
...: Excess GSA Number: Comments: 2024 sq. ft. sq. ft., concrete, poor condition, off-site use only Bldg..., pres. of asbestos clean-up required of contamination, use of respirator required by those entering... (oil storage bldg.--training ctr.), repairs needed for buildings 5 Bldgs. Fort Riley Fort Riley KS...
CERN Bulletin
2010-01-01
As of 8 December 2010 and until the end of February 2011, the Users Office will move from Bldg. 60. New Location : Bldg. 510-R-033 Opening Hours: Monday, Tuesday, Thursday, Friday : 08.30 – 12.30 Monday to Friday: 14.00 – 16.00 Closed Wednesday mornings.
An X-Ray Source for Lithography Based on a Quasi-Optical Maser Undulator
1989-05-09
18, 1986, Edited by J. B. Godel, W. Marcuse and G. P. Williams, Brookhaven National Laboratory Report 52046. 2. In preparing this and the following...90278 Dr. Herbert S. Bennett Dr. John Booske National Bureau of Standards Energy Research Bldg. Bldg. 225, Rm. A352 University of Maryland Washington
2006-01-01
I would like to invite all members of the CERN Personnel to a meeting on Thursday 18 January 2007 at 3:00 p.m. Main Auditorium (bldg.. 500) to convey my best wishes for the new year, to review CERN's activities during 2006 and to present the perspectives for this special year of the LHC start-up. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (bldg.. 31) and the AT Auditorium (bldg.. 30). Simultaneous translation into English will be available in the main Auditorium. Robert AYMAR
Robert Aymar
2005-01-01
I would like to invite all members of the CERN Personnel to a meeting on Thursday 12 January 2006 at 4:00 p.m. - Main Auditorium (bldg. 500) to convey my best wishes for the new year, to review CERN's activities during 2005 and to present the perspectives for this coming year. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (bldg. 31) and the AT Auditorium (bldg. 30). A simultaneous translation into English will be available in the main Auditorium. Best wishes for the festive season Robert AYMAR
Closure Report for Corrective Action Unit 300: Surface Release Areas Nevada Test Site, Nevada
Energy Technology Data Exchange (ETDEWEB)
NSTec Environmental Restoration
2007-07-01
Corrective Action Unit (CAU) 300 is located in Areas 23, 25, and 26 of the Nevada Test Site, which is located approximately 65 miles northwest of Las Vegas, Nevada. CAU 300 is listed in the Federal Facility Agreement and Consent Order of 1996 as Surface Release Areas and is comprised of the following seven Corrective Action Sites (CASs), which are associated with the identified Building (Bldg): {sm_bullet} CAS 23-21-03, Bldg 750 Surface Discharge {sm_bullet} CAS 23-25-02, Bldg 750 Outfall {sm_bullet} CAS 23-25-03, Bldg 751 Outfall {sm_bullet} CAS 25-60-01, Bldg 3113A Outfall {sm_bullet} CAS 25-60-02, Bldg 3901 Outfall {sm_bullet} CAS 25-62-01, Bldg 3124 Contaminated Soil {sm_bullet} CAS 26-60-01, Bldg 2105 Outfall and Decon Pad The Nevada Division of Environmental Protection (NDEP)-approved corrective action alternative for CASs 23-21-03, 23-25-02, and 23-25-03 is no further action. As a best management practice, approximately 48 feet of metal piping was removed from CAS 23-25-02 and disposed of as sanitary waste. The NDEP-approved corrective action alternative for CASs 25-60-01, 25-60-02, 25-62-01, and 26-60-01, is clean closure. Closure activities for these CASs included removing and disposing of soil impacted with total petroleum hydrocarbons-diesel range organics (TPH-DRO), polychlorinated biphenyls (PCBs), semivolatile organic compounds (SVOCs), and cesium (Cs)-137, concrete impacted with TPH-DRO, and associated piping impacted with TPH-DRO. CAU 300 was closed in accordance with the NDEP-approved CAU 300 Corrective Action Plan (CAP) (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2006). The closure activities specified in the CAP were based on the recommendations presented in the CAU 300 Corrective Action Decision Document (NNSA/NSO, 2005). This Closure Report documents CAU 300 closure activities. During closure activities, approximately 40 cubic yards (yd3) of low-level waste consisting of TPH-DRO-, PCB
75 FR 53692 - Pesticide Products; Registration Applications
2010-09-01
...), Environmental Protection Agency, Rm. S-4400, One Potomac Yard (South Bldg.), 2777 S. Crystal Dr., Arlington, VA... (South Bldg.), 2777 S. Crystal Dr., Arlington, VA. The hours of operation of this Docket Facility are...: Bifenthrin. Proposed uses: Grass forage, fodder and hay group, grass grown for seed, pasture and rangeland...
77 FR 23813 - Federal Property Suitable as Facilities To Assist the Homeless
2012-04-20
... Number: Comments: 2024 sq. ft. sq. ft., concrete, poor condition, off-site use only Colorado Bldg. 00127...: 45,216 sq. ft. underground tunnel complex, pres. of asbestos clean-up required of contamination, use..., 07739, 8329 Comments: Off-site removal only, sq. ft. varies for each bldg., current use varies (oil...
75 FR 35810 - Registration Review; Pesticide Dockets Opened for Review and Comment
2010-06-23
...), Environmental Protection Agency, Rm. S-4400, One Potomac Yard (South Bldg.), 2777 S. Crystal Dr., Arlington, VA..., One Potomac Yard (South Bldg.), 2777 S. Crystal Dr., Arlington, VA. The hours of operation of this... Number, E-mail Address Bifenthrin (7402) EPA-HQ-OPP-2010-03 Jacqueline Guerry, 84 (215) 814-2184, guerry...
Simple Computation of the Heat of Formation and Density from Theoretically Predicted Values
2012-09-01
ARSENAL AL 35898-5249 2 US ARMY AVN & MIS CMND ATTN AMSRD AMR PS PT L PLEDGER ATTN AMSRD AMR PS PT M MORRISON BLDG 7120...REDSTONE ARSENAL AL 35898 2 US ARMY AVN & MIS CMND ATTN AMSRD ARL PS PT G DRAKE ATTN AMSRD ARL PS PT N MATHIS BLDG 7120
Change of offices for the FAP Department
FAP Department
2016-01-01
The FAP Department would like to inform personnel that, due to office renovation work, a number of FAP services currently located on the third floor of building 4 and on the first floor of building 33 will move to temporary offices in building 653 as from late June. The following services will be relocated to: Accounting services (J. Robinson): FAP-ACC-AP – Accounts Payable, to bldg 653-R-008 – C. Marme FAP-ACC-GA – General Accounting, to bldg 653-1-007 – C. Poncet FAP-ACC-PA – Salary Office, to bldg 653-R-011 – S. Baudat FAP-ACC-PA – Claims, to bldg 653-R-007 – S. Baudat And the section FAP-TPR-MI - Monitoring and reporting (L. Lockwood) will be located in the office 653-1-016. The removals will take place from Thursday 30 June until Tuesday 5 July 2016 inclusive and during this period, telephone and e-mail contact may be disrupted. Temporary office number...
2007-01-01
I would like to invite all members of the CERN Personnel to a meeting on Wednesday 16 January 2008 at 3:00 p.m. Main Auditorium (bldg 500) to convey my best wishes for the new year, to review CERN’s activities during 2007 and to present the perspectives for 2008, the year of the LHC start-up. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (Bldg. 31) and the AT Auditorium (Bldg. 30). Simultaneous translation into English will be available in the main Auditorium. Best wishes for the festive season! Robert AYMAR
LIMITED RESTAURANT SERVICE: EASTER WEEK-END
2004-01-01
As Friday April 9 and Monday April 12 2004 are CERN holidays, restaurants no. 1 (Bldg. 501- Meyrin) and no. 3 (Bldg. 866 - Prévessin) will be closed and will remain closed on Saturday and Sunday, April 10 - 11. They will reopen on Tuesday, April 13 at 7 a.m. During these four days, a limited service will be provided by restaurant no. 2 (Bldg. 504 - Meyrin): on Friday and Monday from 8 a.m. to 9 p.m. and on Saturday and Sunday from 9 a.m. to 8.30 p.m. Hot meals will be served from 11.30 a.m. to 2 p.m. and from 6 p.m. to 7.30 p.m.
Jean-Claude Gadmer
2013-01-01
29 August 2013 - J.-F. Jauslin, Directeur de l’Office fédéral de la culture (OFC) Ambassadeur suisse auprès de l’UNESCO et de l’OIF au 1er septembre 2013 Confédération suisse visite le centre visiteurs de l’expérience ATLAS ainsi que la caverne expérimentale d'ATLAS avec P. Jenny, ancien Porte-parole d'ATLAS. M. Bona, Conseiller du Directeur général pour les relations avec les Organisations internationales présent tout au long.
Study of the 'non-Abelian' current algebra of a non-linear σ-model
International Nuclear Information System (INIS)
Ghosh, Subir
2006-01-01
A particular form of non-linear σ-model, having a global gauge invariance, is studied. The detailed discussion on current algebra structures reveals the non-Abelian nature of the invariance, with field dependent structure functions. Reduction of the field theory to a point particle framework yields a non-linear harmonic oscillator, which is a special case of similar models studied before in [J.F. Carinena et al., Nonlinearity 17 (2004) 1941, math-ph/0406002; J.F. Carinena et al., in: Proceedings of 10th International Conference in Modern Group Analysis, Larnaca, Cyprus, 2004, p. 39, math-ph/0505028; J.F. Carinena et al., Rep. Math. Phys. 54 (2004) 285, hep-th/0501106]. The connection with non-commutative geometry is also established
Closure Report for Corrective Action Unit 300: Surface Release Areas Nevada Test Site, Nevada
International Nuclear Information System (INIS)
NSTec Environmental Restoration
2007-01-01
Corrective Action Unit (CAU) 300 is located in Areas 23, 25, and 26 of the Nevada Test Site, which is located approximately 65 miles northwest of Las Vegas, Nevada. CAU 300 is listed in the Federal Facility Agreement and Consent Order of 1996 as Surface Release Areas and is comprised of the following seven Corrective Action Sites (CASs), which are associated with the identified Building (Bldg): (sm b ullet) CAS 23-21-03, Bldg 750 Surface Discharge (sm b ullet) CAS 23-25-02, Bldg 750 Outfall (sm b ullet) CAS 23-25-03, Bldg 751 Outfall (sm b ullet) CAS 25-60-01, Bldg 3113A Outfall (sm b ullet) CAS 25-60-02, Bldg 3901 Outfall (sm b ullet) CAS 25-62-01, Bldg 3124 Contaminated Soil (sm b ullet) CAS 26-60-01, Bldg 2105 Outfall and Decon Pad The Nevada Division of Environmental Protection (NDEP)-approved corrective action alternative for CASs 23-21-03, 23-25-02, and 23-25-03 is no further action. As a best management practice, approximately 48 feet of metal piping was removed from CAS 23-25-02 and disposed of as sanitary waste. The NDEP-approved corrective action alternative for CASs 25-60-01, 25-60-02, 25-62-01, and 26-60-01, is clean closure. Closure activities for these CASs included removing and disposing of soil impacted with total petroleum hydrocarbons-diesel range organics (TPH-DRO), polychlorinated biphenyls (PCBs), semivolatile organic compounds (SVOCs), and cesium (Cs)-137, concrete impacted with TPH-DRO, and associated piping impacted with TPH-DRO. CAU 300 was closed in accordance with the NDEP-approved CAU 300 Corrective Action Plan (CAP) (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office [NNSA/NSO], 2006). The closure activities specified in the CAP were based on the recommendations presented in the CAU 300 Corrective Action Decision Document (NNSA/NSO, 2005). This Closure Report documents CAU 300 closure activities. During closure activities, approximately 40 cubic yards (yd3) of low-level waste consisting of TPH
Positron annihilation characteristics of ODS and non-ODS EUROFER isochronally annealed
International Nuclear Information System (INIS)
Ortega, Y.; Castro, V. de; Monge, M.A.; Munoz, A.; Leguey, T.; Pareja, R.
2008-01-01
Yttrium oxide dispersion strengthened (ODS) and non-ODS EUROFER produced by mechanical alloying and hot isostatic pressing have been subjected to isochronal annealing up to 1523 K, and the evolution of the open-volume defects and their thermal stability have been investigated using positron lifetime and coincidence Doppler broadening (CDB) techniques. Transmission electron microscopy (TEM) observations have also been performed on the studied samples to verify the characteristics of the surviving defects after annealing at 1523 K. The CDB spectra of ODS EUROFER exhibit a characteristic signature that is attributed to positron annihilation in Ar-decorated cavities at the oxide particle/matrix interfaces. The variation of the positron annihilation parameters with the annealing temperature shows three stages: up to 623 K, between 823 and 1323 K, and above 1323 K. Three-dimensional vacancy clusters, or voids, are detected in either materials in as-HIPed condition and after annealing at T ≤ 623 K. In the temperature range 823-1323 K, these voids' growth and nucleation and the growth of other new species of voids take place. Above 1323 K, some unstable cavities start to anneal out, and cavities associated to oxide particles and other small precipitates survive to annealing at 1523 K. The TEM observations and the positron annihilation results indicate that these cavities should be decorated with Ar atoms absorbed during the mechanical alloying process
Positron annihilation characteristics of ODS and non-ODS EUROFER isochronally annealed
Energy Technology Data Exchange (ETDEWEB)
Ortega, Y. [Departamento de Fisica, Universidad Carlos III de Madrid, 28911 Leganes (Spain)], E-mail: yanicet@fis.ucm.es; Castro, V. de; Monge, M.A.; Munoz, A.; Leguey, T.; Pareja, R. [Departamento de Fisica, Universidad Carlos III de Madrid, 28911 Leganes (Spain)
2008-05-31
Yttrium oxide dispersion strengthened (ODS) and non-ODS EUROFER produced by mechanical alloying and hot isostatic pressing have been subjected to isochronal annealing up to 1523 K, and the evolution of the open-volume defects and their thermal stability have been investigated using positron lifetime and coincidence Doppler broadening (CDB) techniques. Transmission electron microscopy (TEM) observations have also been performed on the studied samples to verify the characteristics of the surviving defects after annealing at 1523 K. The CDB spectra of ODS EUROFER exhibit a characteristic signature that is attributed to positron annihilation in Ar-decorated cavities at the oxide particle/matrix interfaces. The variation of the positron annihilation parameters with the annealing temperature shows three stages: up to 623 K, between 823 and 1323 K, and above 1323 K. Three-dimensional vacancy clusters, or voids, are detected in either materials in as-HIPed condition and after annealing at T {<=} 623 K. In the temperature range 823-1323 K, these voids' growth and nucleation and the growth of other new species of voids take place. Above 1323 K, some unstable cavities start to anneal out, and cavities associated to oxide particles and other small precipitates survive to annealing at 1523 K. The TEM observations and the positron annihilation results indicate that these cavities should be decorated with Ar atoms absorbed during the mechanical alloying process.
Dicty_cDB: Contig-U09720-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available Contig-U09720-1 gap included 1323 2 5906974 5908260 PLUS 1 2 U09720 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09720-1 Contig ID Contig-U09720-1 Contig update 2002. 9.13 Contig sequence >Contig-U09720-1 (Contig-U09720-1Q) /CSM_Contig/Contig-U09720...ATNATTATTATAAAAATTT Gap gap included Contig length 1323 Chromosome number (1..6, ...QLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLKNQREIIAQSLKIXKKL*linqxll*kf ...AEMFDIDSRNNHAIENDGRLDDA LVCSVGIALAPQSIFQSWKSMSEHKREKYFEQLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLK
30 CFR 75.1323 - Blasting circuits.
2010-07-01
...) Blasting circuits shall be protected from sources of stray electric current. (b) Detonators made by different manufacturers shall not be combined in the same blasting circuit. (c) Detonator leg wires shall be... used between the blasting cable and detonator circuitry shall— (1) Be undamaged; (2) Be well insulated...
40 CFR 52.1323 - Approval status.
2010-07-01
... on January 16, 1979 (44 FR 3274) are met. (b) The Administrator approves Rule 10 CSR 10-2.290 as.... (c) The Administrator approves Rule 10 CSR 10-2.230 as identified under § 52.1320, paragraph (c)(70... SIP would be the emission limits stated in the rule. (d) The Administrator approves Rule 10 CSR 10-5...
International Nuclear Information System (INIS)
1997-05-01
Oak Ridge National Laboratory (ORNL) is a federal facility managed by Lockheed Martin C, Energy Research, Inc., for the U.S. Department of Energy (DOE). ORNL on the Oak Ridge Reservation in East Tennessee at the Anderson and Roane County lines, approximately 38 km (24 miles) west of Knoxville, Tennessee, and 18 km (11 miles) southwest of downtown Oak Ridge. The Oak Ridge Graphite Reactor and its storage and transfer canal are located in Bldg. 3001 in the approximate center of Waste Area Grouping I in the ORNL main complex. 4:1 The Bldg. 3001 Storage Canal is an L-shaped, underground, reinforced-concrete structure running from the back and below the Graphite Reactor in Bldg. 3001 to a location beneath a hot cell in the adjacent Bldg. 3019. The Graphite Reactor was built in 1943 to produce small quantities of plutonium and was subsequently used to produce other isotopes for medical research before it was finally shut down in 1963. The associated canal was used to transport, under water, spent fuel slugs and other isotopes from the back of the reactor to the adjacent Bldg. 31319 hot cell for further processing. During its operation and years subsequent to operation, the canal's concrete walls and floor became contaminated with radioisotopes from the water.This report documents the activities involved with replacing the canal water with a solid, controlled, low-strength material (CLSM) in response to a Comprehensive Environmental Response, Compensation, and Liability Act non-time-critical removal action
C. Colloca TS/FM
2004-01-01
TS/FM group informs you that, for the replacement of the door of the main entrance at bldg. 500, the access will be closed to the public between 19 and 30 July 2004. Access to the Main Building complex will be assured at any time through both of the side doors and from bldg. 64. For more information, please contact 73273. C. Colloca TS/FM
2007 2008 ACADEMIC TRAINING PROGRAMME
2008-01-01
LECTURE SERIES 18, 19, 20 & 21 February 2008 Main Auditorium, bldg. 500-1: 18, 19, 21 February 2008 - 11:00-12:00 Council Chamber, bldg 503-1-001: 20 February 2008 - 11:00-12:00 Council Chamber, bldg 503-1-001: 21 February 2008 - 14:00-15:00 QCD Phenomenology at High Energy Prof. Bryan WEBBER, Cambridge University, UK Whatever kind of physics may be found at the LHC, strongly-interacting particles will be involved and therefore quantum chromodynamics will play a crucial role. For processes at high energy scales, perturbation theory remains the most powerful approach. These lectures will review the foundations and limitations of perturbative QCD and its application to high-energy processes, including jet production and fragmentation, deep inelastic scattering, and heavy quark and Higgs boson production.
2007-2008 ACADEMIC TRAINING PROGRAMME
2008-01-01
LECTURE SERIES QCD Phenomenology at High Energy Prof. Bryan WEBBER, Cambridge University, UK18, 19, 20 & 21 February 2008 Main Auditorium, bldg. 500-1: 18, 19, 21 February 2008 - 11:00-12:00 Council Chamber, bldg 503-1-001: 20 February 2008 - 11:00-12:00 Council Chamber, bldg 503-1-001: 21 February 2008 - 14:00-15:00 Whatever kind of physics may be found at the LHC, strongly-interacting particles will be involved and therefore quantum chromodynamics will play a crucial role. For processes at high energy scales, perturbation theory remains the most powerful approach. These lectures will review the foundations and limitations of perturbative QCD and its application to high-energy processes, including jet production and fragmentation, deep inelastic scattering, and heavy quark and Higgs boson production.
LIMITED RESTAURANT SERVICE : EASTER WEEKEND
2003-01-01
As Friday, April 18 and Monday, April 21, 2003 are CERN holidays, restaurants no. 1 (COOP : Bldg. 501- Meyrin) and no. 3 (AVENANCE : Bldg. 866 - Prévessin) will be closed and will remain so on Saturday and Sunday, April 19 - 20. They will reopen on Tuesday, April 22 at 7h00. During these four days, a limited service will be provided by restaurant no. 2 (DSR : Bldg. 504 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. On Thursday, April 17, all three restaurants will operate according to the usual times except for restaurant no. 1 which will close at 21h00 instead of 1 o'clock in the morning.
Propulsion Systems Laboratory, Bldg. 125
Federal Laboratory Consortium — The Propulsion Systems Laboratory (PSL) is NASAs only ground test facility capable of providing true altitude and flight speed simulation for testing full scale gas...
General Infrastructure Services Department
2011-01-01
As of Monday 21 February, a new schedule will come into effect for the Airport Shuttle (circuit No. 4) at the end of the afternoon: Last departure at 7:00 pm from Main Buildig, (Bldg. 500) to Airport (instead of 5:10 p.m.); Last departure from Airport to CERN, Main Buildig, (Bldg. 500), at 7:30 p.m. (instead of 5:40 p.m.). Group GS-IS
Rare Presentation of a Primary Cutaneous well Differentiated Liposarcoma
2018-02-16
Roberts, Capt Jared 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) 59th Clinical Research Division 1100 Willford Hall Loop, Bldg 4430 JBSA-Lackland...TX 78236-9908 210-292-7141 9. SPONSORING/MONITORING AGENCY NAME(S) AND ADDRESS(ES) 59th Clinical Research Division 1100 Willford Hall Loop, Bldg...been proposed to aid in identifying lipoblasts. Lipoblasts should have a hyperchromatic indented or sharply scalloped nucleus, a lipid -rich droplets
2006 - 2007 ACADEMIC TRAINING PROGRAMME - 3rd Term: From 1st of May to 30 June 2007
HR Department
2007-01-01
LECTURE SERIES QCD and high energy nuclear collisions D. Kharzeev / BNL, Upton, USA 7, 8, 9 May 11:00 -1200 - Auditorium, Bldg 500 9 May - Council Chamber Acceleration of particles in plasma J. Faure / Ecole Polytechnique ENSTA, Palaiseau, F. 21, 22, 23, 24, 25 May 11:00-12:00 - Auditorium, Bldg 500 Nanotechnologies by C. Bottani / Polytechnic of Milano, I., M. Ferrari, Univ. of Texas, Health Science Center, Houston, USA, A. Li Bassi, Polytechnic of Milano, I. 11, 12, 13 June 11:00-12:00 - Auditorium, Bldg 500 11 June - Council Chamber The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the CERN bulletin, the WWW, and by Notices before each term and for each series of lectures.
LIMITED RESTAURANT SERVICE : EASTER WEEKEND
Restaurant Supervisory Committee
2002-01-01
As Friday 29 March and Monday 1st April 2002 are CERN holidays, restaurants no. 1 (COOP, bldg. 501- Meyrin) and no. 3 (Avenance, bldg. 866 - Prévessin) will be closed and will remain so on Saturday and Sunday 30-31 March. They will reopen on Tuesday 2 April at 7h00. During these four days, a limited service will be provided by restaurant no. 2 (DSR, bldg. 504 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. On Thursday 28 March, all three restaurants will operate according to the usual times except for restaurant no. 1 which will close at 21h00 instead of 1 o'clock in the morning. Restaurant Supervisory Committee Tel. 77551
LIMITED RESTAURANT SERVICE: EASTER WEEKEND
Restaurant Supervisory Committee
2001-01-01
As Friday 13 and Monday 16 April 2001 are CERN holidays, restaurants no. 1 (COOP, bldg. 501- Meyrin) and no. 3 (Générale de Restauration, bldg. 866 - Prévessin) will be closed and will remain so on Saturday 14 and Sunday 15 April. They will reopen on Tuesday 17 April at 7h00. During these four days, a limited service will be provided by restaurant no. 2 (DSR, bldg. 504 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. On Thursday 12 April, all three restaurants will operate according to the usual times except for restaurant no 1, which will close at 21h00 instead of 1 o'clock in the morning.
