Directory of Open Access Journals (Sweden)
Simone Bortolan
2009-11-01
Full Text Available O objetivo deste trabalho foi avaliar a expressão, por RT-qPCR, dos genes de nodulação nodC e nodW e do gene nopP da estirpe CPAC 15, que provavelmente atuam na infecção das raízes da soja. Foram realizados dois experimentos. No primeiro, a expressão dos genes foi avaliada nas células após a incubação com genisteína por 15 min, 1, 4 e 8 horas. Os resultados revelaram que os três genes apresentaram maior expressão imediatamente após o contato com o indutor (15 min. No segundo experimento, a bactéria foi cultivada na presença de indutores (genisteína ou exsudatos de sementes de soja por 48 horas. A expressão dos três genes foi maior na presença de genisteína, com valores de expressão para nodC, nodW e nopP superiores ao controle. Os resultados obtidos confirmam a funcionalidade dos três genes na estirpe CPAC 15, com ênfase para o nopP, cuja funcionalidade em Bradyrhizobium japonicum foi descrita pela primeira vez.The objective of this work was to evaluate, by RT-qPCR, the expression of the nodC and nodW nodulation genes and of the nopP gene of the CPAC 15 strain, which probably play a role in the infection of soybean roots. Two experiments were done. In the first, the gene expression was evaluated in cells after incubation with genistein for 15 min, 1, 4 and 8 hours. Results showed that the three genes showed higher expression immediately after contact with the inducer (15 min. In the second experiment, the bacterium was grown in the presence of inducers (genistein or soybean seed exudates for 48 hours. The expression of the three genes was greater when induced by genistein, and the expression of nodC, nodW and nopP had higher values than the control. The results confirm the functionality of the three genes in the CPAC 15 strain, with an emphasis on the nopP, whose functionality in Bradyrhizobium japonicum was described for the first time.
Sensibilidade de estirpes de Bradyrhizobium ao glyphosate
Directory of Open Access Journals (Sweden)
Rodrigo Josemar Seminoti Jacques
2010-02-01
Full Text Available A aplicação do glyphosate sobre a soja resistente a este herbicida pode causar prejuízos à simbiose com o rizóbio. O objetivo deste trabalho foi avaliar a sensibilidade ao herbicida glyphosate de três estirpes de Bradyrhizobium recomendadas para a produção de inoculantes de sementes de soja no Brasil. Avaliou-se o efeito das concentrações de 0,0; 5,4; 10,8; 21,6 e 43,2 µg L-1 do ingrediente ativo do glyphosate [N-(fosfonometil glicina] no meio YM líquido sobre o crescimento de B. japonicum (estirpe SEMIA 5079 e de B. elkanii (estirpe SEMIA 5019 e estirpe SEMIA 587, por meio de leituras das densidades óticas e geração de curvas de crescimento. As reduções de crescimento na presença da menor concentração do glyphosate foram de 18% para SEMIA 5079, 29% para SEMIA 5019 e de 35% para SEMIA 587, sendo, de modo geral, quanto maior a concentração do herbicida no meio de cultura maior a inibição do crescimento. As estirpes apresentaram sensibilidade diferencial somente às concentrações mais baixas do glyphosate; nesse caso, foi possível determinar a seguinte ordem de sensibilidade: SEMIA 587 > SEMIA 5019 > SEMIA 5079. Essa sensibilidade diferencial é dependente da concentração do herbicida, pois na presença de 43,2 µg L-1 todas as estirpes tiveram seu crescimento severamente reduzido, não havendo diferença entre elas.
Directory of Open Access Journals (Sweden)
J.B. Santos
2004-06-01
Full Text Available O objetivo deste trabalho foi avaliar efeitos de formulações comerciais de glyphosate sobre estirpes de Bradyrhizobium, em condições de laboratório. As formulações foram aplicadas na concentração de 43,2 µg L-1 do equivalente ácido. As bactérias foram inoculadas em meio de cultura à base de manitol e extrato de levedura (YM. O efeito do herbicida no crescimento das estirpes de Bradyrhizobium foi avaliado mediante leitura da densidade ótica em espectrofotômetro. Avaliou-se o crescimento das estirpes de B. japonicum SEMIA 5079 e de B. elkanii SEMIA 5019 e SEMIA 587 sob efeito de nove formulações de glyphosate: Zapp Qi®, Roundup®, Roundup Multiação®, Roundup Transorb®, Roundup WG®, Trop®, Agrisato®, glyphosate técnico [padrão de N-(phosphonomethyl glycina] e controle sem adição de herbicida (testemunha para as estirpes. Foram utilizadas seis repetições. Confeccionaram-se curvas de crescimento para cada estirpe. Pelos resultados, pôde-se observar que todas as formulações de glyphosate causaram efeitos diferenciados sobre as estirpes de Bradyrhizobium SEMIA 5019, SEMIA 5079 e SEMIA 587. Constatou-se que a formulação Zapp Qi foi a menos tóxica às estirpes de Bradyrhizobium avaliadas. A maior toxicidade foi observada para Roundup Transorb, que provocou reduções no crescimento acima de 94% para todas as estirpes de Bradyrhizobium estudadas. Não se observou correlação entre o tipo de sal - isopropilamina, amônio ou potássico, presentes na formulação herbicida - e o grau de inibição no crescimento das estirpes. SEMIA 587 foi a estirpe menos tolerante à maioria das formulações testadas, porém SEMIA 5019 foi a mais sensível ao glyphosate padrão, sem adição de sais ou de outros aditivos.This work aimed to evaluate the effects of glyphosate commercial formulations on Bradyrhizobium strains under laboratory conditions. The formulations were applied in the concentration of 43.2 µg L-1 of the a.e. and
EFICIÊNCIA AGRONÔMICA DOS RIZÓBIOS SEMIA 6156, F 3 (4, F 2 (1, F2 - 2B, CPAC-B10 EM FEIJÃO DE PORCO
Directory of Open Access Journals (Sweden)
Thiago Santos de Paula Silva
2015-07-01
Full Text Available O objetivo foi validar e recomendar bactérias fixadoras de nitrogênio usadas em inoculantes comerciais na leguminosa Canavalia ensiformis. O trabalho foi conduzido durante os meses de novembro de 2013 a fevereiro 2014. O delineamento experimental foi o de blocos ao acaso com quatro repetições e com unidade experimental de 24 m2, o plantio realizado no espaçamento de 0,5 m entre sulcos, densidade de 10 sementes por metro linear, As estirpes de rizóbio avaliadas foram: SEMIA 6156, F 3 (4, F 2 (1, F2 - 2B, CPAC-B10. A primeira avaliação foi realizada aos 30 dias após a semeadura (DAS, para número e massa de nódulos frescos e secos, massa seca da parte aérea e raízes. A segunda avaliação foi realizada quando 50% das plantas estavam em florescimento, quantificando-se a massa seca das folhas e caules, massa seca total da parte aérea e análise total de macronutrientes em folhas e caule. A estirpe F 2 (1 pode realizar efetiva simbiose com as plantas de feijão de porco, promovendo ganhos no acúmulo de massa seca de parte aérea das plantas, sendo assim considerada agronomicamente eficiente e recomendada para uso em inoculantes comerciais.
Directory of Open Access Journals (Sweden)
Maria Lucrecia Gerosa Ramos
2005-05-01
Full Text Available The objective of this work was to study the response to water stress of a drought sensitive soybean cultivar inoculated with Bradyrhizobium japonicum (strain CB1809, Semia 586 and B. elkanii (strain 29W, Semia 5019. CB1809 nodulated plants produced a significantly higher root fraction (19% than 29W (14.6%. Plants inoculated with CB1809 produced less nodules and accumulated more nitrogen than those inoculated with 29W. In general, low amounts of ureides in nodules were found in watered plants inoculated with either CB1809 or 29W strains, but those levels were five-fold increased in stressed plants inoculated with CB1809. Nodules formed by strain CB1809 had aspartate and glutamate as major amino acids, while those formed by 29W had glutamate, asparagine and alanine. In nodules of plants inoculated with CB1809 aspartate showed the highest accumulation (5 µmol g-1; in stressed plants this amino acid reached a value of 26 µmol g-1, and asparagine was not detected. Nodules formed by the strain 29W accumulated 1 µmol g-1 of aspartate, whether plants were stressed or not. Asparagine was the major amino acid found in nodules from watered plants (6 µmol g-1 and the amount of this amino acid was six-fold increased when plants were water stressed.O objetivo deste trabalho foi estudar a resposta da soja, com inoculação de Bradyrhizobium japonicum (estirpe CB1809, Semia 586 ou B. elkanii (estirpe 29W, Semia 5019, ao estresse hídrico. Plantas com inoculação da estirpe CB1809 produziram maior fração de raízes (19% do que aquelas com inoculação de 29W (14,6%. As plantas com inoculação de CB1809 produziram menos nódulos e acumularam mais nitrogênio do que aquelas com inoculação de 29W. Em geral, baixos teores de ureídos nos nódulos foram encontrados em plantas irrigadas, com inoculação de CB1809 ou 29W, mas esses valores aumentaram cinco vezes em plantas com CB1809, sob estresse hídrico. Os nódulos formados pela estirpe CB1809 produziram
Martínez, Cecilia; Manzano, Susana; Megías, Zoraida; Barrera, Alejandro; Boualem, Adnane; Garrido, Dolores; Bendahmane, Abdelhafid; Jamilena, Manuel
2014-06-01
A number of Cucurbita pepo genotypes showing instable monoecy or partial andromonoecy, i.e. an incomplete conversion of female into bisexual flowers, have been detected. Given that in melon and cucumber andromonoecy is the result of reduction of ethylene production in female floral buds, caused by mutations in the ethylene biosynthesis genes CmACS7 and CsACS2; we have cloned and characterized two related C. pepo genes, CpACS27A and CpACS27B. The molecular structure of CpACS27A and its specific expression in the carpels of female flowers during earlier stages of flower development suggests that this gene is the Cucurbita ortholog of CmACS7 and CsACS2. CpACS27B is likely to be a paralogous pseudogene since it has not been found to be expressed in any of the analyzed tissues. CpACS27A was sequenced in Bolognese (Bog) and Vegetable Spaghetti (Veg), two monoecious inbred lines whose F2 was segregating for partial andromonoecy. The Bog allele of CpACS27A carried a missense mutation that resulted in a substitution of the conserved serine residue in position 176 by an alanine. Segregation analysis indicated that this mutant variant is necessary but not sufficient to confer the andromonoecious phenotype in squash. In concordance with its involvement in stamen arrest, a reduction in CpACS27A expression has been found in bisexual flower buds at earlier stages of development. This reduction in CpACS27A expression was concomitant with a downregulation of other ethylene biosynthesis and signaling genes during earlier and later stages of ovary development. The role of CpACS27A is discussed regarding the regulation of ethylene biosynthesis and signaling genes in the control of andromonoecy-associated traits, such as the delayed maturation of corolla and stigma as well as the parthenocarpic development of the fruit.
Taxonomy Icon Data: Schistosoma japonicum [Taxonomy Icon
Lifescience Database Archive (English)
Full Text Available Schistosoma japonicum Schistosoma japonicum Platyhelminthes Schistosoma_japonicum_L.png Schistoso...ma_japonicum_NL.png Schistosoma_japonicum_S.png Schistosoma_japonicum_NS.png http://bioscience...dbc.jp/taxonomy_icon/icon.cgi?i=Schistosoma+japonicum&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Schistoso...ma+japonicum&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Schistoso...ma+japonicum&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Schistosoma+japonicum&t=NS http://togodb.biosciencedbc.jp/togodb/view/taxonomy_icon_comment_en?species_id=132 ...
Directory of Open Access Journals (Sweden)
Fabíola Gomes de Carvalho
2005-12-01
Full Text Available O cultivo sucessivo de soja inoculada numa mesma área proporcionou a adaptação de uma população de rizóbios, que podem não ser tão eficientes quanto à capacidade de fixação de N2, mas apresentam alta competitividade, dificultando a introdução de novas estirpes mais eficientes. Com a finalidade de avaliar o desempenho simbiótico (eficiência e competitividade de variantes espontâneos isolados de estirpes de B. japonicum (SEMIA 5079 e SEMIA 5080 e B. elkanii (SEMIA 587 e SEMIA 5019, realizou-se um experimento em casa de vegetação onde os variantes foram inoculados isoladamente e em diferentes combinações entre os variantes e uma estirpe comprovadamente mais competitiva (SEMIA 587 ou SEMIA 5019 a partir da adição de inóculos mistos (1/1; v/v no cultivar de soja BR-16. Por meio da avaliação das variáveis analisadas (nodulação, produção de matéria de seca da parte aérea, N total acumulado na parte aérea e ocupação nodular, foi possível constatar que o determinante da maior eficiência em tratamentos co-inoculados não foi a ocupação nodular de determinada estirpe ou variante presente no inóculo, mas, sim, o tipo de interação (sinérgica ou antagônica predominante no tratamento co-inoculado e que é possível selecionar variantes eficientes e competitivos para a cultura da soja a partir de estirpes parentais que já apresentam características desejáveis para utilização em inoculantes comerciais.The continuous cultivation of inoculated soybean in the same area can determine the soil colonization with a rhizobia population presenting low nitrogen fixation effectiveness. This fact can be a problem for the establishment of a more effective population. A greenhouse experiment was carried out to evaluate the symbiotic effectiveness and competitiveness of spontaneous mutants isolated from B. japonicum (SEMIA 5079 and SEMIA 5080 and B. elkanii (SEMIA 587 and SEMIA 5019 strains. The soybean biovar BR 16 was
Caracterização de biofilmes de estirpes persistentes de Listeria monocytogenes
Gonçalves, Ana Isabel Dias
2017-01-01
Mestrado em Engenharia Alimentar - Instituto Superior de Agronomia - UL Algumas estirpes de L. monocytogenes têm a capacidade de formar biofilmes e persistir em ambientes industriais, por longos períodos de tempo, mesmo após os processos de higienização. O principal objectivo deste trabalho foi caracterizar estirpes persistentes, em indústrias de carne de suíno e de aves, relativamente à sua capacidade de formação de biofilme e à susceptibilidade a um desinfectante comercial (P3 OXONIA) ba...
Directory of Open Access Journals (Sweden)
Ana Paula Guimarães
2008-01-01
Full Text Available In commercial plantations of soybean in both the Southern and the Cerrado regions, contributions from biological nitrogen fixation (BNF are generally proportionately high. When using the 15N natural abundance technique to quantify BNF inputs, it is essential to determine, with accuracy, the 15N abundance of the N derived from BNF (the 'B' value. This study aimed to determine the effect of four recommended strains of Bradyrhizobium spp. (two B. japonicum and two B. elkanii on the 'B' value of soybean grown in pots in an open field using an equation based on the determination of δ15N natural abundance in a non-labelled soil, and estimate of the contribution of BNF derived from the use of 15N-isotope dilution in soils enriched with 15N. To evaluate N2 fixation by soybean, three non-N2-fixing reference crops were grown under the same conditions. Regardless of Bradyrhizobium strain, no differences were observed in dry matter, nodule weight and total N between labelled and non-labelled soil. The N2 fixation of the soybeans grown in the two soil conditions were similar. The mean 'B' values of the soybeans inoculated with the B. japonicum strains were -1.84 ‰ and -0.50 ‰, while those inoculated with B. elkanii were -3.67 ‰ and -1.0 ‰, for the shoot tissue and the whole plant, respectively. Finally, the 'B' value for the soybean crop varied considerably in function of the inoculated Bradyrhizobium strain, being most important when only the shoot tissue was utilised to estimate the proportion of N in the plant derived from N2 fixation.Em plantações comerciais de soja na região Sul e do Cerrado, as contribuições da fixação biológica de Nitrogênio (FBN são geralmente elevadas. Quando usamos a técnica da abundância natural de 15N para quantificar a FBN, é essencial determinar com exatidão a abundância de 15N do N derivado da FBN (valor 'B'. Este trabalho buscou determinar o efeito das quatro estirpes de Bradyrhizobium spp. (duas B
Directory of Open Access Journals (Sweden)
Cristina Lima de Macedo
2012-12-01
Full Text Available O objetivo deste trabalho foi selecionar e caracterizar estirpes nativas de Bacillus thuringiensis tóxicas a Diatraea saccharalis (Lepidoptera: Crambidae. Cento e seis estirpes pertencentes ao Banco de Bactérias de Invertebrados, da Embrapa Recursos Genéticos e Biotecnologia, foram testadas quanto à toxicidade a D. saccharalis, e, as mais tóxicas, caracterizadas por métodos bioquímicos e moleculares. Das 106 estirpes testadas, 16 causaram 100% de mortalidade em 24 horas. As três estirpes mais tóxicas apresentaram concentração letal média entre 8 e 43 ng cm-2. O perfil proteico das 16 estirpes mostrou a presença de proteínas de 130 e 65 kDa, e a caracterização molecular mostrou a presença dos genes tipo cry1 e cry2: cry1Aa, cry1Ab, cry1Ac e cry2Aa. A concentração letal média de esporos e cristais obtidos a partir de estirpes recombinantes, que expressavam individualmente os genes cry1Aa, cry1Ab, cry1Ac e cry2Aa, variou entre 222 e 610 ng cm-2, valores muito superiores aos das estirpes nativas mais tóxicas, que apresentavam possibilidade de expressão simultânea desses genes. Este resultado é indicativo de que há sinergia entre as toxinas. Há interação entre as toxinas de B. thuringiensis e seus receptores na broca-do-colmo da cana-de-açúcar.
Directory of Open Access Journals (Sweden)
Rose Gomes Monnerat
2005-02-01
Full Text Available The objective of this work was to evaluate 210 Bacillus thuringiensis strains against Aedes aegypti and Culex quinquefasciatus larvae to select the most effective. These strains were isolated from different regions of Brazil and are stored in a Bacillus spp. collection at Embrapa Recursos Genéticos e Biotecnologia, Brasília, Brazil. The selected strains were characterized by morphological (microscopy, biochemical (SDS-PAGE 10% and molecular (PCR methods. Six B. thuringiensis strains were identified as mosquito-toxic after the selective bioassays. None of the strains produced the expected PCR products for detection of cry4, cry11 and cyt1A genes. These results indicate that the activity of mosquitocidal Brazilian strains are not related with Cry4, Cry11 or Cyt proteins, so they could be used as an alternative bioinsecticide against mosquitoes.Neste trabalho foram realizados testes de patogenicidade com 210 estirpes de Bacillus thuringiensis contra larvas de Aedes aegypti e Culex quinquefasciatus, a fim de se determinar as mais eficazes. Estas estirpes foram isoladas de diversas regiões do Brasil e estão armazenadas na coleção de Bacillus spp. da Embrapa Recursos Genéticos e Biotecnologia. As estirpes selecionadas foram caracterizadas por métodos morfológicos (microscopia, bioquímicos (SDS-PAGE 10% e moleculares (Reação em Cadeia da Polimerase. Foram selecionadas seis estirpes entomopatogênicas de Bacillus thuringiensis. Nenhuma das estirpes de Bacillus thuringiensis apresentou produtos de PCR esperados para a detecção dos genes cry4, cry11 e cyt1A. A patogenicidade das estirpes não está associada à presença das toxinas Cry4, Cry11 ou Cyt, assim, essas estirpes poderão ser utilizadas para a formatação de um bioinseticida alternativo contra mosquitos.
Energy Technology Data Exchange (ETDEWEB)
Pawel, Steven J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Armstrong, Beth L. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Haynes, James A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2015-07-01
The primary goal of the CPAC program at ORNL was to explore the feasibility of introducing various silica-based superhydrophobic (SH) powder additives as a way to improve the corrosion resistance of US Department of Defense (DOD) military-grade chemical agent resistant coating (CARC) systems. ORNL had previously developed and patented several SH technologies of interest to the USMC, and one of the objectives of this program was to identify methods to incorporate these technologies into the USMC’s corrosion-resistance strategy. This report discusses findings of the CPAC and their application.
Directory of Open Access Journals (Sweden)
Lílian Botelho Praça
2010-06-01
Full Text Available A partir de 21 amostras de solos da região oeste da Bahia, foram isoladas nove estirpes de B. thuringiensis. As estirpes de B. thuringiensis foram testadas contra lagartas de Spodoptera frugiperda, Anticarsia gemmatalis, Plutella xylostella e Anthonomus grandis. Das nove estirpes, duas apresentaram efetividade, a S2183 contra S. frugiperda e a S2186 contra S. frugiperda, A. gemmatalis e P. xylostella. Com relação ao A. grandis, nenhuma das estirpes apresentou mortalidade acima de 70%. Estas estirpes foram submetidas à bioensaios para cálculo da CL50 e a caracterizações bioquímicas e moleculares. Em bioensaio, a S2183 não apresentou efetividade nas doses recomendadas contra os insetos testados e S2186 apresentou uma CL50 de 375 µg/mL apenas para P. xylostella. As estirpes apresentaram duas proteínas principais de 100 e 70 kDa. Somente S2186 apresentou produtos de PCR para o gene cry2 e cristais bipiramidais, apresentando-se semelhante ao padrão B. thuringiensis subespécie kurstaki.