LIMITED RESTAURANT SERVICE : EASTER WEEKEND
Restaurant Supervisory Committee
2002-01-01
As Friday, March 29 and Monday, April 1st, 2002 are CERN holidays, restaurants no. 1 (COOP : Bldg. 501- Meyrin) and no. 3 (Avenance : Bldg. 866 - Prévessin) will be closed and will remain so on Saturday and Sunday, March 30 - 31. They will reopen on Tuesday, April 2 at 7h00. During these four days, a limited service will be provided by restaurant no. 2 (DSR : Bldg. 504 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. On Thursday, March 28, all three restaurants will operate according to the usual times except for restaurant no. 1 which will close at 21h00 instead of 1 o'clock in the morning. Restaurant Supervisory Committee, tel. 77551
RESTAURANT AND CAFETERIA SERVICES ARRANGEMENTS FOR 1 MAY 2002
Restaurant Supervisory Committee
2002-01-01
1. Restaurants As Wednesday 1 May is an official CERN holiday, restaurants no. 2 (DSR: bldg. 504 - Meyrin) and no. 3 (Avenance: bldg. 866 - Prévessin) will be closed as from Tuesda 30 April at 18h00. They will reopen on Thursday 2 May at 6h30 (rest. no. 2) and at 7h00 (rest. no. 3). On 1 May, a limited service will be provided by restaurant no. 1 (COOP: bldg. 501 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. 2. Decentralised services No decentralised services (satellite cafétérias etc.) will operate. 3. Newspaper stand The newspaper kiosque in building 501 will be closed. Restaurant Supervisory Committee, tel. 77551
Bright photoactivatable fluorophores for single-molecule imaging.
Grimm, Jonathan B; English, Brian P; Choi, Heejun; Muthusamy, Anand K; Mehl, Brian P; Dong, Peng; Brown, Timothy A; Lippincott-Schwartz, Jennifer; Liu, Zhe; Lionnet, Timothée; Lavis, Luke D
2016-12-01
Small-molecule fluorophores are important tools for advanced imaging experiments. We previously reported a general method to improve small, cell-permeable fluorophores which resulted in the azetidine-containing 'Janelia Fluor' (JF) dyes. Here, we refine and extend the utility of these dyes by synthesizing photoactivatable derivatives that are compatible with live-cell labeling strategies. Once activated, these derived compounds retain the superior brightness and photostability of the JF dyes, enabling improved single-particle tracking and facile localization microscopy experiments.
Pathophysiology of Heat-Related Illnesses
2012-01-01
Figure 10-4). deHydrATion And elecTrolyTe imBAlAnce Water requirements during heat exposure are primarily deter- mined by a person’s sweat losses. Water...the effect of cyclooxygenase inhibition, J Clin Invest 81:1162, 1988. 241. Opal SM, Fisher CJ Jr, Dhainaut JF, et al: Confirmatory interleukin-1...inhibition, J Clin Invest 81:1162, 1988. 241. Opal SM, Fisher CJ Jr, Dhainaut JF, et al: Confirmatory interleukin-1 receptor antagonist trial in severe
Sharath, B S; Mohankumar, B V; Somashekar, D
2014-03-01
Jatropha seed cake, a byproduct after biodiesel extraction, has several anti-nutrients and toxins. Solid-state fermentation was carried out for the detoxification of the Jatropha seed cake (JSC) using different fungal cultures. The reduction in the anti-nutritional components such as tannins, phytates, saponins, lectin and protease inhibitor, and phorbol esters on 6th, 9th, and 12th day of fermentation was analyzed. The phorbol ester content in the unfermented JSC was 0.83 mg/g, and the maximum degradation of phorbol esters to the extent of 75% was observed in the case of JSC fermented with Cunninghamella echinulata CJS-90. The phytate degradation in the fermented JSC was in the range of 65-96%. There was a gradual reduction of saponin content in the JSC from 6th to 12th day, and the reduction of saponin was in the range of 55-99% after solid-state fermentation. The trypsin inhibitor activity and lectin were 1,680 trypsin inhibitor units (TIU) per gram and 0.32 hemagglutinating unit in the unfermented JSC, respectively. Trypsin inhibitor activity and lectin could not be detected in JSC after 12th day of solid-state fermentation. Tannins accounted for 0.53% in unfermented JSC, and there was a marginal increase of tannins after solid-state fermentation. The results indicate that biological detoxification could be a promising method to reduce anti-nutritional compounds and toxins in the JSC.
1983-07-01
LAUNDROMATS LNDY LAUNDRY MEDL MEDICAL OFFICES MOTL MOTELS MOVI DRIVE-IN MOVIES NURS NURSING HOMES OFFN NEW OFFICE BLDG. OFFO OLD OFFICE BLDG. * JAIL...CHURCHES CLUB GOLF-SWIM CLUBS BOWL BOWLING ALLEYS COLG COLLEGES RESID. HOSP MED CENTERS HOTL HOTELS LNDM LAUNDROMATS LNDY LAUNDRY MEDL MEDICAL OFFICES... Laundromat data YMCA Type Facilities Data for YMCA, YWCA, etc. U.S. Census Bureau Many commercial parameters % "Census of Business" Department of Employment
Advanced Video Activity Analytics (AVAA): Human Factors Evaluation
2015-05-01
HRM -A Aberdeen Proving Ground, MD 21005-5425 8. PERFORMING ORGANIZATION REPORT NUMBER ARL-TR-7286 9. SPONSORING/MONITORING AGENCY NAME(S) AND...A MALHOTRA 1 ARMY RSCH LABORATORY – HRED (PDF) RDRL HRM D T DAVIS BLDG 5400 RM C242 REDSTONE ARSENAL AL 35898-7290 1 ARMY RSCH...HRED (PDF) RDRL HRM DG J RUBINSTEIN BLDG 333 PICATINNY ARSENAL NJ 07806-5000 1 ARMY RSCH LABORATORY – HRED (PDF) ARMC FIELD
Astronaut Ronald Evans is suited up for EVA training
1972-01-01
Astronaut Ronald E. Evans, command module pilot of the Apollo 17 lunar landing mission, is assisted by technicians in suiting up for extravehicular activity (EVA) training in a water tank in bldg 5 at the Manned Spacecraft Center (49970); Evans participates in EVA training in a water tank in bldg 5 at the Manned Spacecraft Center. The structure in the picture simulates the Scientific Instrument Module (SIM) bay of the Apollo 17 Service Module (49971).
Thermogenic Effect from Nutritionally Enriched Coffee Consumption
Directory of Open Access Journals (Sweden)
Jennings Peter F
2006-06-01
Full Text Available Abstract Background The purpose of this study was to examine the effect of nutritionally enriched JavaFit™ (JF coffee (450 mg of caffeine, 1200 mg of garcinia cambogia, 360 mg of citrus aurantium extract, and 225 mcg of chromium polynicotinate on resting oxygen uptake (VO2, respiratory exchange ratio (RER, heart rate (HR, and blood pressure (BP in healthy and physically active individuals. Method Ten subjects (8 male, 2 female; 20.9 ± 1.7 y; 178.1 ± 10.4 cm; 71.8 ± 12.1 kg underwent two testing sessions administered in a randomized and double-blind fashion. During each session, subjects reported to the Human Performance Laboratory after at least 3-h post-absorptive state and were provided either 354 ml (1.5 cups of freshly brewed JF or commercially available caffeinated coffee (P. Subjects then rested in a semi-recumbent position for three hours. VO2 and HR were determined every 5 min during the first 30 min and every 10 min during the next 150 min. BP was determined every 15 min during the first 30 min and every 30 min thereafter. Area under the curve (AUC analysis was computed for VO2, whereas a session-average was calculated for RER, HR and BP. Results Initial analysis revealed no significant differences. However, seven of the ten subjects were considered responders to JF (had a higher AUC for VO2during JF than P. Statistical analysis showed the difference between JF and P (12% to be significantly different in these responders. In addition, the average systolic BP was higher (p Conclusion It appears that consuming a nutritionally-enriched coffee beverage may increase resting energy expenditure in individuals that are sensitive to the caffeine and herbal coffee supplement. In addition, this supplement also appears to affect cardiovascular dynamics by augmenting systolic arterial blood pressure.
Hu, Guo-Bin; Lou, Hui-Min; Dong, Xian-Zhi; Liu, Qiu-Ming; Zhang, Shi-Cui
2012-10-01
Interferon regulatory factor 5 (IRF5) has been identified as a key transcriptional mediator regulating expression of both type I interferons (IFNs) and proinflammatory cytokines. In this study, the cDNA and genomic sequences of IRF5 were isolated from Japanese flounder, Paralichthys olivaceus. The gene of Japanese flounder (Jf)IRF5 is 7326 bp long, contains 9 exons and 8 introns and encodes a putative protein of 472 amino acids. The predicted protein sequence shares 61.1-81.9% identity to fish IRF5 and possesses a DNA-binding domain (DBD), a middle region (MR), an IRF association domain (IAD), a virus activated domain (VAD) and two nuclear localization signals (NLSs) conserved in all known IRF5s. Phylogenetic analysis clustered it into the teleost IRF5 subgroup within vertebrate IRF5 group. JfIRF5 mRNA was constitutively expressed in all tissues examined, with higher levels observed in the gills and head kidney. Gene expression of JfIRF5 was analyzed over a 7-day time course in the gills, head kidney, spleen and muscle of Japanese flounders challenged with lymphocystis disease virus (LCDV) and polyinosinic:polycytidylic acid (poly I:C). The data showed that JfIRF5 expression was slightly up-regulated by LCDV, but its induction time was clearly moved up; in contrast, the induction upon poly I:C challenge started not earlier than day 2 post-injection and was stronger and more persistent with a later peak time in all four organs. The late and long-lasting inductive expression of JfIRF5 following poly I:C challenge suggests that it might be an interferon stimulated gene (ISG), the induction of which is driven by poly I:C-induced type I IFNs. Copyright © 2012 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Marija Karapandzova
2014-12-01
Full Text Available Chemical characterization of three Juniperus species: J. foetidisima (JF, J. excelsa (JE and J. communis (JC from Macedonian flora enclosed determination of yield and essential oil composition of the oils obtained by hydro-distillation of dried leaves and determination of the content of total phenols and total flavonoids in dried plant material. GC/FID/MS analysis showed mainly monoterpene profile of the JC oil and combined monoterpene/sesquiterpene profile of JF and JE oils. Sesquiterpene cedrol was found as an important constituent of the JF and JE, thus the JF oil was characterized by three main components (a-pinene, limonene and cedrol, in amount up to 67.63%, 27.11% and 33.91%, respectively and JE oil by four components (a-pinene, sabinene, cis-thujone and cedrol, in amount up to 33.83%, 29.49%, 26.20% and 24.44%, respectively. The JC oil was free of cedrol, but contained relatively large sesquiterpene fraction (sesquiterpene hydrocarbons and oxygen containing sesquiterpenes in amounts up to 28.64% and 13.57%, respectively. The JC oil was characterized by three monoterpene components (a-pinene, sabinene and terpinen-4-ol, presented up to 28.68%, 16.27% and 12.16%, respectively. The content of total phenols determined by Folin-Ciocalteu method ranged from 96.18-122.91 mg GAE/g dw (water extraction while the content of total flavonoids ranged from 2.05-11.91 mg CE/g dw (ethanol extraction. Both water and ethanol extracts possessed radical scavenging activity against DPPH radical. Water extracts were more powerful with % of inhibition of DPPH ranging up to 64.52%, 67.40% and 78.23% for water extract (10 mg/ml of JF, JE and JC, respectively. Obtained results showed correlation with the content of total phenols.
The number of Jupiter family comets as a constraint on the transneptunian population
Tancredi, G.; et al.
Several duynamical studies point out that the comets of the Jupiter family were originated in a flat belt in the transneptunian region. The Jupiter family is a transient dynamical state between the injection from the outer region and i) the ejection out of the Solar System, ii) the collision against one of its members or iii) the desintegration into a meteor stream. It has been generally assumed that the Jupiter family (JF) is in a steady state; i.e. the injection is balanced by the ejection+collision+ desintegration. Knowing the duration of a typical visit into the Jupiter family and the number of JF comets we could infer the injection rate. The rate of escapes from the transneptunian region and the fraction that reach the Jupiter family can be computed from massive integrations of particles starting in the outer region. An estimate of the required population of transneptunian objects can then be inferred from these numbers. There have been published several estimates of the dynamical parameters mentioned above but the total number of JF comets has been difficult to estimate. Based on a compilation of all the reported nuclear magnitudes of JF comets, we derive the total number of objects in the cometary population. The observed population (~ 200) is a tiny fraction of the total population (several thousands). Compiling all these numbers, we then derive the required trasneptunian population.
Safety Awareness & Communications Internship
Jefferson, Zanani
2015-01-01
The projects that I have worked on during my internships were updating the JSC Safety & Health Action Team JSAT Employee Guidebook, conducting a JSC mishap case study, preparing for JSC Today Close Call success stories, and assisting with event planning and awareness.
2016-05-02
ultrashort electric pulses. Bioelectrochemistry 79: 114–121. doi: 10.1016/ j.bioelechem.2010.01.001 PMID: 20171148 12. Pakhomov AG, Kolb JF, White JA...Bioelec- tromagnetics 28: 655–663. doi: 10.1002/bem.20354 PMID: 17654532 13. Pakhomov AG, Shevin R, White JA, Kolb JF, Pakhomova ON, Joshi RP, et al...current. Proc Natl Acad Sci USA 111: E2281–90. doi: 10.1073/pnas.1407133111 PMID: 24843134 26. Walker K, Pakhomova ON, Kolb J, Schoenbach KS, Stuck
A Bibliographic Database for the History of Pilot Training Selection
2011-07-01
pan 45966a33091 http://hdl.loc.gov/loc.pnp/pan.45966a33091 ). . "Uncle Joe" (J.F. Kerman)of the Knights of Columbus giving chocolate to Marie...Miscellaneous Coll. - Roy Coles Album 73.170 Title: ’Uncle Joe’ (J.F. Kerman) of the Knights of Columbus giving chocolate to Marie Chausson of La Besage...Tice, S. N., & James, E. J. (2005). The Aviator. Journal of Feminist Family Therapy , 17(1), 72- 74. Reviews the Martin Scorse movie, The Aviator
76 FR 19795 - Exelon Generation Company, LLC; Oyster Creek Nuclear Generating Station; Exemption
2011-04-08
... Manually open 7 Intake. valve (V) V-9- 2099 and V-11-49 and close V-11- 63 and V-11-41. Manually open V- 12...-FZ-6B Office Bldg. Manually open V-9- 7 ``B'' 480V SWGR 2099 and V-11-49 Room Elev. 23'- and close V...) FI-225-2 and close V-15-52. 5 OB-FZ-8A Office Bldg. Manually open V-9- 7 Reactor 2099 and V-11-49...
Sharath, Belame S; Muthukumar, Sevva P; Somashekar, Devappa
2017-01-01
The presence of anti-nutrients and toxins like phorbol esters in Jatropha curcas seed cake (JSC) limits its application in feeds. This study was done to assess the potential of detoxified JSC as rat feed. The rats were fed a diet containing 0-5 and 10% of detoxified fermented JSC for four weeks. For the group I, only casein diet was used in rat feed as a negative control. For the group II, untreated JSC was used in rat feed as a positive control. For the group III, fermented JSC using Saccharomyces cerevisiae MTCC-36 was used. For the group IV, the fermented JSC treated with 65% ethanol to remove the residual toxic phorbol esters was used as rat feed. The rats fed with untreated JSC showed increased levels of serum liver enzymes as an indication of the onset of liver disease resulting in mortality. In this group, rats died in week 2, confirming that the cake is not safe as feed until it is processed. The rats fed with detoxified JSC with 5 and 10% level survived with no adverse effects, and the performance was on par with the control groups, although the body weight was slightly less compared to control. Therefore, it was concluded that the detoxified JSC might be the potential and alternative source of protein in the animal feedstuffs up to 10% level. There are recent patents also suggesting the use of alternative feed supplements in the animal feed applications. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
LIMITED RESTAURANT SERVICE: EASTER WEEK-END
2004-01-01
As Friday April 9 and Monday April 12 2004 are CERN holidays, restaurants no. 1 (Bldg. 501- Meyrin) and no. 3 (Bldg. 866 - Prévessin) will be closed and will remain closed on Saturday and Sunday, April 10 - 11. They will reopen on Tuesday, April 13 at 7 a.m. During these four days, a limited service will be provided by restaurant no. 2 (Bldg. 504 - Meyrin): on Friday and Monday from 8 a.m. to 9 p.m. and on Saturday and Sunday from 9 a.m. to 8.30 p.m. Hot meals will be served from 11.30 a.m. to 2 p.m. and from 6 p.m. to 7.30 p.m. On Thursday, April 8, all three restaurants will operate according to the usual times except for restaurant no. 1 which will close at 9 p.m. instead of 1 a.m.
Development of Bismuth Hall sensors for ITER steady state magnetic diagnostics.
Czech Academy of Sciences Publication Activity Database
Ďuran, Ivan; Entler, Slavomír; Kočan, M.; Kohout, Michal; Viererbl, L.; Mušálek, Radek; Chráska, Tomáš; Vayakis, G.
2017-01-01
Roč. 123, November (2017), s. 690-694 ISSN 0920-3796. [SOFT 2016: Symposium on Fusion Technology /29./. Prague, 05.09.2016-09.09.2016] R&D Projects: GA MŠk LG14002 Institutional support: RVO:61389021 ; RVO:68378271 Keywords : ITER * Magnetic diagnostic * Hall sensor * Bismuth * Neutron irradiation * Radiation hardness Subject RIV: JF - Nuclear Energetics; JF - Nuclear Energetics (FZU-D) OBOR OECD: Nuclear related engineering; Nuclear related engineering (FZU-D) Impact factor: 1.319, year: 2016 http://www.sciencedirect.com/science/article/pii/S0920379617306956
Role of Stat3 and ErbB2 in Breast Cancer
2013-12-01
Nemoto, K.E. Pestell , K. Cooley, E.C. Southwick, D.A. Mitchell, W. Furey, R. Gussio, D.W. Zaharevitz, B. Joo, P. Wipf, Identification of a potent...7). Inorg Chem 2008, 47:2798–2804. 26. Bromberg JF, Wrzeszczynska MH, Devgan G, Zhao Y, Pestell RG, Albanese C, et al: Stat3 as an oncogene. Cell...Biochem Biophys Res Commun 382: 440-444, 2009. 7 Bromberg JF, Wrzeszczynska MH, Devgan G, Zhao Y, Pestell RG, Albanese C and Darnell JE Jr.: Stat3 as an
Bannerot, Richard; Sickorez, Donn G.
1995-01-01
The JSC NASA/ASEE Summer Faculty Fellowship Program was conducted by Texas A&M University and JSC. The objectives of the program, which began nationally in 1964 and at JSC in 1965 are to: (1) further the professional knowledge of qualified engineering and science faculty members, (2) stimulate an exchange of ideas between participants and NASA, (3) enrich and refresh the research and teaching activities of participants' institutions, and (4) contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA JSC colleague. This document is a compilation of the final reports on the research projects completed by the faculty fellows during the summer of 1994.
Bannerot, Richard B. (Editor); Sickorez, Donn G. (Editor)
1997-01-01
The 1996 JSC NASA/ASEE Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The objectives of the program, which began nationally in 1964 and at JSC in 1965 are to (1) further the professional knowledge qualified engineering and science faculty members, (2) stimulate an exchange of ideas between participants and NASA, (3) refresh the research and teaching activities of participants' institutions, and (4) contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA JSC colleague. This document is a compilation of the final reports on the research projects completed by the faculty fellows during the summer of 1996.
VO2sim 0.1: Using Simulation to Understand Measurement Error in Indirect Calorimetry
2015-08-01
RDRL CIO LL IMAL HRA MAIL & RECORDS MGMT 1 GOVT PRINTG OFC (PDF) A MALHOTRA 1 ARMY RSCH LAB – HRED (PDF) RDRL HRM D T DAVIS...GREELEY RD FORT SAM HOUSTON TX 78234-5002 1 ARMY RSCH LAB – HRED (PDF) RDRL HRM DG K GUNN BLDG 333 PICATINNY ARSENAL NJ...07806-5000 1 ARMY RSCH LAB – HRED (PDF) ARMC FIELD ELEMENT RDRL HRM CH C BURNS THIRD AVE BLDG 1467B RM 336 FORT KNOX KY 40121
CERN Infirmary closed for building work
2013-01-01
The CERN Infirmary (Bldg 57, ground floor) will be closed from 11 December 2013 to 19 January 2014 due to building work. A minimum service will be provided during this period by nurses and doctors, on the first floor of the Medical Service, bldg. 57. For any questions, please contact the nurses (73802) or the secretariat (73186 / 78435). Note: no complementary examination (audio, visiotest, EFR, etc.) will be possible. Thank you for your understanding and seasons greetings! Medical Service Team
Changes to the shuttle circuits
GS Department
2011-01-01
To fit with passengers expectation, there will be some changes to the shuttle circuits as from Monday 10 October. See details on http://cern.ch/ShuttleService (on line on 7 October). Circuit No. 5 is cancelled as circuit No. 1 also stops at Bldg. 33. In order to guarantee shorter travel times, circuit No. 1 will circulate on Meyrin site only and circuit No. 2, with departures from Bldg. 33 and 500, on Prévessin site only. Site Services Section
31 CFR 132.3 - Designated payment systems.
2010-07-01
... be used by participants in connection with, or to facilitate, a restricted transaction: (a) Automated..., currency exchange, or the issuance or redemption of money orders, travelers' checks, and other similar...
Directory of Open Access Journals (Sweden)
Simon E. Akpo
2013-12-01
Full Text Available This study explored the link between teachers’ inputs and students’ academic achievement in the JSC Mathematics for the period 2006 to 2010. One hundred and fifty secondary schools selected from 573 secondary schools in the country constituted the target population. One hundred and sixty-four JSC mathematics teachers from the 150 secondary schools participated in the study, with the final JSC Mathematics results of the students serving as the dependent variable of the study. Mathematics teachers’ input data (academic qualifications, teaching experience and subject specialisation were collected from a questionnaire developed by the researchers. Standard multiple regression was used to analyse the link between teachers’ inputs and students’ academic achievement in JSC Mathematics at P < 0.05and P < 0.10 respectively. The study found that teachers’ academic qualifications and subject specialisation had a significant and positive relationship with students’ academic achievement in JSC Mathematics. Teachers’ gender, however, was not significantly related to students’ academic achievement in JSC Mathematics. This is the first time within the Namibian context that we have empirically demonstrated the link between teachers’ inputs and students’ academic achievement in JSC Mathematics. The study therefore provides support for the policy initiatives that seek to link teachers’ academic qualifications, subject specialisation and teaching experience to employment and classroom allocation.
Characterization of HIP bonded DS-Cu/SS316L joints for fusion experimental reactors
Energy Technology Data Exchange (ETDEWEB)
Kanari, Moriyasu; Hatano, Toshihisa; Sato, Satoshi; Furuya, Kazuyuki; Kuroda, Toshimasa; Enoeda, Mikio; Abe, Tetsuya; Takatsu, Hideyuki [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment
1998-02-01
A shielding blanket design in a fusion reactor such as ITER has been proposed to be a modular structure integrated with the first wall. In view of the fabrication, HIP(Hot Isostatic Pressing) method has been proposed for the joining of dispersion strengthened copper (DS-Cu) and type 316L stainless steel (SS316L) at the first wall. Characterization of DS-Cu in HIP joints bonded at three different temperatures has been performed placing emphasis on metallurgical quality at the interfacial region of some hundred {mu}m by means of conventional observation and testing techniques. SEM(Scanning Electron Microscope) observation of these joints before and after intergranular corrosion to DS-Cu have shown that in two joints HIPed at 1253K and 1303K some voids of 1-4{mu}m exist in the vicinity to the interface, while in the other one HIPed at 1323K there is no void and the joint reveals good bondability. And in all the joints grain boundary has been developed parallel to the interface. SEM observation of DS-Cu grains have shown that in a joint at 1323K the grains have slightly coarsened to the size larger than as-received DS-Cu by a factor of 2, despite the hardness of that remains as as-received DS-Cu. While in the other two joints grain remains as large as as-received DS-Cu. EPMA(Electron Prove Microscopic Analysis) of aluminium in DS-Cu has shown that in all the joints accumulation of alumina has occurred in the vicinity to the interface and the length of the accumulated region increases as the increase of the HIP temperature and reaches up to 50{mu}m from the interface at 1323K. Vickers hardness test have shown that in a joint bonded at 1323K the hardness decreases to the level of an oxygen free copper in the vicinity to the interface, implying that the distribution of alumina has changed. From these experiments, it can be concluded that the joint at 1323K has exhibited the highest performance in terms of bondability. (J.P.N.)
Czech Academy of Sciences Publication Activity Database
Jirsa, Miloš; Rameš, Michal; Ďuran, Ivan; Entler, Slavomír; Melíšek, T.; Kováč, P.; Viererbl, L.