Eficiência simbiótica de estirpes de Cupriavidus necator tolerantes a zinco, cádmio, cobre e chumbo
Directory of Open Access Journals (Sweden)
Paulo Ademar Avelar Ferreira
2012-01-01
Full Text Available O objetivo deste trabalho foi avaliar a tolerância de estirpes de Cupriavidus necator a zinco, cádmio, cobre e chumbo, além de determinar a eficiência simbiótica das estirpes mais tolerantes em associação a espécies leguminosas com potencial para revegetação. A tolerância foi testada em meio LB, suplementado com 2,5; 5,0; 7,5; 10; 12,5 e 15 mmol L-1 de ZnSO4.7H2O, CdSO4.8H2O, CuSO4.5H2O e PbCl2, respectivamente, em comparação ao controle sem adição de metal. Determinou-se a eficiência simbiótica das quatro estirpes de C. necator mais tolerantes aos metais avaliados (UFLA02-71, UFLA02-73, UFLA01-659 e UFLA01-663, as quais foram inoculadas nas espécies: Leucaena leucocephala, Enterolobium contortisiliquum, Acacia mangium, Mimosa caesalpiniifolia, M. pudica, M. pigra e M. acutistipula. Em vasos com solos, avaliaram-se L. leucocephala, M. pudica e M. caesalpiniifolia e as estirpes UFLA01-659 e UFLA02-71, selecionadas na avaliação de eficiência simbiótica. A estirpe UFLA02-71 proporcionou incrementos de matéria seca da parte aérea de 870% em M. caesalpiniifolia, enquanto que UFLA01-659 proporcionou 885% em M. pudica e 924% em L. leucocephala. As estirpes UFLA01-659 e UFLA02-71, além da alta tolerância a metais pesados, apresentaram eficiência em fixar nitrogênio, em simbiose com essas leguminosas, em solos com rizóbios nativos capazes de nodulá-las, e devem ser avaliadas quanto ao seu potencial de utilização em programas de recuperação de áreas degradadas.
Influência do pH do meio de cultivo e da turfa no comportamento de estirpes de Bradyrhizobium
Directory of Open Access Journals (Sweden)
D. L. Miguel
2001-12-01
Full Text Available A acidez dos solos representa um problema que afeta grandes áreas agrícolas pelo mundo, principalmente nos trópicos, onde fósforo e nitrogênio também são limitantes. No caso do nitrogênio, a fixação biológica torna-se uma das alternativas mais viáveis do ponto de vista ecológico e econômico, por diminuir o uso e o impacto causado pelos fertilizantes nitrogenados. Neste trabalho, foram realizados dois experimentos in vitro e um em casa de vegetação com quatro estirpes de Bradyrhizobium (Br 4406, Br 29, SEMIA 587 e INPA 03-11B, no Departamento de Ciência do Solo (UFLA, de julho de 1998 a julho de 1999, para verificar o efeito de três valores de pH (5,0; 6,0; 6,9 no crescimento destas em meio de cultura YM, na sua simbiose com soja, assim como na sua sobrevivência em inoculantes produzidos com turfa. No primeiro experimento, as estirpes de Bradyrhizobium tiveram um comportamento diferenciado em meio líquido, obtendo melhor desempenho em pH 6,0, tanto em número de unidades formadoras de colônias quanto em produção de exopolissacarídeos. +No segundo experimento, o número de nódulos, a atividade da nitrogenase (Nase, as massas secas de nódulos, raízes e parte aérea de plantas de soja, de modo geral, não foram influenciados pelos valores de pH de cultivo das estirpes no inoculante. Entretanto, a estirpe INPA 03 - 11B mostrou-se efetiva, apresentando número de nódulos e atividade de Nase semelhantes aos de Br 29 e SEMIA 587, que são recomendadas como estirpes inoculantes, devendo, assim, ser indicada para testes de eficiência em campo. No terceiro experimento, com exceção da Br 29, que atingiu maior sobrevivência de células em pH 6,0, as outras estirpes tiveram sobrevivência semelhante neste valor de pH e em pH 6,9. O melhor desempenho das estirpes de Bradyrhizobium em pH 6,0 no meio de cultura e em turfa demonstrou a possibilidade do uso de inoculantes corrigidos para esse valor de pH, como modo de pr
[Seasonal changes and response to stress of total flavonoids content of Farfugium japonicum].
Cui, Dalian; Ma, Yuxin
2013-05-01
To investigate the seasonal variation of total flavonoid content of Farfugium japonicum and its response to stress. The total flavonoids of Farfugium japonicum were determined by spectrophotometry in different seasons and under various stressful factors. The total flavonoid content in Farfugium japonicum leaves was the highest, followed by the petiole, and rhizomes (Pseasons (Pwater stress, the total flavonoid content in Farfugium japonicum leaves gradually increased, that in petiole first increased and then decreased,while that in rhizomes decreased (Pstress, the total flavonoid content in leaves, petioles and rhizomes of Farfugium japonicum showed a decreasing trend (Pseasons and that in different parts of the plant has different responses to ecological stressful factors.
Differential pulmonic NK and NKT cell responses in Schistosoma japonicum-infected mice.
Cha, Hefei; Qin, Wenjuan; Yang, Quan; Xie, Hongyan; Qu, Jiale; Wang, Mei; Chen, Daixiong; Wang, Fang; Dong, Nuo; Chen, Longhua; Huang, Jun
2017-02-01
Natural killer cells (NK cells) and natural killer T cells (NKT cells) play a role in anti-infection, anti-tumor, transplantation immunity, and autoimmune regulation. However, the role of NK and NKT cells during Schistosoma japonicum (S. japonicum) infection has not been widely reported, especially regarding lung infections. The aim of this study was to research the NK and NKT cell response to S. japonicum infection in the lungs of mice. Using immunofluorescent histological analysis, NK and NKT cells were found near pulmonary granulomas. Moreover, flow cytometry revealed that the percentage and number of pulmonic NK cells in S. japonicum-infected mice were significantly increased (P cell number of NKT cells were decreased compared to those of normal mice (P NKT cells was increased after infection (P NKT cells (P cells (P NKT cells significantly increased (P NKT cells (P NKT cell activation during S. japonicum infection.
Chemical composition and anti-inflammatory effects of essential oil from Farfugium japonicum flower.
Kim, Ji-Young; Oh, Tae-Heon; Kim, Byeong Jin; Kim, Sang-Suk; Lee, Nam Ho; Hyun, Chang-Gu
2008-01-01
In this study, the chemical composition and anti-inflammatory activities of hydrodistilled essential oil from Farfugium japonicum were investigated for the first time. The chemical constituents of the essential oil were further analyzed by GC-MS and included 1-undecene (22.43%), 1-nonene (19.83%), beta-caryophyllene (12.26%), alpha-copaene (3.70%), gamma-curcumene (2.86%), germacrene D (2.69%), and 1-decene (2.08%). The effects of the essential oil on nitric oxide (NO) and prostaglandin E2 (PGE(2)) production in lipopolysaccharide (LPS)-activated RAW 264.7 macrophages were also examined. The results indicate that the F. japonicum essential oil is an effective inhibitor of LPS-induced NO and PGE(2) production in RAW 264.7 cells. These inhibitory effects of the F. japonicum essential oil were accompanied by dose-dependent decreases in the iNOS and COX-2 mRNA expression. In order to determine whether F. japonicum essential oil can safely be applied to human skin, the cytotoxic effects of F. japonicum essential oil were determined by colorimetric MTT assays in human dermal fibroblast and keratinocyte HaCaT cells. F. japonicum essential oil exhibited low cytotoxicity at 100 mug/mL. Based on these results, we suggest that F. japonicum essential oil may be considered a potential anti-inflammatory candidate for topical application.
Directory of Open Access Journals (Sweden)
Antonio Roberto Giardini
1984-01-01
Full Text Available Um ensaio foi conduzido em casa de vegetação, com solução nutritiva isenta de N, com o objetivo de selecionar estirpes de Rhizobium eficientes fixadoras de N2, quando associadas com amendoim (Arachis hypogaea L. cultivar Tatu. Foram testadas 35 estirpes de Rhizobium sp., isoladas de quinze diferentes espécies de leguminosas tropicais, e incluído um tratamento de inoculação com solo previamente cultivado com amendoim. Das 35 estirpes testadas, doze formaram nódulos e, entre essas, sete foram eficientes fixadoras de nitrogênio. Das doze estirpes que nodularam, sete foram isoladas de leguminosas da tribo Hedysareae (à qual pertence o género Arachis e, destas, apenas quatro foram eficientes fixadoras de nitrogênio. O peso e o número de nódulos não se mostraram como critérios adequados para avaliação da eficiência.An experiment was carried out in Leonard jars, in the greenhouse, with nitrogen-free nutrient solution to test the efficiency of 35 strains of rhizobia isolated from 15 species of tropical legumes. Twelve of the tested strains were capable of nodule formation in peanut. Seven of those strains were isolated from the trible Hedysareae, which includes the genus Arachis. Only four of the rhizobia strains with inducing nodulation were effective. Dry weight and number of nodules were not good criteria for evaluating effectiveness.
Wen-Qiao, Huang; Yuan-Jian, Zhu; Da-Bing, Lv; Xia, Zhou; Ying-Nan, Yang; Hong-Xiang, Zhu-Ge
2016-05-24
To explore the correlation between the genetic dissimilarity and heterozygosity of mates and the pathogenicity of Schistosoma japonicum in the definitive host. By using seven microsatellite loci markers, S. japonicum genotyping of sixteen pairs randomly mated was performed, the genetic dissimilarity and heterozygosity were calculated between the mates, and the correlation between the genetic dissimilarity and heterozygosity of the mates and the pathogenicity of S. japonicum in the definitive host was evaluated. There was a significant correlation between the genetic similarity of S. japonicum mates and the mean number of eggs per worm pair in the liver and intestinal tissue ( r = 0.501 6, P correlation between the genetic similarity of the mates and hepatosplenomegaly per worm pair ( r = 0.109 5, P > 0.05; r = 0.265 3, P > 0.05, respectively) and the average diameter of granuloma in the liver ( r = -0.272 7, P > 0.05), respectively. There was no correlation between the heterozygosity of the mates and all the pathological parameters of S. japonicum in the definitive host ( P > 0.05). There is the correlation between the genetic dissimilarity of the mates and the pathogenicity of S. japonicum in the definitive host, and the genetic dissimilarity is greater, pathogenicity is weaker. There is no correlation between heterozygosity of the mates and the pathogenicity of S. japonicum in the definitive host.
Co-inoculation effects of Bradyrhizobium japonicum and ...
African Journals Online (AJOL)
Co-inoculation effects of Bradyrhizobium japonicum and Azospirillum sp. on competitive nodulation and rhizosphere eubacterial community structures of soybean under rhizobia-established soil conditions.
Directory of Open Access Journals (Sweden)
, Triadiati
2013-10-01
Full Text Available The use of acid tolerant rhizobacteria such as Bradyrhizobium japonicum is one effort for increasing soybeanproductivity in acid soil. B. japonicum is a N-fixing bacteria that can promote soybean growth through symbiosis with thehost plants. The objective of this study was to investigate the growth and production of soybean var. Wilis inoculated by B.japonicum and NPK inorganic fertilizer application in acid soil. Two isolates of B. japonicum that were BJ 11(19 and BJ11(wt were used as inoculant for soybean. BJ 11(19 was resulted by transposons mutagenesis, whereas BJ 11(wt is a wild type of bacteria. Both isolates of B. japonicum were acid tolerant. Soybean was inoculated with BJ 11(19 and BJ 11(wtcombined with compost and nitrogen fertilizer (with two rates. The field experiment was conducted at Cikabayan, Darmaga,in a randomized complete block design with 12 treatments and 3 replicates. The results showed that application of the acidtolerant B. japonicum BJ 11(wt, compost, and nitrogen fertilizer (10 g m-2 increased the plant height, dry weight of shootsand roots, nodule number, dry weight of nodules, nitrogenase activity, number of pod and seed, seed weight, and nitrogencontent of seeds in acid soil.Keywords: acid soil, acid tolerant rhizobia, Bradyrhizobium japonicum, compost, nitrogen fertilizer
Transmission dynamics of Schistosoma japonicum in the lakes and marshlands of China.
Directory of Open Access Journals (Sweden)
Darren J Gray
Full Text Available Schistosoma japonicum is a major public health concern in China, with over one million people infected and another 40 million living in areas at risk of infection. Unlike the disease caused by S. mansoni and S. haematobium, schistosomiasis japonica is a zoonosis, involving a number of different mammalian species as reservoir hosts. As a result of a number of published reports from China, it has long been considered that bovines, particularly water buffaloes, play a major role in human S. japonicum transmission there, and a drug-based intervention study (1998-2003 around the Poyang Lake in Jiangxi Province provided proof of concept that water buffaloes are, indeed, major reservoirs of human infection in this setting.In this study we incorporated recently obtained epidemiological information to model the steady-state S. japonicum transmission as well as the impact of the removal of S. japonicum transmission attributable to water buffaloes on human infection rates across six different endemic scenarios within three villages in the Dongting (Hunan and Poyang (Jiangxi lakes of southern China. Similar results were obtained for all scenarios. Steady-state S. japonicum infection rates remained constant and human prevalence and incidence were predicted to fall considerably over time. The model showed that the contribution of S. japonicum water buffalo transmission to human infection ranged from 39.1% to 99.1% and predicted that the removal of water buffalo transmission would reduce parasite reproductive rates below 1. This indicates that without the contribution of water buffaloes, S. japonicum transmission is interrupted and unsustainable. These scenarios are generalizable to other endemic villages in the lake and marshland areas of China where a similar cycle of snail infection and infection/reinfection of humans and bovines occurs.Along with previous epidemiological data, our findings strongly support water buffaloes as an important component of the
Chrysosplenium japonicum (Saxifragaceae, Newly Recorded from Taiwan
Directory of Open Access Journals (Sweden)
Tian-Chuan Hsu
2011-11-01
Full Text Available Chrysosplenium japonicum (Maxim. Makino (Saxifragaceae is newly recorded from northeastern Taiwan. Description, color photos and a key to the Chrysosplenium species in Taiwan are provided.
Soybean Lectin Enhances Biofilm Formation by Bradyrhizobium japonicum in the Absence of Plants
Directory of Open Access Journals (Sweden)
Julieta Pérez-Giménez
2009-01-01
Full Text Available Soybean lectin (SBL purified from soybean seeds by affinity chromatography strongly bound to Bradyrhizobium japonicum USDA 110 cell surface. This lectin enhanced biofilm formation by B. japonicum in a concentration-dependent manner. Presence of galactose during biofilm formation had different effects in the presence or absence of SBL. Biofilms were completely inhibited in the presence of both SBL and galactose, while in the absence of SBL, galactose was less inhibitory. SBL was very stable, since its agglutinating activity of B. japonicum cells as well as of human group A+ erythrocytes was resistant to preincubation for one week at 60°C. Hence, we propose that plant remnants might constitute a source of this lectin, which might remain active in soil and thus favor B. japonicum biofilm formation in the interval between soybean crop seasons.
Co-inoculation effects of Bradyrhizobium japonicum and ...
African Journals Online (AJOL)
Corporate Edition
2013-05-15
. 2851. MATERIALS AND METHODS. Bacterial strains, media and growth conditions. Two B. japonicum strains of CB 1809 and USDA 110 those currently used in rhizobial inoculants production for soybean at the. Department ...
Nested-PCR assay for detection of Schistosoma japonicum infection in domestic animals.
Zhang, Xin; He, Chuan-Chuan; Liu, Jin-Ming; Li, Hao; Lu, Ke; Fu, Zhi-Qiang; Zhu, Chuan-Gang; Liu, Yi-Ping; Tong, Lai-Bao; Zhou, De-Bao; Zha, Li; Hong, Yang; Jin, Ya-Mei; Lin, Jiao-Jiao
2017-04-13
Schistosomiasis japonica is a common zoonosis. Domestic animals are the primary source of infection and play an important role in disease transmission. The prevalence and infectivity of this disease in domestic animals in China have significantly decreased and, for this reason, diagnostics with a higher sensitivity have become increasingly necessary. It was reported that polymerase chain reaction (PCR)-based methods could be used to detect schistosome infection in humans and animals and presented a high sensitivity and specificity. The present study aimed to develop a PCR-based method for detection of Schistosoma japonicum infection in domestic animals. A specific nested-PCR assay was developed to detect S. japonicum infection in domestic animals via amplification of a 231-bp DNA fragment of retrotransposon SjR2. The developed assay was first used in sera and dry blood filter paper (DBFP) from goats and buffaloes at different time points of infection. Then, 78 DBFPs from 39 artificially-infected bovines at 14 and 28 days post-infection and 42 DBFPs from schistosome-negative bovines from the city of Huangshan in the Anhui province were used to evaluate the diagnostic validity. Furthermore, this assay was used to detect S. japonicum infection in domestic animals in Dongzhi and Wangjiang counties. The expected PCR product was detected in eggs and adult worms of S. japonicum and blood samples from S. japonicum-infected goats and water buffaloes, but not from Fasciola and Haemonchus contortus worms. The nested-PCR assay could detect the target S. japonicum DNA in DBFPs from goats and buffaloes after day 3 post-infection. The sensitivity in buffaloes at 14 and 28 days post-infection was 92.30% (36/39) and 100% (39/39), respectively. The specificity was 97.60% (41/42). The positivity rates in Dongzhi and Wangjiang counties were 6.00% and 8.00% in bovines and 22.00% and 16.67% in goats, respectively. The positivity rates in goats in both counties were higher than those
Follicular helper T cells promote liver pathology in mice during Schistosoma japonicum infection.
Directory of Open Access Journals (Sweden)
Xiaojun Chen
2014-05-01
Full Text Available Following Schistosoma japonicum (S. japonicum infection, granulomatous responses are induced by parasite eggs trapped in host organs, particular in the liver, during the acute stage of disease. While excessive liver granulomatous responses can lead to more severe fibrosis and circulatory impairment in chronically infected host. However, the exact mechanism of hepatic granuloma formation has remained obscure. In this study, we for the first time showed that follicular helper T (Tfh cells are recruited to the liver to upregulate hepatic granuloma formation and liver injury in S. japonicum-infected mice, and identified a novel function of macrophages in Tfh cell induction. In addition, our results showed that the generation of Tfh cells driven by macrophages is dependent on cell-cell contact and the level of inducible costimulator ligand (ICOSL on macrophages which is regulated by CD40-CD40L signaling. Our findings uncovered a previously unappreciated role for Tfh cells in liver pathology caused by S. japonicum infection in mice.
Directory of Open Access Journals (Sweden)
G.O. Silva
2012-10-01
Full Text Available Isolaram-se estirpes de Campylobacter spp. em amostras de carcaças (n=65, fezes (n=65 e linfonodos mesentéricos (n=65 de suínos abatidos em frigoríficos do estado de São Paulo e detectaram, pela técnica da Multiplex-PCR, a presença do complexo de genes cdt, responsáveis pela expressão do fator de virulência da toxina CDT. Do total de 195 amostras de origem suína, Campylobacter spp. foi isolado de 31 (15,9%, sendo 29 (93,6% de amostras de suabe retal, 1/65 (3,2% de suabe de carcaça e um (3,2% de linfonodo. Vinte e oito estirpes de C. coli foram positivas para a detecção dos genes cdt, e três estirpes de C. jejuni foram negativas para a detecção desses genes. Foi detectada, pela primeira vez no estado de São Paulo, a presença dos genes cdt em 100% das estirpes de Campylobacter coli provenientes de suínos abatidos em frigoríficos.
Pectolinarigenin - A Flavonoid Compound from Cirsium Japonicum ...
African Journals Online (AJOL)
HP
/tjpr.v13i2.9. Original Research Article. Pectolinarigenin - A Flavonoid Compound from Cirsium. Japonicum with Potential Anti-proliferation Activity in MCF-. 7 Breast Cancer Cell. Mingqian Lu. 1,2,3. , Qingzhi Kong. 1,4. *, Xinhua Xu. 2,3.
Cloning and characterisation of Schistosoma japonicum insulin receptors.
Directory of Open Access Journals (Sweden)
Hong You
2010-03-01
Full Text Available Schistosomes depend for growth and development on host hormonal signals, which may include the insulin signalling pathway. We cloned and assessed the function of two insulin receptors from Schistosoma japonicum in order to shed light on their role in schistosome biology.We isolated, from S. japonicum, insulin receptors 1 (SjIR-1 and 2 (SjIR-2 sharing close sequence identity to their S. mansoni homologues (SmIR-1 and SmIR-2. SjIR-1 is located on the tegument basal membrane and the internal epithelium of adult worms, whereas SjIR-2 is located in the parenchyma of males and the vitelline tissue of females. Phylogenetic analysis showed that SjIR-2 and SmIR-2 are close to Echinococcus multilocularis insulin receptor (EmIR, suggesting that SjIR-2, SmIR-2 and EmIR share similar roles in growth and development in the three taxa. Structure homology modelling recovered the conserved structure between the SjIRs and Homo sapiens IR (HIR implying a common predicted binding mechanism in the ligand domain and the same downstream signal transduction processing in the tyrosine kinase domain as in HIR. Two-hybrid analysis was used to confirm that the ligand domains of SjIR-1 and SjIR-2 contain the insulin binding site. Incubation of adult worms in vitro, both with a specific insulin receptor inhibitor and anti-SjIRs antibodies, resulted in a significant decrease in worm glucose levels, suggesting again the same function for SjIRs in regulating glucose uptake as described for mammalian cells.Adult worms of S. japonicum possess insulin receptors that can specifically bind to insulin, indicating that the parasite can utilize host insulin for development and growth by sharing the same pathway as mammalian cells in regulating glucose uptake. A complete understanding of the role of SjIRs in the biology of S. japonicum may result in their use as new targets for drug and vaccine development against schistosomiasis.
Directory of Open Access Journals (Sweden)
Eloir Paulo Gris
2005-02-01
Full Text Available A soja em simbiose com Bradyrhizobium japonicum é capaz de ter a sua exigência de N satisfeita com a fixação biológica de N2 (FBN. Entretanto, a FBN é afetada pela deficiência Mo, visto que este nutriente faz parte da enzima nitrogenase responsável pelo processo. Foi realizado um experimento, em condição de campo, em Latossolo Vermelho eutroférrico, no município de Palotina, PR, com o objetivo de avaliar o tratamento de sementes com Mo, inoculação de B. japonicum e adubação foliar de Mo na produtividade da soja. Os tratamentos foram quatro doses de Mo (0, 40, 80 e 160 g ha-1 aplicadas em adubação foliar e tratamento com aplicação nas sementes de 40 g ha-1 de Mo, combinados com e sem inoculação com B. japonicum. Não foram observados efeitos estatísticos significativos do tratamento de sementes com Mo, inoculação de B. japonicum e adubação foliar de Mo na produtividade da soja. Não foram obtidas diferenças significativas entre os tratamentos, obtendo-se tendência apra ganho de produtividade apenas com aplicação foliar de 80 g ha-1 de Mo e tratamento de sementes com 40 g ha-1.Soybean in symbiosis with Bradyrhizobium japonicum is able to satisfy its nitrogen (N2 demand with biological nitrogen fixation (BNF. However, BNF can be affected by molybdenium deficiency because this micronutrient is part of the nitrogenase enzyme responsible for the process. An experiment was conducted under field conditions on a Red Latosol (Oxisol in Palotina, state of Paraná, Brazil. The effects of seed treatments with Mo, B. japonicum inoculation as well as foliar Mo fertilization on soybean yield were evaluated. Four Mo rates (0, 40, 80 and 160 g ha-1 were applied as foliar fertilizer in two Mo application forms (without Mo, seed treatment with Mo 40 g ha-1 combined with and without B. japonicum inoculation. There were no significant effects of the seed treatments with Mo, inoculation with B. japonicum and foliar Mo fertilization on
International Nuclear Information System (INIS)
Rehman, A.; Hamid, N.; Jawaid, F.
2010-01-01
Seeds of Glycine max (soybean) were inoculated with N-fixing bacterium Bradyrhizobium japonicum and grown in growth chamber to investigate interactive effects of atmospheric CO/sub 2/ and plants Nitrogen status on root and shoot length and biomass, nodule formation and Nitrogen concentration. Plants were grown with CO/sub 2/ at 3500 and 1000 ppm with or without Bradyrhizobium japonicum inoculation. Root and shoot length and dry mass of Glycine max increased significantly with CO/sub 2/ enrichment provided with Bradyrhizobium japonicum as compared to deficient Nitrogen fixing bacterium. While ambient and enriched CO/sub 2/ levels resulted in increased Nitrogen concentration of Glycine max shoot and root which is inoculated with N-fixing bacterium. Nodule formation was also enhanced in plants supplied with Bradyrhizobium japonicum as compared to plants which is Bradyrhizobium japonicum deficient at both CO/sub 2/ concentrations. (author)
Directory of Open Access Journals (Sweden)
Rafael Silva Menezes
2011-04-01
Full Text Available Agrotis ipsilon (Lepidoptera: Noctuidae, conhecida como lagarta rosca, é uma praga polífaga e cosmopolita, causadora de sérios danos em cultivos hortícolas e em sistemas de produção de grãos. Uma das alternativas para o combate a esta praga pode ser a utilização de produtos a base de Bacillus thuringiensis (Bt, bactéria aeróbica, Gram positiva, caracterizada pela produção proteínas tóxicas a insetos. A Embrapa Recursos Genéticos e Biotecnologia possui uma coleção de cerca de 2.300 estirpes de Bt. Neste trabalho cem estirpes desta coleção foram testadas para controle de A. ipsilon e destas, nove foram bastante tóxicas. Essas estirpes pertencem aos sorotipos kurstaki, aizawai, sotto e galleriae. A análise molecular e protéica mostrou a presença dos genes cry1Aa, cry1Ab, cry1Ac, cry1B, cry1C, cry1F, cry2 e cry11 e suas respectivas proteínas, indicando serem elas as proteínas envolvidas na atividade tóxica das estirpes selecionadas.
Soares, René Arderius; Passaglia, Luciane Maria Pereira
2010-10-01
Bradyrhizobium elkanii is successfully used in the formulation of commercial inoculants and, together with B. japonicum, it fully supplies the plant nitrogen demands. Despite the similarity between B. japonicum and B. elkanii species, several works demonstrated genetic and physiological differences between them. In this work Representational Difference Analysis (RDA) was used for genomic comparison between B. elkanii SEMIA 587, a crop inoculant strain, and B. japonicum USDA 110, a reference strain. Two hundred sequences were obtained. From these, 46 sequences belonged exclusively to the genome of B. elkanii strain, and 154 showed similarity to sequences from B. japonicum genome. From the 46 sequences with no similarity to sequences from B. japonicum, 39 showed no similarity to sequences in public databases and seven showed similarity to sequences of genes coding for known proteins. These seven sequences were divided in three groups: similar to sequences from other Bradyrhizobium strains, similar to sequences from other nitrogen-fixing bacteria, and similar to sequences from non nitrogen-fixing bacteria. These new sequences could be used as DNA markers in order to investigate the rates of genetic material gain and loss in natural Bradyrhizobium strains.
Delgado, María J; Tresierra-Ayala, Alvaro; Talbi, Chouhra; Bedmar, Eulogio J
2006-01-01
A modABC gene cluster that encodes an ABC-type, high-affinity molybdate transporter from Bradyrhizobium japonicum has been isolated and characterized. B. japonicum modA and modB mutant strains were unable to grow aerobically or anaerobically with nitrate as nitrogen source or as respiratory substrate, respectively, and lacked nitrate reductase activity. The nitrogen-fixing ability of the mod mutants in symbiotic association with soybean plants grown in a Mo-deficient mineral solution was severely impaired. Addition of molybdate to the bacterial growth medium or to the plant mineral solution fully restored the wild-type phenotype. Because the amount of molybdate required for suppression of the mutant phenotype either under free-living or under symbiotic conditions was dependent on sulphate concentration, it is likely that a sulphate transporter is also involved in Mo uptake in B. japonicum. The promoter region of the modABC genes has been characterized by primer extension. Reverse transcription and expression of a transcriptional fusion, P(modA)-lacZ, was detected only in a B. japonicum modA mutant grown in a medium without molybdate supplementation. These findings indicate that transcription of the B. japonicum modABC genes is repressed by molybdate.
Role of Bradyrhizobium japonicum and Trichoderma spp. in the control of root rot disease of soybean
Directory of Open Access Journals (Sweden)
Syed Ehteshamul-Haque
2014-08-01
Full Text Available Seed treatment of soybean with Bndyrhizobium japonicum, Trichoderma harzianum, T. viride, T. hamatum, T. koningii and T. pseudokoningii significantly controlled the infection of 30-day-old seedlingsby Maerophomina phaseolina, Rhizoctonia solani and Fusarium spp. In 60-day-old plants Trichoderma spp.. and B. japonicum inhibited the grouth of R. solani and Fusarium spp., whereas the use of B. japonicum (TAL-102 with T. harzianum. T. viride, T. koningii and T. pseudokoningii controlled the infection by M. phaseolina. Greater grain yield was recorded when B. japonium (TAI-102 was used with T. hamatum.
International Nuclear Information System (INIS)
AlWaheeb, Salah; AlMurshed, Maryam; Dashti, Fareed; Hira Parsotam R; AlSarrafd, Lamia
2007-01-01
Schistosomiasis (also known as bilharzia, bilharziasis, bilharziosis or snail fever) is a human disease syndrome caused by infection from one of several species of parasitic trematodes of the genus Schistosoma. The three main species infecting humans are S haematobium, S japonicum, and S mansoni. S japonicum is most common in the far east, mostly in China and the Philippines. We present an unusual case of S japonicum in a 32-year-old Filipino woman who had schistosomal ova studding the peritoneal cavity and forming a mass in the right iliac fossa. (author)
Tan, Wee-Cheat; Kuppusamy, Umah Rani; Phan, Chia-Wei; Tan, Yee-Shin; Raman, Jegadeesh; Anuar, Azliza Mad; Sabaratnam, Vikineswary
2015-01-01
Mushroom cultivation benefits humankind as it deliberately encourages wild mushrooms to be commercially propagated while recycling agricultural wastes. Ganoderma neo-japonicum is a rare polypore mushroom found growing on decaying Schizostachyum brachycladium (a tropical bamboo) clumps in Malaysia. The Malaysian indigenous tribes including the Temuans and Temiars use the basidiocarps of G. neo-japonicum to treat various ailments including diabetes. In this study, the domestication of G. neo-japonicum in artificial logs of different agricultural residues was investigated. Sawdust promoted the mycelia spawn colonisation in the shortest period of 38 ± 0.5 days. However, only sawdust and bamboo dust supported the primodia formation. Complex medium supported mycelium growth in submerged cultures and 27.11 ± 0.43 g/L of mycelia was obtained after 2 weeks of cultivation at 28 °C and 200 rpm. Antioxidant potential in mushroom may be influenced by different cultivation and extraction methods. The different extracts from the wild and cultivated basidiocarps as well as mycelia were then tested for their antioxidant properties. Aqueous and ethanol extracts of mycelia and basidiocarps tested had varying levels of antioxidant activities. To conclude, domestication of wild G. neo-japonicum using agroresidues may ensure a continuous supply of G. neo-japonicum for its medicinal use while ensuring the conservation of this rare species. PMID:26213331
Pectolinarigenin - A Flavonoid Compound from Cirsium Japonicum ...
African Journals Online (AJOL)
Protein expression of Bcl2 was almost completely inhibited upon the treatment with 25 μM pectolinarigenin. Conclusion: A rapid method to isolate high purity pectolinarigenin from C. japonicum and as well as evaluate its anti-proliferative potential and induction of apoptosis in MCF-7 breast cancer cells is presented for the ...
Isaza, Laura Arango; Opelt, Katja; Wagner, Tobias; Mattes, Elke; Bieber, Evi; Hatley, Elwood O; Roth, Greg; Sanjuán, Juan; Fischer, Hans-Martin; Sandermann, Heinrich; Hartmann, Anton; Ernst, Dieter
2011-01-01
A field study was conducted at the Russell E. Larson Agricultural Research Center to determine the effect of transgenic glyphosate-resistant soybean in combination with herbicide (Roundup) application on its endosymbiont Bradyrhizobium japonicum. DNA of bacteroids from isolated nodules was analysed for the presence of the transgenic 5-enolpyruvylshikimate-3-phosphate synthase (CP4-EPSPS) DNA sequence using polymerase chain reaction (PCR). To further assess the likelihood that the EPSPS gene may be transferred from the Roundup Ready (RR) soybean to B. japonicum, we have examined the natural transformation efficiency of B. japonicum strain 110spc4. Analyses of nodules showed the presence of the transgenic EPSPS DNA sequence. In bacteroids that were isolated from nodules of transgenic soybean plants and then cultivated in the presence of glyphosate this sequence could not be detected. This indicates that no stable horizontal gene transfer (HGT) of the EPSPS gene had occurred under field conditions. Under laboratory conditions, no natural transformation was detected in B. japonicum strain 110spc4 in the presence of various amounts of recombinant plasmid DNA. Our results indicate that no natural competence state exists in B. japonicum 110spc4. Results from field and laboratory studies indicate the lack of functional transfer of the CP4-EPSPS gene from glyphosate-tolerant soybean treated with glyphosate to root-associated B. japonicum.
Directory of Open Access Journals (Sweden)
Yan-Rong Yu
2016-04-01
Full Text Available In schistosomiasis, egg-induced hepatic granuloma formation is a cytokine-mediated, predominantly CD4+ Th2 immune response that can give rise to hepatic fibrosis. Hepatic fibrosis is the main cause of increased morbidity and mortality in humans with schistosome infection. Taurine has various physiological functions and hepatoprotective properties as well as anti-inflammatory and immunomodulatory activity. However, little is known about the role of taurine in schistosome egg-induced granuloma formation and fibrosis. We aimed to evaluate the therapeutic potential of taurine as preventative treatment for Schistosoma japonicum infection. Mice infected with S. japonicum cercariae were supplied with taurine drinking water (1% w/v for 4 weeks starting at 4 weeks post-infection. Taurine supplementation significantly improved the liver pathologic findings, reduced the serum levels of aminotransferases and area of hepatic granuloma, and prevented fibrosis progression. In addition, taurine decreased the expression of the granulomatous and fibrogenic mediators transforming growth factor β1, tumor necrosis factor α, monocyte chemotactic protein 1α and macrophage inflammatory protein 1α as well as the endoplasmic reticulum stress marker glucose-regulated protein 78. Thus, taurine can significantly attenuate S. japonicum egg-induced hepatic granuloma and fibrosis, which may depend in part on the downregulation of some relevant cytokine/chemokines and reducing the endoplasmic reticulum stress response. Keywords: Schistosomiasis, Schistosoma japonicum, Granuloma, Fibrosis, Taurine
Tang, Rui; Babendreier, Dirk; Zhang, Feng; Kang, Min; Song, Kai; Hou, Mao-Lin
2017-01-01
Two species of Trichogramma wasps were assessed for their effectiveness against yellow stem borer Scirpophaga incertulas. A laboratory cage test with T. japonicum and T. chilonis showed that both species parasitized yellow stem borer egg masses at 60.0% ± 9.13% and 40.7% ± 7.11%, respectively, with egg parasitism rates of 15.8% ± 22.2% for T. japonicum and 2.8% ± 5.0% for T. chilonis. Once the host eggs were parasitized, emergence rates were high for both species (95.7% ± 0.12% for T. japonicum and 100% for T. chilonis). In paddy field trials, the two Trichogramma species were released at three densities (50,000/ha, 100,000/ha and 200,000/ha) in Southwestern China. Egg mass parasitism was 9% ± 7.7% for T. japonicum and 15% ± 14.1% for T. chilonis, and again only a relatively small fraction of eggs was successfully parasitized. No clear conclusion could be drawn on the most efficient release rate as no significant differences were found among the three release rates. A comparison of field-collected T. japonicum with T. japonicum and T. chilonis mass reared on Corcyra cephalonica showed significantly larger body size and ovipositor length in field-collected wasps, suggesting potentially higher effectiveness on yellow stem borer eggs after at least one generation on the target host. Factors contributing to the low field parasitism rates are discussed. PMID:28208706
DEFF Research Database (Denmark)
McGarvey, Stephen T.; Carabin, Hélène; Batalong, Ernesto Jr.
2006-01-01
To estimate the association between the intensity of animal infection with Schistosoma japonicum and human infection in Western Samar province, the Philippines......To estimate the association between the intensity of animal infection with Schistosoma japonicum and human infection in Western Samar province, the Philippines...
International Nuclear Information System (INIS)
Moloney, N.A.; Webbe, G.; Hinchcliffe, P.
1987-01-01
Single percutaneous immunizations of Fischer rats with 1000 ultra-violet attenuated Schistosoma japonicum cercariae induced 52-88% resistance to challenge 4 weeks later. Increasing this to 3 immunizations induced 90% resistance to challenge, and this level of protection remained undiminished for up to 40 weeks after vaccination. Rats vaccinated with gamma-irradiated S. mansoni cercariae were resistant to challenge with S. mansoni but not S. japonicum. Similarly rats vaccinated with u.v.-attenuated S. japonicum cercariae were not resistant to heterologous challenge. Thus irradiated vaccines are species-specific in both permissive and non-permissive hosts. (author)
Directory of Open Access Journals (Sweden)
Stephen W Attwood
Full Text Available Schistosoma japonicum causes major public health problems in China and the Philippines; this parasite, which is transmitted by freshwater snails of the species Oncomelania hupensis, causes the disease intestinal schistosomiasis in humans and cattle. Researchers working on Schistosoma in Africa have described the relationship between the parasites and their snail intermediate hosts as coevolved or even as an evolutionary arms race. In the present study this hypothesis of coevolution is evaluated for S. japonicum and O. hupensis. The origins and radiation of the snails and the parasite across China, and the taxonomic validity of the sub-species of O. hupensis, are also assessed.The findings provide no evidence for coevolution between S. japonicum and O. hupensis, and the phylogeographical analysis suggests a heterochronous radiation of the parasites and snails in response to different palaeogeographical and climatic triggers. The results are consistent with a hypothesis of East to West colonisation of China by Oncomelania with a re-invasion of Japan by O. hupensis from China. The Taiwan population of S. japonicum appears to be recently established in comparison with mainland Chinese populations.The snail and parasite populations of the western mountain region of China (Yunnan and Sichuan appear to have been isolated from Southeast Asian populations since the Pleistocene; this has implications for road and rail links being constructed in the region, which will breach biogeographical barriers between China and Southeast Asia. The results also have implications for the spread of S. japonicum. In the absence of coevolution, the parasite may more readily colonise new snail populations to which it is not locally adapted, or even new intermediate host species; this can facilitate its dispersal into new areas. Additional work is required to assess further the risk of spread of S. japonicum.
In vitro propagation of katsura tree (Cercidiphyllum japonicum Sieb ...
African Journals Online (AJOL)
ajl5
Katsura tree (Cercidiphyllum japonicum Sieb. Et Zucc) is a long-lived, deciduous, wind-pollinated tree with dimorphic leaves. It is valued as an ornamental or a shade tree for landscape and a commercially valuable tree. Conventional propagation through seeds and cutting is not sufficient to satisfy the progressive demand.
Cytokine mRNA profiles in pigs exposed prenatally and postnatally to Schistosoma japonicum
DEFF Research Database (Denmark)
Techau, Michala E.; Johansen, Maria V.; Aasted, Bent
2007-01-01
of septal fibrosis were significantly higher in the postnatal group compared to the prenatal group (P prenatally infected animals compared to the control...... group (P prenatal group showed higher levels of TGF-beta 1 in the liver compared with the postnatally infected group (P control group (P prenatally exposed pigs.......The pig is a natural host for Schistosoma japonicum and a useful animal model of human infection. The aim of the present study was to assess the differences between the cytokine profiles in prenatally or postnatally S. japonicum exposed pigs. Seven prenatally exposed pigs, 7 postnatally exposed...
Identification and characterization of novel microRNAs from Schistosoma japonicum.
Directory of Open Access Journals (Sweden)
Xiangyang Xue
Full Text Available BACKGROUND: Schistosomiasis japonica remains a major public health problem in China. Its pathogen, Schistosoma japonicum has a complex life cycle and a unique repertoire of genes expressed at different life cycle stages. Exploring schistosome gene regulation will yield the best prospects for new drug targets and vaccine candidates. MicroRNAs (miRNAs are a highly conserved class of noncoding RNA that control many biological processes by sequence-specific inhibition of gene expression. Although a large number of miRNAs have been identified from plants to mammals, it remains no experimental proof whether schistosome exist miRNAs. METHODOLOGY AND RESULTS: We have identified novel miRNAs from Schistosoma japonicum by cloning and sequencing a small (18-26 nt RNA cDNA library from the adult worms. Five novel miRNAs were identified from 227 cloned RNA sequences and verified by Northern blot. Alignments of the miRNAs with corresponding family members indicated that four of them belong to a metazoan miRNA family: let-7, miR-71, bantam and miR-125. The fifth potentially new (non conserved miRNA appears to belong to a previously undescribed family in the genus Schistosome. The novel miRNAs were designated as sja-let-7, sja-miR-71, sja-bantam, sja-miR-125 and sja-miR-new1, respectively. Expression of sja-let-7, sja-miR-71 and sja-bantam were analyzed in six stages of the life cycle, i.e. egg, miracidium, sporocyst, cercaria, schistosomulum, and adult worm, by a modified stem-loop reverse transcribed polymerase chain reaction (RT-PCR method developed in our laboratory. The expression patterns of these miRNAs were highly stage-specific. In particular, sja-miR-71 and sja-bantam expression reach their peaks in the cercaria stage and then drop quickly to the nadirs in the schistosomulum stage, following penetration of cercaria into a mammalian host. CONCLUSIONS: Authentic miRNAs were identified for the first time in S. japonicum, including a new schistosome
Directory of Open Access Journals (Sweden)
Yupei Jin
Full Text Available The dioecious relic Cercidiphyllum japonicum is one of two species of the sole genus Cercidiphyllum, with a tight inflorescence lacking an apparent perianth structure. In addition, its systematic place has been much debated and, so far researches have mainly focused on its morphology and chloroplast genes. In our investigation, we identified 10 floral organ identity genes, including four A-class, three B-class, two C-class and one D-class. Phylogenetic analyses showed that all ten genes are grouped with Saxifragales plants, which confirmed the phylogenetic place of C. japonicum. Expression patterns of those genes were examined by quantitative reverse transcriptase PCR, with some variations that did not completely coincide with the ABCDE model, suggesting some subfunctionalization. As well, our research supported the idea that thebract actually is perianth according to our morphological and molecular analyses in Cercidiphyllum japonicum.