2017-01-01
Roč. 124, November (2017), s. 73-76 ISSN 0920-3796. [SOFT 2016: Symposium on Fusion Technology /29./. Prague, 05.09.2016-09.09.2016] EU Projects: European Commission(XE) 633053 - EUROfusion Institutional support: RVO:61389021 ; RVO:68378271 Keywords : Superconducting REBaCuO tapes * Magnetic hysteresis loops * Transport currents * Engineering currents * Angular dependence * Neutron irradiation Subject RIV: JF - Nuclear Energetics; JF - Nuclear Energetics (FZU-D) OBOR OECD: Nuclear related engineering; Nuclear related engineering (FZU-D) Impact factor: 1.319, year: 2016 www.sciencedirect.com/science/article/pii/S0920379617304829
International Nuclear Information System (INIS)
Biringer, B.E.
1976-11-01
This report documents a study of the annual probabilities of aircraft impact with the Sandia Pulsed Reactor (SPR) and Bldg. 836 at Sandia Laboratories, Albuquerque. The probability of aircraft impact into each structure was estimated using total yearly operations, effective structure area, structure location relative to air activity, and accident rate per kilometer. The estimated probability for an aircraft impact with SPR is 1.1 x 10 -4 per year; the estimated probability for impact with Bldg. 836 is 1.0 x 10 -3 per year
Bannerot, Richard B. (Editor); Sickorez, Donn G. (Editor)
2003-01-01
The 2000 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began in 1965 at JSC and 1964 nationally, are to (1) further the professional knowledge of qualified engineering and science faculty, (2) stimulate an exchange of ideas between participants and NASA, (3) enrich and refresh the research and teaching activities of participants' institutions, and (4) contribute to the research objectives of the NASA Centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project commensurate with her/his interests and background, and worked in collabroation with a NASA/JSC colleague. This document is a compilation of the final reports on the research projects done by the faculty fellows during the summer of 2000.
Hyman, William A. (Editor); Sickorez, Donn G. (Editor)
1996-01-01
The JSC NASA/ASEE Summer Faculty Fellowship Program was conducted at JSC, including the White Sands Test Facility, by Texas A&M University and JSC. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of the participants' institutions; and (4) to contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA/JSC colleague. In addition to the faculty participants, the 1995 program included five students. This document is a compilation of the final reports on the research projects completed by the faculty fellows and visiting students during the summer of 1995. The reports of two of the students are integral with that of the respective fellow. Three students wrote separate reports.
Microbial reduction of Fe(III) in the presence of oxygen under low pH conditions
Energy Technology Data Exchange (ETDEWEB)
Kusel, K.; Roth, U.; Drake, H.L. [University of Bayreuth, Bayreuth (Germany)
2002-07-01
In acidic, coal mining lake sediments, facultatively anaerobic Acidiphilium species are probably involved in the reduction of Fe(III). Previous results indicate that these bacteria can co-respire O{sub 2} and Fe(III). In this study, we investigated the capacity of the sediment microbiota to reduce Fe(III) in the presence of O{sub 2} at pH 3. In sediment microcosms with 4% O{sub 2} in the headspace, the concentration of Fe(II) increased at a rate of 1.03 {mu}mol (g wet sediment){sup -1} day{sup -1} within the first 7 days of incubation which was similar to the rate obtained with controls incubated under anoxic conditions. However, in microcosms incubated under air, Fe(II) was consumed after a lag phase of 8 h with a rate of 2.66 {mu}mol (g wet sediment){sup -1} day{sup -1}. Acidiphilium cryptum JF-5, isolated from this sediment, reduced soluble Fe(III) with either 4 or 21% O{sub 2} in the headspace, and concomitantly consumed O{sub 2}. However, the rate of Fe(II) formation normalized for cell density decreased under oxic conditions. Schwertmannite, the predominant Fe(III)-mineral of this sediment, was also reduced by A. cryptum JF-5 under oxic conditions. The rate of Fe(II) formation by A. cryptum JF-5 decreased after transfer from preincubation under air in medium lacking Fe(III). Acidiphilium cryptum JF-5 did not form Fe(II) when preincubated under air and transferred to anoxic medium containing Fe(III) and chloramphenicol, an inhibitor of protein synthesis. These results indicate that: (i) the reduction of Fe(III) can occur at low O{sub 2} concentrations in acidic sediments; (ii) Fe(II) can be oxidized at O{sub 2} concentrations near saturation; and (iii) the enzyme(s) responsible for the reduction of Fe(III) in A. cryptum JF-5 are not constitutive.
2013-11-01
landfills, sewage lagoons, radioactive holding tanks , oil/water separators, drainage areas, septic systems, spill areas, fire-training areas, and...Waste Acc. Area Bldg. 617 2,371 NFA 3 ST-351 10-21-B Building 635 Septic Tank 1,610 NFA 3 SS-063 10-02-E Jet Engine Cell (ST-336) 2,341 NFA 3 ST...349 10-21-B Building 626 Septic Tank 2,224 NFA 3 ST-350 10-21-X 600 Area Field Office Septic Tank 433 NFA 3 ST-296 10-21-D Septic System, Bldg.702
Ülestähendusi Birgitta festivalilt 2009 / Raili Sule
Sule, Raili, 1944-
2009-01-01
13.-23. augustini Pirita kloostri varemetes toimunud Tallinna Filharmoonia korraldatud Birgitta festivali raames toimunud Dmitri Bertmanni lavastustest - Umberto Giordano "Siber" ja Giuseppe Verdi "Falstaff"
Taxonomy, Ontology and Semantics at Johnson Space Center
Berndt, Sarah Ann
2011-01-01
At NASA Johnson Space Center (JSC), the Chief Knowledge Officer has been developing the JSC Taxonomy to capitalize on the accomplishments of yesterday while maintaining the flexibility needed for the evolving information environment of today. A clear vision and scope for the semantic system is integral to its success. The vision for the JSC Taxonomy is to connect information stovepipes to present a unified view for information and knowledge across the Center, across organizations, and across decades. Semantic search at JSC means seemless integration of disparate information sets into a single interface. Ever increasing use, interest, and organizational participation mark successful integration and provide the framework for future application.
DEFF Research Database (Denmark)
Nørholm, Morten
2009-01-01
10% (1939) til 55% (1990) (62,25% i 1998) ‑ jf. Petersen (1992/3, især p. 72), Nørholm (1997a, b, c, 1999). Hele uddannelsen ser ud til at indeholde (praktiske) teorier for det praktiske arbejde (jf. Durkheim 1975), en socialt og symbolsk nødvendig del af praktikken, men hverken teori i egen ret......, 1992), Durkheims teori om forskellige former for teori/viden (1975), teoriens rolle for praktiske uddannelser (fx Petersen 2001, 1997/8), samt videnskabelige teorier om evalueringer (Nørholm 2008, 2003). Derudover inddrages teorier af Lundgren, Callewaert, Broady og andre. Selvforståelsen er her...
2007 2008 ACADEMIC TRAINING PROGRAMME
2008-01-01
LECTURE SERIES 6 & 8 May 2008 11:00 -12:00 – Main Auditorium, bldg. 500-1 Energy isn’t Everything: CERN’s Fixed Target Niche Prof. John DAINTON / Cockcroft Institute & Liverpool University, UK Fixed target physics at CERN remains an essential part of the Laboratory’s scientific programme and horizon. In recent years fixed target and decay physics using CERN’s unique accelerator and beam facilities has continued to enable unique experiments to be undertaken. An overview is presented of the status of this physics and, wherever appropriate, of its future. LECTURE SERIES 7 May 2008 11:00 -12:00 – TH Auditorium – Bldg. 4-3-006 A rich revenue from the use of radioactive beams and radioactive targets: recent highlights from the nTOF and ISOLDE facilities 9 May 2008 11:00 -12:00 – Main Auditorium, bldg. 500-1 The fifth decade of ISOLDE: HIE-ISOLDE Professor Mark HUYSE, Leuven University, BE The On-Line Isotope Mass Separator ISOLDE is a facility dedicated to the production of a...
CERN Academic Training Programme 2008/2009
HR Department
2009-01-01
LECTURE SERIES 9-10 February 2009 Monday 9 February 2009 11:00-12:00, 16:00-17:00. Tuesday 10 February 2009 11:00-12:00, 14:00-15:00. Council Chamber, Bldg 503-1-001 Understanding Cross Sections at the LHC Dr. Stephen MRENNA / Fermi National Accelerator Laboratory, USA My lectures will focus on the theoretical and phenomenological tools that will be needed to understand the Standard Model at the LHC. Emphasis will be placed on parton shower event generators and the methodology for tuning them to data. 5-6 March 2009 Thursday, 5 March 2009: 11:00-12:00, 14:00-15:00 Main Auditorium, Bldg. 500-1-001 Friday, 6 March 2009: 10:00-12:00, Main Auditorium, Bldg. 500-1-001 Recent developments at 3rd generation storage ring light sources Jean-Marc FILHOL, Deputy Director-General SOLEIL, France Over the last decade, many 3rd generation storage ring light sources have been built and put into operation. Progressively, significant improvements have been brought to the machine performances and experiences developed at...
Limited restaurant service over the Easter weekend
2005-01-01
As Friday, 25 March and Monday, 28 March 2005 are CERN holidays, restaurants no. 1 (Bldg. 501- Meyrin) and no. 3 (Bldg. 866 - Prévessin) will be closed and will remain closed on Saturday, 26 March and Sunday, 27 March. They will re-open on Tuesday, 29 March. During these four days, a limited service will be provided by restaurant no. 2 (Bldg. 504 - Meyrin): on Friday and Monday from 8 a.m. to 8.30 p.m. and on Saturday and Sunday from 9 a.m. to 8.00 p.m. Hot meals will be served from 12.00 p.m. to 2 p.m. and from 6 p.m. to 7.30 p.m. They will be served at the self-service restaurant on the first floor on Friday and at the cafeteria on the ground floor on Saturday, Sunday and Monday. On Thursday, March 24, all three restaurants will operate according to their usual opening times except for restaurant no. 1 which will close at 9 p.m. instead of 1 a.m.
LIMITED RESTAURANT SERVICE : ASCENSION AND WHITSUNTIDE WEEKENDS
Restaurant Supervisory Committee
2002-01-01
Details of the arrangements to ensure the provision of a restaurant service during the Ascension and Whitsuntide weekends are given below. On all the days indicated, hot meals will be served from 11h30 to 14h00 and 18h00 to 19h30. RESTAURANT SATELLITE CAFETERIAS KIOSQUE No. Opening times Usual opening times ASCENSION Thursday 9 May 1 2 3 08h00 - 21h00 Friday 10 May 1 2 3 07h00 - 21h00 07h00 - 18h00 Bldg. 40 Bldg. 30, 54 Bldg. 864 08h00 - 17h00 Saturday 11 May 1 2 3 07h00 - 23h00 Sunday 12 May 1 2 3 07h00 - 23h00 WHITSUNTIDE Saturday 18 May 1 2 3 08h00 - 21h00 Sunday 19 May 1 2 3 08h00 - 21h00 Monday 20 May 1 2 3 08h00 - 21h00 Restaurant Supervisory Committee Tel. 77551
Limited restaurant service over the Easter weekend
2005-01-01
As Friday, 25 March and Monday, 28 March 2005 are CERN holidays, restaurants No. 1 (Bldg. 501- Meyrin) and No. 3 (Bldg. 866 - Prévessin) will be closed and will remain closed on Saturday, 26 March and Sunday, 27 March. They will re-open on Tuesday, 29 March at 7.00 a.m. During these four days, a limited service will be provided by restaurant No. 2 (Bldg. 504 - Meyrin): on Friday and Monday from 8 a.m. to 8.30 p.m. and on Saturday and Sunday from 9 a.m. to 8.00 p.m. Hot meals will be served from 12.00 p.m. to 2 p.m. and from 6 p.m. to 7.30 p.m. They will be served at the self-service restaurant on the first floor on Friday and at the cafeteria on the ground floor on Saturday, Sunday and Monday. On Thursday, March 24, all three restaurants will operate according to their usual opening times except for restaurant No. 1, which will close at 9 p.m. instead of 1 a.m.
RESTAURANT and CAFETERIA SERVICES: ARRANGEMENTS for MAY 1st, 2003
2003-01-01
1. Restaurants As Thursday, May 1st, is an official CERN holiday, restaurants no. 2 (DSR : Bldg. 504 - Meyrin) and no. 3 (Avenance : Bldg. 866 - Prévessin) will be closed as from Wednesday, April 30 at 18h00. They will reopen on Friday, May 2nd at 6h30 (rest. no. 2) and at 7h00 (rest. no. 3). On May 1st, a limited service will be provided by restaurant no. 1 (COOP : Bldg. 501 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. 2. Newspaper stand The newspaper kiosque run by restaurant no. 1 in building 501 will be closed. 3. Decentralised services No decentralised services (satellite cafétérias etc.) will operate on May 1st, but will resume their normal activites on Friday, May 2nd, except for those dependent on restaurant no. 3 (Prévessin site) which will not reopen until Monday, May 5, 2003.
RESTAURANT AND CAFETERIA SERVICES ARRANGEMENTS FOR MAY 1ST, 2001
Restaurant Supervisory Committee
2001-01-01
1. Restaurants As Tuesday, May 1st, is an official CERN holiday, restaurants no 2 (DSR : Bldg. 504 - Meyrin) and no 3 (Avenance : Bldg. 866 - Prévessin) will be closed as from Monday, April 30 at 18h00. They will reopen on Wednesday, May 2nd at 6h30 (rest. no 2) and at 7h00 (rest. no 3). On May 1st, a limited service will be provided by restaurant no. 1 (COOP : Bldg. 501 - Meyrin) from 8h00 to 21h00 with hot meals served from 11h30 to 14h00 and from 18h00 to 19h30. 2. Satellite cafétérias All satellite cafétérias will be closed on May 1st. They will all operate normally on Monday, April 30, except for buildings 17 (Meyrin), 865 and 892 (Prévessin) which will be closed. 3. Newspaper stand The newspaper kiosque in building 501 will be closed on May 1st.
CERN Academic Training Programme 2008/2009
HR Department
2009-01-01
LECTURE SERIES 23, 24 , 25 February 2009 11:00-12:00 - Main Auditorium, Bldg. 500-1-001 String Theory for Pedestrians Prof. Constantin Bachas / École normale supérieure, Paris, France This is a rapid non-technical course on string theory. Lecture 1 is an introduction to the basics of the subject: classical and quantum strings, D(irichlet) branes and string-string dualities. In lecture 2 I will discuss string unification of the fundamental forces, covering both its successes and failures. Finally in lecture 3 I will review string models of black hole microstates, the holographic gauge/gravity duality and, if time permits, potential applications to the physics of the strong interactions.. 5-6 March 2009 Thursday, 5 March 2009: 11:00-12:00, 14:00-15:00, Main Auditorium, Bldg. 500-1-001. Friday, 6 March 2009: 10:00-12:00, Main Auditorium, Bldg. 500-1-001 Recent developments at 3rd generation storage ring light sources Jean-Marc FILHOL, Deputy Director-General SOLEIL, France Over the last decade, many 3rd ge...
International Nuclear Information System (INIS)
Otomo, Takuma; Matsumoto, Hiroaki; Chiba, Akihiko; Nomura, Naoyuki
2009-01-01
Changes in Young's modulus of the Co-31 mass%Ni-19 mass%Cr-10 mass%Mo alloy (Co-Ni based alloy) with cold-swaging, combined with heat-treatment at temperatures from 673 to 1323 K, was investigated to enhance the Young's modulus of Co-Ni based alloy. After cold-swaging, the Co-Ni based alloy, forming fiber deformation texture, shows the Young's modulus of 220 GPa. Furthermore, after ageing the cold-swaged alloy at temperature from 673 to 1323 K, the Young's modulus increased to 230 GPa, accompanied by a decrease in the internal fiction and an increase in the tensile strength. This suggests that the increment in Young's modulus is caused by a moving of the vacancies to the dislocation cores and a continuous locking of the dislocations along their entire length with solute atoms (trough model). By annealing at 1323 K after cold swaging, Young's modulus slightly increased to 236 GPa. On the other hand, the tensile strength decreases to almost the same value as that before cold swaging due to recrystallization. These results suggest that the Young's modulus and the strength in the present alloy are simultaneously enhanced by the continuous dislocation locking during aging as well as the formation of fiber deformation texture. (author)
Gugusheff, J R; Ong, Z Y; Muhlhausler, B S
2014-06-22
We have previously reported that the opioid receptor blocker, naloxone, is less effective in reducing palatable food intake in offspring exposed to a maternal cafeteria diet during the perinatal period, implicating a desensitization of the central opioid pathway in the programming of food preferences. The present study aimed to investigate the effect of a maternal cafeteria diet and naloxone treatment on the development of the mesolimbic reward pathway and food choices in adulthood. We measured mRNA expression of key components of the reward pathway (mu-opioid receptor, proenkephalin, tyrosine hydroxylase, D1 and D2 receptors and the dopamine active transporter (DAT)) in the nucleus accumbens (NAc) and ventral tegmental area (VTA) of the offspring of control and cafeteria fed (JF) dams at weaning and after a 10-day naloxone treatment post-weaning and determined food preferences in adulthood in the remaining offspring. Naloxone treatment decreased the expression of DAT by 8.2 fold in female control offspring but increased it by 4.3 fold in female offspring of JF dams relative to the saline-injected reference groups. Proenkephalin mRNA expression was higher in the NAc of female JF offspring compared to controls, independent of naloxone treatment (Pfood preferences in adulthood in either control or JF offspring. These data indicate that prenatal exposure to a cafeteria diet alters the impact of opioid signaling blockade in the early post-weaning period on gene expression in the central reward pathway in a sex specific manner, but that these changes in gene expression do not appear to have any persistent impact on food preferences in adulthood. Copyright © 2014 Elsevier Inc. All rights reserved.
1981-01-01
Oklahoma City Police Department developed a computerized communications system, based on Johnson Space Center's (JSC's) 1960-mission control knowledge. JSC furnished information on lighting and other fatigue reducing measures, and provided specifications for equipment and design layouts. JSC also advised OCPD how to avoid communications bottlenecks associated with simultaneous handling of telephone, radio and inner-office transmissions. Oklahoma City saved money in reduced design and engineering costs by utilizing the already developed NASA technology.
2010-09-29
... as Anvifish JSC) Anvifish Co., Ltd Asia Commerce Fisheries Joint Stock Company (aka as Acomfish JSC... Trading Company Limited Qingdao Tiger Hardware Factory Co., Ltd Qingyuan County Hongyi Hardware Products...
Developing Tools and Techniques to Increase Communication Effectiveness
Hayes, Linda A.; Peterson, Doug
1997-01-01
The Public Affairs Office (PAO) of the Johnson Space Center (JSC) is responsible for communicating current JSC Space Program activities as well as goals and objectives to the American Public. As part of the 1996 Strategic Communications Plan, a review of PAO' s current communication procedures was conducted. The 1996 Summer Faculty Fellow performed research activities to support this effort by reviewing current research concerning NASA/JSC's customers' perceptions and interests, developing communications tools which enable PAO to more effectively inform JSC customers about the Space Program, and proposing a process for developing and using consistent messages throughout PAO. Note that this research does not attempt to change or influence customer perceptions or interests but, instead, incorporates current customer interests into PAO's communication process.
颈静脉孔的应用解剖学%Applied anatomy of jugular foramen
Institute of Scientific and Technical Information of China (English)
肖明; 丁炯; 韩群颖; 王鹤鸣; 左国平
2001-01-01
Objective: To provide anatomic data for imaging diagnosis and microsurgical treatment of jugular foramen (JF) lesions.Methods: The JF was observed and measured from internal and external aspects in 80 adult skulls.The anatomic relationships between the nerves and vessles in this region were observed in detail by dissecting 20 adult cephalic specimens.Results: ①In 62.3% of all these cases the right JF was larger than the left.In 15.9% the left was larger and in 21.8% they were equal in size. ②Bone bridges could be seen in 14.38% and could not in 85.62%. ③Measured from extracranial aspect, the average distance from midsagittal plane to the medial and lateral border of the JF (medial 26.11mm, lateral 33.41mm), was larger than those measured from intracramial aspect (medial 22.29mm, lateral 27.52mm).④Ⅸ cranial nerve made its exit through the anterior superior border of the JF in most cases, meanwhile Ⅹ and Ⅺ cranial nerve through the medial border, they were distinctly separated from each other by a band of fibrous tissue (account for 87.5%) or a bone bridge (12.5%). ⑤Just outside the JF,Ⅸ cranial nerve appeared at the anterior border and made a loop downward and forward superficial to the internal carotid artery.Ⅸ cranial nerve run downward and backward deep (account for 57.5%), or superficially (42.5%) to the internal jugular vein.Conclusions: The right JF is usually larger than the left, and not symmetry on both sides.The key to imaging diagnosis of nerves and vessels in the JF region is to select the sectional plane correctly.%目的:为与颈静脉孔相关的影像诊断和临床治疗提供解剖学资料。方法:从颅底内、外面,对80具成年颅骨的颈静脉孔进行观测;并对20具成人尸头进行解剖,观察该区域神经血管解剖关系。结果:①62.3%右侧颈静脉孔较左侧大,15.9%左侧较大,21.8%两侧大小一致;②14.38%的颈静脉孔有骨桥,85.62%
Kultura literacka Wilna (1323-1655) : retoryczna organizacja miasta
Niedźwiedź, Jakub
2012-01-01
The book is about the use of texts in medieval and early-modern Vilnius. The main concern of the book is the influence that the produc-tion and exchange of texts had on the functioning of the city. The author focuses on questions such as literacy, reading and writing, multiplicity of alphabets and languages of writing, institutions and people producing texts, storage of texts, education, women’s writings, the production and use of books, rhetorical genres and the functions of texts. The intro...
Directory of Open Access Journals (Sweden)
Maylen G. Eroa
2015-11-01
Full Text Available The processing of Jatrophacurcas (tubang-bakod to produce biodiesel entails wastes in the form of seedcake which can be converted into valuable product that can help nurture and improve soil properties. The College of Industrial Technology and the Chemical Engineering Department of Batangas State University (BatstateU conducted an experimental study which includes the composting of the combination of Jatropha Seed-Cake(JSC and Chicken Manure(CM , formulating ratios of JSC and CM andcharacterization of the organic fertilizer produced. Generally, this study aimed to promote proper waste disposal by producing an organic fertilizer from the waste of biodiesel production which uses Jatropha plant and proving the feasibility of making the fertilizer as the main source of nutrient for plants. Specifically, the nutrients that were considered were Nitrogen (N, Phosphorus (P, Potassium (K and the Carbon: Nitrogen (C:N ratio. Composting lasted for 6 weeks, three formulations were used, 30(CM:70(JSC, 50(CM:50(JSC and 70(CM:30(JSC. The result implies that theorganic fertilizers produced can be a good substitute to the commercially available fertilizers.
2007-2008 ACADEMIC TRAINING PROGRAMME
2008-01-01
LECTURE SERIES 10 & 11 March 2008 10 March 2008, 11:00-12:00 - Main Auditorium, bldg. 500-1 11 March 2008, 11:00-12:00, 14:00-15:00 - Main Auditorium, bldg. 500-1 Warped Extra-Dimensional Opportunities and Signatures Prof. Lisa RANDALL, Harvard University, USA I plan to discuss ways of searching for warped geometry and other extra-dimensional scenarios, with emphasis on the general lessons for search strategies. We will consider RS geometry on the brane and in the bulk, as well as possible black hole or quantum gravity signatures. If time permits, we will also consider fermion masses and/or precision Higgs measurements.
Jones, William B., Jr. (Editor); Goldstein, Stanley H. (Editor)
1989-01-01
The 1989 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by Texas A and M University and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers.
Bannerot, Richard B. (Editor); Sickorez, Donn G. (Editor)
1999-01-01
JSC NASA/ASEE Summer Faculty Fellowship Program was conducted by the University of Houston and JSC, under ASEE. The objectives of the program are to further the professional knowledge of qualified engineering and science members; stimulate an exchange of ideas between participants and NASA; enrich and refresh the research and teaching activities of participants; and contribute to the research objectives of the NASA Centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project commensurate with his/her interests and background and worked in collaboration with a NASA/JSC colleague. This document is a compilation of the final reports on the fellows' research projects performed during the summer of 1998. Volume 1, current volume, contains the first reports, and volume 2 contains the remaining reports.
Jones, William B., Jr. (Editor); Goldstein, Stanley H. (Editor)
1989-01-01
The 1989 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by Texas A and M University and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers.
Bannerot, Richard B. (Editor); Goldstein, Stanley H. (Editor)
1989-01-01
The 1988 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began in 1965 at JSC and in 1964 nationally, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objectives of the NASA Centers.
Bannerot, Richard B. (Editor); Goldstein, Stanley H. (Editor)
1992-01-01
The 1992 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters Washington, DC. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers. This document contains reports 13 through 24.
Bannerot, Richard B. (Editor); Goldstein, Stanley H. (Editor)
1992-01-01
The 1992 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JSC. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, Washington, DC. The objectives of the program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objective of the NASA Centers. This document is a compilation of the final reports 1 through 12.
Lactational Vitamin E Protects Against the Histotoxic Effects of ...
African Journals Online (AJOL)
olayemitoyin
Summary: The work investigated the protective role of lactational vitamin E administration on vanadium-induced histotoxicity. ... includes vitamin C, glutathione, selenium, and .... Int. J. Cancer: 120: 13-23. ... Vanadium (IV) mediated free radical.
27 CFR 30.32 - Determination of proof obscuration.
2010-04-01
... added to the temperature corrected hydrometer reading will give the true proof. (c) Distillation method... use of a precision hydrometer and thermometer in accordance with the provisions of § 13.23 to the...
Reconstruction of the cranial base in surgery for jugular foramen tumors.
Ramina, Ricardo; Maniglia, Joao J; Paschoal, Jorge R; Fernandes, Yvens B; Neto, Mauricio Coelho; Honorato, Donizeti C
2005-04-01
The surgical removal of a jugular foramen (JF) tumor presents the neurosurgeon with a complex management problem that requires an understanding of the natural history, diagnosis, surgical approaches, and postoperative complications. Cerebrospinal fluid (CSF) leakage is one of the most common complications of this surgery. Different surgical approaches and management concepts to avoid this complication have been described, mainly in the ear, nose, and throat literature. The purpose of this study was to review the results of CSF leakage prevention in a series of 66 patients with JF tumors operated on by a multidisciplinary cranial base team using a new technique for cranial base reconstruction. We retrospectively studied 66 patients who had JF tumors with intracranial extension and who underwent surgical treatment in our institutions from January 1987 to December 2001. Paragangliomas were the most frequent lesions, followed by schwannomas and meningiomas. All patients were operated on using the same multidisciplinary surgical approach (neurosurgeons and ear, nose, and throat surgeons). A surgical strategy for reconstruction of the cranial base using vascularized flaps was carried out. The closure of the surgical wound was performed in three layers. A specially developed myofascial flap (temporalis fascia, cervical fascia, and sternocleidomastoid muscle) associated to the inferior rotation of the posterior portion of the temporalis muscle was used to reconstruct the cranial base with vascularized flaps. In this series of 66 patients, postoperative CSF leakage developed in three cases. These patients presented with very large or recurrent tumors, and the postoperative CSF fistulae were surgically closed. The cosmetic result obtained with this reconstruction was classified as excellent or good in all patients. Our results compare favorably with those reported in the literature. The surgical strategy used for cranial base reconstruction presented in this article has
CERN Shop - Christmas Sale in Bldg. 33
PH Department
Looking for Christmas present ideas? The CERN Shop will give the CERN card holders a special reduction of 10 % on all CERN Shop articles from Friday 11.12.2009 to Thursday 17.12.2009. Come to visit the CERN Shop at the Reception, Building 33. PH-EDU-PO
CERN Shop - Christmas Sale in Bldg. 33
PH Department
2010-01-01
Looking for Christmas present ideas? The CERN Shop will give CERN card holders a special reduction of 10 % on all CERN Shop articles from Monday 13.12.2010 to Saturday 18.12.2010. Come and visit the CERN Shop in the Reception Building 33.
Interaction of candidate plasma facing materials with tokamak plasma in COMPASS
Czech Academy of Sciences Publication Activity Database
Matějíček, Jiří; Weinzettl, Vladimír; Macková, Anna; Malinský, Petr; Havránek, Vladimír; Naydenkova, Diana; Klevarová, Veronika; Petersson, P.; Gasior, P.; Hakola, A.; Rubel, M.; Fortuna, E.; Kolehmainen, J.; Tervakangas, S.
2017-01-01
Roč. 493, September (2017), s. 102-119 ISSN 0022-3115. [International Conference on Plasma-Facing Materials and Components for Fusion Applications/15./. Aix-en-Provence, 18.05.2015-22.05.2015] R&D Projects: GA ČR(CZ) GA14-12837S; GA ČR(CZ) GA15-10723S; GA MŠk(CZ) LM2015045; GA MŠk LM2015056 Institutional support: RVO:61389021 ; RVO:61389005 Keywords : erosion * COMPASS tokamak * plasma-material interaction * ion beam analysis Subject RIV: JF - Nuclear Energetics; JF - Nuclear Energetics (UJF-V) OBOR OECD: Nuclear related engineering ; Nuclear related engineering (UJF-V) Impact factor: 2.048, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0022311517301708
ELM-induced arcing on tungsten fuzz in the COMPASS divertor region
Czech Academy of Sciences Publication Activity Database
Matějíček, Jiří; Weinzettl, Vladimír; Vilémová, Monika; Morgan, T.W.; De Temmerman, G.; Dimitrova, Miglena; Cavalier, Jordan; Adámek, Jiří; Seidl, Jakub; Jäger, Aleš
2017-01-01
Roč. 492, August (2017), s. 204-212 ISSN 0022-3115. [PSI 2016 - 22nd International Conference on Plasma Surface Interactions in Controlled Fusion Devices/22./. Roma, 30.05.2016-03.06.2016] R&D Projects: GA ČR(CZ) GA14-12837S; GA ČR(CZ) GA15-10723S; GA MŠk(CZ) LM2015045; GA MŠk(CZ) LM2011026 Institutional support: RVO:61389021 ; RVO:68378271 Keywords : tungsten fuzz * arcing * COMPASS tokamak * plasma-material interaction Subject RIV: JF - Nuclear Energetics; JF - Nuclear Energetics (FZU-D) OBOR OECD: Nuclear related engineering ; Nuclear related engineering (FZU-D) Impact factor: 2.048, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0022311517301824
Veerabhadrappa, Mohankumar Bavimane; Shivakumar, Sharath Belame; Devappa, Somashekar
2014-02-01
This study focused on the solid-state fermentation of Jatropha seed cake (JSC), a byproduct generated after biodiesel production. Presence of anti-nutritional compounds and toxins restricts its application in livestock feed. The disposal of the JSC is a major environmental problem in the future, due to the generation of huge quantity of JSC after biodiesel extraction. Hence the JSC was assessed for its suitability as substrate for production and optimization of lipase and protease from Aspergillus versicolor CJS-98 by solid-state fermentation (SSF). The present study was also focused on the biodetoxification of anti-nutrients and toxins in JSC. The SSF parameters were optimized for maximum production of lipase and protease. Under the optimized conditions, the JSC supplemented with maltose and peptone (2%), adjusted to pH 7.0, moisture content 40%, inoculated with 1 × 10(7) spores per 5 g cake and incubated at 25°C, produced maximum lipase, 1288 U/g and protease, 3366 U/g at 96 h. The anti-nutrients like phytic acid (6.08%), tannins (0.37%), trypsin inhibitors (697.5 TIU/g), cyanogenic glucosides (692.5 μg/100 g), and lectins (0.309 mg/ml), were reduced to 1.70%, 0.23%, 12.5 TIU/g, 560.6 μg/100 g and 0.034 mg/ml respectively. The main toxic compound phorbol esters content in the JSC was reduced from 0.083% to 0.015% after SSF. Our results indicate that viability of SSF to utilize the huge amount of seed cake generated after extraction of biodiesel, for production of industrial enzymes and biodetoxification of anti-nutrients, toxins. Copyright © 2013 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
M. Burghoorn
2014-12-01
Full Text Available Textured transparent conductors are widely used in thin-film silicon solar cells. They lower the reflectivity at interfaces between different layers in the cell and/or cause an increase in the path length of photons in the Si absorber layer, which both result in an increase in the number of absorbed photons and, consequently, an increase in short-circuit current density (Jsc and cell efficiency. Through optical simulations, we recently obtained strong indications that texturing of the transparent conductor in copper indium gallium (di-selenide (CIGS solar cells is also optically advantageous. Here, we experimentally demonstrate that the Jsc and efficiency of CIGS solar cells with an absorber layer thickness (dCIGS of 0.85 μm, 1.00 μm and 2.00 μm increase through application of a moth-eye textured resist with a refractive index that is sufficiently similar to AZO (nresist = 1.792 vs. nAZO = 1.913 at 633 nm to avoid large optical losses at the resist-AZO interface. On average, Jsc increases by 7.2%, which matches the average reduction in reflection of 7.0%. The average relative increase in efficiency is slightly lower (6.0%. No trend towards a larger relative increase in Jsc with decreasing dCIGS was observed. Ergo, the increase in Jsc can be fully explained by the reduction in reflection, and we did not observe any increase in Jsc based on an increased photon path length.
Gugusheff, Jessica R; Bae, Sung Eun; Rao, Alexandra; Clarke, Iain J; Poston, Lucilla; Taylor, Paul D; Coen, Clive W; Muhlhausler, Beverly S
2016-03-15
Perinatal junk food exposure increases the preference for palatable diets in juvenile and adult rat offspring. Previous studies have implicated reduced sensitivity of the opioid pathway in the programming of food preferences; however it is not known when during development these changes in opioid signalling first emerge. This study aimed to determine the impact of a maternal junk food (JF) diet on mu-opioid receptor (MuR) expression and ligand binding in two key regions of the reward pathway, the nucleus accumbens (NAc) and the ventral tegmental area (VTA) in rats during the early suckling (postnatal day (PND) 1 and 7) and late suckling/early post-weaning (PND 21 and 28) periods. Female rats were fed either a JF or a control diet for two weeks prior to mating and throughout pregnancy and lactation. MuR expression in the VTA was significantly reduced in female JF offspring on PND 21 and 28 (by 32% and 57% respectively, Pjunk food exposure on MuR mRNA expression or binding were detected at these time points in male offspring. These findings provide evidence that the opioid signalling system is a target of developmental programming by the end of the third postnatal week in females, but not in males. Copyright © 2015 Elsevier B.V. All rights reserved.
S =1/2 ferromagnetic-antiferromagnetic alternating Heisenberg chain in a zinc-verdazyl complex
Yamaguchi, Hironori; Shinpuku, Yasuhiro; Shimokawa, Tokuro; Iwase, Kenji; Ono, Toshio; Kono, Yohei; Kittaka, Shunichiro; Sakakibara, Toshiro; Hosokoshi, Yuko
2015-02-01
We successfully synthesized the zinc-verdazyl complex [Zn(hfac)2].(o -Py -V ) [hfac = 1,1,1,5,5,5-hexafluoroacetylacetonate; o -Py-V = 3-(2-pyridyl)-1,5-diphenylverdazyl], which is an ideal model compound with an S = 1/2 ferromagnetic-antiferromagnetic alternating Heisenberg chain (F-AF AHC). Ab initio molecular-orbital (MO) calculations indicate that two dominant interactions JF and JAF form the S = 1/2 F-AF AHC in this compound. The magnetic susceptibility and magnetic specific heat of the compound exhibit thermally activated behavior below approximately 1 K. Furthermore, its magnetization curve is observed up to the saturation field and directly indicates a zero-field excitation gap of 0.5 T. These experimental results provide evidence for the existence of a Haldane gap. We successfully explain the results in terms of the S = 1/2 F-AF AHC through quantum Monte Carlo calculations with | JAF/JF|=0.22 . The ab initio MO calculations also indicate a weak AF interchain interaction J' and that the coupled F-AF AHCs form a honeycomb lattice. The J' dependence of the Haldane gap is calculated, and the actual value of J' is determined to be less than 0.01 | JF| .
Czech Academy of Sciences Publication Activity Database
Santos, M. J.; Karvonen, A.; Pedro, J. C.; Faltýnková, Anna; Seppälä, O.; Valtonen, E. T.
2007-01-01
Roč. 93, č. 6 (2007), s. 1319-1323 ISSN 0022-3395 Institutional research plan: CEZ:AV0Z60220518 Keywords : Trematoda * cercariae * behaviour * Finland Subject RIV: EG - Zoology Impact factor: 1.129, year: 2007
A jumping spark counter for various applications; rapid determination of its counting parameters
International Nuclear Information System (INIS)
Varnagy, M.; Vasvary, L.; Gyarmati, E.; Juhasz, S.; Scharbert, T.; Sztaricskai, T.
1977-01-01
On the basis of the method proposed by Cross and Tommasino a jumping spark counter (JSC) has been constructed which is applicable for the counting (continuously or 'step by step') of the perforations in thin (5-20μm) polymer foils. The JSC was combined with a DIDAC 4000 multichannel pulse-height analyser and multiscaler to determine automatically the best parameters and procedures for spark counting as well as to study the working mechanism of the JSC. Investigations were performed on etched Markrofol GK foils irradiated with fission fragments and exposed to 0.35 MRad gamma-rays. The track density interval studies was 0-50000 tracks/cm 2 . The possibility of the adoption of JSC for neutron dosimetric application, evaluation of angular distribution and for safegaurd purposes was tested. The possible consequences of the results are discussed. (Auth.)
Achieving Workplace Health through Application of Wellness Strategies
Robinson, Judith L.
2008-01-01
Purpose: 1) Understand and measure JSC workplace health: a) levels, sources, indicators & effects of negative, work-related stress; b) define leading indicators of emerging issues. 2 Provide linkage to outcomes: a) Focus application of wellness strategies & HR tools; b) Increase quality of work life and productivity. 3) Current effort will result in: a) Online assessment tool; b) Assessment of total JSC population (civil service & contractors); c) Application of mitigation tools and strategies. 4) Product of the JSC Employee Wellness Program. 5) Collaboration with Corporate Health Improvement Program/University of Arizona.
Environmental Microbiology Laboratory
Federal Laboratory Consortium — The Environmental Microbiology Laboratory, located in Bldg. 644 provides a dual-gas respirometer for measurement of oxygen consumption and carbon dioxide evolution...
African Journals Online (AJOL)
Items 401 - 450 of 1323 ... ... of chronic unpredictable mild stress on the mice salivary glands? ... vitro antifungal activities on six human pathogenic fungi, Abstract PDF ... of a traditional herbal medicine containing garlic and black cumin, Abstract.
77 FR 21578 - Agency Information Collection Activities: Guam-CNMI Visa Waiver Agreement
2012-04-10
... fine, pursuant to section 273 of the Immigration and Nationality Act (INA) (8 U.S.C. 1323), for...: http://forms.cbp.gov/pdf/CBP_Form_i760.pdf . Current Actions: CBP proposes to extend the expiration...
Astronaut Anna Fisher practices control of the RMS in a trainer
1984-01-01
Astronaut Anna Lee Fisher, mission specialist for 51-A, practices control of the remote manipulator system (RMS) at a special trainer at JSC. Dr. Fisher is pictured in the manipulator development facility (MDF) of JSC's Shuttle mockup and integration laboratory.
The Enigmatic Nature of the Israeli Legal System
African Journals Online (AJOL)
RV
independent and shall not be subject to the control or direction of any person or authority". 11 ...... JSC should have a central role in the removal of judges. The JSC ...... Thomas JB Judicial Ethics in Australia (Law Book Company Sydney 1988).
Françoise Benz
2002-01-01
25, 26, 27, 28 February and 1st March from 11.00 to 12.00 hrs - 25, 26, 27 February and 1 March at Main Auditorium, bldg. 500, 28 February at Council Chamber, bldg. 503 LECTURE SERIES Neutrino masses and oscillations by A. de Rujula / CERN-TH This course will not cover its subject in the customary way. The emphasis will be on the simple theoretical concepts (helicity, handedness, chirality, Majorana masses) which are obscure in most of the literature, and on the quantum mechanics of oscillations, that ALL books get wrong. Which, hopefully, will not deter me from discussing some of the most interesting results from the labs and from the cosmos.
78 FR 49253 - Pacific Southwest Recreation Resource Advisory Committee
2013-08-13
... (Region 5), 1323 Club Drive, Vallejo, CA. Please call ahead to Frances Enkoji, at 707-562-8846 to... Club Drive, Vallejo, CA 94592, or by email to [email protected] , or via facsimile to 707-562-9047...
Search Results | Page 28 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 271 - 280 of 1323 ... Increasing awareness of zoonotic diseases among health ... were manadated to be reserved for women in local level politics. ... this percentage is inverted for Indian Muslims, with most living in ... All rights reserved.
Astronaut Wendy Lawrence participates in training session in the CCT
1994-01-01
Seated in the pilot's seat of a JSC Shuttle trainer, astronaut Wendy B. Lawrence, STS-67 flight engineer, participates in a training session. The 1992 astronaut class graduate is in the crew compartment trainer (CCT) of JSC's Shuttle mockup and integration laboratory.
Astronaut Tamara Jernigan in the CCT during a training session
1994-01-01
Astronaut Tamara E. Jernigan, STS-67 payload commander, is shown here in the Shuttle Training Facility at JSC participating in a training session. Jernigan is training with the RMS controls in the Crew Compartment Trainer (CCT) of JSC's Shuttle mockup and integration laboratory.
Energy Technology Data Exchange (ETDEWEB)
Shaw, A. (ed.)
1989-01-01
This book contains techniques for energy efficiency in architectural design. Many aspects are covered including: cost; comfort and health; energy use; the design process; and analytical techniques. 202 figs. (JF)
75 FR 30847 - Federal Property Suitable as Facilities To Assist the Homeless
2010-06-02
... Price, Department of Energy, Office of Engineering & Construction Management, MA-50, 1000 Independence...: 41201020007 Status: Excess Reasons: Extensive deterioration Secured Area Indiana Bldg. 18 Grissom AFB Peru IN...
Dietary energy level for optimum productivity and carcass ...
African Journals Online (AJOL)
user
2013-08-05
Aug 5, 2013 ... optimum weights at dietary energy levels of 13.81, 13.23, 13.43 and ... Tadelle & Ogle (2000) reported that energy requirement of ..... The authors would like to acknowledge the National Research Foundation (NRF) and VLIR ...
Analytical Plug-In Method for Kernel Density Estimator Applied to Genetic Neutrality Study
Directory of Open Access Journals (Sweden)
Samir Saoudi
2008-07-01
Full Text Available The plug-in method enables optimization of the bandwidth of the kernel density estimator in order to estimate probability density functions (pdfs. Here, a faster procedure than that of the common plug-in method is proposed. The mean integrated square error (MISE depends directly upon J(f which is linked to the second-order derivative of the pdf. As we intend to introduce an analytical approximation of J(f, the pdf is estimated only once, at the end of iterations. These two kinds of algorithm are tested on different random variables having distributions known for their difficult estimation. Finally, they are applied to genetic data in order to provide a better characterisation in the mean of neutrality of Tunisian Berber populations.
Scalar field cosmologies with inverted potentials
Energy Technology Data Exchange (ETDEWEB)
Boisseau, B.; Giacomini, H. [Université de Tours, Laboratoire de Mathématiques et Physique Théorique, CNRS/UMR 7350, 37200 Tours (France); Polarski, D., E-mail: bruno.boisseau@lmpt.univ-tours.fr, E-mail: hector.giacomini@lmpt.univ-tours.fr, E-mail: david.polarski@umontpellier.fr [Université Montpellier and CNRS, Laboratoire Charles Coulomb, UMR 5221, F-34095 Montpellier (France)
2015-10-01
Regular bouncing solutions in the framework of a scalar-tensor gravity model were found in a recent work. We reconsider the problem in the Einstein frame (EF) in the present work. Singularities arising at the limit of physical viability of the model in the Jordan frame (JF) are either of the Big Bang or of the Big Crunch type in the EF. As a result we obtain integrable scalar field cosmological models in general relativity (GR) with inverted double-well potentials unbounded from below which possess solutions regular in the future, tending to a de Sitter space, and starting with a Big Bang. The existence of the two fixed points for the field dynamics at late times found earlier in the JF becomes transparent in the EF.
Scalar field cosmologies with inverted potentials
International Nuclear Information System (INIS)
Boisseau, B.; Giacomini, H.; Polarski, D.
2015-01-01
Regular bouncing solutions in the framework of a scalar-tensor gravity model were found in a recent work. We reconsider the problem in the Einstein frame (EF) in the present work. Singularities arising at the limit of physical viability of the model in the Jordan frame (JF) are either of the Big Bang or of the Big Crunch type in the EF. As a result we obtain integrable scalar field cosmological models in general relativity (GR) with inverted double-well potentials unbounded from below which possess solutions regular in the future, tending to a de Sitter space, and starting with a Big Bang. The existence of the two fixed points for the field dynamics at late times found earlier in the JF becomes transparent in the EF
... resonance imaging - chest; NMR - chest; MRI of the thorax; Thoracic MRI Patient Instructions ... Gotway MB, Panse PM, Gruden JF, Elicker BM. Thoracic radiology. In: Broaddus VC, Mason RJ, Ernst JD, et ...
77 FR 44262 - Federal Property Suitable as Facilities To Assist the Homeless
2012-07-27
....; office; major repairs required; extensive mold & asbestos located beneath the bldg.; remediation required... Service Admin. complex; mold and lead identified; historic property. Utah 2 Buildings 9160 N. Hwy 83...
October 1994 Shikotan, Kuril Islands, Russia Images
National Oceanic and Atmospheric Administration, Department of Commerce — A magnitude 8.1 earthquake occurred in the southern Kurils and on northern Hokkaido on Tuesday, October 5, 1994, (October 4 at 13:23 GMT). It was a sudden event,...
Fúzní palivo a obnovitelné zdroje
Czech Academy of Sciences Publication Activity Database
Entler, Slavomír
2015-01-01
Roč. 65, č. 5 (2015), s. 249-252 ISSN 0375-8842 Keywords : nuclear fusion * fusion fuel power plant * renewable source * fusion energy Subject RIV: JF - Nuclear Energetics http://www.casopisenergetika.cz
Sun, Lu; Shen, Liang; Mengd, Fanxu; Xu, Peng; Guo, Wenbin; Ruan, Shengping
2014-05-01
Here we demonstrate the influence of electron-donating polymer addition on the performance of poly(3-hexylthiophene) (P3HT):1 -(3-methoxycarbonyl)-propyl-1-phenyl-(6,6) C61 (PCBM) solar cells. Poly[(4,42-bis(2-ethylhexyl) dithieno [3,2-b:22,32-d] silole)-2,6-diylalt-(2,1,3-benzothiadiazole)-4,7-diyl] (PSBTBT) was chosen as the electron-donating polymer to improve the short circuit current (J(sc)) due to its distinct absorption in the near-IR range and similar HOMO level with that of P3HT. In the study, we found that J(sc) was improved for ternary blend (P3HT:PSBTBT:PCBM) solar cells. The dependence of device performance was investigated. J(sc) got decreased with increasing the ratio of PSBTBT. Result showed that J(sc) of ternary blend solar cells was improved greatly after thermal annealing at 150 degrees C, close to that of the binary blend (PSBTBT:PCBM) solar cells.
Li, Yilin; Li, Zhipeng; Ablekim, Tursunjan; Ren, Tianhui; Dong, Wen-Ji
2014-12-21
A rational design strategy of novel fluorophores for luminescent down-shifting (LDS) application was proposed and tested in this paper. Three new fluorophores (1a-c) with specific intramolecular charge transfer (ICT) and aggregation-induced emission (AIE) characteristics were synthesized as LDS molecules for increasing the output short circuit current density (Jsc) of a CdTe solar cell. Photophysical studies of their solution and solid states, and photovoltaic measurements of their PMMA solid films applied on a CdTe solar cell suggested that the specific spectroscopic properties and Jsc enhancement effects of these molecules were highly related to their chemical structures. The Jsc enhancement effects of these fluorophores were measured on both a CdTe small cell and a large panel. An increase in the output Jsc by as high as 5.69% for a small cell and 8.88% for a large panel was observed. Compared to a traditional LDS molecule, Y083, these fluorophores exhibited more superior capabilities of LDS.
Hyman, William A. (Editor); Sickorez, Donn G. (Editor)
1996-01-01
The objectives of the JSC NASA/ASEE Summer Faculty Fellowship Program, which began nationally in 1964 and at JSC in 1965, are (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of the participants' institutions; and (4) to contribute to the research objectives of the NASA centers. Each faculty fellow spent at least 10 weeks at JSC engaged in a research project in collaboration with a NASA/JSC colleague. In addition to the faculty participants, the 1995 program included five students. This document is a compilation of the first fifteen of twenty-seven final reports on the research projects completed by the faculty fellows and visiting students during the summer of 1995. The reports of two of the students are integral with that of the respective fellow. Three students wrote separate reports included in Volume 2.