Jin, Yupei; Wang, Yubing; Zhang, Dechun; Shen, Xiangling; Liu, Wen; Chen, Faju
2017-01-01
The dioecious relic Cercidiphyllum japonicum is one of two species of the sole genus Cercidiphyllum, with a tight inflorescence lacking an apparent perianth structure. In addition, its systematic place has been much debated and, so far researches have mainly focused on its morphology and chloroplast genes. In our investigation, we identified 10 floral organ identity genes, including four A-class, three B-class, two C-class and one D-class. Phylogenetic analyses showed that all ten genes are grouped with Saxifragales plants, which confirmed the phylogenetic place of C. japonicum. Expression patterns of those genes were examined by quantitative reverse transcriptase PCR, with some variations that did not completely coincide with the ABCDE model, suggesting some subfunctionalization. As well, our research supported the idea that thebract actually is perianth according to our morphological and molecular analyses in Cercidiphyllum japonicum.
Wang, Xian-Hong; Zhou, Xiao-Nong; Vounatsou, Penelope; Chen, Zhao; Utzinger, Jürg; Yang, Kun; Steinmann, Peter; Wu, Xiao-Hua
2008-06-11
Spatial modeling is increasingly utilized to elucidate relationships between demographic, environmental, and socioeconomic factors, and infectious disease prevalence data. However, there is a paucity of studies focusing on spatio-temporal modeling that take into account the uncertainty of diagnostic techniques. We obtained Schistosoma japonicum prevalence data, based on a standardized indirect hemagglutination assay (IHA), from annual reports from 114 schistosome-endemic villages in Dangtu County, southeastern part of the People's Republic of China, for the period 1995 to 2004. Environmental data were extracted from satellite images. Socioeconomic data were available from village registries. We used Bayesian spatio-temporal models, accounting for the sensitivity and specificity of the IHA test via an equation derived from the law of total probability, to relate the observed with the 'true' prevalence. The risk of S. japonicum was positively associated with the mean land surface temperature, and negatively correlated with the mean normalized difference vegetation index and distance to the nearest water body. There was no significant association between S. japonicum and socioeconomic status of the villages surveyed. The spatial correlation structures of the observed S. japonicum seroprevalence and the estimated infection prevalence differed from one year to another. Variance estimates based on a model adjusted for the diagnostic error were larger than unadjusted models. The generated prediction map for 2005 showed that most of the former and current infections occur in close proximity to the Yangtze River. Bayesian spatial-temporal modeling incorporating diagnostic uncertainty is a suitable approach for risk mapping S. japonicum prevalence data. The Yangtze River and its tributaries govern schistosomiasis transmission in Dangtu County, but spatial correlation needs to be taken into consideration when making risk prediction at small scales.
DEFF Research Database (Denmark)
Li, Z.J.; Ge, J; Dai, J.R.
2016-01-01
Schistosomiasis caused by Schistosoma japonicum is a severe parasitic disease in The People's Republic of China and imposed considerable burden on human and domestic animal health and socioeconomic development. The significant achievement in schistosomiasis control has been made in last 60years. ....... Oncomelania hupensis as the only intermediate host of S. japonicum plays a key role in disease transmission. The habitat complexity of the snails challenges to effective control. In this review we share the experiences in control and research of O. hupensis....
van 't Wout, A. B.; de Jonge, N.; Tiu, W. U.; Garcia, E. E.; Mitchell, G. F.; Deelder, A. M.
1992-01-01
The presence of the schistosome circulating anodic antigen (CAA) in serum of patients infected with Schistosoma japonicum from The Philippines has been investigated using an enzyme-linked immunosorbent assay (ELISA). Serum samples were tested from 48 patients who excreted S. japonicum eggs, 9
Yu, Yan-Rong; Ni, Xian-Qiang; Huang, Jie; Zhu, Yong-Hong; Qi, Yong-Fen
2016-04-01
In schistosomiasis, egg-induced hepatic granuloma formation is a cytokine-mediated, predominantly CD4(+) Th2 immune response that can give rise to hepatic fibrosis. Hepatic fibrosis is the main cause of increased morbidity and mortality in humans with schistosome infection. Taurine has various physiological functions and hepatoprotective properties as well as anti-inflammatory and immunomodulatory activity. However, little is known about the role of taurine in schistosome egg-induced granuloma formation and fibrosis. We aimed to evaluate the therapeutic potential of taurine as preventative treatment for Schistosoma japonicum infection. Mice infected with S. japonicum cercariae were supplied with taurine drinking water (1% w/v) for 4 weeks starting at 4 weeks post-infection. Taurine supplementation significantly improved the liver pathologic findings, reduced the serum levels of aminotransferases and area of hepatic granuloma, and prevented fibrosis progression. In addition, taurine decreased the expression of the granulomatous and fibrogenic mediators transforming growth factor β1, tumor necrosis factor α, monocyte chemotactic protein 1α and macrophage inflammatory protein 1α as well as the endoplasmic reticulum stress marker glucose-regulated protein 78. Thus, taurine can significantly attenuate S. japonicum egg-induced hepatic granuloma and fibrosis, which may depend in part on the downregulation of some relevant cytokine/chemokines and reducing the endoplasmic reticulum stress response.
Directory of Open Access Journals (Sweden)
Cristina Lima de Macedo
2012-12-01
Full Text Available O objetivo deste trabalho foi selecionar e caracterizar estirpes nativas de Bacillus thuringiensis tóxicas a Diatraea saccharalis (Lepidoptera: Crambidae. Cento e seis estirpes pertencentes ao Banco de Bactérias de Invertebrados, da Embrapa Recursos Genéticos e Biotecnologia, foram testadas quanto à toxicidade a D. saccharalis, e, as mais tóxicas, caracterizadas por métodos bioquímicos e moleculares. Das 106 estirpes testadas, 16 causaram 100% de mortalidade em 24 horas. As três estirpes mais tóxicas apresentaram concentração letal média entre 8 e 43 ng cm-2. O perfil proteico das 16 estirpes mostrou a presença de proteínas de 130 e 65 kDa, e a caracterização molecular mostrou a presença dos genes tipo cry1 e cry2: cry1Aa, cry1Ab, cry1Ac e cry2Aa. A concentração letal média de esporos e cristais obtidos a partir de estirpes recombinantes, que expressavam individualmente os genes cry1Aa, cry1Ab, cry1Ac e cry2Aa, variou entre 222 e 610 ng cm-2, valores muito superiores aos das estirpes nativas mais tóxicas, que apresentavam possibilidade de expressão simultânea desses genes. Este resultado é indicativo de que há sinergia entre as toxinas. Há interação entre as toxinas de B. thuringiensis e seus receptores na broca-do-colmo da cana-de-açúcar.The objective of this work was to select and characterize native strains of Bacillus thuringiensis toxic to Diatraea saccharalis (Lepidoptera: Crambidae. A hundred-and-six strains, belonging to the bank of invertebrate bacteria (Brazil, of Embrapa Genetic Resources and Biotechnology, were tested as to their toxicity to D. saccharalis, and the most toxic ones were characterized by biochemical and molecular methods. Out of the 106 tested strains, 16 caused 100% mortality within 24 hours. The three most toxic strains showed median lethal concentrations between 8 and 43 ng cm-2. The protein profile of the 16 strains showed the presence of 130 and 65 kDa proteins, and the molecular
Directory of Open Access Journals (Sweden)
Xian-Hong Wang
Full Text Available BACKGROUND: Spatial modeling is increasingly utilized to elucidate relationships between demographic, environmental, and socioeconomic factors, and infectious disease prevalence data. However, there is a paucity of studies focusing on spatio-temporal modeling that take into account the uncertainty of diagnostic techniques. METHODOLOGY/PRINCIPAL FINDINGS: We obtained Schistosoma japonicum prevalence data, based on a standardized indirect hemagglutination assay (IHA, from annual reports from 114 schistosome-endemic villages in Dangtu County, southeastern part of the People's Republic of China, for the period 1995 to 2004. Environmental data were extracted from satellite images. Socioeconomic data were available from village registries. We used Bayesian spatio-temporal models, accounting for the sensitivity and specificity of the IHA test via an equation derived from the law of total probability, to relate the observed with the 'true' prevalence. The risk of S. japonicum was positively associated with the mean land surface temperature, and negatively correlated with the mean normalized difference vegetation index and distance to the nearest water body. There was no significant association between S. japonicum and socioeconomic status of the villages surveyed. The spatial correlation structures of the observed S. japonicum seroprevalence and the estimated infection prevalence differed from one year to another. Variance estimates based on a model adjusted for the diagnostic error were larger than unadjusted models. The generated prediction map for 2005 showed that most of the former and current infections occur in close proximity to the Yangtze River. CONCLUSION/SIGNIFICANCE: Bayesian spatial-temporal modeling incorporating diagnostic uncertainty is a suitable approach for risk mapping S. japonicum prevalence data. The Yangtze River and its tributaries govern schistosomiasis transmission in Dangtu County, but spatial correlation needs to be taken
Uptake and metabolism of carbohydrates by Bradyrhizobium japonicum bacteroids
International Nuclear Information System (INIS)
Salminen, S.O.; Streeter, J.G.
1987-01-01
Bradyrhizobium japonicum bacteroids were isolated anaerobically and were supplied with 14 C-labeled trehalose, sucrose, UDP-glucose, glucose, or fructose under low O 2 (2% in the gas phase). Uptake and conversion of 14 C to CO 2 were measured at intervals up to 90 minutes. Of the five compounds studied, UDP-glucose was most rapidly absorbed but it was very slowly metabolized. Trehalose was the sugar most rapidly converted to CO 2 , and fructose was respired at a rate of at least double that of glucose. Sucrose and glucose were converted to CO 2 at a very low but measurable rate ( 2 at a rate 30 times greater than the conversion of carbon Number 6 to CO 2 , indicating high activity of the pentose phosphate pathway. Enzymes of the Entner-Doudoroff pathway were not detected in bacteroids, but very low activities of sucrose synthase and phosphofructokinase were demonstrated. Although metabolism of sugars by B. japonicum bacteroids was clearly demonstrated, the rate of sugar uptake was only 1/30 to 1/50 the rate of succinate uptake. The overall results support the view that, although bacteroids metabolize sugars, the rates are very low and are inadequate to support nitrogenase
The effect of colostrum on pigs pre-natally or post-natally exposed to Schistosoma japonicum
DEFF Research Database (Denmark)
Techau, M.E.; Johansen, M.V.; Lind, Peter
2004-01-01
Pre-natal infection of Schistosoma japonicum in pigs may prove to be a useful model in shedding light on human pre-natal schistosomiasis. This study describes the effects of immune colostrum on worm burdens, tissue egg counts, liver pathology and crude worm or egg antigen-specific IgG and Ig......A responses, in groups of pigs pre-natally, pre-natally + post-natally or post-natally exposed to S. japonicum. Results suggest that pre-natal exposure and immune colostrum did not affect the establishment of a post-natal challenge infection. However, immune colostrum seemed to increase the levels of septal...
Detection of Extracellular Enzyme Activities in Ganoderma neo-japonicum
Jo, Woo-Sik; Park, Ha-Na; Cho, Doo-Hyun; Yoo, Young-Bok; Park, Seung-Chun
2011-01-01
The ability of Ganoderma to produce extracellular enzymes, including β-glucosidase, cellulase, avicelase, pectinase, xylanase, protease, amylase, and ligninase was tested in chromogenic media. β-glucosidase showed the highest activity, among the eight tested enzymes. In particular, Ganoderma neo-japonicum showed significantly stronger activity for β-glucosidase than that of the other enzymes. Two Ganoderma lucidum isolates showed moderate activity for avicelase; however, Ganoderma neo-japonic...
The temperature--dependent expression of GST of Schistosoma japonicum (Philippine strain).
Cai, Z H; Song, G C; Xu, Y X; Liu, S X
1993-03-01
Obtained from pSj5, the cDNA gene encoding GST antigen of Schistosoma japonicum (Philippine strain) was ligated with efficient temperature-dependent PBV220 vector which was constructed in CAPM, and then introduced into host bacterium-DH5 alpha (E. coli) by transformation. Transformants were selected by ampicillin and recombinant clones were identified by restriction mapping. The result showed that recombinant clone 43 was the one carrying recombinant plasmid PBV 220 with the correct insertion of the gene fragment. The GST expression ability of clone 43 was investigated by GST enzymic activity assay and SDS-PAGE. A relatively high level of GST enzymic activity was expressed by this clone under the temperature-dependent condition, that is, cultured at 30 degrees C and expressed at 42 degrees C. A more strongly stained 26 kDa protein band was identified by SDS-PAGE. The result indicated that GST of S. japonicum (Philippine strain) could be expressed not only by IPTG induction, but also by the temperature-dependent method.
Field testing of Schistosoma japonicum DNA vaccines in cattle in China.
Shi, Fuhui; Zhang, Yaobi; Lin, Jiaojiao; Zuo, Xin; Shen, Wei; Cai, Yiumin; Ye, Ping; Bickle, Quentin D; Taylor, Martin G
2002-11-01
Vaccines are needed to reduce the zoonotic reservoir of Schistosoma japonicum infection in bovines in China. We have developed two experimental DNA vaccines and have already shown these to be capable of inducing partial protection in water buffalo naturally exposed to the risk of S. japonicum infection in the field. We now report a similar field trial in cattle, the other major bovine reservoir host species in China. Groups of cattle were vaccinated with the VRSj28 vaccine or the VRSj23 vaccine, or, to test whether protection could be enhanced by combination vaccination, with both these DNA vaccines together. After vaccination, the cattle were exposed to natural infection in the field for a period of 54 days. Worm and egg counts carried out at the end of the experiment showed that each of the vaccine groups showed partial resistance, and that combined vaccination was not more effective than vaccination with the individual plasmids.
Approaches to genotyping individual miracidia of Schistosoma japonicum
Xiao, Ning; Remais, Justin V.; Brindley, Paul J.; Qiu, Dong-chuan; Carlton, Elizabeth J.; Li, Rong-zhi; Lei, Yang; Blair, David
2013-01-01
Molecular genetic tools are needed to address questions as to the source and dynamics of transmission of the human blood fluke Schistosoma japonicum in regions where human infections have re-emerged, and to characterize infrapopulations in individual hosts. The life-stage that interests us as a target for collecting genotypic data is the miracidium, a very small larval stage that consequently yields very little DNA for analysis. Here, we report the successful development of a multiplex format...
Directory of Open Access Journals (Sweden)
Patrícia P. Pinto
1998-10-01
Full Text Available High temperatures can affect the survival, establishment and symbiotic properties of Rhizobium strains. Bean nodulating Rhizobium strains are considered particularly sensitive because on this strains genetic recombinations and/or deletions occur frequently, thus compromising the use of these bacteria as inoculants. In this study R. tropici and R. leguminosarum bv. phaseoli strains isolated from Cerrado soils were exposed to thermal stress and the strains’ growth, survival and symbiotic relationships as well as alterations in their genotypic and phenotypic characteristics were analyzed. After successive thermal shocks at 45ºC for four hours, survival capacity appeared to be strain-specific, independent of thermo-tolerance and was more apparent in R. tropici strains. Certain R. leguminosarum bv. phaseoli strains had significant alterations in plant dry weight and DNA patterns obtained by AP-PCR method. R. tropici strains (with the exception of FJ2.21 were more stable than R. leguminosarum bv. phaseoli strains because no significant phenotypic alterations were observed following thermal treatments and they maintained their original genotypic pattern after inoculation in plants.Altas temperaturas podem afetar a sobrevivência, estabelecimento e as propriedades simbióticas em estirpes de Rhizobium. As estirpes capazes de nodular o feijoeiro têm sido consideradas particularmente sensíveis, porque nessas estirpes é comum a ocorrência de recombinações e/ou deleções genômicas comprometendo, muitas vezes, a sua utilização como inoculantes. Neste trabalho, procurou-se avaliar a capacidade de crescimento e sobrevivência em temperaturas elevadas de estirpes de Rhizobium efetivas na fixação de nitrogênio no feijoeiro isoladas dos cerrados, bem como avaliar suas características fenotípicas e genotípicas após choque térmico. A capacidade de sobrevivência à temperaturas elevadas, avaliada após choques térmicos sucessivos (45ºC por 4
Identification and characterization of microRNAs and endogenous siRNAs in Schistosoma japonicum
Directory of Open Access Journals (Sweden)
Wang Heng
2010-01-01
Full Text Available Abstract Background Small endogenous non-coding RNAs (sncRNAs such as small interfering RNA (siRNA, microRNA and other small RNA transcripts are derived from distinct loci in the genome and play critical roles in RNA-mediated gene silencing mechanisms in plants and metazoa. They are approximately 22 nucleotides long; regulate mRNA stability through perfect or imperfect match to the targets. The biological activities of sncRNAs have been related to many biological events, from resistance to microbe infections to cellular differentiation. The development of the zoonotic parasite Schistosoma japonicum parasite includes multiple steps of morphological alterations and biological differentiations, which provide a unique model for studies on the functions of small RNAs. Characterization of the genome-wide transcription of the sncRNAs will be a major step in understanding of the parasite biology. The objective of this study is to investigate the transcriptional profile and potential function of the small non-coding RNAs in the development of S. japanicum. Results The endogenous siRNAs were found mainly derived from transposable elements (TE or transposons and the natural antisense transcripts (NAT. In contrast to other organisms, the TE-derived siRNAs in S. japonicum were more predominant than other sncRNAs including microRNAs (miRNAs. Further, there were distinct length and 3'end variations in the sncRNAs, which were associated with the developmental differentiation of the parasite. Among the identified miRNA transcripts, there were 38 unique to S. japonicum and 16 that belonged to 13 miRNA families are common to other metazoan lineages. These miRNAs were either ubiquitously expressed, or they exhibited specific expression patterns related to the developmental stages or sex. Genes that encoded miRNAs are mainly located in clusters within the genome of S. japonicum. However, genes within one cluster could be differentially transcribed, which suggested
Directory of Open Access Journals (Sweden)
Lílian Botelho Praça
2004-01-01
Full Text Available O objetivo deste trabalho foi selecionar entre 300 estirpes de Bacillus thuringiensis as efetivas simultaneamente contra larvas de Spodoptera frugiperda J.E. Smith e Anticarsia gemmatalis Hübner (Lepidoptera: Noctuidae, Anthonomus grandis Boheman (Coleoptera: Curculionidae, Aedes aegypti Linnaeus e Culex quinquefasciatus Say (Diptera: Culicidae. Foram selecionadas duas estirpes de B. thuringiensis, denominadas S234 e S997, que apresentaram atividade contra as três ordens de insetos. As estirpes foram caracterizadas por métodos morfológicos, bioquímicos e moleculares. As mesmas apresentaram duas proteínas principais de 130 e 65 kDa, produtos de reação em cadeia da polimerase de tamanho esperado para a detecção dos genes cry1Aa, cry1Ab, cry1Ac, cry1B e cry2 e cristais bipiramidais, cubóides e esféricos.The aim of this work was to select among 300 strains of Bacillus thuringiensis those which are simultaneously effective against larvae of Spodoptera frugiperda J.E. Smith and Anticarsia gemmatalis Hübner (Lepidoptera: Noctuidae, Anthonomus grandis Boheman (Coleoptera: Curculionidae, Aedes aegypti Linnaeus and Culex quinquefasciatus Say (Diptera: Culicidae. Two strains of B. thuringiensis were selected, S234 and S997, which presented activity against those three insect orders. Both strains were characterized by morphological, biochemical and molecular methods. They have presented two main proteins with 130 and 65 kDa, polimerase chain reaction products with expected sizes for detection of the genes cry1Aa, cry1Ab, cry1Ac, cry1B and cry2 and bipiramidal, cubical and spherical crystals.
Directory of Open Access Journals (Sweden)
Elizabeth J Carlton
Full Text Available In light of multinational efforts to reduce helminthiasis, we evaluated whether there exist high-risk subpopulations for helminth infection. Such individuals are not only at risk of morbidity, but may be important parasite reservoirs and appropriate targets for disease control interventions.We followed two longitudinal cohorts in Sichuan, China to determine whether there exist persistent human reservoirs for the water-borne helminth, Schistosoma japonicum, in areas where treatment is ongoing. Participants were tested for S. japonicum infection at enrollment and two follow-up points. All infections were promptly treated with praziquantel. We estimated the ratio of the observed to expected proportion of the population with two consecutive infections at follow-up. The expected proportion was estimated using a prevalence-based model and, as highly exposed individuals may be most likely to be repeatedly infected, a second model that accounted for exposure using a data adaptive, machine learning algorithm. Using the prevalence-based model, there were 1.5 and 5.8 times more individuals with two consecutive infections than expected in cohorts 1 and 2, respectively (p<0.001 in both cohorts. When we accounted for exposure, the ratio was 1.3 (p = 0.013 and 2.1 (p<0.001 in cohorts 1 and 2, respectively.We found clustering of infections within a limited number of hosts that was not fully explained by host exposure. This suggests some hosts may be particularly susceptible to S. japonicum infection, or that uncured infections persist despite treatment. We propose an explanatory model that suggests that as cercarial exposure declines, so too does the size of the vulnerable subpopulation. In low-prevalence settings, interventions targeting individuals with a history of S. japonicum infection may efficiently advance disease control efforts.