New High-Precision Measurement of the Reaction Rate of the O-18(p, alpha)N-15 Reaction via THM
Czech Academy of Sciences Publication Activity Database
La Cognata, M.; Spitaleri, C.; Mukhamedzhanov, A. M.; Irgaziev, B.; Tribble, R. E.; Banu, A.; Cherubini, S.; Coc, A.; Crucilla, V.; Goldberg, V. Z.; Gulino, M.; Kiss, G. G.; Lamia, L.; Chengbo, L.; Mrázek, Jaromír; Pizzone, R. G.; Puglia, S. M. R.; Rapisarda, G. G.; Romano, S.; Sergi, M. L.; Tabacaru, G.; Trache, L.; Trzaska, W.; Tumino, A.
2009-01-01
Roč. 26, č. 3 (2009), s. 237-242 ISSN 1323-3580 Institutional research plan: CEZ:AV0Z10480505 Keywords : nuclear reactions * nucleosynthesis * abundances Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.786, year: 2009
Gender composition of college graduates by field of study and early fertility
Czech Academy of Sciences Publication Activity Database
Bičáková, Alena; Jurajda, Štěpán
2017-01-01
Roč. 15, č. 4 (2017), s. 1323-1343 ISSN 1569-5239 Institutional support: Progres-Q24 Keywords : field-of-study gender segregation * college graduates * fertility Subject RIV: AH - Economics OBOR OECD: Applied Economics , Econometrics Impact factor: 0.972, year: 2016
Indoor/outdoor Particulate Matter Number and Mass Concentration in Modern Offices
Czech Academy of Sciences Publication Activity Database
Chatoutsidou, S.E.; Ondráček, Jakub; Tesař, Ondřej; Tørseth, K.; Ždímal, Vladimír; Lazaridis, M.
2015-01-01
Roč. 92, OCT 2015 (2015), s. 462-474 ISSN 0360-1323 EU Projects: European Commission(XE) 315760 Institutional support: RVO:67985858 Keywords : modern offices * particulate matter * mechanical ventilation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.394, year: 2015
75 FR 78716 - Center for Scientific Review; Notice of Closed Meetings
2010-12-16
... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Center for Scientific Review... 20892. (301) 451-1323. [email protected] . Name of Committee: Digestive, Kidney and Urological Systems Integrated Review Group. Hepatobiliary Pathophysiology Study Section. Date: January 31-February 1...
2012-08-20
... disability, please contact Cindy Garris, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 66, rm... that the implant must withstand and perform. Moreover, the optimal preclinical/bench testing paradigm...
Ong, Z Y; Muhlhausler, B S
2014-01-01
This study aimed to determine whether the negative effects of maternal 'junk food' feeding on food preferences and gene expression in the mesolimbic reward system could be reversed by weaning the offspring onto a low-fat diet. Offspring of control (n = 11) and junk food-fed (JF, n = 12) dams were weaned onto a standard rodent chow until 6 weeks (juvenile) or 3 months (adult). They were then given free access to both chow and junk food for 3 weeks and food preferences determined. mRNA expression of key components of the mesolimbic reward system was determined by qRT-PCR at 6 weeks, 3 and 6 months of age. In the juvenile group, both male and female JF offspring consumed more energy and carbohydrate during the junk food exposure at 6 weeks of age and had a higher body fat mass at 3 months (P junk food; however, female JF offspring had a higher body fat mass at 6 months (P junk food exposure on food preferences and fat mass can be reversed by consuming a low-fat diet from weaning to adulthood in males. Females, however, retain a higher propensity for diet-induced obesity even after consuming a low-fat diet for an extended period after weaning. © 2013 Scandinavian Physiological Society. Published by John Wiley & Sons Ltd.
Antifungal and proteolytic activities of endophytic fungi isolated from Piper hispidum Sw
Directory of Open Access Journals (Sweden)
Ravely Casarotti Orlandelli
2015-06-01
Full Text Available Endophytes are being considered for use in biological control, and the enzymes they secrete might facilitate their initial colonization of internal plant tissues and direct interactions with microbial pathogens. Microbial proteases are also biotechnologically important products employed in bioremediation processes, cosmetics, and the pharmaceutical, photographic and food industries. In the present study, we evaluated antagonism and competitive interactions between 98 fungal endophytes and Alternaria alternata, Colletotrichum sp., Phyllosticta citricarpa and Moniliophthora perniciosa. We also examined the proteolytic activities of endophytes grown in liquid medium and conducted cup plate assays. The results showed that certain strains in the assemblage of P. hispidum endophytes are important sources of antifungal properties, primarily Lasiodiplodia theobromae JF766989, which reduced phytopathogen growth by approximately 54 to 65%. We detected 28 endophytes producing enzymatic halos of up to 16.40 mm in diameter. The results obtained in the present study highlight the proteolytic activity of the endophytes Phoma herbarum JF766995 and Schizophyllum commune JF766994, which presented the highest enzymatic halo diameters under at least one culture condition tested. The increased activities of certain isolates in the presence of rice or soy flour as a substrate (with halos up to 17.67 mm in diameter suggests that these endophytes have the potential to produce enzymes using agricultural wastes.
2002 - 2003 ACADEMIC TRAINING PROGRAMME
Françoise Benz
2002-01-01
1st TERM : November - December 2002 LECTURE SERIES FOR POSTGRADUATE STUDENTS 18, 19, 20, 21, 22 November 2002 Telling the Truth with Statistics by R. Barlow / Univ. of Manchester, UK 11:00-12:00 - Auditorium, bldg. 500 REGULAR LECTURE PROGRAMME 2, 3, 4, 5 December 2002 Introduction to String Theory by W. Lerche / CERN-TH 11:00-12:00 - Auditorium, bldg. 500 The lectures are open to all those interested, without application. The abstract of the lectures, as well as any change to the above information (title, dates, time, place etc.) will be published in the CERN bulletin, the WWW, and by Notices before each term and for each series of lectures. Françoise Benz Tel. 73127 francoise.benz@cern.ch
The Origins of Team Management
Swift, James S.
1971-01-01
An analysis of the factors that have led to team management, including classical principles of management, the human relations or behavioral school of management, and the systems theory both closed and open. (JF)
Limestone cliff - face and cave use by wild ring-tailed lemurs ( Lemur ...
African Journals Online (AJOL)
... FP Cuozzo, IA Youssouf Jacky, KD Fish, M LaFleur, LAL Ravelohasindrazana, JF Ravoavy ... This work is documenting newly discovered behaviors by this species. ... variation and increasing threats to this endangered primate species.
2097-IJBCS-Article-Jean Pierre Mingoas K
African Journals Online (AJOL)
hp
circumference and reproductive hormones rate .... t-test was used to compare means. RESULTS ..... Meeting between organizations involved in the integrated trypanosomosis control,. Bordeaux ... Faye D, Sulon J, Kane Y, Beckers JF, Leak S,.
Networking at NASA. Johnson Space Center
Garman, John R.
1991-01-01
A series of viewgraphs on computer networks at the Johnson Space Center (JSC) are given. Topics covered include information resource management (IRM) at JSC, the IRM budget by NASA center, networks evolution, networking as a strategic tool, the Information Services Directorate charter, and SSC network requirements, challenges, and status.
75 FR 32658 - Change of Contact Information; Technical Amendment
2010-06-09
... Gorski, Office of Crisis Management, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 32, rm... contacting the FDA Office of Emergency Operations, Office of Crisis Management, Office of the Commissioner...
77 FR 68805 - Federal Property Suitable as Facilities To Assist the Homeless
2012-11-16
... deficiencies; 50% of roof missing; trees fallen into bldg.--destroying the structural foundation; removal will... collapsed; floors/walls are caved in; removal of property will most likely result in complete collapse...
76 FR 38809 - Federal Property Suitable as Facilities To Assist the Homeless
2011-07-01
... Ave Motor pool Fort Rucker AL 36362 Landholding Agency: Army Property Number: 21201110019 Status... recent use-- barracks, off-site use only Bldg. 01516 Fort Carson El Paso CO 80913 Landholding Agency...
77 FR 72359 - Animal Generic Drug User Fee Act; Public Meeting; Request for Comments
2012-12-05
... Parklawn Dr., Element Bldg., Rockville, MD 20857. Comments: Interested persons may submit either written... to brand name drugs for consumers. Under AGDUFA I, FDA agreed to meet review performance goals for...
77 FR 75616 - Procurement List; Additions
2012-12-21
.... 611, 1919 E Grange Ave., Milwaukee, WI NPA: Easter Seals Southeast Wisconsin, Inc., South Milwaukee... B, Bldg. 39, Wright-Patterson AFB, Dayton, OH NPA: Goodwill Easter Seals Miami Valley, Dayton, OH...
A Practitioner's Perspective on Taxonomy, Ontology and Findability
Berndt, Sarah
2011-01-01
This slide presentation reviews the presenters perspective on developing a taxonomy for JSC to capitalize on the accomplishments of yesterday, while maintaining the flexibility needed for the evolving information of today. A clear vision and scope for the semantic system is integral to its success. The vision for the JSC Taxonomy is to connect information stovepipes to present a unified view for information and knowledge across the Center, across organizations, and across decades. Semantic search at JSC means seamless integration of disparate information sets into a single interface. Ever increasing use, interest, and organizational participation mark successful integration and provide the framework for future application.
Direct Analysis of JV-Curves Applied to an Outdoor-Degrading CdTe Module (Presentation)
Energy Technology Data Exchange (ETDEWEB)
Jordan, D; Kurtz, S.; Ulbrich, C.; Gerber, A.; Rau, U.
2014-03-01
We present the application of a phenomenological four parameter equation to fit and analyze regularly measured current density-voltage JV curves of a CdTe module during 2.5 years of outdoor operation. The parameters are physically meaningful, i.e. the short circuit current density Jsc, open circuit voltage Voc and differential resistances Rsc, and Roc. For the chosen module, the fill factor FF degradation overweighs the degradation of Jsc and Voc. Interestingly, with outdoor exposure, not only the conductance at short circuit, Gsc, increases but also the Gsc(Jsc)-dependence. This is well explained with an increase in voltage dependent charge carrier collection in CdTe.
International Nuclear Information System (INIS)
Mcinnis, B.; Goldstein, S.
1987-06-01
The Johnson Space Center (JSC) NASA/ASEE Summer Faculty Fellowship Program was conducted by the University of Houston. The basic objectives of the program are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching objectives of participants' institutions; and (4) to contribute to the research objectives of the NASA Centers. Each faculty fellow spent ten weeks at JSC engaged in a research project commensurate with his interests and background and worked in collaboration with a NASA/JSC colleague. Volume 1 contains sections 1 through 14
Licenční proces nového jaderného zdroje Temelín 3,4 – umisťování (1)
Czech Academy of Sciences Publication Activity Database
Havlín Nováková, D.; Štuller, J.; Cílek, Václav
2013-01-01
Roč. 21, 5/6 (2013), s. 130-134 ISSN 1210-7085 Institutional support: RVO:67985831 Keywords : geology * hydrology * legislation * licensing procedures * reactor safety * site selection * Temelin-1 reactor Subject RIV: JF - Nuclear Energetics
Bioencapsulation strategy and highly unsaturated fatty acids (HUFA ...
African Journals Online (AJOL)
SERVER
2007-09-05
Sep 5, 2007 ... as biological carriers for transferring essential nutrients to. *Corresponding author. ... plemented with egg yolk and vitamins (water and fat soluble) were prepared following ..... Fisheries chemotherapy: A review. In Muir JF and.
WNT5A: a motility-promoting factor in Hodgkin lymphoma
Czech Academy of Sciences Publication Activity Database
Linke, F.; Zaunig, S.; Nietert, M. M.; von Bonin, F.; Lutz, S.; Dullin, C.; Janovská, P.; Beissbarth, T.; Alves, F.; Klapper, W.; Bryja, Vítězslav; Pukrop, T.; Truemper, L.; Wilting, J.; Kube, D.
2017-01-01
Roč. 36, č. 1 (2017), s. 13-23 ISSN 0950-9232 Institutional support: RVO:68081707 Keywords : cell polarity pathway * reed-sternberg cells * chronic lymphocytic- leukemia Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 7.519, year: 2016
African Journals Online (AJOL)
Items 751 - 800 of 1323 ... Vol 8, No 5S (2011): Special Issue:Reviews of Modern Tools in Traditional Medicines, Guiding Tool in Unani Tibb for Maintenance and Preservation of .... and species of china by GC-MS and GC method, Abstract PDF.
Biodegradation of PCBs by ligninolytic fungi and characterization of the degradation products
Czech Academy of Sciences Publication Activity Database
Čvančarová, Monika; Křesinová, Zdena; Filipová, Alena; Covino, S.; Cajthaml, Tomáš
2012-01-01
Roč. 88, č. 11 (2012), s. 1317-1323 ISSN 0045-6535 R&D Projects: GA ČR GA525/09/1058 Institutional support: RVO:61388971 Keywords : Polychlorinated biphenyls * PCBs * Biodegradation Subject RIV: EE - Microbiology, Virology Impact factor: 3.137, year: 2012
76 FR 58277 - Animal Generic Drug User Fee Act; Public Meeting; Request for Comments
2011-09-20
... support for lower-cost alternatives to brand drugs for consumers. Under AGDUFA, FDA agreed to meet review... Parklawn Dr., Element Bldg., Rockville, MD 20857. Dated: September 13, 2011. Leslie Kux, Acting Assistant...
77 FR 35993 - Federal Property Suitable as Facilities To Assist the Homeless
2012-06-15
... identified in the floor Virginia Hampton Rds, Shore Patrol Bldg 811 East City Hall Ave Norfolk VA 23510... Reclamation Henderson NV 89011 Landholding Agency: GSA Property Number: 54201140004 Status: Surplus GSA Number...
Optical effects of shadow masks on short circuit current of organic photovoltaic devices.
Lin, Chi-Feng; Lin, Bing-Hong; Liu, Shun-Wei; Hsu, Wei-Feng; Zhang, Mi; Chiu, Tien-Lung; Wei, Mau-Kuo; Lee, Jiun-Haw
2012-03-21
In this paper, we have employed different shadow masks attached on top of organic photovoltaic (OPV) devices to study the optical effects of the former on the short circuit current (J(SC)). To rule out possible lateral electrical conduction and simplify the optical effects inside the device, a small-molecular heterojunction OPV device with a clear donor/acceptor interface was employed with a hole extraction layer exhibiting high resistance intentionally. Careful calibration with a shadow mask was employed. By attaching two layers of opaque masks in combination with a suitable holder design to shield the light from the edges and backside, the value of J(SC) approached that of the dark current, even under 1-sun radiation. With different illumination areas, we found that the photons illuminating the non-active region of the device contributed to 40% of the J(SC) by optical effect within the width of about 1 mm around the active region. When illuminating the non-active area with 12 mm to the active area, a 5.6 times improvement in the J(SC) was observed when the incident angle was 75°. With the introduction of a microstructured film onto the OPV device and an increase in the reflection from the non-active region, a 15% enhancement of the J(SC) compared to the control device was achieved.
International Nuclear Information System (INIS)
1997-09-01
The purpose of this report is to document the condition of Bldg. 3032, after completion of deactivation activities as outlined by the Department of Energy (DOE) Office of Nuclear Materials and Facility Stabilization Program (EM-60) guidance documentation. This report outlines the activities conducted to place the facility in a safe and environmentally sound condition for transfer to the DOE Office of Environmental Restoration Program (EM-40). This report provides a history and profile of Bldg. 3032 prior to commencing deactivation activities and a profile of the building after completion of deactivation activities. Turnover items, such as the Postdeactivation Surveillance ampersand Maintenance Plan, remaining hazardous materials, radiological controls, Safeguards and Security, quality assurance, facility operations, and supporting documentation provided in the EM-60 turnover package are discussed. Building 3032 will be used as the Health Physics Office for the Isotopes Facilities Deactivation Program area and will require access for these offices and to facilitate required surveillance and maintenance (S ampersand M) activities to maintain the building safety envelope. Bldg. 3032 was stabilized during deactivation so that when transferred to the EM-40 program, only a minimal S ampersand M effort would be required to maintain the building safety envelope. All materials have been removed from the building, and all utility systems, piping, and alarms have been deactivated except electricity and steam needed for the office areas
Lifescience Database Archive (English)
Full Text Available ORS ... Hilton JF, Christensen KE, Watkins D, Raby BA, Renaud Y, de la Luna S, Estivill X, MacKenzie RE, Hud...son TJ, Rosenblatt DS ... TITLE ... The molecular basis of glutamate formiminotransfe
Effect of gamma-irradiation on strength of concrete for nuclear-safety structures
Czech Academy of Sciences Publication Activity Database
Vodák, F.; Trtík, K.; Sopko, V.; Kapičková, O.; Demo, Pavel
2005-01-01
Roč. 35, - (2005), s. 1447-1451 ISSN 0008-8846 Institutional research plan: CEZ:AV0Z10100521 Keywords : concrete * gamma-irradiation * strength * porosity Subject RIV: JF - Nuclear Energetics Impact factor: 0.727, year: 2005
African Journals Online (AJOL)
ebutamanya
2015-01-30
Jan 30, 2015 ... comorbidities, symptoms, CM used, injection mode, site and rate, extravasated volume, location .... extravasated CM volume, application of ice packs, alcoholized .... Miles SG, Rasmussen JF, Litwiller T, Osik A. Safe use of an.
2013-02-15
..., 10903 New Hampshire Ave., Bldg. 66, rm. 4613, Silver Spring, MD 20993-0002. Send one self-addressed... was conceived in February 2011 as a forum to discuss future directions in medical device regulatory...
2011-04-13
... Hampshire Ave., Bldg. 51, rm. 2201, Silver Spring, MD 20993-0002. Send one self-addressed adhesive label to... exploration and verification of drug effects under epidemic and pandemic conditions. A draft notice of...
77 FR 52397 - Federal Property Suitable as Facilities To Assist the Homeless
2012-08-29
... the processing of applications, the reader is encouraged to refer to the interim rule governing this... paint, most recent use--dining, off-site use only Bldg. 90551 Fort Huachuca Cochise AZ 85613 Landholding...
78 FR 15127 - Federal Property Suitable as Facilities To Assist the Homeless
2013-03-08
... the processing of applications, the reader is encouraged to refer to the interim rule governing this... recent use--dining, off-site use only Bldg. 90551 Fort Huachuca Cochise AZ 85613 Landholding Agency: Army...
ACHALASIA:WHAT IS THE BEST TREATMENT?
African Journals Online (AJOL)
Emmanuel Ameh
Method: A Medline, PubMed and Cochrane database search was conducted using reference manager. 11. Original articles ..... onto the stomach.10,49 A recent meta-analysis on 21 .... Mbembati NAA, Lema LEK, Kahamba JF, Mcharo. ONM.
... page: //medlineplus.gov/ency/article/003566.htm Aldolase blood test To use the sharing features on this page, ... risk any time the skin is broken) Images Blood test References Berridge BR, Van Vleet JF, Herman E. ...
Dynamics of Magnetic Bright Points in an Active Region
Czech Academy of Sciences Publication Activity Database
Möstl, C.; Hanslmeier, A.; Sobotka, Michal; Puschmann, K.G.; Muthsam, H. J.
2006-01-01
Roč. 237, č. 1 (2006), s. 13-23 ISSN 0038-0938 Grant - others:FWF(AT) P-17024 Institutional research plan: CEZ:AV0Z10030501 Keywords : Sun * photosphere * magnetic fields Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 1.887, year: 2006
2013-04-16
... New Hampshire Ave., Bldg. 51, rm. 2201, Silver Spring, MD 20993-0002 or Office of Communication... acceptance of advertising and promotional labeling in the eCTD format, it has become necessary to expand the...
32 CFR 725.6 - Authority to determine and respond.
2010-07-01
... Regs., art. 0327 (1990) 5 , shall be referred to the cognizant Command Counsel under, and subject to... Counsel, Navy Litigation Office, 720 Kennon Street SE, Bldg 36 Room 233, Washington Navy Yard, DC 20374...
78 FR 11429 - Federal Property Suitable as Facilities To Assist the Homeless
2013-02-15
...: Mr. Scott Whiteford, Army Corps of Engineers, Real Estate, CEMP-CR, 441 G Street NW., Washington, DC...., needs rehab, most recent use--chemistry lab, off-site use only Bldg. E3335 Property Number: 21200330144...
Ph. Bernard
2004-01-01
Dear Colleagues, Many of you have accepted the Director-General's invitation to the fête on October 15. We are very pleased to be able to welcome all those who have replied to this invitation. The meeting will take place in the Main Auditorium and will be transmitted by television to the Council Chamber and to the four meeting rooms of bldg. 40 (40-S2-A01, 40-S2-B01, 40-SS-C01, 40-SS-D01). It will start promptly at 9 a.m. and we ask you to come very early so that all may find their seats in the various rooms. The reception offered by the Director-General will take place in bldg. 40 at around 12 o'clock. Ph. Bernard Chairman, GAC Committee
Academic Training: QCD: are we ready for the LHC
2006-01-01
2006-2007 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 4, 5, 6, 7 December, from 11:00 to 12:00 4, 5, 6 December - Main Auditorium, bldg. 500, 7 December - TH Auditorium, bldg. 4 - 3-006 QCD: are we ready for the LHC S. FRIXIONE / INFN, Genoa, Italy The LHC energy regime poses a serious challenge to our capability of predicting QCD reactions to the level of accuracy necessary for a successful programme of searches for physics beyond the Standard Model. In these lectures, I'll introduce basic concepts in QCD, and present techniques based on perturbation theory, such as fixed-order and resummed computations, and Monte Carlo simulations. I'll discuss applications of these techniques to hadron-hadron processes, concentrating on recent trends in perturbative QCD aimed at improving our understanding of LHC phenomenology.
... Adenocarcinoma - chest x-ray Pulmonary nodule - front view chest x-ray Pulmonary nodule, solitary - CT scan Respiratory system References Gotway MB, Panse PM, Gruden JF, Elicker BM. Thoracic radiology: noninvasive diagnostic imaging. In: Broaddus VC, Mason RJ, ...
Effective chemical control of fruit flies (Diptera: Tephritidae) pests in ...
African Journals Online (AJOL)
Effective chemical control of fruit flies (Diptera: Tephritidae) pests in mango orchards in northern Côte-d'Ivoire. OR N'depo, N Hala, A N'da Adopo, F Coulibaly, PK Kouassi, JF Vayssieres, M de Meyer ...
Advanced Energy Projects FY 1990 research summaries
International Nuclear Information System (INIS)
1990-09-01
This report serves as a guide to prepare proposals and provides summaries of the research projects active in FY 1990, sponsored by the Office of Basic Energy Sciences Division of Advanced Energy Projects, Department of Energy. (JF)
Curation of US Martian Meteorites Collected in Antarctica
Lindstrom, M.; Satterwhite, C.; Allton, J.; Stansbury, E.
1998-01-01
To date the ANSMET field team has collected five martian meteorites (see below) in Antarctica and returned them for curation at the Johnson Space Center (JSC) Meteorite Processing Laboratory (MPL). ne meteorites were collected with the clean procedures used by ANSMET in collecting all meteorites: They were handled with JSC-cleaned tools, packaged in clean bags, and shipped frozen to JSC. The five martian meteorites vary significantly in size (12-7942 g) and rock type (basalts, lherzolites, and orthopyroxenite). Detailed descriptions are provided in the Mars Meteorite compendium, which describes classification, curation and research results. A table gives the names, classifications and original and curatorial masses of the martian meteorites. The MPL and measures for contamination control are described.
75 FR 51040 - Issuance of an Experimental Use Permit by the State of Florida
2010-08-18
... Docket in Rm. S- 4400, One Potomac Yard (South Bldg.), 2777 S. Crystal Dr., Arlington, VA. The hours of... determine if the addition of mosquito ovitrap strips (Trap-N-Kill\\TM\\), impregnated with bifenthrin to...
2011-09-07
... Bldg. 3F, 2-1 Yaesu 2- chome Chuo-ku, Tokyo 104-0028, Japan. Elpida Memory (USA) Inc., 1175 Sonora..., Round Rock, TX 78682. Hewlett-Packard Company, 3000 Hanover Street, Palo Alto, CA 94304. Kingston...
75 FR 65362 - Oncologic Drugs Advisory Committee; Notice of Meeting
2010-10-22
... Hampshire Ave., Silver Spring, MD 20993-0002. Information regarding special accommodations due to a... Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 31, rm. 2417, Silver...) Soft Gelatin Capsules, [[Page 65363
APD detectors for biological fluorescence spectroscopy
International Nuclear Information System (INIS)
Mazeres, S.; Borrel, V.; Magenc, C.; Courrech, J.L.; Bazer-Bachi, R.
2006-01-01
Fluorescence spectroscopy is a very convenient and widely used method for studying the molecular background of biological processes [L. Salome, J.L. Cazeil, A. Lopez, J.F. Tocanne, Eur. Biophys. J. 27 (1998) 391-402]. Chromophores are included in the structure under study and a flash of laser light induces fluorescence (Fluorescence Recovery After Photo-bleaching), the decay of which yields information on the polarity, the speed of rotation, and the speed of diffusion as well as on the temporal and spatial evolution of interactions between molecular species. The method can even be used to study living cells [J.F. Tocanne, L. Cezanne, A. Lopez, Prog. Lipid Res. 33 (1994) 203-237, L. Cezanne, A. Lopez, F. Loste, G. Parnaud, O. Saurel, P. Demange, J.F. Tocanne, Biochemistry 38 (1999) 2779-2786]. This is classically performed with a PM-based system. For biological reasons a decrease of the excitation of the cells is highly desirable. Because the fluorescence response then becomes fainter a significant improvement in detector capability would be welcome. We present here results obtained with an Avalanche Photo Diode (APD)-based system. The small sensitive area of detection allows a very significant improvement in signal/noise ratio, improvement in gain, and the opening-up of a new parameter space. With these new detectors we can begin the study of information transmission between cells through morphine receptors. This work involves both electronics engineers and biophysicists, so results and techniques in both fields will be presented here
A tightly-coupled domain-decomposition approach for highly nonlinear stochastic multiphysics systems
Energy Technology Data Exchange (ETDEWEB)
Taverniers, Søren; Tartakovsky, Daniel M., E-mail: dmt@ucsd.edu
2017-02-01
Multiphysics simulations often involve nonlinear components that are driven by internally generated or externally imposed random fluctuations. When used with a domain-decomposition (DD) algorithm, such components have to be coupled in a way that both accurately propagates the noise between the subdomains and lends itself to a stable and cost-effective temporal integration. We develop a conservative DD approach in which tight coupling is obtained by using a Jacobian-free Newton–Krylov (JfNK) method with a generalized minimum residual iterative linear solver. This strategy is tested on a coupled nonlinear diffusion system forced by a truncated Gaussian noise at the boundary. Enforcement of path-wise continuity of the state variable and its flux, as opposed to continuity in the mean, at interfaces between subdomains enables the DD algorithm to correctly propagate boundary fluctuations throughout the computational domain. Reliance on a single Newton iteration (explicit coupling), rather than on the fully converged JfNK (implicit) coupling, may increase the solution error by an order of magnitude. Increase in communication frequency between the DD components reduces the explicit coupling's error, but makes it less efficient than the implicit coupling at comparable error levels for all noise strengths considered. Finally, the DD algorithm with the implicit JfNK coupling resolves temporally-correlated fluctuations of the boundary noise when the correlation time of the latter exceeds some multiple of an appropriately defined characteristic diffusion time.
Design and development of ITER high-frequency magnetic sensor
Czech Academy of Sciences Publication Activity Database
Ma, Y.; Vayakis, G.; Begrambekov, L.B.; Cooper, J.-J.; Ďuran, Ivan; Hirsch, M.; Laqua, H.P.; Moreau, P.; Oosterbeek, J.W.; Spuig, P.; Stange, T.; Walsh, M.
2016-01-01
Roč. 112, November (2016), s. 594-612 ISSN 0920-3796 Institutional support: RVO:61389021 Keywords : ITER * High-frequency * Magnetic diagnostics * ECHa Subject RIV: JF - Nuclear Energetics OBOR OECD: Nuclear related engineering Impact factor: 1.319, year: 2016
Základy fúzní energetiky I. – Historie
Czech Academy of Sciences Publication Activity Database
Entler, Slavomír; Mlynář, Jan; Dostál, V.
červenec (2016), č. článku 14482. ISSN 1801-4399 Institutional support: RVO:61389021 Keywords : Nuclear fusion * ITER * DEMO Subject RIV: JF - Nuclear Energetics http://energetika.tzb-info.cz/elektroenergetika/14482-zaklady-fuzni-energetiky-i-historie
Measurement of gamma and neutron radiations inside spent fuel assemblies with passive detectors
Czech Academy of Sciences Publication Activity Database
Viererbl, L.; Lahodová, Z.; Voljanskij, A.; Klupák, V.; Koleška, M.; Cabalka, M.; Turek, Karel
2011-01-01
Roč. 652, č. 1 (2011), s. 90-93 ISSN 0168-9002 Institutional research plan: CEZ:AV0Z10480505 Keywords : fuel assembly * spent fuel * track detector Subject RIV: JF - Nuclear Energetics Impact factor: 1.207, year: 2011
African Journals Online (AJOL)
ANDERSEN-TAWIL SYNDROME IN A NIGERIAN WOMAN: A CASE. REPORT AND .... may represent a manifestation of disease rather than. 5 a normal variant . ... Klein R, Ganelin R, Marks JF, Usher P, Richards C. J. Periodic paralysis with ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 5; Issue 10. Electronic Commerce - What is E-Commerce? V Rajaraman. Series Article Volume 5 Issue 10 October 2000 pp 13-23 ... Author Affiliations. V Rajaraman1. IBM Professor of Information Technology, JNCASR, Bangalore 560 064, India.
Crystal field and magnetism with Wannier functions: rare-earth dopedaluminum garnets
Czech Academy of Sciences Publication Activity Database
Mihóková, Eva; Novák, Pavel; Laguta, Valentyn
2015-01-01
Roč. 33, č. 12 (2015), 1316-1323 ISSN 1002-0721 R&D Projects: GA ČR GA13-09876S Institutional support: RVO:68378271 Keywords : crystal field * ab initio calculations * garnets * rare earths Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.188, year: 2015
From Calculus to Number Theory
Indian Academy of Sciences (India)
A. Raghuram
2016-11-04
Nov 4, 2016 ... diverges to infinity. This means given any number M, however large, we can add sufficiently many terms in the above series to make the sum larger than M. This was first proved by Nicole Oresme (1323-1382), a brilliant. French philosopher of his times.
Leferink, N.G.H.; Berg, van den W.A.M.; Berkel, van W.J.H.
2008-01-01
l-Galactono-1,4-lactone dehydrogenase (GALDH; ferricytochrome c oxidoreductase; EC 1.3.2.3) is a mitochondrial flavoenzyme that catalyzes the final step in the biosynthesis of vitamin C (l-ascorbic acid) in plants. In the present study, we report on the biochemical properties of recombinant
Czech Academy of Sciences Publication Activity Database
Mašková, Ludmila; Smolík, Jiří; Ďurovič, M.
2017-01-01
Roč. 120, August 1 (2017), s. 77-84 ISSN 0360-1323 R&D Projects: GA MK DF11P01OVV020 Keywords : indoor environment * gaseous pollution * indoor/outdoor ratio Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 4.053, year: 2016
Czech Academy of Sciences Publication Activity Database
Chatoutsidou, S.E.; Mašková, Ludmila; Ondráčková, Lucie; Ondráček, Jakub; Lazaridis, M.; Smolík, Jiří
2015-01-01
Roč. 89, JUL (2015), s. 253-263 ISSN 0360-1323 EU Projects: European Commission(XE) 315760 Grant - others:EEA(NO) A/CZ0046/2/001 Institutional support: RVO:67985858 Keywords : infiltration factor * penetration * deposition Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.394, year: 2015
Dirac electronics states in graphene systems: optical spectroscopy studies
Czech Academy of Sciences Publication Activity Database
Orlita, Milan; Potemski, M.
2010-01-01
Roč. 25, č. 6 (2010), 063001/1-063001/22 ISSN 0268-1242 R&D Projects: GA AV ČR KAN400100652 Institutional research plan: CEZ:AV0Z10100521 Keywords : graphene * Dirac fermions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.323, year: 2010
Accessing information to rural communities: case studies of selected ...
African Journals Online (AJOL)
... facilities is, therefore, a basic need. This paper defines Telecentres, reviews Information Communication Technologies, and gives an overview of selected Telecentres in Uganda and their users. It concludes with discussing challenges and possible solutions. (University of Dar es Salaam Library Journal: 2003 5(1): 13-23) ...
Astronaut John Young in Command Module Simulator during Apollo Simulation
1968-01-01
Astronaut John W. Young, command module pilot, inside the Command Module Simulator in bldg 5 during an Apollo Simulation. Astronauts Thomas P. Stafford, commander and Eugene A. Cernan, lunar module pilot are out of the view.
Three astronauts inside Command Module Simulator during Apollo Simulation
1968-01-01
Three astronauts inside the Command Module Simulator in bldg 5 during an Apollo Simulation. Left to right are Astronauts Thomas P. Stafford, commander; John W. Young, command module pilot; and Eugene A. Cernan, lunar module pilot.
75 FR 6997 - Federal Property Suitable as Facilities To Assist the Homeless
2010-02-12
... 22202; (703) 601-2545; Corps of Engineers: Scott Whiteford, Director of Real Estate, CEMP-CR, 441 G... Comments: 44,352 sq. ft., needs rehab, most recent use--chemistry lab, off-site use only Bldg. E3335...
The numerous lessons to learn from the 2001 year
International Nuclear Information System (INIS)
Anon.
2002-01-01
This article summarizes the content of the talk given by J.F. Giannesini, adviser to the president of the French institute of petroleum (IFP), at the 'Panorama 2002' meeting held in Paris on February 2002 and organized by the IFP. In his talk, J.F. Giannesini has evoked the September 11 2001 US terror events but also, in a more sectorial domain, the US energy crisis and Enron's bankruptcy. The energy future has been evoked too with two main preoccupations: the future automotive fuels and the disaffection of young engineers and technicians to the petroleum industry. Two speakers, the president of Renault car making company and the president of the French agency of environment and energy mastery (Ademe) have confirmed the IFP's opinion according to which no miracle solution exist to the problem of CO 2 emissions from the automobile traffic. (J.S.)
International Nuclear Information System (INIS)
Erasov, V.S.; Konoplenko, V.P.; Pirogov, E.N.
1986-01-01
Steel OKh16N15M3B is used extensively for the manufacture of atomic reactor fuel-element shells. The aim of this work is a study of the mechanical characteristics of this steel cold-worked by 20% with active tension and creep in the temperature range 973-1323 0 K, which is necessary for predicting the behavior of fuel-element shells in critical situations. It is found that above 973 0 K there is active loss of strength for cold-worked steel OKh16N15M3B. Strength characteristics in the region 973-1323 0 K decrease by more than a factor of six. Thermal activation analysis of the plastic deformation process, showing a sharp increase in activation energy above 1073 0 K, suggests a change in the mechanisms of plastic deformation taking place. For active tension and creep the same temperature range is obtained for a marked change in activation energy
Základy fúzní energetiky III. – Reaktorové technologie
Czech Academy of Sciences Publication Activity Database
Entler, Slavomír; Mlynář, Jan; Dostál, V.
Srpen (2016), č. článku 14587. ISSN 1801-4399 Institutional support: RVO:61389021 Keywords : Nuclear fusion * reactor technologies * plasma Subject RIV: JF - Nuclear Energetics http://energetika.tzb-info.cz/elektroenergetika/14587-zaklady-fuzni-energetiky-iii-reaktorove-technologie
The Rhetoric of Defeat: Nazi Propaganda in 1945.
Bytwerk, Randall L.
1978-01-01
The rhetoric of the final four months of Hitler's Reich is examined, including arguments that Germany could still win the war based on moral and logical grounds, and later appeals based on source credibility, historical analogy, and terror. (JF)
The sperm of Hylodinae species (Anura, Leptodactylidae ...
Indian Academy of Sciences (India)
Madhu
from the Instituto Brasileiro do Meio Ambiente e Recursos. Naturais Renováveis .... Note the globular shape of the axial fiber (af) and the short extension of the juxtaxonemal fiber (jf). ..... Ultraestructura comparada; Medio Ambiente 5. 45–57.
Caustic addition system operability test procedure
International Nuclear Information System (INIS)
Parazin, R.E.
1994-11-01
This test procedure provides instructions for performing operational testing of the major components of the 241-AN-107 Caustic Addition System by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E)
Caustic addition system operability test procedure
Energy Technology Data Exchange (ETDEWEB)
Parazin, R.E.
1994-11-01
This test procedure provides instructions for performing operational testing of the major components of the 241-AN-107 Caustic Addition System by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E).
System Requirements Document for the Molten Salt Reactor Experiment 233U conversion system
International Nuclear Information System (INIS)
Aigner, R.D.
2000-01-01
The purpose of the conversion process is to convert the 233 U fluoride compounds that are being extracted from the Molten Salt Reactor Experiment (MSRE) equipment to a stable oxide for long-term storage at Bldg. 3019
Brown, I. I.; Bryant, D.; Sarkisova, S.; Shen, G.; Garrison, D.; McKay, D. S.
2009-01-01
Of all extant environments, iron-depositing hot springs may constitute the most appropriate natural models (Pierson and Parenteau, 2000) for analysis of the ecophysiology of ancient cyanobacteria (CB) which may have emerged in association with hydrothermal activity (Brown et al., 2007) and elevated levels of environmental Fe (Rouxel et al., 2005). Elevated environmental Fe2+ posed a significant challenge to the first oxygenic phototrophs - CB - because reduced Fe2+ induces toxic Fenton reactions (Wiedenheft et al., 2005). Ancient CB could have also been stressed by occasional migrations from the Fe2+-rich Ocean to the basaltic land which was almost devoid of dissolved Fe2+. That is why the study of the adaptation reactions of siderophilic CB, which inhabit iron-depositing hot springs, to up and down shifts in levels of dissolved Fe may shed light on the paleophysiology of ancient oxygenic prokaryotes. Methods. Siderophilic CB (Brown et al., 2007) were cultivated in media with different concentrations of added Fe3+. In some cases basaltic rocks were used as a source of Fe and trace elements. The processes of Fe mineralization and rock dissolution were studied using TEM, SEM and EDS techniques. Fluorescence spectroscopy was used for checking chlorophyll-protein complexes. Results. It was found that five siderophilic isolates Chroogloeocystis siderophila, JSC-1, JSC-3, JSC-11 and JSC-12 precipitated Fe-bearing phases on the exopolymeric sheaths of their cells if [Fe3+] was approx. 400-600 M (high Fe). Same [Fe3+] was most optimal one for the cultures proliferation rate (Brown et al., 2005; Brown et al., 2007). Higher concentrations of Fe3+ repressed the growth of some siderophilic CB (Brown et al., 2005). No mineralized Fe3+ was observed on the sheath of freshwater isolates Synechocystis sp. PCC 6803 and Phormidium aa. Scanning TEM in conjunction with thin-window energy dispersive X-ray spectroscopy (EDS) revealed intracellular Fe-rich phases within all three isolates
National Research Council Canada - National Science Library
Nagel, Wolfgang E; Kröner, Dietmar; Resch, Michael
2010-01-01
...), NIC/JSC (J¨ u lich), and LRZ (Munich). As part of that strategic initiative, in May 2009 already NIC/JSC has installed the first phase of the GCS HPC Tier-0 resources, an IBM Blue Gene/P with roughly 300.000 Cores, this time in J¨ u lich, With that, the GCS provides the most powerful high-performance computing infrastructure in Europe alread...
President Ronald Reagan speaks at STS 51-L Memorial service
1986-01-01
President Ronald Reagan tells a large turnout of JSC employees and family and friends of the 51-L crewmembers about their accomplishments and sacrifices during memorial services held following the Challenger accident at Kennedy Space Center (KSC).'They slipped the surly bonds of earth to touch the face of God' the President told the thousands gathered on the central mall at JSC.
Multiple-Vehicle Resource-Constrained Navigation in the Deep Ocean
2011-09-01
David E. Hardt Chairman, Department Committee on Graduate Students MIT Accepted by...Blackwell, 2007. [84] I.G. Priede, S. Addison, S. Bradley, P.M. Bagley, P. Gray, C. Yau, J.-F. Rolin, J. Blandin, J. Legrand, A. Cremer , U. Witte, O
Western Indian Ocean Journal of Marine Science - Vol 9, No 1 (2010)
African Journals Online (AJOL)
Coastal Marine Pollution in Dar es Salaam (Tanzania) relative to Recommended Environmental Quality Targets for the Western Indian Ocean · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JF Machiwa, 17-30 ...
African Journals Online (AJOL)
Forty-three patients completed the study (54%). There were no significant ..... Miles JF, Tunnicliffe W, Cayton RM, Ayser JG, Miller MR. Potential effects of ... Cape region, the east coast of Africa and the oceanic islands such as Mauritius; and ...
Czech Academy of Sciences Publication Activity Database
Taraněnko, L.; Janouch, František; Owsiacki, L.
2001-01-01
Roč. 61, 3/6 (2001), s. 795-796 ISSN 0969-806X R&D Projects: GA AV ČR KSK2067107 Keywords : Ukrainian nuclear facilities * nuclear data bank Subject RIV: JF - Nuclear Energetics Impact factor: 0.819, year: 2001
South African Journal of Chemistry - Vol 55 (2002)
African Journals Online (AJOL)
On-line Determination of Hydrochloric Acid in Process Effluent Streams by Potentiometric Sequential Injection Acid-Base Titration · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JF Van Staden, MG Mashamba, RI Stefan ...
South African Journal for Research in Sport, Physical Education and ...
African Journals Online (AJOL)
F.F. Coetzee, T. McDonald, J.F. Kilian, 17-28 ... Cognitive strategies used by marathoners in each quartile of a training run · EMAIL FULL TEXT EMAIL FULL TEXT ... Application of relationship marketing in non-profit organisations involved in ...
Základy fúzní energetiky II - Základní fyzika fúzních reaktorů
Czech Academy of Sciences Publication Activity Database
Entler, Slavomír; Mlynář, Jan; Dostál, V.
Srpen (2016), č. článku 14538. ISSN 1801-4399 Institutional support: RVO:61389021 Keywords : Nuclear fusion * fusion reactors * plasma Subject RIV: JF - Nuclear Energetics http://energetika.tzb-info.cz/elektroenergetika/14538-zaklady-fuzni-energetiky-ii-zakladni-fyzika-fuznich-reaktoru
A novel CYP1A1 gene polymorphism and the risk of head and neck ...
African Journals Online (AJOL)
Administrator
2011-06-15
Jun 15, 2011 ... 5274 Afr. J. Biotechnol. The principal enzymes ..... Amalio T, Paul I, Francine M, Tobias S, Thomas B (1993). Direct, automated .... Olshan A, Weissler M, Watson MA, Bell D (2000). GSTM1, GSTT1, ... Jr. JF, editors. Cancer ...
Ultrastructure and lectin characterization of granular salivary cells from Ixodes ricinus females
Czech Academy of Sciences Publication Activity Database
Vancová, Marie; Zacharovová, Klára; Grubhoffer, Libor; Nebesářová, Jana
2006-01-01
Roč. 92, č. 3 (2006), s. 431-440 ISSN 0022-3395 R&D Projects: GA ČR GA206/03/1323 Institutional research plan: CEZ:AV0Z60220518 Keywords : Ixodes ricinus * salivary glands * lectin labeling Subject RIV: EE - Microbiology, Virology Impact factor: 1.300, year: 2006
Twelve single nucleotide polymorphisms on chromosome 19q13.2-13.3
DEFF Research Database (Denmark)
Yin, Jiaoyang; Vogel, Ulla; Gerdes, Lars Ulrik
2003-01-01
The genetic susceptibility to basal cell carcinoma (BCC) among Danish psoriatic patients was investigated in association studies with 12 single nucleotide polymorphisms on chromosome 19q13.2-3. The results show a significant association between BCC and the A-allele of a polymorphism in ERCCI exon4...
75 FR 41180 - Notice of Order: Revisions to Enterprise Public Use Database
2010-07-15
.... This responsibility to maintain a public use database (PUDB) for such mortgage data was transferred to... FEDERAL HOUSING FINANCE AGENCY [No. 2010-N-10] Notice of Order: Revisions to Enterprise Public Use Database AGENCY: Federal Housing Finance Agency. ACTION: Notice of order. SUMMARY: Section 1323(a)(1) of...
Czech Academy of Sciences Publication Activity Database
López-Aparicio, S.; Smolík, Jiří; Mašková, Ludmila; Součková, M.; Grøntoft, T.; Ondráčková, Lucie; Stankiewicz, J.
2011-01-01
Roč. 46, č. 7 (2011), s. 1460-1468 ISSN 0360-1323 Grant - others:MF NF(CZ) A/CZ0046/2/0001 Institutional research plan: CEZ:AV0Z40720504 Keywords : indoor/outdoor ration * natural ventilation * ammonia Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.400, year: 2011
Plugging criteria for WWER SG tubes
Energy Technology Data Exchange (ETDEWEB)
Papp, L.; Wilam, M. [Vitkovice NPP Services (Switzerland); Herman, M. [Vuje, Trnava (Slovakia)
1997-12-31
At operated Czech and Slovak nuclear power plants the 80 % criteria for crack or other bulk defect depth is used for steam generator heat exchanging tubes plugging. This criteria was accepted as the recommendation of designer of WWER steam generators. Verification of this criteria was the objective of experimental program performed by Vitkovice, J.S.C., UJV Rez, J.S.C. and Vuje Trnava, J.S.C .. Within this program the following factors were studied: (1) Influence of secondary water chemistry on defects initiation and propagation, (2) Statistical evaluation of corrosion defects progression at operated SG, and (3) Determination of critical pressure for tube rupture as a function of eddy current indications. In this presentation items (2) and (3) are considered.
Plugging criteria for WWER SG tubes
Energy Technology Data Exchange (ETDEWEB)
Papp, L; Wilam, M [Vitkovice NPP Services (Switzerland); Herman, M [Vuje, Trnava (Slovakia)
1998-12-31
At operated Czech and Slovak nuclear power plants the 80 % criteria for crack or other bulk defect depth is used for steam generator heat exchanging tubes plugging. This criteria was accepted as the recommendation of designer of WWER steam generators. Verification of this criteria was the objective of experimental program performed by Vitkovice, J.S.C., UJV Rez, J.S.C. and Vuje Trnava, J.S.C .. Within this program the following factors were studied: (1) Influence of secondary water chemistry on defects initiation and propagation, (2) Statistical evaluation of corrosion defects progression at operated SG, and (3) Determination of critical pressure for tube rupture as a function of eddy current indications. In this presentation items (2) and (3) are considered.
System Requirements Document for the Molten Salt Reactor Experiment
Energy Technology Data Exchange (ETDEWEB)
Aigner, R.D.
2000-04-01
The purpose of the conversion process is to convert the {sup 233}U fluoride compounds that are being extracted from the Molten Salt Reactor Experiment (MSRE) equipment to a stable oxide for long-term storage at Bldg. 3019.
Academic Training; Tel. 73127
2001-01-01
19, 20, 21, 22 and 23 February REGULAR LECTURE PROGRAMME From 11:00 hrs - 19, 20 and 21 February Main Auditorium bldg. 500, 22 and 23 February Council Chamber, bldg 503 Introduction to Cryogenic Engineering J.G. Weisend / SLAC, Stanford, USA Cryogenic engineering is an important speciality at CERN. With the construction of LHC, this technology will have an even greater impact on machine operations. The goal of the course is to give people not working in cryogenics an appreciation of the basic principals and problems associated with the field. The course will also provide a foundation for future learning in cryogenics. Topics to be covered will include: properties of cryogenic fluids and materials, refrigeration, cryostat design, instrumentation, safety and propertiesof He II. Examples of working cryogenic systems, many of them from high energy physics, will be presented.
Test Procedure - pumping system for caustic addition project
International Nuclear Information System (INIS)
Leshikar, G.A.
1994-01-01
This test procedure provides the requirements for sub-system testing and integrated operational testing of the submersible mixer pump and caustic addition equipment by WHC and Kaiser personnel at the Rotating Equipment Shop run-in pit (Bldg. 272E)
Astronaut Neil Armstrong participates in simulation of moon's surface
1969-01-01
Astronaut Neil A. Armstrong, wearing an Extravehicular Mobility Unit, deploys a lunar surface television camera during lunar surface simulation training in bldg 9, Manned Spacecraft Center. Armstrong is the prime crew commander of the Apollo 11 lunar landing mission.
Public Relations for Principals. "A Guidebook for the Pennsylvania Administrator."
Pennsylvania School Boards Association, Inc., Harrisburg.