Directory of Open Access Journals (Sweden)
P. Fareleira
2007-07-01
Full Text Available O trabalho teve como principal objectivo a obtenção de estirpes de rizóbio adequadas à nodulação de luzernas anuais e adaptadas a sobreviver nas condições ambientais susceptíveis de ocorrer em solos degradados. Dado que as populações de rizóbio apresentam variabilidade considerável no que respeita à tolerância a factores ambientais, os estudos focaram-se na pesquisa e na selecção de estirpes resistentes a condições adversas. Efectuaram-se colheitas de solos em diversas zonas no sul do País, seleccionando-se locais afectados por secura, temperaturas elevadas e, pontualmente, salinidade. A partir destes solos, isolaram-se estirpes de rizóbio, usando como planta hospedeira a luzerna anual Medicago polymorpha. Estudaram-se os efeitos de condições de stresse ambiental, como a salinidade e as altas temperaturas, no crescimento das estirpes isoladas. Dos 41 isolamentos analisados, 11 apresentaram crescimento em meio con-tendo 1,4 M de cloreto de sódio e suplementado com 10% de extracto de terra, e 22 cresceram quando incubadas a 45 ºC em meio sem aditivos. Três estirpes mostraram ter capacidade para crescer sob os efeitos conjuntos da salinidade e da alta temperatura. A análise de extractos etanólicos de estirpes tolerantes à salinidade revelou, na maior parte dos casos, a acumulação, induzida pelo sal, dos solutos compatíveis de Sinorhizobium: o dipéptido N - acetilglutaminilglutamina amida, vários tipos de betaínas, trealose, glutamato e prolina. A observação, por NMR de 31P in vivo, de uma estirpe tolerante ao sal, proveniente de um solo xistoso de baixo teor em fósforo, mostrou a presença de níveis elevados de reservas intracelulares de fosfato inorgânico (polifosfato, sugerindo um bom potencial para utilização em solos onde os riscos de salinização se conjuguem com deficiências em fósforo assimilável.The main objective of this work was to obtain rhizobial strains able to nodulate annual medics and
Iwanaga, Yuzuru; Tsuji, Moriyasu; Tanaka, Noriyasu
1988-01-01
Antigenic communities were studied with sera from rabbits immunized with the Yamanashi and Chinese strains of Schistosoma japonicum eggs, and the antigens of five subspecies of Oncomelania snails, by immunoelectrophoresis. With regard to antigenic communities defined by the Yamanashi strain of S. japonicum eggs and Oncomelania snails, the schistosome egg produced 5 to 6 bands with Oncomelania hupensis nosophora, 3 to 4 bands with O.h.hupensis, 3 bands with O.h.chiui, 2 bands with O.h.quad...
Directory of Open Access Journals (Sweden)
Xin Long
Full Text Available The aim of this study was to determine whether two polymorphisms in the gene encoding IL13 previously associated with Schistosoma hematobium (S. hematobium and S. mansoni infection are associated with S. japonicum infection. Single nucleotide polymorphisms (SNPs rs1800925 (IL13/-1112C>T and rs20541 (IL13R130Q were genotyped in 947 unrelated individuals (307 chronically infected, 339 late-stage with liver fibrosis, 301 uninfected controls from a schistosomiasis-endemic area of Hubei province in China. Regression models were used to evaluate allelic and haplotypic associations with chronic and late-stage schistosomiasis adjusted for non-genetic covariates. Expression of IL-13 was measured in S. japonicun-infected liver fibrosis tissue and normal liver tissue from uninfected controls by immunohistochemistry (IHC. The role of rs1800925 in IL-13 transcription was further determined by Luciferase report assay using the recombinant PGL4.17-rs180092 plasmid. We found SNP rs1800925T was associated with late-stage schistosomiasis caused by S. japonicum but not chronic schistosomiasis (OR = 1.39, 95%CI = 1.02-1.91, p = 0.03 and uninfected controls (OR = 1.49, 95%CI = 1.03-2.13, p = 0.03. Moreover, the haplotype rs1800925T-rs20541C increased the risk of disease progression to late-stage schistosomiasis (OR = 1.46, p = 0.035, whereas haplotype rs1800925C-rs20541A showed a protective role against development of late-stage schistosomiasis (F = 0.188, OR = 0.61, p = 0.002. Furthermore, S. japonicum-induced fibrotic liver tissue had higher IL13 expression than normal liver tissue. Plasmid PGL4.17-rs1800925T showed a stronger relative luciferase activity than Plasmid PGL4.17-rs1800925C in 293FT, QSG-7701 and HL-7702 cell lines. In conclusion, the functional IL13 polymorphism, rs1800925T, previously associated with risk of schistosomiasis, also contributes to risk of late-stage schistosomiasis caused by S. japonicum.
Spatial risk profiling of Schistosoma japonicum in Eryuan county, Yunnan province, China
Directory of Open Access Journals (Sweden)
Peter Steinmann
2007-11-01
Full Text Available Bayesian spatial risk profiling holds promise to enhance our understanding of the epidemiology of parasitic diseases, and to target interventions in a cost-effective manner. Here, we present findings from a study using Bayesian variogram models to map and predict the seroprevalence of Schistosoma japonicum in Eryuan county, Yunnan province, China, including risk factor analysis. Questionnaire and serological data were obtained through a cross-sectional survey carried out in 35 randomly selected villages with 3,220 people enrolled. Remotely-sensed environmental data were derived from publicly available databases. Bivariate and non-spatial Bayesian multiple logistic regression models were used to identify associations between the local seroprevalence and demographic (i.e. age and sex, environmental (i.e. location of village, altitude, slope, land surface temperature and normalized difference vegetation index and socio-economic factors. In the spatially-explicit Bayesian model, S. japonicum seroprevalence was significantly associated with sex, age and the location of the village. Males, those aged below 10 years and inhabitants of villages situated on steep slopes (inclination ≥20° or on less precipitous slopes of >5° above 2,150 m were at lower risk of seroconversion than their respective counterparts. Our final prediction model revealed an elevated risk for seroconversion in the plains of the eastern parts of Eryuan county. In conclusion, the prediction map can be utilized for spatial targeting of schistosomiasis control interventions in Eryuan county. Moreover, S. japonicum seroprevalence studies might offer a convenient means to assess the infection pressure experienced by local communities, and to improve risk profiling in areas where the prevalence and infection intensities have come down following repeated rounds of praziquantel administration.
Directory of Open Access Journals (Sweden)
Amara E Ezeamama
Full Text Available To determine whether treatment of intestinal parasitic infections improves cognitive function in school-aged children, we examined changes in cognitive testscores over 18 months in relation to: (i treatment-related Schistosoma japonicum intensity decline, (ii spontaneous reduction of single soil-transmitted helminth (STH species, and (iii ≥2 STH infections among 253 S. japonicum-infected children.Helminth infections were assessed at baseline and quarterly by the Kato-Katz method. S. japonicum infection was treated at baseline using praziquantel. An intensity-based indicator of lower vs. no change/higher infection was defined separately for each helminth species and joint intensity declines of ≥2 STH species. In addition, S. japonicum infection-free duration was defined in four categories based on time of schistosome re-infection: >18 (i.e. cured, >12 to ≤18, 6 to ≤12 and ≤6 (persistently infected months. There was no baseline treatment for STHs but their intensity varied possibly due to spontaneous infection clearance/acquisition. Four cognitive tests were administered at baseline, 6, 12, and 18 months following S. japonicum treatment: learning and memory domains of Wide Range Assessment of Memory and Learning (WRAML, verbal fluency (VF, and Philippine nonverbal intelligence test (PNIT. Linear regression models were used to relate changes in respective infections to test performance with adjustment for sociodemographic confounders and coincident helminth infections.Children cured (β = 5.8; P = 0.02 and those schistosome-free for >12 months (β = 1.5; P = 0.03 scored higher in WRAML memory and VF tests compared to persistently infected children independent of STH infections. A decline vs. no change/increase of any individual STH species (β:11.5-14.5; all P12 months post-treatment and those who experienced declines of ≥2 STH species scored higher in three of four cognitive tests. Our result suggests that sustained
Structural characterization of the thermostable Bradyrhizobium japonicumD-sorbitol dehydrogenase.
Fredslund, Folmer; Otten, Harm; Gemperlein, Sabrina; Poulsen, Jens Christian N; Carius, Yvonne; Kohring, Gert Wieland; Lo Leggio, Leila
2016-11-01
Bradyrhizobium japonicum sorbitol dehydrogenase is NADH-dependent and is active at elevated temperatures. The best substrate is D-glucitol (a synonym for D-sorbitol), although L-glucitol is also accepted, giving it particular potential in industrial applications. Crystallization led to a hexagonal crystal form, with crystals diffracting to 2.9 Å resolution. In attempts to phase the data, a molecular-replacement solution based upon PDB entry 4nbu (33% identical in sequence to the target) was found. The solution contained one molecule in the asymmetric unit, but a tetramer similar to that found in other short-chain dehydrogenases, including the search model, could be reconstructed by applying crystallographic symmetry operations. The active site contains electron density consistent with D-glucitol and phosphate, but there was not clear evidence for the binding of NADH. In a search for the features that determine the thermostability of the enzyme, the T m for the orthologue from Rhodobacter sphaeroides, for which the structure was already known, was also determined, and this enzyme proved to be considerably less thermostable. A continuous β-sheet is formed between two monomers in the tetramer of the B. japonicum enzyme, a feature not generally shared by short-chain dehydrogenases, and which may contribute to thermostability, as may an increased Pro/Gly ratio.
Gordon, Catherine A.; Acosta, Luz P.; Gobert, Geoffrey N.; Jiz, Mario; Olveda, Remigio M.; Ross, Allen G.; Gray, Darren J.; Williams, Gail M.; Harn, Donald; Li, Yuesheng; McManus, Donald P.
2015-01-01
The cause of zoonotic schistosomiasis in the Philippines is Schistosoma japonicum, which infects up to 46 mammalian hosts, including humans and bovines. In China, water buffaloes have been identified as major reservoir hosts for schistosomiasis japonica, contributing up to 75% of human transmission. In the Philippines, water buffaloes (carabao; Bubalus bubalis carabanesis) have, historically, been considered unimportant reservoirs. We therefore revisited the possible role of bovines in schistosome transmission in the Philippines, using the recently described formalin-ethyl acetate sedimentation (FEA-SD) technique and a qPCR assay to examine fecal samples from 153 bovines (both carabao and cattle) from six barangays in Northern Samar. A high prevalence of S. japonicum was found using qPCR and FEA-SD in both cattle (87.50% and 77.08%, respectively) and carabao (80.00% and 55.24%, respectively). The average daily egg output for each bovine was calculated at 195,000. High prevalence and infection intensity of F. gigantica was also found in the bovines by qPCR and FEA-SD (95.33% and 96.00%, respectively). The identification of bovines as major reservoir hosts for S. japonicum transmission suggests that bovine treatment and/or vaccination, as one becomes available, should be included in any future control program that aims to reduce the disease burden due to schistosomiasis in the Philippines. PMID:25643317
Directory of Open Access Journals (Sweden)
Feng Liu
2006-04-01
Full Text Available Schistosomiasis remains a serious public health problem with an estimated 200 million people infected in 76 countries. Here we isolated ~ 8,400 potential protein-encoding cDNA contigs from Schistosoma japonicum after sequencing circa 84,000 expressed sequence tags. In tandem, we undertook a high-throughput proteomics approach to characterize the protein expression profiles of a number of developmental stages (cercariae, hepatic schistosomula, female and male adults, eggs, and miracidia and tissues at the host-parasite interface (eggshell and tegument by interrogating the protein database deduced from the contigs. Comparative analysis of these transcriptomic and proteomic data, the latter including 3,260 proteins with putative identities, revealed differential expression of genes among the various developmental stages and sexes of S. japonicum and localization of putative secretory and membrane antigens, enzymes, and other gene products on the adult tegument and eggshell, many of which displayed genetic polymorphisms. Numerous S. japonicum genes exhibited high levels of identity with those of their mammalian hosts, whereas many others appeared to be conserved only across the genus Schistosoma or Phylum Platyhelminthes. These findings are expected to provide new insights into the pathophysiology of schistosomiasis and for the development of improved interventions for disease control and will facilitate a more fundamental understanding of schistosome biology, evolution, and the host-parasite interplay.
Directory of Open Access Journals (Sweden)
Catherine A Gordon
2015-02-01
Full Text Available The cause of zoonotic schistosomiasis in the Philippines is Schistosoma japonicum, which infects up to 46 mammalian hosts, including humans and bovines. In China, water buffaloes have been identified as major reservoir hosts for schistosomiasis japonica, contributing up to 75% of human transmission. In the Philippines, water buffaloes (carabao; Bubalus bubalis carabanesis have, historically, been considered unimportant reservoirs. We therefore revisited the possible role of bovines in schistosome transmission in the Philippines, using the recently described formalin-ethyl acetate sedimentation (FEA-SD technique and a qPCR assay to examine fecal samples from 153 bovines (both carabao and cattle from six barangays in Northern Samar. A high prevalence of S. japonicum was found using qPCR and FEA-SD in both cattle (87.50% and 77.08%, respectively and carabao (80.00% and 55.24%, respectively. The average daily egg output for each bovine was calculated at 195,000. High prevalence and infection intensity of F. gigantica was also found in the bovines by qPCR and FEA-SD (95.33% and 96.00%, respectively. The identification of bovines as major reservoir hosts for S. japonicum transmission suggests that bovine treatment and/or vaccination, as one becomes available, should be included in any future control program that aims to reduce the disease burden due to schistosomiasis in the Philippines.
Directory of Open Access Journals (Sweden)
Ligiane Aparecida Florentino
2010-08-01
Full Text Available The genetic diversity of ten Bradyrhizobium strains was evaluated for tolerance to high temperatures, to different salinity levels and for the efficiency of symbiosis with cowpea plants (Vigna unguiculata (L. Walp.. Eight of these strains were isolated from nodules that appeared on cowpea after inoculation with suspensions of soil sampled from around the root system of Sesbania virgata (wand riverhemp in ecosystems of South Minas Gerais. The other two strains used in our analyses as references, were from the Amazon and are currently recommended as cowpea inoculants. Genetic diversity was analyzed by amplifying repetitive DNA elements with the BOX primer, revealing high genetic diversity with each strain presenting a unique band profile. Leonard jar assays showed that the strains UFLA 03-30 and UFLA 03-38 had the highest N2-fixing potentials in symbiosis with cowpea. These strains had more shoot and nodule dry matter, more shoot N accumulation, and a higher relative efficiency than the strains recommended as inoculants. All strains grew in media of pH levels ranging from 4.0 to 9.0. The strains with the highest N2-fixing efficiencies in symbiosis with cowpea were also tolerant to the greatest number of antibiotics. However, these strains also had the lowest tolerance to high salt concentrations. All strains, with the exceptions of UFLA 03-84 and UFLA 03-37, tolerated temperatures of up to 40 ºC. The genetic and phenotypic characteristics of the eight strains isolated from soils of the same region were highly variable, as well as their symbiotic efficiencies, despite their common origin. This variability highlights the importance of including these tests in the selection of cowpea inoculant strains.Dez estirpes de rizóbios, sendo oito isoladas de amostras de solos coletadas próximo ao sistema radicular de Sesbania virgata, no Sul de Minas Gerais, e duas recomendadas como inoculante para o caupi (Vigna unguiculata (L. Walp. usadas como refer
Directory of Open Access Journals (Sweden)
Jonathan A Shortt
2017-01-01
Full Text Available In areas where schistosomiasis control programs have been implemented, morbidity and prevalence have been greatly reduced. However, to sustain these reductions and move towards interruption of transmission, new tools for disease surveillance are needed. Genomic methods have the potential to help trace the sources of new infections, and allow us to monitor drug resistance. Large-scale genotyping efforts for schistosome species have been hindered by cost, limited numbers of established target loci, and the small amount of DNA obtained from miracidia, the life stage most readily acquired from humans. Here, we present a method using next generation sequencing to provide high-resolution genomic data from S. japonicum for population-based studies.We applied whole genome amplification followed by double digest restriction site associated DNA sequencing (ddRADseq to individual S. japonicum miracidia preserved on Whatman FTA cards. We found that we could effectively and consistently survey hundreds of thousands of variants from 10,000 to 30,000 loci from archived miracidia as old as six years. An analysis of variation from eight miracidia obtained from three hosts in two villages in Sichuan showed clear population structuring by village and host even within this limited sample.This high-resolution sequencing approach yields three orders of magnitude more information than microsatellite genotyping methods that have been employed over the last decade, creating the potential to answer detailed questions about the sources of human infections and to monitor drug resistance. Costs per sample range from $50-$200, depending on the amount of sequence information desired, and we expect these costs can be reduced further given continued reductions in sequencing costs, improvement of protocols, and parallelization. This approach provides new promise for using modern genome-scale sampling to S. japonicum surveillance, and could be applied to other schistosome species
Shortt, Jonathan A; Card, Daren C; Schield, Drew R; Liu, Yang; Zhong, Bo; Castoe, Todd A; Carlton, Elizabeth J; Pollock, David D
2017-01-01
In areas where schistosomiasis control programs have been implemented, morbidity and prevalence have been greatly reduced. However, to sustain these reductions and move towards interruption of transmission, new tools for disease surveillance are needed. Genomic methods have the potential to help trace the sources of new infections, and allow us to monitor drug resistance. Large-scale genotyping efforts for schistosome species have been hindered by cost, limited numbers of established target loci, and the small amount of DNA obtained from miracidia, the life stage most readily acquired from humans. Here, we present a method using next generation sequencing to provide high-resolution genomic data from S. japonicum for population-based studies. We applied whole genome amplification followed by double digest restriction site associated DNA sequencing (ddRADseq) to individual S. japonicum miracidia preserved on Whatman FTA cards. We found that we could effectively and consistently survey hundreds of thousands of variants from 10,000 to 30,000 loci from archived miracidia as old as six years. An analysis of variation from eight miracidia obtained from three hosts in two villages in Sichuan showed clear population structuring by village and host even within this limited sample. This high-resolution sequencing approach yields three orders of magnitude more information than microsatellite genotyping methods that have been employed over the last decade, creating the potential to answer detailed questions about the sources of human infections and to monitor drug resistance. Costs per sample range from $50-$200, depending on the amount of sequence information desired, and we expect these costs can be reduced further given continued reductions in sequencing costs, improvement of protocols, and parallelization. This approach provides new promise for using modern genome-scale sampling to S. japonicum surveillance, and could be applied to other schistosome species and other
Análise proteómica de uma estirpe clínica de Staphylococcus aureus ST398 resistente à meticilina
Monteiro, Ricardo Jorge Rego
2015-01-01
Dissertação de Mestrado em Genética Molecular Comparativa e Tecnológica Actualmente a proteómica é uma ferramenta muito utilizada na análise das diferenças na expressão de genes em estirpes bacterianas. Há muitos anos que Staphylococcus aureus tem sido reconhecido como um importante agente patogénico responsável por doenças humanas. A dificuldade no tratamento e o surgimento constante de múltiplas resistências a antibióticos têem feito deste organismo um importante foco de e...
International Nuclear Information System (INIS)
Shi, Y.E.; Jiang, C.F.; Han, J.J.; Li, Y.L.; Ruppel, A.
1990-01-01
Water buffaloes were vaccinated three times with 10,000 Schistosoma japonicum cercariae irradiated with ultraviolet (uv) light at a dose of 400 microW x min/cm2. The irradiation was performed with cheap, simple, and portable equipment in a rural area of Hubei Province (People's Republic of China). A challenge infection of 1000 untreated cercariae was given to six vaccinated and six naive control buffaloes, while two vaccinated animals were not challenged. The experiment was terminated 6 weeks after the challenge. Control animals had lost body weight and harbored a mean of 110 worms and 37 eggs per gram of liver. The vaccinated animals gained weight after the challenge and developed 89% resistance to infection with S. japonicum. Since schistosomiasis japonica is nowadays transmitted in China predominantly by domestic livestock, a uv-attenuated cercarial vaccine for bovines may contribute to the control of this disease
Clinical diagnostic value of viable Schistosoma japonicum eggs detected in host tissues.
Gu, Kongzhen; Li, Yuesheng; Driguez, Patrick; Zeng, Qingren; Yu, Xinlin; Sun, Hui; Cai, Liting; He, Yongkang; Wang, Wenyang; McManus, Donald P
2017-04-04
Schistosomiasis, one of the neglected tropical diseases, is endemic in more than 70 countries. However, the clinical diagnosis of patients with a low degree of infection is an unsolved technical problem. In areas endemic for schistosomiasis japonica, proctoscopy detection of eggs has been one method used for clinical diagnosis. However, it is often a challenge to find typical live eggs and it is difficult to distinguish live eggs from large numbers of partially degraded and/or completely degraded eggs within colon biopsy tissue. To address this problem, we tested six different morphological and biochemical/molecular markers (ALP; morphological characteristics of egg; CalS (calcified substance); AOS (antioxidase); SDHG (succinic dehydrogenase) and SjR2 mRNA (retrotransposons 2 of S.japonicum genome mRNA)), including four new markers (CalS; AOS; SDHG and SjR2 mRNA.), to determine the viability of S. japonicum eggs deposited in human and mouse colon tissues. Our ultimate aim is to obtain a new method that is more sensitive, practical and accurate to clinically diagnose schistosomiasis. Tissue samples were collected from mice at six different time points during S. japonicum infection with or without treatment with praziquantel (PZQ). Four new biochemical or molecular markers were used for the detection of egg viability from mouse liver and intestinal samples: CalS; AOS; SDHG and SjR2 mRNA. Subsequently, all markers were employed for the detection and analysis of eggs deposited in biopsy materials from patients with suspected schistosomiasis japonica for clinical evaluation. Microscopic examination of the egg morphology, worm burden in vivo and ALP (alkaline phosphatase) levels were used as a reference standard to evaluate the sensitivity and reliability of four new markers detecting egg viability. The results of the study showed that the morphology of S. japonicum eggs deposited in tissues of hosts with schistosomiasis, especially cases with chronic schistosomiasis, is
Silva, Luís R; Pereira, Maria J; Azevedo, Jessica; Mulas, Rebeca; Velazquez, Encarna; González-Andrés, Fernando; Valentão, Patrícia; Andrade, Paula B
2013-12-15
Soybean (Glycine max (L.) Merrill) is one of the most important food crops for human and animal consumption, providing oil and protein at relatively low cost. The least expensive source of nitrogen for soybean is the biological fixation of atmospheric nitrogen by the symbiotic association with soil bacteria, belonging mainly to the genus Bradyrhizobium. This study was conducted to assess the effect of the inoculation of G. max with Bradyrhizobium japonicum on the metabolite profile and antioxidant potential of its seeds. Phenolic compounds, sterols, triterpenes, organic acids, fatty acids and volatiles profiles were characterised by different chromatographic techniques. The antioxidant activity was evaluated against DPPH, superoxide and nitric oxide radicals. Inoculation with B. japonicum induced changes in the profiles of primary and secondary metabolites of G. max seeds, without affecting their antioxidant capacity. The increase of organic and fatty acids and volatiles suggest a positive effect of the inoculation process. These findings indicate that the inoculation with nodulating B. japonicum is a beneficial agricultural practice, increasing the content of bioactive metabolites in G. max seeds owing to the establishment of symbiosis between plant and microorganism, with direct effects on seed quality. Copyright © 2013 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
I. C. B. Trannin
2001-06-01
Full Text Available Com o objetivo de avaliar a tolerância a metais pesados "in vitro" de estirpes inoculantes (I, isolados de solos contaminados com metais (ISC e de solos não contaminados (ISNC de Bradyrhizobium, simbiontes de Enterolobium contortisiliquum (tamboril e de Acacia mangium (acácia e de Azorhizobium, simbiontes de Sesbania virgata (sesbânia, foram realizados dois experimentos. No primeiro, dez estirpes e, ou, isolados para cada espécie vegetal foram testados em meio YMA modificado por adição de tampões biológicos (HEPES e MES, suplementado com diferentes concentrações de Cu, Cd e Zn. Cobre e Cd foram testados em concentrações de 0 a 40 mg L-1, para ambos os gêneros, enquanto Zn variou de 0 a 1.000 mg L-1, para Bradyrhizobium, e de 0 a 500 mg L-1, para Azorhizobium. O crescimento de rizóbio nas diferentes concentrações de metais foi avaliado com atribuição de valores para os padrões observados (0 a 5. Os ISC de ambos os gêneros foram mais tolerantes, mas Bradyrhizobium tolerou Zn (800 mg L-1 até duas vezes e Cu (40 mg L-1 até oito vezes mais que Azorhizobium. No segundo experimento, estirpes e isolados tolerantes (T, sensíveis (S e de tolerância média (TM a metais selecionados em meio YMA modificado foram estudados em soluções aquosas com diferentes concentrações de Cu (0 a 0,01 mg L-1, Cd e Zn (0 a 1,0 mg L-1. A avaliação do número de células viáveis em soluções de metais foi feita por contagem das unidades formadoras de colônia em 0, 24, 48, 72 e 96 h de incubação, pelo método das diluições sucessivas e inoculação em YMA. Embora as soluções de metais tenham sido mais discriminatórias quanto a tolerância a metais que o meio YMA, estes dois métodos mostraram que: (a Azorhizobium foi mais sensível que Bradyrhizobium, (b os ISC de ambos os gêneros foram mais tolerantes do que os ISNC e (c a ordem de toxidez dos metais foi Cu > Cd > Zn.
Directory of Open Access Journals (Sweden)
Patrícia Teles Medeiros
2005-11-01
Full Text Available O objetivo deste trabalho foi selecionar e caracterizar, no Banco de Germoplasma de Bacillus spp., da Empresa Brasileira de Pesquisa Agropecuária, as estirpes de Bacillus thuringiensis mais tóxicas à Plutella xylostella, por métodos morfológicos, bioquímicos e moleculares. Das 203 estirpes testadas, sete causaram 100% de mortalidade e foram semelhantes à estirpe padrão utilizada, B. thuringiensis subsp. kurstaki. Elas apresentaram proteínas de 130 kDa e 65 kDa, presença de genes cry1 e cry2 e cristais bipiramidais, cubóides e redondos. As estirpes selecionadas oferecem novas perspectivas de controle de P. xylostella.The aim of this work was to select and characterize the most toxic Bacillus thuringiensis strains, from the Germplasm Bank of Bacillus spp. of Empresa Brasileira de Pesquisa Agropecuária, against Plutella xylostella. Strains were characterized by morphological, biochemical and molecular methods. It was observed that seven out of the 203 strains tested showed high toxicity compared to the standard used B. thuringiensis subsp. kurstaki (HD-1, which showed 100% mortality. Selected strains showed features described for lepidoptera regarding the protein of 130 kDa and 65 kDa; profile and features were obtained through the PCR reactions, making possible to identify the presence of cry1 and cry2 genes. Moreover, the scanning electron microscopy showed the bipiramydal, cubed and round crystal forms. The selected strains offer new perspectives to control P. xylostella.
Directory of Open Access Journals (Sweden)
Eliana Scarcelli
2005-12-01
Full Text Available The objective of the present trial was to characterize genetically strains of Campylobacter jejuni subsp. jejuni isolated from humans and several animal sources (bovines, swine, dogs, primates, wild boars and poultry. A total of 828 different animal samples (feces, carcass, aborted fetus and hysterectomized uterus were analysed by means of routine bacteriological methods, and 36 C. jejuni strains were isolated. Thirty strains of human fecal origin were obtained in clinical analysis laboratories in the city of São Paulo. The 66 C. jejuni strains isolated were submitted to genetic characterization. Primers based on fla A gene were used in a polymerase chain reaction (PCR and amplified a fragment of the 702 bp. PCR products were evaluated by means of sequencing and genealogic analysis. Genetic variability analysis of 66 strains showed 44 different subtypes of C. jejuni. One subtype was identical to a C. jejuni strain of human origin with the sequence in the GenBank (GENBANK accession number AF050186. Subtyping analysis of C. jejuni strains based on sequencing of the fla A gene variable region and analysis of sequence alignment by the Maximum Parsimony method showed to be highly discriminatory, providing the best conditions to differentiate strains involved in outbreaks from those sporadically isolated. This is the first study of molecular subtyping analysis of human and animal C. jejuni strains using sequencing technique and genealogic analysis in the state of São Paulo, Brazil.O objetivo do presente trabalho foi caracterizar geneticamente estirpes de Campylobacter jejuni subsp. jejuni isoladas de humanos e de diferentes origens animais (bovinas, suínas, cães, primatas, javalis, suínos e aves de corte. Um total de 828 amostras (fezes, carcaças, fetos abortados e útero histerectomizado foram analisadas por métodos de rotina bacteriológica e 36 estirpes de C. jejuni foram isoladas. Trinta estirpes de origem fecal humana foram obtidas de
Complete Genome Sequence of the Soybean Symbiont Bradyrhizobium japonicum Strain USDA6T
Directory of Open Access Journals (Sweden)
Nobukazu Uchiike
2011-10-01
Full Text Available The complete nucleotide sequence of the genome of the soybean symbiont Bradyrhizobium japonicum strain USDA6T was determined. The genome of USDA6T is a single circular chromosome of 9,207,384 bp. The genome size is similar to that of the genome of another soybean symbiont, B. japonicum USDA110 (9,105,828 bp. Comparison of the whole-genome sequences of USDA6T and USDA110 showed colinearity of major regions in the two genomes, although a large inversion exists between them. A significantly high level of sequence conservation was detected in three regions on each genome. The gene constitution and nucleotide sequence features in these three regions indicate that they may have been derived from a symbiosis island. An ancestral, large symbiosis island, approximately 860 kb in total size, appears to have been split into these three regions by unknown large-scale genome rearrangements. The two integration events responsible for this appear to have taken place independently, but through comparable mechanisms, in both genomes.
Directory of Open Access Journals (Sweden)
Yang Jianmei
2012-03-01
Full Text Available Abstract Background Yellow cattle and water buffalo are two of the most important natural hosts for Schistosoma japonicum in China. Previous observation has revealed that yellow cattle are more suited to the development of S. japonicum than water buffalo. Understanding more about the molecular mechanisms involved in worm development, as well as the pathological and immunological differences between yellow cattle and water buffalo post infection with S japonicum will provide useful information for the vaccine design and its delivery procedure. Results The worm length (p p p + T cells was higher in yellow cattle, while the percentage of CD8+ T cells was higher in water buffalo from pre-infection to 7 w post infection. The CD4/CD8 ratios were decreased in both species after challenge with schistosomes. Comparing with water buffalo, the IFN-γ level was higher and decreased significantly, while the IL-4 level was lower and increased gradually in yellow cattle from pre-infection to 7 w post infection. Conclusions In this study, we confirmed that yellow cattle were more suited to the development of S. japonicum than water buffalo, and more serious pathological damage was observed in infected yellow cattle. Immunological analysis suggested that CD4+ T cells might be an integral component of the immune response and might associate with worm development in yellow cattle. A shift from Th1 to Th2 type polarized immunity was only shown clearly in schistosome-infected yellow cattle, but no shift in water buffalo. The results provide valuable information for increased understanding of host-schistosome interactions, and for control of schistosomiasis.
Directory of Open Access Journals (Sweden)
Kharleezelle J Moendeg
2017-07-01
Full Text Available Microsatellites have been found to be useful in determining genetic diversities of various medically-important parasites which can be used as basis for an effective disease management and control program. In Asia and Africa, the identification of different geographical strains of Schistosoma japonicum, S. haematobium and S. mansoni as determined through microsatellites could pave the way for a better understanding of the transmission epidemiology of the parasite. Thus, the present study aims to apply microsatellite markers in analyzing the populations of S. japonicum from different endemic areas in the Philippines for possible strain differentiation.Experimental mice were infected using the cercariae of S. japonicum collected from infected Oncomelania hupensis quadrasi snails in seven endemic municipalities. Adult worms were harvested from infected mice after 45 days of infection and their DNA analyzed against ten previously characterized microsatellite loci. High genetic diversity was observed in areas with high endemicity. The degree of genetic differentiation of the parasite population between endemic areas varies. Geographical separation was considered as one of the factors accounting for the observed difference between populations. Two subgroups have been observed in one of the study sites, suggesting that co-infection with several genotypes of the parasite might be present in the population. Clustering analysis showed no particular spatial structuring between parasite populations from different endemic areas. This result could possibly suggest varying degrees of effects of the ongoing control programs and the existing gene flow in the populations, which might be attributed to migration and active movement of infected hosts from one endemic area to another.Based on the results of the study, it is reasonable to conclude that genetic diversity could be one possible criterion to assess the infection status in highly endemic areas. Genetic
Directory of Open Access Journals (Sweden)
Jianmei Yang
Full Text Available BACKGROUND: Water buffalo and goats are natural hosts for S. japonicum in endemic areas of China. The susceptibility of these two hosts to schistosome infection is different, as water buffalo are less conducive to S. japonicum growth and development. To identify genes that may affect schistosome development and survival, we compared gene expression profiles of schistosomes derived from these two natural hosts using high-throughput microarray technology. RESULTS: The worm recovery rate was lower and the length and width of worms from water buffalo were smaller compared to those from goats following S. japonicum infection for 7 weeks. Besides obvious morphological difference between the schistosomes derived from the two hosts, differences were also observed by scanning and transmission electron microscopy. Microarray analysis showed differentially expressed gene patterns for parasites from the two hosts, which revealed that genes related to lipid and nucleotide metabolism, as well as protein folding, sorting, and degradation were upregulated, while others associated with signal transduction, endocrine function, development, immune function, endocytosis, and amino acid/carbohydrate/glycan metabolism were downregulated in schistosomes from water buffalo. KEGG pathway analysis deduced that the differentially expressed genes mainly involved lipid metabolism, the MAPK and ErbB signaling pathways, progesterone-mediated oocyte maturation, dorso-ventral axis formation, reproduction, and endocytosis, etc. CONCLUSION: The microarray gene analysis in schistosomes derived from water buffalo and goats provide a useful platform to disclose differences determining S. japonicum host compatibility to better understand the interplay between natural hosts and parasites, and identify schistosome target genes associated with susceptibility to screen vaccine candidates.
Improved Soybean Root Association of N-Starved Bradyrhizobium japonicum
López-García, Silvina L.; Vázquez, Tirso E. E.; Favelukes, Gabriel; Lodeiro, Aníbal R.
2001-01-01
In this study, we addressed the effects of N limitation in Bradyrhizobium japonicum for its association with soybean roots. The wild-type strain LP 3001 grew for six generations with a growth rate of 1.2 day−1 in a minimal medium with 28 mM mannitol as the carbon source and with the N source [(NH4)2SO4] limited to only 20 μM. Under these conditions, the glutamine synthetase (GS) activity was five to six times higher than in similar cultures grown with 1 or 0.1 mM (NH4)2SO4. The NtrBC-inducibl...
Mefloquine in combination with hemin causes severe damage to adult Schistosoma japonicum in vitro.
Xiao, Shu-hua; Qiao, Chunhua; Xue, Jian; Wang, Lili
2014-03-01
In order to explore the interaction of mefloquine with hemin against adult Schistosoma japonicum in vitro, the 50% and 95% lethal concentration (LC50 and LC95) of mefloquine and hemin against schistosomes, some factors, such as other iron providing agents, iron chelaters, zinc protoporphyrin-IX, and biological relevant reductants, that might impact on antischistosomal activity induced by interaction of mefloquine with hemin, and preliminary analysis of chemical interaction of both compounds were undertaken. The LC50 and LC95 of mefloquine and hemin alone against schistosomes were determined to be 6.5μg/ml and 7.8μg/ml as well as 232μg/ml and 355μg/ml, respectively. The LC50 and LC95 of mefloquine in the presence of hemin 100μg/ml was 0.24μg/ml and 0.59μg/ml, respectively. On the other hand the LC50 and LC95 of hemin in the presence of mefloquine 1μg/ml was 23.2μg/ml and 77.2μg/ml, respectively. Meanwhile, mefloquine/hemin combinations showed potential synergistic effects against adult S. japonicum, with combination index (CI) values vitamine C or cysteine showed no apparent worm protection effect from toxic mefloquine-hemin even at higher concentrations (242.3-614.6μg/ml, i.e., 6.4-17.8-fold higher than the concentration of hemin). Chemical interaction of mefloquine with hemin was studied in 40% DMSO-Tris buffer solution. Both UV-Vis spectrum and mass spectrum demonstrated the strong interaction of mefloquine with hemin, which resulted in a reduction of hemin color and emergence of an adduct formed by mefloquine and hemin. The results confirm that mefloquine combined with hemin exhibits potential synergistic effect against adult S. japonicum in vitro. Copyright © 2013 Elsevier B.V. All rights reserved.
Kageyama, Shinji; Beppu, Masanori; Ohnogi, Hiromu; Miyazaki, Sayaka; Haruno, Akihiro; Ito, Yoshihiko; Yamada, Shizuo
2018-05-01
To evaluate changes over time in subjective symptom scores and urination parameters before and after oral administration of formulated food containing a combination of Peucedanum japonicum (P. japonicum) extract and saw palmetto extract (SPE) in male patients with lower urinary tract symptoms (LUTS). This study was conducted in an open label manner on male patients with untreated LUTS. The urination state of patients was evaluated before and after administration of food formulated with P. japonicum extract and SPE for 4 weeks, based on urodynamic parameters and subjective symptom scores (International Prostate Symptom Score [IPSS and IPSS-QOL], Overactive Bladder Symptom Score [OABSS], Overactive Bladder Questionnaire [OAB-q], and International Index of Erectile Function [IIEF]). After the administration of food formulated with these extracts, the following results were obtained: (i) Subjective findings: The IPSS-QOL score improved significantly; both parameters related to nocturia, i.e., frequency of nighttime urination and OABSS-2, improved significantly; other ratings for subjective symptoms slightly improved. (ii) Objective findings: Residual urine volume decreased significantly, and blood prostate specific antigen (PSA) and urinary 8-OHdG levels decreased slightly after the treatment. (iii) Other findings: Blood pressure decreased slightly. No adverse drug reactions were reported. (iv) Patient impressions: 75% of patients gave a rating of "Good" or higher, with 15 out of 20 patients wanting to continue treatment after the end of 4-week administration period. Food formulated with P. japonicum extract and SPE may be useful to decrease frequency of nighttime urination and residual urine volume in male patients with LUTS. © 2017 John Wiley & Sons Australia, Ltd.
Comparative Analysis of Proteome-Wide Lysine Acetylation in Juvenile and Adult Schistosoma japonicum
Directory of Open Access Journals (Sweden)
Qing Li
2017-11-01
Full Text Available Schistosomiasis is a devastating parasitic disease caused by tremotodes of the genus Schistosoma. Eggs produced by sexually mature schistosomes are the causative agents of for pathogenesis and transmission. Elucidating the molecular mechanism of schistosome development and sexual maturation would facilitate the prevention and control of schistosomiasis. Acetylation of lysine is a dynamic and reversible post-translational modification playing keys role in many biological processes including development in both eukaryotes and prokaryotes. To investigate the impacts of lysine acetylation on Schistosoma japonicum (S. japonicum development and sexual maturation, we used immunoaffinity-based acetyllysine peptide enrichment combined with mass spectrometry (MS, to perform the first comparative analysis of proteome-wide lysine acetylation in both female and male, juvenile (18 days post infection, 18 dpi and adult (28 dpi schistosome samples. In total, we identified 874 unique acetylated sites in 494 acetylated proteins. The four samples shared 47 acetylated sites and 46 proteins. More acetylated sites and proteins shared by both females and males were identified in 28 dpi adults (189 and 143, respectively than in 18 dpi schistosomula (76 and 59, respectively. More stage-unique acetylated sites and proteins were also identified in 28 dpi adults (494 and 210, respectively than in 18 dpi schistosomula (73 and 44, respectively. Functional annotation showed that in different developmental stages and genders, a number of proteins involving in muscle movement, glycometabolism, lipid metabolism, energy metabolism, environmental stress resistance, antioxidation, etc., displayed distinct acetylation profiles, which was in accordance with the changes of their biological functions during schistosome development, suggesting that lysine acetylation modification exerted important regulatory roles in schistosome development. Taken together, our data provided the first
MicroRNA-gene expression network in murine liver during Schistosoma japonicum infection.
Directory of Open Access Journals (Sweden)
Pengfei Cai
Full Text Available BACKGROUND: Schistosomiasis japonica remains a significant public health problem in China and Southeast Asian countries. The most typical and serious outcome of the chronic oriental schistosomiasis is the progressive granuloma and fibrosis in the host liver, which has been a major medical challenge. However, the molecular mechanism underling the hepatic pathogenesis is still not clear. METHODOLOGY AND PRINCIPAL FINDINGS: Using microarrays, we quantified the temporal gene expression profiles in the liver of Schistosoma japonicum-infected BALB/c mice at 15, 30, and 45 day post infection (dpi with that from uninfected mice as controls. Gene expression alternation associated with liver damage was observed in the initial phase of infection (dpi 15, which became more magnificent with the onset of egg-laying. Up-regulated genes were dominantly associated with inflammatory infiltration, whereas down-regulated genes primarily led to the hepatic functional disorders. Simultaneously, microRNA profiles from the same samples were decoded by Solexa sequencing. More than 130 miRNAs were differentially expressed in murine liver during S. japonicum infection. MiRNAs significantly dysregulated in the mid-phase of infection (dpi 30, such as mmu-miR-146b and mmu-miR-155, may relate to the regulation of hepatic inflammatory responses, whereas miRNAs exhibiting a peak expression in the late phase of infection (dpi 45, such as mmu-miR-223, mmu-miR-146a/b, mmu-miR-155, mmu-miR-34c, mmu-miR-199, and mmu-miR-134, may represent a molecular signature of the development of schistosomal hepatopathy. Further, a dynamic miRNA-gene co-expression network in the progression of infection was constructed. CONCLUSIONS AND SIGNIFICANCE: This study presents a global view of dynamic expression of both mRNA and miRNA transcripts in murine liver during S. japonicum infection, and highlights that miRNAs may play a variety of regulatory roles in balancing the immune responses during the
Sobierajska, Katarzyna; Fabczak, Hanna; Fabczak, Stanisław
2006-06-01
Blepharisma japonicum and Stentor coeruleus are related ciliates, conspicuous by their photosensitivity. They are capable of avoiding illuminated areas in the surrounding medium, gathering exclusively in most shaded places (photodispersal). Such behaviour results mainly from motile photophobic response occurring in ciliates. This light-avoiding response is observed during a relatively rapid increase in illumination intensity (light stimulus) and consists of cessation of cell movement, a period of backward movement (ciliary reversal), followed by a forward swimming, usually in a new direction. The photosensitivity of ciliates is ascribed to their photoreceptor system, composed of pigment granules, containing the endogenous photoreceptor -- blepharismin in Blepharisma japonicum, and stentorin in Stentor coeruleus. A light stimulus, applied to both ciliates activates specific stimulus transduction processes leading to the electrical changes at the plasma membrane, correlated with a ciliary reversal during photophobic response. These data indicate that both ciliates Blepharisma japonicum and Stentor coeruleus, the lower eukaryotes, are capable of transducing the perceived light stimuli in a manner taking place in some photoreceptor cells of higher eukaryotes. Similarities and differences concerning particular stages of light transduction in eukaryotes at different evolutional levels are discussed in this article.