This report discusses what makes news, what people want to read, and how to write news releases or other informative bulletins and brochures. Also included are a description of principal-reporter-editor relations, some layout and typography data, and photography instructions. (JF)
Základy fúzní energetiky IV. – Jaderné komponenty
Czech Academy of Sciences Publication Activity Database
Entler, Slavomír; Mlynář, Jan; Dostál, V.
Září (2016), č. článku 14669. ISSN 1801-4399 Institutional support: RVO:61389021 Keywords : Fusion Energy * Nuclear technology * plasma * ITER Subject RIV: JF - Nuclear Energetics http://energetika.tzb-info.cz/elektroenergetika/14669-zaklady-fuzni-energetiky-iv-jaderne-komponenty
Year-round School Makes Good Business Sense, Says This Boardman-Businessman
Howe, Paul H.
1973-01-01
Argues that year-round schools make good business sense by providing (1) a more efficient use of capital investments, (2) an alleviation of uneconomical and undesirable peaks in working and recreation, and (3) a more sensible way of looking at teacher salaries. (JF)
Houston, W. Robert; Howsam, Robert B.
1974-01-01
A heated controversy occurred when the Texas State Board of Education mandated competency based teacher education (CBTE) for all of the State's 66 teacher preparatory institutions. This is an account of developments in Texas by two major proponents of CBTE. (Author/JF)
Quaestiones Mathematicae - Vol 40, No 5 (2017)
African Journals Online (AJOL)
Completion of a fractal structure · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. J.F. Gálvez-Rodríguez, M.A. Sánchez-Granero, 679-695. http://dx.doi.org/10.2989/16073606.2017.1307285 ...
CSIR Research Space (South Africa)
Oberholster, Paul
2013-05-01
Full Text Available review of laboratory studies. Water, 574 Air, & Soil Pollution 60, 135-148. 575 Ludwig J.A., Reynolds J.F., 1988. Statistical ecology. John Wiley and Sons, New York. 576 Margalef R., 1951. Diversidad de especies en las comunidades naturales...
Biezeno en de mechanica - Herdenkingsdag 14 mei 1976.
Biezeno, C.B.; Geerlings, J.J.P.; Haringx, J.A.; Meijers, P.; Van der Neut, A.
1976-01-01
Presentations at a symposium commemorating the death of prof.dr.ir. C.B. Biezeno on 5 September 1975. Presentations by prof. A. van der Neut, prof. R.G. Boiten, prof. W.T. Koiter, prof. J.P. den Hartog, and prof. J.F. Besseling.
Základy fúzní energetiky V. – Výroba elektřiny
Czech Academy of Sciences Publication Activity Database
Entler, Slavomír; Mlynář, Jan; Dostál, V.
Září (2016), č. článku 14704. ISSN 1801-4399 Institutional support: RVO:61389021 Keywords : Production of electricity * Fusion Energy * Nuclear fusion Subject RIV: JF - Nuclear Energetics http://energetika.tzb-info.cz/elektroenergetika/14704-zaklady-fuzni-energetiky-v-vyroba-elektriny
The challenge of the social sciences: The impact of Sociology ...
African Journals Online (AJOL)
The challenge of the social sciences: The impact of Sociology among first year students. JF Graaff. Abstract. No Abstract. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Article Metrics. Metrics Loading ... Metrics powered by PLOS ALM
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. R Divakar. Articles written in Bulletin of Materials Science. Volume 36 Issue 7 December 2013 pp 1323-1329. Structural characterization of electrodeposited boron · Ashish Jain C Ghosh T R Ravindran S Anthonysamy R Divakar E Mohandas G S Gupta · More Details Abstract ...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. C Ghosh. Articles written in Bulletin of Materials Science. Volume 36 Issue 7 December 2013 pp 1323-1329. Structural characterization of electrodeposited boron · Ashish Jain C Ghosh T R Ravindran S Anthonysamy R Divakar E Mohandas G S Gupta · More Details Abstract ...
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. T R Ravindran. Articles written in Bulletin of Materials Science. Volume 36 Issue 7 December 2013 pp 1323-1329. Structural characterization of electrodeposited boron · Ashish Jain C Ghosh T R Ravindran S Anthonysamy R Divakar E Mohandas G S Gupta · More Details ...
Czech Academy of Sciences Publication Activity Database
Humpolíková Adámková, L.; Kovařík, J.; Dušek, L.; Lauerová, L.; Boudný, V.; Fait, V.; Fojtová, Miloslava; Krejčí, E.; Kovařík, Aleš
2009-01-01
Roč. 45, - (2009), s. 1315-1323 ISSN 0959-8049 Grant - others:GA ČR(CZ) GA301/06/0912 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : malignant melanoma * interferons * STAT3 activation Subject RIV: BO - Biophysics Impact factor: 4.121, year: 2009
2013-12-26
... posted to the Region 5 Web site at http://www.fs.usda.gov/main/r5/landmanagement/planning . The Forest..., U.S. Forest Service, Ecosystem Planning Staff, 1323 Club Drive, Vallejo, CA 94592. Comments or...-8823. Individuals who use telecommunication devices for the deaf (TDD) may call the Federal Information...
Astronaut John Grunsfeld during EVA training in the WETF
1995-01-01
Astronaut John M. Grunsfeld, STS-67 mission specialist, gives a salute as he is about to be submerged in a 25-feet deep pool in JSC's Weightless Environment Training Facility (WETF). Wearing a special training version of the Extravehicular Mobility Unit (EMU) space suit and assisted by several JSC SCUBA-equipped divers, Grunsfeld was later using the pool to rehearse contingency space walk chores.
76 FR 10610 - Federal Property Suitable as Facilities To Assist the Homeless
2011-02-25
... Force Property Number: 18200820001 Status: Unutilized Reasons: Secured Area Bldg. 3224 Eielson AFB Eielson AK 99702 Landholding Agency: Air Force Property Number: 18200820002 Status: Unutilized Reasons: Secured Area, Extensive deterioration Bldgs. 1437, 1190, 2375 Eielson AFB Eielson AK [[Page 10613...
75 FR 54236 - Federal Property Suitable as Facilities To Assist the Homeless
2010-09-03
...: Secured Area Bldg. 3224 Eielson AFB Eielson AK 99702 Landholding Agency: Air Force Property Number: 18200820002 Status: Unutilized Reasons: Extensive deterioration, Secured Area Bldgs. 1437, 1190, 2375 Eielson AFB Eielson AK Landholding Agency: Air Force Property Number: 18200830001 Status: Unutilized Reasons...
Software Engineering for Human Spaceflight
Fredrickson, Steven E.
2014-01-01
The Spacecraft Software Engineering Branch of NASA Johnson Space Center (JSC) provides world-class products, leadership, and technical expertise in software engineering, processes, technology, and systems management for human spaceflight. The branch contributes to major NASA programs (e.g. ISS, MPCV/Orion) with in-house software development and prime contractor oversight, and maintains the JSC Engineering Directorate CMMI rating for flight software development. Software engineering teams work with hardware developers, mission planners, and system operators to integrate flight vehicles, habitats, robotics, and other spacecraft elements. They seek to infuse automation and autonomy into missions, and apply new technologies to flight processor and computational architectures. This presentation will provide an overview of key software-related projects, software methodologies and tools, and technology pursuits of interest to the JSC Spacecraft Software Engineering Branch.
Energy Systems Test Area (ESTA) Pyrotechnic Operations: User Test Planning Guide
Hacker, Scott
2012-01-01
The Johnson Space Center (JSC) has created and refined innovative analysis, design, development, and testing techniques that have been demonstrated in all phases of spaceflight. JSC is uniquely positioned to apply this expertise to components, systems, and vehicles that operate in remote or harsh environments. We offer a highly skilled workforce, unique facilities, flexible project management, and a proven management system. The purpose of this guide is to acquaint Test Requesters with the requirements for test, analysis, or simulation services at JSC. The guide includes facility services and capabilities, inputs required by the facility, major milestones, a roadmap of the facility s process, and roles and responsibilities of the facility and the requester. Samples of deliverables, facility interfaces, and inputs necessary to define the cost and schedule are included as appendices to the guide.
Bannerot, Richard B.; Goldstein, Stanley H.
1989-01-01
The 1988 Johnson Space Center (JSC) National Aeronautics and Space Administration (NASA)/American Society for Engineering Education (ASEE) Summer Faculty Fellowship Program was conducted by the University of Houston and JCS. The 10-week program was operated under the auspices of the ASEE. The program at JSC, as well as the programs at other NASA Centers, was funded by the Office of University Affairs, NASA Headquarters, Washington, D.C. The objectives of the program, which began in 1965 at JSC and in 1964 nationally, are: (1) to further the professional knowledge of qualified engineering and science faculty members; (2) to stimulate an exchange of ideas between participants and NASA; (3) to enrich and refresh the research and teaching activities of participants' institutions; and (4) to contribute to the research objectives of the NASA Centers.
Hikida, Takuji; Yamaguchi, Masaru; Shimizu, Mami; Kikuta, Jun; Yoshino, Tomokazu; Kasai, Kazutaka
2016-07-01
Root mobility due to reciprocating movement of the tooth (jiggling) may exacerbate orthodontic root resorption (ORR). "Jiggling" describes mesiodistal or buccolingual movement of the roots of the teeth during orthodontic treatment. In the present study, buccolingual movement is described as "jiggling." We aimed to investigate the relationship between ORR and jiggling and to test for positive cell expression in odontoclasts in resorbed roots during experimental tooth movement (jiggling) in vivo. Male Wistar rats were divided into control, heavy force (HF), optimal force (OF), and jiggling force (JF) groups. The expression levels of cathepsin K, matrix metalloproteinase (MMP)-9 protein, interleukin (IL)-6, cytokine-induced neutrophil chemoattractant 1 (CINC-1; an IL-8-related protein in rodents), receptor activator of nuclear factor κB ligand (RANKL), and osteoprotegerin protein in the dental root were determined using immunohistochemistry. On day 21, a greater number of root resorption lacunae, which contained multinucleated odontoclasts, were observed in the palatal roots of rats in the JF group than in rats from other groups. Furthermore, there was a significant increase in the numbers of cathepsin K-positive and MMP-9-positive odontoclasts in the JF group on day 21. Immunoreactivities for IL-6, CINC-1, and RANKL were stronger in resorbed roots exposed to jiggling than in the other groups on day 21. Negative reactivity was observed in the controls. These results suggest that jiggling may induce ORR via inflammatory cytokine production during orthodontic tooth movement, and that jiggling may be a risk factor for ORR.
40 CFR 86.1323-2007 - Oxides of nitrogen analyzer calibration.
2010-07-01
... check described in this section shall be performed on CLD NOX analyzers. CO2 and water vapor interfere with the response of a CLD by collisional quenching. The combined quench effect at their highest.... After the %CO2 measurement, measure the NO concentration at the gas divider outlet with the CLD analyzer...
JSC Wireless Sensor Network Update
Wagner, Robert
2010-01-01
Sensor nodes composed of three basic components... radio module: COTS radio module implementing standardized WSN protocol; treated as WSN modem by main board main board: contains application processor (TI MSP430 microcontroller), memory, power supply; responsible for sensor data acquisition, pre-processing, and task scheduling; re-used in every application with growing library of embedded C code sensor card: contains application-specific sensors, data conditioning hardware, and any advanced hardware not built into main board (DSPs, faster A/D, etc.); requires (re-) development for each application.
JSC Human Life Sciences Project
1998-01-01
This section of the Life and Microgravity Spacelab (LMS) publication includes articles entitled: (1) E029 - Magnetic Resonance Imaging after Exposure to Microgravity; (2) E030 - Extended Studies of Pulmonary Function in Weightlessness; (3) E074 - Direct Measurement of the Initial Bone Response to Spaceflight in Humans; (4) E401 - The Effects of Microgravity on Skeletal Muscle Contractile Properties; (5) E407 - Effects of Microgravity on the Biochemical and Bioenergetic Characteristics of Human Skeletal Muscle; (6) E410 - Torso Rotation Experiment; (7) E920 - Effect of Weightlessness on Human Single Muscle Fiber Function; (8) E948 - Human Sleep, Circadian Rhythms and Performance in Space; (9) E963 - Microgravity Effects on Standardized Cognitive Performance Measures; and (10) E971 - Measurement of Energy Expenditures During Spaceflight Using the Doubly Labeled Water Method
How Instructional Systems Will Manage Learning
Flanagan, John C.
1970-01-01
Discusses trends toward the systems approach in education including the development of effective instructional systems in government and industry; the introduction of teaching machines, programed learning, and computer- assisted instruction; and the increase in both the amount and sophistication of educational research and development. (JF)
Digital Repository Service at National Institute of Oceanography (India)
Quadros, G.; Sukumaran, S.; Athalye, R.P.
of Bombay, India. Part I: quantification of heavy metal pollution of aquatic sediments and recogni- tion of environmental discriminants. Chem Geol 90:263– 283. doi:10.1016/0009-2541(91)90104-Y Sanders HL, Grassle JF, Hampson GR, Morse LS, Garner Price S...
1988-04-01
dyspnea, dysphagia , and urinary incontinence. 2 6 Although the muscular rigidity and hyperthermia are reminiscent of malignant hyperthermia, the putative...401, 1986. 106. Litman, R.E.: Heatstroke in parkinsonism . Arch Int Med, 89:562- 567, 1952. 107. Logue, R.B., Hanson, J.F.: Electrocardiographic
Laser coating of zirconium and ZrO(sub2) composites on Ti(sub6)Al(sub4)V for biomedical applications
CSIR Research Space (South Africa)
Baloyi, NM
2014-05-01
Full Text Available , pp 234–256. [21] Piconi, C. & Maccauro, G. 1999. Zirconia as a ceramic biomaterial, Biomaterials, 20, p 125. [22] Baklouti, S., Bouaziz, J., Chartier, T. & Baumard, J.-F. 2001. Binder burnout and evolution of the mechanical strength of dry pressed...
Review of HIV Pre exposure prophylaxis (PrEP) and example of HIV PrEP Toolkit
2017-08-28
at Initiation of Sexual Activity Correct & Consistent Condom Use Prevention of mother-to- child transmission July 16, 2012: FDA approves...Okulicz JF, Medicine 2016 PrEP Utilization in a Managed Care System (Kaiser Permanente) 1200 ~ 1045 1000 . 800 600 . 400 200 0 835 657 0
Influence of hydratation on the characteristics of zirconium alloys oxide layers
Czech Academy of Sciences Publication Activity Database
Gosmanová, G.; Kraus, I.; Kolega, M.; Vrtílková, V.; Weishauptová, Zuzana
2008-01-01
Roč. 54, č. 1 (2008), s. 1576-1580 ISSN 1210-0471 R&D Projects: GA ČR GA106/04/0043 Institutional research plan: CEZ:AV0Z30460519 Keywords : zirconium alloys * corrosion layer * hydrated ZrO2 Subject RIV: JF - Nuclear Energetics
Recent progress in research on tungsten materials for nuclear fusion applications in Europe
Czech Academy of Sciences Publication Activity Database
Rieth, M.; Dudarev, S.L.; Gonzalez de Vicente, S.M.; Aktaa, J.; Ahlgren, T.; Antusch, S.; Armstrong, D.E.J.; Balden, M.; Baluc, N.; Barthe, M.-F.; Basuki, W.W.; Battabyal, M.; Becquart, C.S.; Blagoeva, N.; Boldyryeva, Hanna; Brinkmann, J.; Celino, M.; Ciupinski, L.; Correia, J.B.; De Backer, A.; Domain, C.; Gaganidze, E.; García-Rosales, C.; Gibson, J.; Gilbert, M.R.; Giusepponi, S.; Gludovatz, B.; Greuner, H.; Heinola, K.; Höschen, T.; Hoffmann, A.; Holstein, A.; Koch, F.; Krauss, W.; Li, H.; Lindig, S.; Linke, J.; Linsmeier, Ch.; López-Ruiz, P.; Maier, H.; Matějíček, Jiří; Mishra, T.P.; Muhammed, M.; Muñoz, A.; Muzyk, M.; Nordlund, K.; Nguyen-Manh, D.; Opschoor, J.; Ordás, N.; Palacios, Y.; Pintsuk, G.; Pippan, R.; Reiser, J.; Riesch, J.; Roberts, S. G.; Romaner, L.; Rosiński, M.; Sanchez, M.; Schulmeyer, W.; Traxler, H.; Ureña, G.; van der Laan, J.G.; Veleva, L.; Wahlberg, S.; Walter, M.; Weber, T.; Weitkamp, T.; Wurster, S.; Yar, M.A.; You, J.H.; Zivelonghi, A.
2013-01-01
Roč. 432, 1-3 (2013), s. 482-500 ISSN 0022-3115 Institutional support: RVO:61389021 Keywords : tungsten * joining * composites * graded materials * fusion materials Subject RIV: JF - Nuclear Energetics Impact factor: 2.016, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022311512004278
Tort Liability of School Districts, Officers, and Employees
Knowles, Laurence
1972-01-01
Discusses the tactics of tort litigation in the public area, and outlines 1972 State and Federal court cases involving such tort liability issues as (1) governmental immunity, (2) negligence and foreseeability, (3) assumption of risk, (4) contributory negligence, and (5) independent intervening cause. (JF)
Rhetoric and Truth: A Note on Aristotle, Rhetoric 1355a 21-24
Grimaldi, William M. A.
1978-01-01
A passage from Aristotle is discussed and interpreted. Rhetoric represents truth and justice in any situation for the auditor through the use of language. The usefulness of rhetoric lies in its ability to assure an adequate and competent articulation of truth and justice. (JF)
Rhetoric and Essentially Contested Arguments
Garver, Eugene
1978-01-01
Draws a connection between Gallie's essentially contested concepts and Aristotle's account of rhetorical argument by presenting a definition of Essentially Contested Argument which is used as the connecting term between rhetoric and essentially contested concepts and by demonstrating the value of making this connection. (JF)
Quick Reference Guide for IRB submission at Air Command and Staff College
2009-04-01
Description, Validation, and Application. (Ed) Lubar J.F., Haworth Press, New York. 2004; 1-29. Cronbach, L. Test Validation, In: R. Thorndike (ed...Test Validation, In: R. Thorndike (ed.) Educational Measurement. Washington, DC, American Council on Education. 2005; 443-507. Duff, J. The Usefulness
Diffusion of particles adsorbed on reconstructive surface
Czech Academy of Sciences Publication Activity Database
Tarasenko A., Nataliya; Tarasenko, Alexander; Jastrabík, Lubomír
2005-01-01
Roč. 11, č. 1 (2005), s. 485-489 ISSN 0929-5607 R&D Projects: GA MŠk LN00A015 Institutional research plan: CEZ:AV0Z10100522 Keywords : lattice gas * surface reconstruction * surface diffusion * phase transitions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.323, year: 2005
Indian Academy of Sciences (India)
Home; Journals; Bulletin of Materials Science. G S Gupta. Articles written in Bulletin of Materials Science. Volume 36 Issue 7 December 2013 pp 1323-1329. Structural characterization of electrodeposited boron · Ashish Jain C Ghosh T R Ravindran S Anthonysamy R Divakar E Mohandas G S Gupta · More Details Abstract ...
2017-05-12
2454 (2015). 412 16. Blackley, D.J., et al. Reduced evolutionary rate in reemerged Ebola virus 413 transmission chains. Sci Adv 2, e1600378 (2016). 414...and Marburgvirus Infections. in Harrison’s Principles of 456 Internal Medicine , Vol. 2 (eds. Kasper, D.L., et al.) 1323-1329 (McGraw-Hill 457
Babb, Jeff
2005-01-01
This paper examines the mathematical work of the French bishop, Nicole Oresme (c. 1323-1382), and his contributions towards the development of the concept of graphing functions and approaches to investigating infinite series. The historical importance and pedagogical value of his work will be considered in the context of an undergraduate course on…
A Flipped Classroom Redesign in General Chemistry
Reid, Scott A.
2016-01-01
The flipped classroom continues to attract significant attention in higher education. Building upon our recent parallel controlled study of the flipped classroom in a second-term general chemistry course ("J. Chem. Educ.," 2016, 93, 13-23), here we report on a redesign of the flipped course aimed at scaling up total enrollment while…
Gender composition of college graduates by field of study and early fertility
Czech Academy of Sciences Publication Activity Database
Bičáková, Alena; Jurajda, Štěpán
2017-01-01
Roč. 15, č. 4 (2017), s. 1323-1343 ISSN 1569-5239 R&D Projects: GA ČR(CZ) GBP402/12/G130 Institutional support: RVO:67985998 Keywords : field-of-study gender segregation * college graduates * fertility Subject RIV: AH - Economics OBOR OECD: Applied Economics , Econometrics Impact factor: 0.972, year: 2016
Nondestructive inspection of ductile cast iron by measurement of minor magnetic hysteresis loops
Czech Academy of Sciences Publication Activity Database
Vértesy, G.; Uchimoto, T.; Takagi, T.; Tomáš, Ivan
2010-01-01
Roč. 659, č. 9 (2010), 355-360 ISSN 0255-5476 R&D Projects: GA ČR GA101/09/1323; GA AV ČR 1QS100100508 Institutional research plan: CEZ:AV0Z10100520 Keywords : magnetic NDE * magnetic adaptive testing * cast iron * magnetic hysteresis Subject RIV: BM - Solid Matter Physics ; Magnetism
Gene : CBRC-ACAR-01-0755 [SEVENS
Lifescience Database Archive (English)
Full Text Available tical protein FLJ13236 [Homo sapiens] gb|AAH33236.1| Hypothetical protein FLJ13236 [Homo sapiens] gb|EAW5806...6.1| hypothetical protein FLJ13236, isoform CRA_a [Homo sapiens] gb|EAW58067.1| hypothetical protein FLJ1323...LGGPVGLHHLYLGRDNHALLWMLTLGGFGFGWLWELWMLPGWVAQANHPLEKRHNDPPSFNPVRFLGQALVGIYFGLVALVGLSTLPGFYILALPLAVGLGVHLVSAVGNQTSDLQATLMAAFVTAPI...6, isoform CRA_a [Homo sapiens] 2e-95 61% MWDATFYYSFLLRTSASQQDVPPFTVMAKRLLVAVAFWA
77 FR 14411 - Federal Property Suitable as Facilities To Assist the Homeless
2012-03-09
... Energy, Office of Engineering & Construction Management, MA-50, 1000 Independence Ave. SW., Washington... Landholding Agency: Air Force Property Number: 18201210016 Status: Underutilized Directions: 1076 Jack's...: 1077 Jack's Valley Rd. Comments: 512 sq. ft.; current use: vacant; bldg. has no heat Kitchen Center...
75 FR 14612 - Federal Property Suitable as Facilities To Assist the Homeless
2010-03-26
... Reasons: Secured Area Bldg. 3224 Eielson AFB Eielson, AK 99702 Landholding Agency: Air Force Property.... 1437, 1190, 2375 Eielson, AFB Eielson AK Landholding Agency: Air Force Property Number: 18200830001 Status: Unutilized Reasons: Secured Area Extensive deterioration 5 Bldgs. Eielson, AFB Eielson AK...
Françoise Benz
2002-01-01
12, 13, 14, March LECTURE SERIES from 11.00 to 12.00 hrs - Auditorium, bldg. 500 POSTPONED! - Modern Project Management Methods - POSTPONED! By G. Vallet / Ed. Highware, Paris, F. Academic Training Françoise Benz Secretariat Tel. 73127 francoise.benz@cern.ch
FERMI: A Flexible Expert Reasoner with Multi-Domain Inferencing.
1985-07-29
for Life Sciences University of Leyden AFOSR Education Research Center Boiling AFB Boerhaavelaan 2 Washington. DC 20032-6448 2334 EN Leyden The... Kathleen McKeown Columbia University Dr. Michael Levine Department of Computer Science Educational Psychology New York, NY 10027 210 Education Bldg
75 FR 10347 - Federal Property Suitable as Facilities To Assist the Homeless
2010-03-05
... plan, existing sanitary facilities, exact street address), providers should contact the appropriate... story stone structure, no sanitary or heating facilities, Natl Register of Historic Places Bldg. 10 VA..., State Hwy 52 Celina Co: Clay TN 38551 Landholding Agency: COE Property Number: 31199140006 Status...
2010-06-24
... Conservation Seat and Diving Operations Seat for the Flower Garden Banks National Marine Sanctuary Advisory... Flower Garden Banks National Marine Sanctuary Advisory Council: Conservation and Diving Operations... Jennifer Morgan, NOAA--Flower Garden Banks National Marine Sanctuary, 4700 Avenue U, Bldg. 216, Galveston...
78 FR 63970 - Proposed Collection; Comment Request
2013-10-25
... information is necessary for the proper performance of the functions of the agency, including whether the... proposed information collection; (c) ways to enhance the quality, utility, and clarity of the information... Deployment and Distribution Command, 709 Ward Drive, Bldg. 1990, [[Page 63971
Apollo Lunar Sample Photographs: Digitizing the Moon Rock Collection
Lofgren, Gary E.; Todd, Nancy S.; Runco, S. K.; Stefanov, W. L.
2011-01-01
The Acquisition and Curation Office at JSC has undertaken a 4-year data restoration project effort for the lunar science community funded by the LASER program (Lunar Advanced Science and Exploration Research) to digitize photographs of the Apollo lunar rock samples and create high resolution digital images. These sample photographs are not easily accessible outside of JSC, and currently exist only on degradable film in the Curation Data Storage Facility
Academic Training: Practical Statistics for Particle Physicists
2006-01-01
2006-2007 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 9, 10, 11, 12, 13 October from 11:00 to 12:00 - Main Auditorium, bldg. 500, TH Auditorium, bldg 4, 3rd floor, on 13 October Practical Statistics for Particle Physicists L. LYONS, University of Oxford, GB Lecture 1: Learning to love the errror matrix Introductory remarks. Conditional probability. Statistical and systematic errors. Combining results Binomial, Poisson and 1-D Gaussian 2-D Gaussian and the error matrix. Understanding the covariance. Using the error matrix. Estimating the error matrix. Combining correlated measurements Lecture 2: Parameter determination by likelihood: Do's and don'ts Introduction to likelihood. Error estimate. Simple examples: (1) Breit Wigner (2) Lifetime binned and unbinned likelihood several parameters extended maximum likelihood. Common misapprehensions: Normalisation delta(lnL) = 1/2 rule and coverage Integrating the likelihood Unbinned L_max as goodness of fit Punzi effect Lecture 3: Chi-squared and hypothesis test...
Turci, Francesco; Corazzari, Ingrid; Alberto, Gabriele; Martra, Gianmario; Fubini, Bice
2015-05-01
Lunar dust toxicity has to be evaluated in view of future manned missions to the Moon. Previous studies on lunar specimens and simulated dusts have revealed an oxidant activity assigned to HO· release. However, the mechanisms behind the reactivity of lunar dust are still quite unclear at the molecular level. In the present study, a complementary set of tests--including terephthalate (TA) hydroxylation, free radical release as measured by means of the spin-trapping/electron paramagnetic resonance (EPR) technique, and cell-free lipoperoxidation--is proposed to investigate the reactions induced by the fine fraction of a lunar dust analogue (JSC-1A-vf) in biologically relevant experimental environments. Our study proved that JSC-1A-vf is able to hydroxylate TA also in anaerobic conditions, which indicates that molecular oxygen is not involved in such a reaction. Spin-trapping/EPR measures showed that the HO· radical is not the reactive intermediate involved in the oxidative potential of JSC-1A-vf. A surface reactivity implying a redox cycle of phosphate-complexed iron via a Fe(IV) state is proposed. The role of this iron species was investigated by assessing the reactivity of JSC-1A-vf toward hydrogen peroxide (Fenton-like activity), formate ions (homolytic rupture of C-H bond), and linoleic acid (cell-free lipoperoxidation). JSC-1A-vf was active in all tests, confirming that redox centers of transition metal ions on the surface of the dust may be responsible for dust reactivity and that the TA assay may be a useful field probe to monitor the surface oxidative potential of lunar dust.
Feasibility Investigation for a Solar Power Generation Facility
Nathan, Lakshmi
2010-01-01
The Energy Policy Act of 2005 states that by fiscal year 2013, at least 7.5% of the energy consumed by the government must be renewable energy. In an effort to help meet this goal, Johnson Space Center (JSC) is considering installing a solar power generation facility. The purpose of this project is to conduct a feasibility investigation for such a facility. Because Kennedy Space Center (KSC) has a solar power generation facility, the first step in this investigation is to learn about KSC's facility and obtain information on how it was constructed. After collecting this information, the following must be determined: the amount of power desired, the size of the facility, potential locations for it, and estimated construction and maintenance costs. Contacts with JSC's energy provider must also be established to determine if a partnership would be agreeable to both parties. Lastly, all of this data must be analyzed to decide whether or not JSC should construct the facility. The results from analyzing the data collected indicate that a 200 kW facility would provide enough energy to meet 1% of JSC's energy demand. This facility would require less than 1 acre of land. In the map below, potential locations are shown in green. The solar power facility is projected to cost $2 M. So far, the information collected indicates that such a facility could be constructed. The next steps in this investigation include contacting JSC's energy provider, CenterPoint Energy, to discuss entering a partnership; developing a life cycle cost analysis to determine payback time; developing more detailed plans; and securing funding.
Regular, dependable, mechanical - J.F. Struensee and the mechanical state (1770-1772)
DEFF Research Database (Denmark)
Lassen, Frank Beck
2009-01-01
orders was to reform the central administration thus creating a truly enlightened regime. Reforms inspired by a quite unsystematic combination of French materialism and Prussian cameralism were initiated to promote regularity and swiftness within and between the different departments...... of the administration. As part of the attempt to legitimize such an enterprise, the metaphor of the machine was invoked - if not frequently then at least regularly - in order to indicate the general direction of the sometimes impossibly different reforms. Based on theoretical premises first presented by Hans...
Lectin-binding characteristics of a Lyme borreliosis spirochete Borrelia burgdorferi sensu stricto
Czech Academy of Sciences Publication Activity Database
Vancová, M.; Nebesářová, J.; Grubhoffer, Libor
2005-01-01
Roč. 50, č. 3 (2005), s. 229-238 ISSN 0015-5632 R&D Projects: GA ČR GA206/03/1323; GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z60220518 Keywords : Borrelia burgdorferi * electron microscopy * lectin binding Subject RIV: EE - Microbiology, Virology Impact factor: 0.918, year: 2005
Effects of high pressure on the magnetism of ErCo.sub.2./sub..
Czech Academy of Sciences Publication Activity Database
Míšek, M.; Prokleška, J.; Sechovský, V.; Turčinková, D.; Prchal, J.; Kusmartseva, A.F.; Kamenev, K. V.; Kamarád, Jiří
2012-01-01
Roč. 111, č. 7 (2012), "07E132-1"-"07E132-3" ISSN 0021-8979 Institutional research plan: CEZ:AV0Z10100521 Keywords : cobalt alloys * erbium alloys * ferrimagnetic materials * ferromagnetic mataterials * high- pressure effects * magnetic moments * magnetic susceptibility Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.210, year: 2012
Czech Academy of Sciences Publication Activity Database
Sustr, D.; Hlaváček, Antonín; Duschl, C.; Volodkin, D.
2018-01-01
Roč. 122, č. 3 (2018), s. 1323-1333 ISSN 1520-6106 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : fluorescence correlation spectroscopy * laser-scanning microscope * single-particle tracking Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 3.177, year: 2016
Czech Academy of Sciences Publication Activity Database
Sustr, D.; Hlaváček, Antonín; Duschl, C.; Volodkin, D.
2018-01-01
Roč. 122, č. 3 (2018), s. 1323-1333 ISSN 1520-6106 R&D Projects: GA ČR(CZ) GBP206/12/G014 Institutional support: RVO:68081715 Keywords : fluorescence correlation spectroscopy * laser-scanning microscope * single-particle tracking Subject RIV: CB - Analytical Chemistry , Separation OBOR OECD: Analytical chemistry Impact factor: 3.177, year: 2016
Bishop, Peter C.; Erickson, Lloyd
1990-01-01
The Management Information and Decision Support Environment (MIDSE) is a research activity to build and test a prototype of a generic human interface on the Johnson Space Center (JSC) Information Network (CIN). The existing interfaces were developed specifically to support operations rather than the type of data which management could use. The diversity of the many interfaces and their relative difficulty discouraged occasional users from attempting to use them for their purposes. The MIDSE activity approached this problem by designing and building an interface to one JSC data base - the personnel statistics tables of the NASA Personnel and Payroll System (NPPS). The interface was designed against the following requirements: generic (use with any relational NOMAD data base); easy to learn (intuitive operations for new users); easy to use (efficient operations for experienced users); self-documenting (help facility which informs users about the data base structure as well as the operation of the interface); and low maintenance (easy configuration to new applications). A prototype interface entitled the JSC Management Information Systems (JSCMIS) was produced. It resides on CIN/PROFS and is available to JSC management who request it. The interface has passed management review and is ready for early use. Three kinds of data are now available: personnel statistics, personnel register, and plan/actual cost.
Recirkulace výkonu ve fúzních elektrárnách.
Czech Academy of Sciences Publication Activity Database
Entler, Slavomír; Kolovratník, M.; Dostál, V.
2017-01-01
Roč. 67, č. 4 (2017), s. 247-250 ISSN 0375-8842 Grant - others:AV ČR(CZ) StrategieAV21/2 Program:StrategieAV Institutional support: RVO:61389021 Keywords : fusion energy * power recirculation * net efficiency Subject RIV: JF - Nuclear Energetics OBOR OECD: Nuclear related engineering
Effects of Nicotine and Stress on Anxiety-related and Depression-related Behavior in Rats
2014-07-30
mesolimbic dopamine (3). Picciotto et al (46) highlight the ambiguity of nicotine’s relationship with stress suggesting that the drug can either...Toxicology 57:380-6 43. Lewis EM, Barnett JF, Freshwater L, Hoberman AM, Christian MS. 2002. Sexual maturation data for Crl Sprague-Dawley rats
Effect of an oil spill from MV Sea Transporter on intertidal meiofauna at Goa, India
Digital Repository Service at National Institute of Oceanography (India)
Ansari, Z.A.; Ingole, B.S.
–163. Sanders, H.L., Grassle, J.F., Hampson, G.R., Morse, L.S., Garner- Price, S., Jones, C.C., 1980. Anatomyof an oil spill: long-term effects from the grounding of the barge Florida off west Falmouth, Massachusetts. Journal of Marine Research 38, 265...
Influence of protecting gel film on oxidation of zirconium alloys
Czech Academy of Sciences Publication Activity Database
Frank, H.; Weishauptová, Zuzana; Vrtílková, V.
2007-01-01
Roč. 360, č. 3 (2007), s. 282-292 ISSN 0022-3115 R&D Projects: GA ČR GA106/04/0043 Institutional research plan: CEZ:AV0Z30460519 Keywords : fuel cladding * corrosion * Zirconium oxide Subject RIV: JF - Nuclear Energetics Impact factor: 1.643, year: 2007
African Journal of Environmental Science and Technology - Vol 8 ...
African Journals Online (AJOL)
Studies on the effect of simulated acid rain of different pH on the growth response of TMS 419 cultivar of Manihot esculenta (Crantz) · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. BO Odiyi, JF Bamidele, 558-561 ...
MicroRNAs Targeting Caspase-3 and -7 in PANC-1 Cells
Directory of Open Access Journals (Sweden)
Jong Kook Park
2018-04-01
Full Text Available MicroRNAs (miRNAs, a critical part of the RNA silencing machinery, are known to play important regulatory roles in cancer. However, the consequence of miRNA deregulation in cancer is unknown for many miRNAs. Here, we define that miRNAs, miR-17-5p, miR-132-3p/-212-3p, and miR-337-3p are significantly up-regulated in the pancreatic ductal adenocarcinomas (PDAC compared to the normal and benign tissues. Furthermore, by using PANC-1 cells, we demonstrate that overexpressed miR-337-3p and miR-17-5p/miR-132-3p/-212-3p can regulate executioner caspases-3 and -7, respectively. In addition, over-expression of miRNAs, especially miR-337-3p, attenuates tumor necrosis factor-related apoptosis-inducing ligand (TRAIL cytotoxicity in PANC-1 cells. Our findings unveil an important biological function for miRNAs up-regulated in PDAC in coordinately regulating caspases, potentially contributing to the malignant progression of PDAC.
MicroRNAs Targeting Caspase-3 and -7 in PANC-1 Cells.
Park, Jong Kook; Doseff, Andrea I; Schmittgen, Thomas D
2018-04-16
MicroRNAs (miRNAs), a critical part of the RNA silencing machinery, are known to play important regulatory roles in cancer. However, the consequence of miRNA deregulation in cancer is unknown for many miRNAs. Here, we define that miRNAs, miR-17-5p, miR-132-3p/-212-3p, and miR-337-3p are significantly up-regulated in the pancreatic ductal adenocarcinomas (PDAC) compared to the normal and benign tissues. Furthermore, by using PANC-1 cells, we demonstrate that overexpressed miR-337-3p and miR-17-5p/miR-132-3p/-212-3p can regulate executioner caspases-3 and -7, respectively. In addition, over-expression of miRNAs, especially miR-337-3p, attenuates tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) cytotoxicity in PANC-1 cells. Our findings unveil an important biological function for miRNAs up-regulated in PDAC in coordinately regulating caspases, potentially contributing to the malignant progression of PDAC.
Flight Dynamic Simulation of Fighter In the Asymmetric External Store Release Process
Safi’i, Imam; Arifianto, Ony; Nurohman, Chandra
2018-04-01
In the fighter design, it is important to evaluate and analyze the flight dynamic of the aircraft earlier in the development process. One of the case is the dynamics of external store release process. A simulation tool can be used to analyze the fighter/external store system’s dynamics in the preliminary design stage. This paper reports the flight dynamics of Jet Fighter Experiment (JF-1 E) in asymmetric Advance Medium Range Air to Air Missile (AMRAAM) release process through simulations. The JF-1 E and AIM 120 AMRAAAM models are built by using Advanced Aircraft Analysis (AAA) and Missile Datcom software. By using these softwares, the aerodynamic stability and control derivatives can be obtained and used to model the dynamic characteristic of the fighter and the external store. The dynamic system is modeled by using MATLAB/Simulink software. By using this software, both the fighter/external store integration and the external store release process is simulated, and the dynamic of the system can be analyzed.
2012-07-13
... scientific and technological challenges for performance validation of radiation biodosimetry devices. Date... participants (non-FDA employees) is through Bldg. 1 where routine security check procedures will be performed... this document. FDA will do its best to accommodate requests to make public comment. Individuals and...
Marine Microbial Production of Dimethylsulfide From Dissolved Dimethylsulfoniopropionate
1993-02-01
Kirst. 1990. The P3-dimethylsulphonio- propionate (DMSP) content of macroalgae from Antarctica and Southern Chile. Botanica Mar. 33:143-146. 85. Karsten...Oceanography Teaching Bldg. Gifts & Exchanges University of Washington Library Seattle, WA 98195 Bedford Institute of Oceanography Library P.O. Box 1006
Employee Turnover and Absenteeism: A Future Research Agenda.
1981-08-01
Department (NMPC-6) Washington, DC 20350 Naval Training Analysis and Evaluation Group Orlando, FL 32813 Commanding Officer ATTN: TIC , Bldg. 2068 Naval...RD-i Washington, DC 20380 Educacion Advisor Education Center (E031) MCDEC Quantico, VA 22134 Commanding Officer Education Center (E031) MCDZC Quantico
2011-04-01
... and Development (HFM-40), Center for Biologics Evaluation and Research (CBER), Food and Drug... Drug Information, Center for Drug Evaluation and Research, Food and Drug Administration, 10903 New..., Center for Drug Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 51...
2013-03-13
... and Development (HFM-40), Center for Biologics Evaluation and Research, Food and Drug Administration... Drug Information, Center for Drug Evaluation and Research, Food and Drug Administration, 10903 New..., Center for Drug Evaluation and Research, Food and Drug Administration, 10903 New Hampshire Ave., Bldg. 22...
75 FR 60129 - Draft Guidance for Industry and Investigators on Safety Reporting Requirements for...
2010-09-29
...., Bldg. 51, rm. 2201, Silver Spring, MD 20993-0002; or the Office of Communication, Outreach, and...'s ability to review critical safety information, improve safety monitoring of human drug and..., will represent the Agency's current thinking on safety reporting requirements for INDs and BA/BE...
2002-01-01
Monday 4 March, at 10h00 - SL Auditorium, Prévessin, bldg. 864 Radioisotopes in Medicine: Requirements, Production and Application by Gerd-J.BEYER / University Hospital of Geneva, Department of Radiology (see details at page 7 of the Weekly Bulletin nr 10/2002).
75 FR 13347 - Federal Property Suitable as Facilities To Assist the Homeless
2010-03-19
...: 21200130081 Status: Excess Comments: 2024 sq. ft., concrete, poor condition, off-site use only Bldg. 00052... required of contamination, use of respirator required by those entering property, use limitations Illinois... Number: 21199620666 Status: Unutilized Comments: 2000 sq. ft., most recent use--oil storage, needs repair...
Disruption of Methicillin-resistant Staphylococcus aureus Biofilms with Enzymatic Therapeutics
2015-04-29
cultures grown in 50% plasma appeared to form gelatinous clots in the media (data not shown), suggesting FOR OFFICIAL USE ONLY 11 bacteria...Bldg. 500 Silver Spring, MD 20910 10. SPONSOR/MONITOR’S ACRONYM(S) BUMED 11. SPONSOR/MONITOR’S REPORT NUMBER(s) 12. DISTRIBUTION
Views of STS-4 crew during a training session in the SMS
1982-01-01
Views of STS-4 crew during a training session in the Shuttle Mission Simulator (SMS) in bldg 5. Astronauts Thomas K. Mattingly, II. (left) and Henry W. Hartsfield, Jr., commander and pilot respectively for STS-4 get in some training time in the SMS.
Academic Training: Climate change and challenges for the environment / POSTPONED!!!
Françoise Benz
2005-01-01
2004-2005 ACADEMIC TRAINING PROGRAMME LECTURE SERIES 20, 21, 22 June 20, 21, 22 June, from 11:00 to 12:00 â Main Auditorium, bldg. 500 Climate change and challenges for the environment C. SCHLUECHTER / Univ. Bern, CH The Academic Training is postponed.
75 FR 39955 - Homeland Security Science and Technology Advisory Committee
2010-07-13
... Homeland Security Science and Technology Advisory Committee meeting will be open to the public on July 20th... Burse, Science and Technology Directorate, Department of Homeland Security, 245 Murray Lane, Bldg. 410... Protection programs in Science & Technology and updates on homeland security sensitive Federally Funded...
78 FR 45260 - Federal Property Suitable as Facilities To Assist the Homeless
2013-07-26
... bldg., good conditions, contact AF for more info. Land New York FAA Radio Communication Link Adjacent... Landholding Agency: Navy Property Number: 77201330005 Status: Excess Comments: Due to anti-terrorism force... Agency: Navy Property Number: 77201330006 Status: Excess Comments: Due to anti-terrorism/force protection...
77 FR 34056 - Federal Property Suitable as Facilities To Assist the Homeless
2012-06-08
....; communication facility; no utilities; possible ground contamination; need repairs and remediation Bldg. 500 Plum...: Unutilized Comments: 3,519 sf.; communication facility; no utilities; possible contamination; needs repairs... denied due to anti- terrorism & no alternative method to gain access w/out comprising nat'l security...
Associateship | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Fellowship; Associateship. Associate Profile. Period: 2016–2019. Thapa, Dr Ranjit Ph.D. (Jadavpur). Date of birth: 17 September 1982. Specialization: Density Functional Theory, Metal-free Catalyst, Hydrogen Storage, Catalysis & CO Oxidation Address: SRM Research Institute, 13th Floor, Central Lib. Bldg., SRM ...
77 FR 26566 - Federal Property Suitable as Facilities To Assist the Homeless
2012-05-04
....; vacant; poor conditions; need repairs; asbestos & lead; remediation needed; secured area; contact Army re...; usage varies; need repairs; lead and asbestos identified; need remediation Maryland Bldg. 724B Aberdeen...; asbestos & lead identified; need remediation Utah 4 Bldgs. Tooele Army Depot Tooele UT 84074 Landholding...
77 FR 20574 - Notice of Meeting for the Indian Oil Valuation Negotiated Rulemaking Committee
2012-04-05
... representatives from Indian Tribes, individual Indian mineral owner organizations, the oil and gas industry, and... Federal Center, 6th Ave and Kipling, Bldg. 85 Auditorium, Lakewood, Colorado 80225. FOR FURTHER... Lakewood, Colorado. These meetings are conducted under the authority of the Federal Advisory Committee Act...
TRANSFER OF THE SHIPPING IMPORT & EXPORT SECTION (BLDG589)
Division SPL, Groupe Logistique
2000-01-01
With effect from 14 August 2000, the Shipping Import & Export Section will occupy new premises: Building 73 - 1-013 (near Goods Entry D) The telephone numbers will be unchanged. We would like to take this opportunity to apologise for any disruption of services that may arise during the move. Thank you for your understanding.
Assimilating Thor: How Airmen Integrate Weather Prediction
2010-06-01
President Thomas Jefferson, recorded weather observations on his trek across the Continental Divide to the Pacific and back from 1804 to 1806. 13 Army...Vanguard: A History, The NASA Historical Series no. SP-4202 (Washington, D.C.: National Aeronautics and Space Administration, 1970), also available online...still fly with NASA , http://jsc-aircraft- ops.jsc.nasa.gov/wb57/history.html (accessed 30 March 2010). 52 Brandli, ―The Use of Meteorological
Energy Technology Data Exchange (ETDEWEB)
M.J. McInerney; R.M. Knapp; D.P. Nagle, Jr.; Kathleen Duncan; N. Youssef; M.J. Folmsbee; S. Maudgakya
2003-06-26
Biosurfactants enhance hydrocarbon biodegradation by increasing apparent aqueous solubility or affecting the association of the cell with poorly soluble hydrocarbon. Here, we show that a lipopeptide biosurfactant produced by Bacillus mojavensis strain JF-2 mobilized substantial amounts of residual hydrocarbon from sand-packed columns when a viscosifying agent and a low molecular weight alcohol were present. The amount of residual hydrocarbon mobilized depended on the biosurfactant concentration. One pore volume of cell-free culture fluid with 900 mg/l of the biosurfactant, 10 mM 2,3-butanediol and 1000 mg/l of partially hydrolyzed polyacrylamide polymer mobilized 82% of the residual hydrocarbon. Consistent with the high residual oil recoveries, we found that the bio-surfactant lowered the interfacial tension (IFT) between oil and water by nearly 2 orders of magnitude compared to typical IFT values of 28-29 mN/m. Increasing the salinity increased the IFT with or without 2,3-butanediol present. The lowest interfacial tension observed was 0.1 mN/m. The lipopeptide biosurfactant system may be effective in removing hydrocarbon contamination sources in soils and aquifers and for the recovery of entrapped oil from low production oil reservoirs. Previously, we reported that Proteose peptone was necessary for anaerobic growth and biosurfactant production by B. mojavensis JF-2. The data gathered from crude purification of the growth-enhancing factor in Proteose peptone suggested that it consisted of nucleic acids; however, nucleic acid bases, nucleotides or nucleosides did not replace the requirement for Proteose Peptone. Further studies revealed that salmon sperm DNA, herring sperm DNA, Echerichia coli DNA and synthetic DNA replaced the requirement for Proteose peptone. In addition to DNA, amino acids and nitrate were required for anaerobic growth and vitamins further improved growth. We now have a defined medium that can be used to manipulate growth and biosurfactant
BDDC by a frontal solver and the stress computation in a hip joint replacement
Czech Academy of Sciences Publication Activity Database
Šístek, Jakub; Novotný, Jaroslav; Mandel, J.; Čertíková, M.; Burda, P.
2010-01-01
Roč. 80, č. 6 (2010), s. 1310-1323 ISSN 0378-4754 Institutional research plan: CEZ:AV0Z10190503; CEZ:AV0Z20760514 Keywords : domain decomposition * iterative substructuring * finite elements * linear elasticity * parallel algorithms Subject RIV: BA - General Mathematics Impact factor: 0.812, year: 2010 http://www.sciencedirect.com/science/article/pii/S0378475409000044
The influence of heat pre-treatment on the sorption of water vapour on bentonite
Czech Academy of Sciences Publication Activity Database
Mokrejš, P.; Zikánová, Arlette; Hradil, David; Štulík, K.; Pacáková, V.; Kočiřík, Milan; Eić, M.
2005-01-01
Roč. 11, č. 1 (2005), s. 57-63 ISSN 0929-5607 R&D Projects: GA ČR(CZ) GA104/02/1464; GA MŠk(CZ) LN00A028 Institutional research plan: CEZ:AV0Z40400503 Keywords : adsorption * bentonite * montmorillonite * water vapour Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.323, year: 2005