Mitigation of nitrous oxide emissions from soils by Bradyrhizobium japonicum inoculation
Itakura, Manabu; Uchida, Yoshitaka; Akiyama, Hiroko; Hoshino, Yuko Takada; Shimomura, Yumi; Morimoto, Sho; Tago, Kanako; Wang, Yong; Hayakawa, Chihiro; Uetake, Yusuke; Sánchez, Cristina; Eda, Shima; Hayatsu, Masahito; Minamisawa, Kiwamu
2013-03-01
Nitrous oxide (N2O) is a greenhouse gas that is also capable of destroying the ozone layer. Agricultural soil is the largest source of N2O (ref. ). Soybean is a globally important leguminous crop, and hosts symbiotic nitrogen-fixing soil bacteria (rhizobia) that can also produce N2O (ref. ). In agricultural soil, N2O is emitted from fertilizer and soil nitrogen. In soybean ecosystems, N2O is also emitted from the degradation of the root nodules. Organic nitrogen inside the nodules is mineralized to NH4+, followed by nitrification and denitrification that produce N2O. N2O is then emitted into the atmosphere or is further reduced to N2 by N2O reductase (N2OR), which is encoded by the nosZ gene. Pure culture and vermiculite pot experiments showed lower N2O emission by nosZ+ strains and nosZ++ strains (mutants with increased N2OR activity) of Bradyrhizobium japonicum than by nosZ- strains. A pot experiment using soil confirmed these results. Although enhancing N2OR activity has been suggested as a N2O mitigation option, this has never been tested in the field. Here, we show that post-harvest N2O emission from soybean ecosystems due to degradation of nodules can be mitigated by inoculation of nosZ+ and non-genetically modified organism nosZ++ strains of B. japonicum at a field scale.
Reseña Libro: Malditas. Una estirpe transfeminista
Directory of Open Access Journals (Sweden)
Maria Medina-Vicent
2017-06-01
Full Text Available Autora: Itziar Ziga Tafalla: Editorial Txalaparta, 2014 La autora de Devenir Perra (Melusina, 2009, Un zulo propio (Melusina, 2009 y Sexual Herria (Txalaparta, 2011 vuelve a agitar nuestras conciencias con su última obra titulada Malditas. Una estirpe transfeminista (2014. De nuevo, Itziar Ziga nos sorprende con su tono irreverente y su escritura directa. En esta ocasión, la autora recupera las biografías de ocho mujeres que aunque fueron claves en el desarrollo del movimiento feminista, han sido generalmente olvidadas e incluso minusvaloradas dentro de las propias filas del movimiento por la igualdad. De este modo, Ziga nos introduce en las perspectivas de las minorías, las obreras, las lesbianas, las negras, las chicanas, las putas, las transexuales… todos aquellos grupos que aún luchan por derrocar la noción dominante del sujeto del feminismo, así como ampliar su sentido. A través de su obra, así como de su trayectoria y comprometido activismo, Ziga pone en jaque al “Feminismo del Gran Poder”, como ella misma denomina. Sus palabras nos recuerdan que la lucha feminista no ha sido homogénea, sino que ha estado protagonizada a lo largo de las décadas por mujeres diversas, por grupos dispares que no se corresponden con el modelo de mujer blanca, occidental y heterosexual que parece ostentar el monopolio del discurso feminista en nuestra sociedad. En este sentido y con el objetivo de ampliar dicha noción, la selección de las biografías que aparecen en la obra se basa, según Ziga, en un aspecto común que une a todas las mujeres estudiadas, esto es, el estigma y la rebeldía: “todas fueron, son y serán mujeres de acción a las que les persigue cierto malditismo y que nunca trataron de erigirse como líderes”.
Ohmae, H; Tanaka, M; Nara, T; Utsunomiya, H; Taguchi, H; Irie, Y; Yasuraoka, K
1991-09-01
We describe the parameters useful in evaluating the development of hepatic fibrosis in Schistosoma japonicum infection, as well as its improvement after treatment with praziquantel (PZQ). Various serologic parameters and ultrasonographic images were examined, and their changes were monitored using rabbits infected with 200 or 300 cercariae of S. japonicum. Infected rabbits were administered one oral treatment of PZQ at a dosage of 100 mg/kg at 6, 12, or 24 weeks after infection. Histopathologic examinations revealed that PZQ had a strong and rapid effect, even on damage that developed long after the infection. The improvement of moderate hepatic fibrosis that developed over 24 weeks after infection was also detected by histopathologic examinations. The serum level of total bile acid was the most sensitive parameter in evaluating the severity of hepatic fibrosis and its improvement after treatment with PZQ. The level of serum procollagen-III-peptide was also useful in evaluating the development of hepatic fibrosis, but not in its improvement. Ultrasonography revealed specific echogenic bands and nodules according to the progress of granuloma formation and fibrosis, and the reversal of these changes could also be observed after treatment with PZQ.
Xu, Jing; Guan, Zhi-Xun; Zhao, Bo; Wang, Yan-Yan; Cao, Yun; Zhang, Hui-Qin; Zhu, Xing-Quan; He, Yong-Kang; Xia, Chao-Ming
2015-04-01
Schistosomiasis has decreased significantly in prevalence and intensity of infection in China, thus more accurate and sensitive methods are desperately needed for the further control of schistosomiasis. The present work aimed to assess the utility of the loop-mediated isothermal amplification (LAMP) for detection of light intensity infection or false-negative patients and patients post-treatment, targeting the highly repetitive retrotransposon SjR2 of Schistosoma japonicum. LAMP was first assessed in rabbits with low intensity infection (EPGLAMP. Meanwhile, 42 sera from healthy individuals in a non-endemic area, and 60 sera from "healthy" residents who were identified as being negative for feces examination and immuno-methods in an endemic area were also examined. The results showed that LAMP could detect S. japonicum DNA in sera from rabbits at 3rd day post-infection. Following administration of praziquantel, the S. japonicum DNA in rabbit sera became negative at 10 weeks post-treatment. Of 110 sera from patients, LAMP showed 95.5% sensitivity, and even for 41 patients with less than 10 EPG, the sensitivity of LAMP still reached to 95.1%. For 47 patients after treatment, the negative conversion rate of S. japonicum DNA in patient sera increased from 23.4%, 61.7% to 83.0% at 3 months, 6 months and 9 months post-treatment, respectively. No false-positive result was obtained for 42 human sera from non-endemic area, while for the 60 "healthy" individuals from endemic area, 10 (16.7%) individuals were positive by LAMP, which suggested that these individuals might be false-negative patients. The present study demonstrated that the LAMP assay is sensitive, specific, and affordable, which would help reduce schistosomiasis transmission through targeted treatment of individuals, particularly for those with negative stool examinations who may yet remain infected. The LAMP assay may provide a potential tool to support schistosomiasis control and elimination strategies.
Narożna, Dorota; Pudełko, Krzysztof; Króliczak, Joanna; Golińska, Barbara; Sugawara, Masayuki; Mądrzak, Cezary J; Sadowsky, Michael J
2015-08-15
It was previously demonstrated that there are no indigenous strains of Bradyrhizobium japonicum forming nitrogen-fixing root nodule symbioses with soybean plants in arable field soils in Poland. However, bacteria currently classified within this species are present (together with Bradyrhizobium canariense) as indigenous populations of strains specific for nodulation of legumes in the Genisteae tribe. These rhizobia, infecting legumes such as lupins, are well established in Polish soils. The studies described here were based on soybean nodulation field experiments, established at the Poznań University of Life Sciences Experiment Station in Gorzyń, Poland, and initiated in the spring of 1994. Long-term research was then conducted in order to study the relation between B. japonicum USDA 110 and USDA 123, introduced together into the same location, where no soybean rhizobia were earlier detected, and nodulation and competitive success were followed over time. Here we report the extra-long-term saprophytic survival of B. japonicum strains nodulating soybeans that were introduced as inoculants 20 years earlier and where soybeans were not grown for the next 17 years. The strains remained viable and symbiotically competent, and molecular and immunochemical methods showed that the strains were undistinguishable from the original inoculum strains USDA 110 and USDA 123. We also show that the strains had balanced numbers and their mobility in soil was low. To our knowledge, this is the first report showing the extra-long-term persistence of soybean-nodulating strains introduced into Polish soils and the first analyzing the long-term competitive relations of USDA 110 and USDA 123 after the two strains, neither of which was native, were introduced into the environment almost 2 decades ago. Copyright © 2015, American Society for Microbiology. All Rights Reserved.
DEFF Research Database (Denmark)
Jensen, J B; Egsgaard, H; Van Onckelen, H
1995-01-01
Some strains of Bradyrhizobium japonicum have the ability to catabolize indole-3-acetic acid. Indoleacetic acid (IAA), 4-chloro-IAA (4-Cl-IAA), and 5-Cl-IAA were metabolized to different extents by strains 61A24 and 110. Metabolites were isolated and analyzed by high-performance liquid chromatogr...
International Nuclear Information System (INIS)
Moloney, N.A.; Bickle, Q.D.; Webbe, G.
1985-01-01
Mice can be partially protected against Schistosoma japonicum by prior exposure to ultraviolet (UV)-attenuated infections which fail to survive to the adult stage and produce no overt pathology in the host. Optimum resistance was induced by parasites exposed to 40 seconds of UV, significantly lower levels of resistance being stimulated by both shorter and longer exposures. No consistent relationship between the degree of resistance induced and the number of irradiated cercariae given could be demonstrated and equivocal results were obtained when comparing the efficacy of single and multiple vaccinations. Vaccinations with UV-attenuated cercariae given intraperitoneally (i.p.) were as efficacious as those given percutaneously but mice were as or more resistant to challenges given by the i.p. route, the possible reasons are discussed. There was no observed delay in the migration of the challenge, vaccinated mice being as resistant when perfused 6 or 3.5 weeks after challenge. Vaccination was species specific since mice exposed to either UV-attenuated S. japonicum cercariae or gamma-attenuated S. mansoni cercariae were resistant to homologous but not heterologous challenge. (author)
Energy Technology Data Exchange (ETDEWEB)
Pathania, Deepak, E-mail: dpathania74@gmail.com [School of Chemistry, Shoolini University of Biotechnology and Management Sciences, Solan, H.P. (India); Gupta, Divya [School of Chemistry, Shoolini University of Biotechnology and Management Sciences, Solan, H.P. (India); Agarwal, Shilpi [Department of Applied Chemistry, University of Johannesburg, Johannesburg (South Africa); Asif, M. [Chemical Engineering Department, King Suad University Riyadh (Saudi Arabia); Gupta, Vinod Kumar [Department of Applied Chemistry, University of Johannesburg, Johannesburg (South Africa); Department of Chemistry, Indian Institute of Technology Roorkee, Roorkee, 247667 (India)
2016-07-01
In present study, we reported the synthesis of chitosan-g-poly(acrylamide)/CuS (CPA/CS) nanocomposite for controlled delivery of ofloxacin. The CPA/CS nanocomposites were characterized by Fourier transmission infrared spectroscopy (FTIR), UV–visible spectroscopy (UV), scanning electron microscopy (SEM), X-ray diffraction (XRD) analysis. From the FTIR spectra, the various groups present in CPA/CS nanocomposite were monitored. The homogeneity, morphology and crystallinity of the CPA/CS nanocomposite were ascertained from SEM/EDX and XRD data, respectively. The kinetics of ofloxacin drug delivery was investigated at different pH. The drug released studies were investigated at different pH (2.2, 7.4 and 9.4) and time intervals (2, 4, 6, 8, 10, 12, 14, 16 h). The drug release behavior depends upon the pH of medium and the nature of matrix. The maximum drug loading efficiency of 85% was recorded for CPA/CS. The maximum drug release of 76% was observed at 2.2. pH after 18 h onto CPA/CS. Nanocomposites were also tested for antibacterial activity against Escherichia coli bacteria. About 97% killing of E. coli was observed after 24 h. - Highlights: • Chitosan-g-poly(acrylamide)/CuS (CPA/CS) nanocomposite has been synthesized in microwave reactor. • Different spectral techniques confirmed the formation of nanocomposite. • The drug release behavior of CPA/CS nanocomposites were studied at different pH and different time interval. • CPA/CS has been investigated for an excellent antibacterial activity against E. coli bacterial culture.
International Nuclear Information System (INIS)
Pathania, Deepak; Gupta, Divya; Agarwal, Shilpi; Asif, M.; Gupta, Vinod Kumar
2016-01-01
In present study, we reported the synthesis of chitosan-g-poly(acrylamide)/CuS (CPA/CS) nanocomposite for controlled delivery of ofloxacin. The CPA/CS nanocomposites were characterized by Fourier transmission infrared spectroscopy (FTIR), UV–visible spectroscopy (UV), scanning electron microscopy (SEM), X-ray diffraction (XRD) analysis. From the FTIR spectra, the various groups present in CPA/CS nanocomposite were monitored. The homogeneity, morphology and crystallinity of the CPA/CS nanocomposite were ascertained from SEM/EDX and XRD data, respectively. The kinetics of ofloxacin drug delivery was investigated at different pH. The drug released studies were investigated at different pH (2.2, 7.4 and 9.4) and time intervals (2, 4, 6, 8, 10, 12, 14, 16 h). The drug release behavior depends upon the pH of medium and the nature of matrix. The maximum drug loading efficiency of 85% was recorded for CPA/CS. The maximum drug release of 76% was observed at 2.2. pH after 18 h onto CPA/CS. Nanocomposites were also tested for antibacterial activity against Escherichia coli bacteria. About 97% killing of E. coli was observed after 24 h. - Highlights: • Chitosan-g-poly(acrylamide)/CuS (CPA/CS) nanocomposite has been synthesized in microwave reactor. • Different spectral techniques confirmed the formation of nanocomposite. • The drug release behavior of CPA/CS nanocomposites were studied at different pH and different time interval. • CPA/CS has been investigated for an excellent antibacterial activity against E. coli bacterial culture.
Directory of Open Access Journals (Sweden)
Jing Xu
2015-04-01
Full Text Available Schistosomiasis has decreased significantly in prevalence and intensity of infection in China, thus more accurate and sensitive methods are desperately needed for the further control of schistosomiasis. The present work aimed to assess the utility of the loop-mediated isothermal amplification (LAMP for detection of light intensity infection or false-negative patients and patients post-treatment, targeting the highly repetitive retrotransposon SjR2 of Schistosoma japonicum.LAMP was first assessed in rabbits with low intensity infection (EPG<10. Then 110 patient sera from Hunan Province, China, and 47 sera after treatment by praziquantel were used to evaluate the diagnostic validity of LAMP. Meanwhile, 42 sera from healthy individuals in a non-endemic area, and 60 sera from "healthy" residents who were identified as being negative for feces examination and immuno-methods in an endemic area were also examined. The results showed that LAMP could detect S. japonicum DNA in sera from rabbits at 3rd day post-infection. Following administration of praziquantel, the S. japonicum DNA in rabbit sera became negative at 10 weeks post-treatment. Of 110 sera from patients, LAMP showed 95.5% sensitivity, and even for 41 patients with less than 10 EPG, the sensitivity of LAMP still reached to 95.1%. For 47 patients after treatment, the negative conversion rate of S. japonicum DNA in patient sera increased from 23.4%, 61.7% to 83.0% at 3 months, 6 months and 9 months post-treatment, respectively. No false-positive result was obtained for 42 human sera from non-endemic area, while for the 60 "healthy" individuals from endemic area, 10 (16.7% individuals were positive by LAMP, which suggested that these individuals might be false-negative patients.The present study demonstrated that the LAMP assay is sensitive, specific, and affordable, which would help reduce schistosomiasis transmission through targeted treatment of individuals, particularly for those with
Directory of Open Access Journals (Sweden)
Malcolm K Jones
Full Text Available BACKGROUND: Schistosome eggs must traverse tissues of the intestine or bladder to escape the human host and further the life cycle. Escape from host tissues is facilitated by secretion of immuno-reactive molecules by eggs and the formation of an intense strong granulomatous response by the host which acts to exclude the egg into gut or bladder lumens. Schistosome eggs hatch on contact with freshwater, but the mechanisms of activation and hatching are poorly understood. In view of the lack of knowledge of the behaviour of egg hatching in schistosomes, we undertook a detailed dynamic and correlative study of the hatching biology of Schistosoma japonicum. METHODOLOGY/PRINCIPAL FINDINGS: Hatching eggs of S. japonicum were studied using correlative light and electron microscopy (EM. The hatching behaviour was recorded by video microscopy. EM preparative methods incorporating high pressure freezing and cryo-substitution were used to investigate ultrastructural features of the miracidium and extra-embryonic envelopes in pre-activated and activated eggs, and immediately after eggshell rupture. Lectin cytochemistry was performed on egg tissues to investigate subcellular location of specific carbohydrate groups. CONCLUSIONS/SIGNIFICANCE: The hatching of S. japonicum eggs is a striking phenomenon, whereby the larva is liberated explosively while still encapsulated within its sub-shell envelopes. The major alterations that occur in the egg during activation are scission of the outer envelope-eggshell boundary, autolysis of the cellular inner envelope, and likely hydration of abundant complex and simple polysaccharides in the lacunal space between the miracidial larva and surrounding envelopes. These observations on hatching provide insight into the dynamic activity of the eggs and the biology of schistosomes within the host.
Directory of Open Access Journals (Sweden)
Luciano Menezes Ferreira
2006-08-01
Full Text Available Foram submetidas a PCR-Ribotipagem e aos testes de sensibilidade in vitro frente a 12 antimicrobianos 77 estirpes de Staphylococcus aureus isoladas em amostras de leite procedentes de 40 vacas da raça holandesa que apresentaram mastite subclínica, em uma propriedade rural localizada no Estado de São Paulo, Brasil. Os resultados obtidos revelaram quatro diferentes padrões de resistência a antimicrobianos, sendo observada a predominância de resistência à lincomicina entre 19 (24,7% estirpes de S.aureus. As 58 (75,3% estirpes restantes foram sensíveis aos 12 antimicrobianos testados. A PCR-ribotipagem revelou a ocorrência de nove padrões genotípicos distintos, além de apresentar uma capacidade discriminatória maior (D = 0,82 que a obtida nos antibiogramas (D = 0,42. Entre as 19 estirpes resistentes aos antimicrobianos, 14 (73,7% foram agrupadas em três padrões de ribotipagem e, destas, 13 (92,9% apresentaram resistência à eritromicina e à lincomicina, isoladamente ou em associação. O grande número de ribotipos e de padrões de resistência a antimicrobianos observados nesta propriedade demonstrou que há grande heterogeneidade genética em populações naturais de S. aureus, fato este que deve ser levado em consideração em programas de controle da mastite bovina.Seventy-seven S. aureus strains, isolated in milk samples obtained from 40 Holstein cows suffering from subclinical mastitis in a dairy herd in the state of São Paulo - Brazil, were undergone to PCR-ribotyping and in vitro susceptibility testing to 12 antimicrobial drugs. PCR-ribotyping revealed nine different patterns and presented a higher discriminatory power (D = 0.82 in comparison with the in vitro antibiotic susceptibility test (D = 0.42. Moreover,, the results showed four antibiotic resistance patterns, with the resistance to lincomycin being the most predominant and comprising 19 (24.7% S. aureus strains. The other 58 (75.3% isolates were sensitive to all
Sun, R X; Zhang, C H; Zheng, Y Q; Zong, Y C; Yu, X D; Huang, P
2016-05-06
Thirty-four Styphnolobium japonicum varieties were analyzed using sequence-related amplified polymorphism (SRAP) markers, to investigate genetic variation and test the effectiveness of SRAP markers in DNA fingerprint establishment. Twelve primer pairs were selected from 120 primer combinations for their reproducibility and high polymorphism. We found a total of 430 amplified fragments, of which 415 fragments were considered polymorphic with an average of 34.58 polymorphic fragments for each primer combination. The percentage of polymorphic fragments was 96.60%, and four primer pairs showed 100% polymorphism. Moreover, simple matched coefficients ranged between 0.68 and 0.89, with an average of 0.785, indicating that the genetic variation among varieties was relatively low. This could be because of the narrow genetic basis of the selected breeding material. Based on the similarity coefficient value of 0.76, the varieties were divided into four major groups. In addition, abundant and clear SRAP fingerprints were obtained and could be used to establish DNA fingerprints. In the DNA fingerprints, each variety had its unique pattern that could be easily distinguished from others. The results demonstrated that 34 varieties of S. japonicum had a relatively narrow genetic variation. Hence, a broadening of the genetic basis of breeding material is necessary. We conclude that establishment of DNA fingerprint is feasible by means of SRAP markers.
Directory of Open Access Journals (Sweden)
Santana Clara
2009-10-01
Full Text Available Abstract Background Schistosomes are trematode parasites of the phylum Platyhelminthes. They are considered the most important of the human helminth parasites in terms of morbidity and mortality. Draft genome sequences are now available for Schistosoma mansoni and Schistosoma japonicum. Non-coding RNA (ncRNA plays a crucial role in gene expression regulation, cellular function and defense, homeostasis, and pathogenesis. The genome-wide annotation of ncRNAs is a non-trivial task unless well-annotated genomes of closely related species are already available. Results A homology search for structured ncRNA in the genome of S. mansoni resulted in 23 types of ncRNAs with conserved primary and secondary structure. Among these, we identified rRNA, snRNA, SL RNA, SRP, tRNAs and RNase P, and also possibly MRP and 7SK RNAs. In addition, we confirmed five miRNAs that have recently been reported in S. japonicum and found two additional homologs of known miRNAs. The tRNA complement of S. mansoni is comparable to that of the free-living planarian Schmidtea mediterranea, although for some amino acids differences of more than a factor of two are observed: Leu, Ser, and His are overrepresented, while Cys, Meth, and Ile are underrepresented in S. mansoni. On the other hand, the number of tRNAs in the genome of S. japonicum is reduced by more than a factor of four. Both schistosomes have a complete set of minor spliceosomal snRNAs. Several ncRNAs that are expected to exist in the S. mansoni genome were not found, among them the telomerase RNA, vault RNAs, and Y RNAs. Conclusion The ncRNA sequences and structures presented here represent the most complete dataset of ncRNA from any lophotrochozoan reported so far. This data set provides an important reference for further analysis of the genomes of schistosomes and indeed eukaryotic genomes at large.
Vitamin E reduces hepatic fibrosis in mice with Schistosoma japonicum infection.
Wang, Xuefeng; Zhang, Rongbo; Du, Jiuwei; Hu, Youying; Xu, Lifa; Lu, Jun; Ye, Song
2012-02-01
To investigate whether vitamin E protects against hepatic fibrosis in mice with Schistosoma japonicum infection, 24 pathogen-free Kunming mice were selected and randomly divided into four groups: control (uninfected, untreated), model (infected, untreated), low-dose intervention (infected, vitamin E-treated, 30 mg/g bodyweight/day) and high-dose intervention (infected, vitamin E-treated, 60 mg/g bodyweight/day). Mice were infected with Schistosoma japonicum by inoculating abdominal skin with snail hosts. The activities of malondialdehyde (MDA), superoxide dismutase (SOD), glutathione peroxidase (GPx) and catalase (CAT) were detected in hepatic tissue by colorimetry. The expression levels of laminin (LN), hyaluronic acid (HA), procollagen type Ⅲ (PC-III) and type Ⅳ collagen (IV-C) were detected in the serum by radioimmunoassay. Finally, areas and numbers of granulomas were assessed through histopathology 42 days following treatment. The results revealed that mean areas of granulomas were smaller in the low- and high-dose intervention groups compared to those in the model group. Furthermore, the higher dose of vitamin E resulted in smaller granulomas than the low dose. The levels of LN, HA, PC-III and IV-C in the serum were lower following vitamin E treatment than in the model group. By contrast, activity of SOD, GPx and CAT in hepatic tissue was higher following vitamin E treatment compared to the model group. The activity of MDA was lower in hepatic tissue following vitamin E treatment compared to the model group, but was higher compared to controls. In general, the higher dose of vitamin E affected measurements to a greater extent than the lower dose. In conclusion, vitamin E treatment may reduce the growth of granulomas, slowing the process of hepatic fibrosis, and this effect may be the result of the altered activity of the oxidation-reduction enzyme system.
Intake of Erythrocytes Required for Reproductive Development of Female Schistosoma japonicum
Wang, Jipeng; Wang, Shuqi; Liu, Xiufeng; Xu, Bin; Chai, Riyi; Zhou, Pan; Ju, Chuan; Sun, Jun; Brindley, Paul J.; Hu, Wei
2015-01-01
The reproductive development and maturation of female schistosomes are crucial since their released eggs are responsible for the host immunopathology and transmission of schistosomiasis. However, little is known about the nutrients required by female Schistosoma japonicum during its sexual maturation. We evaluated the promoting effect of several nutrients (calf serum, red blood cells (RBCs), ATP and hypoxanthine) on the reproductive development of pre-adult females at 18 days post infection (dpi) from mixed infections and at 50 dpi from unisexual infections of laboratory mice in basic medium RPMI-1640. We found RBCs, rather than other nutrients, promoted the female sexual maturation and egg production with significant morphological changes. In 27% of females (18 dpi) from mixed infections that paired with males in vitro on day 14, vitelline glands could be positively stained by Fast Blue B; and in 35% of females (50 dpi) from unisexual infections on day 21, mature vitelline cells were observed. Infertile eggs were detected among both groups. To analyze which component of mouse RBCs possesses the stimulating effect, RBCs were fractionated and included in media. However, the RBC fractions failed to stimulate development of the female reproductive organs. In addition, bovine hemoglobin hydrolysate, digested by neutral protease, was found to exhibit the promoting activity instead of untreated bovine hemoglobin. The other protein hydrolysate, lactalbumin hydrolysate, exhibited a similar effect with bovine hemoglobin hydrolysate. Using quantitative RT-PCR, we found the expression levels of four reproduction-related genes were significantly stimulated by RBCs. These data indicate that RBCs provide essential nutrients for the sexual maturation of female S. japonicum and that the protein component of RBCs appeared to constitute the key nutrient. These findings would improve laboratory culture of pre-adult schistosomes to adult worms in medium with well-defined components
Directory of Open Access Journals (Sweden)
João Carlos Pereira
1999-01-01
Full Text Available Este trabalho teve por objetivo avaliar o espectro antibiótico de actinomicetos provenientes de solos de Cerrados e a sua influência na nodulação da soja. As estirpes BR 29, BR 33, BR 40, BR 85, BR 86, BR 96, 47/587, 3B-7 e 4A-5 de Bradyrhizobium spp. apresentaram comportamento diferenciado em relação à resistência natural aos antibióticos produzidos por 204 actinomicetos. As estirpes BR 29 e BR 96 foram sensíveis a 5,2 e 9,9% dos antibióticos produzidos, respectivamente, enquanto a BR 33 apresentou sensibilidade a 20,3%. O antagonismo exercido pelos actinomicetos exclusivamente à BR 29 e BR 33 foi de 1,6 e 5,7%, respectivamente. Esse efeito não foi observado nas estirpes BR 40 e BR 96. Inoculações simples e em mistura das estirpes na presença de actinomicetos influenciaram a nodulação da soja. A co-inoculação da BR 33 e BR 29 com o isolado 370 reduziu o percentual de ocorrência média, nos nódulos, da BR 29, de 94,1% para 83,7%, com conseqüente aumento da BR 33 de 6,7% para 17,2%. Os resultados evidenciam a importância de estudos ecológicos desses microrganismos, visando avaliar o seu papel no estabelecimento de uma nodulação eficiente.The aim of this work was to evaluate the antibiotic spectrum of actinomycetes from Cerrado soils and their influence on soybean nodulation. Strains BR 29, BR 33, BR 40, BR 85, BR 86, BR 96, 47/587, 3B-7 and 4A-5 of Bradyrhizobium spp. were characterized by their natural resistence to antibiotics produced by 204 actinomycete isolates. The strains BR 29 and BR 96 of B. elkanii were sensitive to 5.2% and 9.9% the products of actinomycete isolates, respectively, while BR 33 was sensitive up to 20.3%. The antagonistic effects caused by actinomycete exclusively to BR 29 and BR 33 were 1.6% and 5.7% respectively. This effect was not observed for strains BR 40 and BR 96. Single and multistrains inoculations in the presence or absence of actinomycetes affected soybean nodulation. On double
Directory of Open Access Journals (Sweden)
Jerri Édson Zilli
2009-08-01
Roraima, em solo com baixo teor de matéria orgânica e desprovido de bactérias nodulantes de soja. Em 2005, as sementes de soja foram tratadas com fungicida à base de carbendazim + tiram e inoculação com produtos comerciais contendo as estirpes de Bradyrhizobium elkanii SEMIA 5019 e SEMIA 587 e B. japonicum SEMIA 5079 e SEMIA 5080. Em 2006, as sementes foram tratadas com fungicidas à base de carbendazim+tiram ou carboxin + tiram e inoculação individual com cada uma das quatro estirpes. Aos 35 dias após a emergência das plantas de soja, foram realizadas avaliações da nodulação, matéria seca e N-total da parte aérea e, na colheita, foram avaliados a produtividade e o N total acumulado nos grãos. Ambos os fungicidas reduziram a nodulação das plantas de soja, sobretudo para as estirpes de B. elkanii. O fungicida à base de carbendazim + tiram reduziu significativamente (cerca de 50 % a nodulação e em mais de 20 % (cerca de 700 kg ha-1, o rendimento de grãos no tratamento inoculado com a estirpe SEMIA 587.
Directory of Open Access Journals (Sweden)
Juliano dos Santos Malty
2006-02-01
Full Text Available Os efeitos do herbicida Roundup, formulado à base de glifosato, foram avaliados sobre três estirpes de Bradyrhizobium elkanii (BR 29, INPA 80A e INPA 553A, e uma de B. japonicum (BR 86, e sobre três espécies de fungos micorrízicos arbusculares (FMA (Gigaspora margarita, Glomus etunicatum e Scutellospora heterogama, em meios de cultivo com concentrações crescentes do herbicida (0 a 454 µmol L-1; foram também avaliados os efeitos sobre a nodulação e micorrização da soja, em casa de vegetação, em solo que recebeu, antes da semeadura, doses do herbicida equivalentes a 1,25 até 10 L ha-1. O Roundup mostrou-se inibitório ao crescimento de Bradyrhizobium spp. e aos fungos em meio de cultura, e esse efeito foi crescente com o aumento das concentrações aplicadas, tendo variado em razão das espécies ou estirpes avaliadas. No entanto, a inibição in vitro só ocorreu em concentrações muito superiores à dose recomendada para aplicações no campo. As estirpes BR 29, INPA 553A e INPA 80A mostraram-se mais tolerantes ao glifosato, em relação à estirpe BR 86. O efeito do herbicida sobre a germinação e o crescimento dos tubos germinativos dos esporos dos FMA foi diferenciado, tendo sido observada inibição decrescente de G. etunicatum para S. heterogama e G. margarita. A aplicação do herbicida ao solo, antes da semeadura, até a dose equivalente a 10 L ha-1 não influenciou na nodulação e na colonização micorrízica da soja.The effects of the Roundup herbicide on three strains of Bradyrhizobium elkanii (BR 29, INPA 80A and INPA 553A, one of B. japonicum (BR 86, and on three species of arbuscular mycorrhizal fungi (AMF (Gigaspora margarita,Glomus etunicatum and Scutellospora heterogama, were evaluated in culture media containing increasing concentrations of the herbicide (0_454 µM; evaluations were also made on the effects on nodulation and mycorrhiza colonization of soybean grown in a soil treated with Roundup doses
Changes in NK and NKT cells in mesenteric lymph nodes after a Schistosoma japonicum infection.
Luo, Xueping; Xie, Hongyan; Chen, Dianhui; Yu, Xiuxue; Wu, Fan; Li, Lu; Wu, Changyou; Huang, Jun
2014-03-01
The mesenteric lymph node (MLN) is the main draining lymph node in mouse enterocoelia, which contains many types of immune cells. Among these cells, natural killer (NK) and natural killer T (NKT) cells belong to innate lymphoid cells (ILCs), which have potent activities for controlling a variety of pathogenic infections. In this study, C57BL/6 mice were infected with Schistosoma japonicum for 5-7 weeks. Lymphocytes were isolated from the MLN to detect changes in the phenotype and function of NK and NKT cells using a fluorescence activating cell sorter (FACS). These results demonstrated that a S. japonicum infection could significantly increase the percentage of NK cells in the mouse MLN, (P cell number of both NK and NKT cells. In addition, we found that NK and NKT cells from infected mice expressed higher levels of CD69 compared to normal mice (P NKT cell activation. Moreover, we found that the expression of CD4 was increased in infected MLN NK cells (P NKT cells of infected mice after phorbol 12-myristate 13-acetate (PMA) and ionomycin stimulation (P NKT cells might play roles in modulating the classical T cell response. Finally, our results indicated that the expression of CD94 was decreased in NK cells, suggesting that the downregulation of CD94 expression might served as a mechanism in NK cell activation.
Liu, Rong; Dong, Hui-Fen; Jiang, Ming-Sen
2012-05-01
In 2009, Wang et al.'s field trial published in the New England Journal of Medicine, reported that a comprehensive strategy aiming to reduce the roles of humans and cattle as sources of Schistosoma japonicum infection in snails was implemented and proved effective and promising in dramatically reducing the percentage of infected humans and snails, which had been extended to other endemic provinces in China afterwards. This implies that the integrated schistosomiasis-control strategies of interventions including political will, financial support and residents' participation to control human and bovine sources of S. japonicum infection in snails may direct to successfully interrupt the parasitic transmission and to ultimately eliminate schistosomiasis. Confusingly, however, the role of health education, which is a critical part of the integrated strategy and should play an active role in schistosomiasis control, was not reflected. We wish the authors to provide the readers a better and clearer statement of the role of health education as part of the integrated control strategy and so we write this comment.
Bioakumulasi Logam Berat oleh Beberapa Galur Bradyrhizobium japonicum
Directory of Open Access Journals (Sweden)
ADE NOOR SYAMSUDIN
2005-09-01
Full Text Available Heavy metal utilization in industry and agriculture have caused an environmental problem to existing life. Bioaccumulation is made up by a concentration of certain chemical compounds in living tissues. The objective of this research was to reveal the ability of lipopolysaccharides (LPSs of heavy metal Bradyrhizobium japonicum tolerant strains in accumulating heavy metals. The strains used were BDG 10, KDR 10, and KDR 15. The ability of each strains on heavy metal accumulation of Cu, Pb, Zn, Ni, and Cd were quantitatively determined using atomic absorption spectrophotometry. The result showed that each strains has its own capacity to accumulate heavy metals. Accumulation of Cu (0.100, Pb (0.320, and Cd (0.048 ppm/mg dry weight by KDR 10 seem higher than BDG 10 and KDR 15. The highest accumulation of Zn and Ni was shown by KDR 15 in which the value were 0.360 and 0.165 ppm/mg dry weight, respectively and the least accumulation of all heavy metal studied was shown by BDG 10.
Directory of Open Access Journals (Sweden)
Camila Cesário Fernandes
2010-06-01
Full Text Available Anticorpos monoclonais constituem a base de vários testes usados na detecção e na identificação de antígenos. Nesse contexto, tais imuno-reagentes têm sido extensivamente empregados na identificação de estirpes virais envolvidas na etiologia de surtos de bronquite infecciosa a campo, permitindo o aperfeiçoamento das técnicas de detecção e caracterização antigênica do vírus da bronquite infecciosa das galinhas (VBI. No presente estudo, uma biblioteca de fragmentos de anticorpos de galinha originalmente preparada por phage display contra a estirpe vacinal (H120 do VBI foi usada para a seleção de fragmentos de anticorpos recombinantes com reatividade cruzada para as estirpes heterólogas IBVPR01 e IBVPR05, isoladas de surtos a campo no Brasil e a estirpe SE-17, isolada nos Estados Unidos. Após três ciclos de panning, foi identificado, pelo ELISA, um conjunto de 15 anticorpos scFv expressos em fagos e com reatividade cruzada para essas mesmas estirpes do VBI. A análise por Western-blotting revelou que dois desses clones apresentavam fagos expressando fragmentos de anticorpos monoclonais com reatividade cruzada para a nucleoproteína N das três estirpes do VBI e também para a forma recombinante dessa nucleoproteína derivada da estirpe M41. Concluindo, os fragmentos de anticorpos monoclonais recombinantes scFv-N produzidos em fagos interagem com um epítopo mais conservado da proteína N do VBI e apresentam um grande potencial para utilização na detecção e no diagnóstico direto desse vírus.Monoclonal antibodies are the basis of various techniques used for antigen detection or characterization, and their use is specially recommended for the identification of viral strains involved in the etiology of infectious bronchitis outbreaks. These antibodies are homogeneous, highly specific and fully characterizable, allowing the improvement of immunological techniques detection and antigenic characterization of avian infectious
Directory of Open Access Journals (Sweden)
Wang Jie
2011-05-01
Full Text Available Abstract Background Schistosomiasis remains a major public health concern that afflicts millions of people worldwide. Low levels of Schistosoma infection require more sensitive diagnostic methods. In this study, a time-resolved fluoroimmunoassay (TRFIA was developed for detecting the signal transduction protein 14-3-3, a circulating antigen of Schistosoma japonicum. Results The detection limit of 14-3-3-TRFIA was 0.78 ng/ml, with a linear measurement range from 0.78 to 800 ng/ml. The average intra-assay and inter-assay variability of this TRFIA was 8.9% and 12.2% respectively, and the mean recovery rate ranged from 92.1% to 115.5%. Within the first 21 days post-infection in rabbits, the positive rates of the 14-3-3-TRFIA were distinctly higher compared to ELISA. All these findings illustrate that 14-3-3-TRFIA has a higher detection efficacy and is a good early diagnostic method for active Schistosoma infection. Conclusions A sandwich TRFIA for detecting the circulating antigen 14-3-3 of S. japonicum has been developed, and has demonstrated to be a good potential diagnostic method for schistosomiasis.
Directory of Open Access Journals (Sweden)
Paul N. Schwarz
2018-03-01
Full Text Available The isoprenoid brasilicardin A is a promising immunosuppressant compound with a unique mode of action, high potency and reduced toxicity compared to today's standard drugs. However, production of brasilicardin has been hampered since the producer strain Nocardia terpenica IFM0406 synthesizes brasilicardin in only low amounts and is a biosafety level 2 organism. Previously, we were able to heterologously express the brasilicardin gene cluster in the nocardioform actinomycete Amycolatopsis japonicum. Four brasilicardin congeners, intermediates of the BraA biosynthesis, were produced. Since chemical synthesis of the brasilicardin core structure has remained elusive we intended to produce high amounts of the brasilicardin backbone for semi synthesis and derivatization. Therefore, we used a metabolic engineering approach to increase heterologous production of brasilicardin in A. japonicum. Simultaneous heterologous expression of genes encoding the MVA pathway and expression of diterpenoid specific prenyltransferases were used to increase the provision of the isoprenoid precursor isopentenyl diphosphate (IPP and to channel the precursor into the direction of diterpenoid biosynthesis. Both approaches contributed to an elevated heterologous production of the brasilicardin backbone, which can now be used as a starting point for semi synthesis of new brasilicardin congeners with better properties.
DEFF Research Database (Denmark)
Gauer, Sabrina; Wang, Zhijie; Otten, Harm
2014-01-01
A gene in Bradyrhizobium japonicum USDA 110, annotated as a ribitol dehydrogenase (RDH), had 87 % sequence identity (97 % positives) to the N-terminal 31 amino acids of an L-glucitol dehydrogenase from Stenotrophomonas maltophilia DSMZ 14322. The 729-bp long RDH gene coded for a protein consistin...
Directory of Open Access Journals (Sweden)
Pingping Liu
Full Text Available Schistosomiasis is an important global public health problem, as millions of people are at risk of acquiring this infection. An ideal method for sustainable control of schistosomiasis is using a vaccine alone or in combination with drugs. In the present study, we cloned the SjGALE gene and generated the expression product in E. coli. The expression level of SjGALE during different developmental stages of S. japonicum was evaluated by real-time RT-PCR and western blotting. Immunolocalization indicated that the protein was mainly located on the tegument of the parasite. Infection of rSjGALE-immunized mice demonstrated a 34% and 49% reduction of the mean worm burden and liver egg burden, respectively, in two independent experiments, indicating immune protection. The liver egg count from each female adult worm was significantly reduced by 63% in the two trials. The cytokine profile and IgG isotype analysis demonstrated the induction of a Th1 immune profile in response to immunization with this protein, further suggesting protection against infection. In conclusion, these findings indicated that SjGALE is a potential vaccine against S. japonicum.
Yoshida, Ken-ichi; Takemoto, Yuki; Sotsuka, Takayuki; Tanaka, Kosei; Takenaka, Shinji
2013-01-01
Background Bradyrhizobium japonicum USDA110, a soybean symbiont, is capable of accumulating a large amount of poly-β-hydroxybutyrate (PHB) as an intracellular carbon storage polymer during free-living growth. Within the genome of USDA110, there are a number of genes annotated as paralogs of proteins involved in PHB metabolism, including its biosynthesis, degradation, and stabilization of its granules. They include two phbA paralogs encoding 3-ketoacyl-CoA thiolase, two phbB paralogs encoding ...
Zuo, Guo-Ying; An, Jing; Han, Jun; Zhang, Yun-Ling; Wang, Gen-Chun; Hao, Xiao-Yan; Bian, Zhong-Qi
2012-01-01
Through bioassay-guided fractionation of the extracts from the aerial parts of the Chinese herb Hypericum japonicum Thunb. Murray, Isojacareubin (ISJ) was characterized as a potent antibacterial compound against the clinical methicillin-resistant Staphylococcus aureus (MRSA). The broth microdilution assay was used to determine the minimal inhibitory concentrations (MICs) and minimal bactericidal concentrations (MBCs) of ISJ alone. The results showed t...
Directory of Open Access Journals (Sweden)
Shuai Liu
2014-10-01
Full Text Available Blood fluke proteases play pivotal roles in the processes of invasion, nutrition acquisition, immune evasion, and other host-parasite interactions. Hundreds of genes encoding putative proteases have been identified in the recently published schistosome genomes. However, the expression profiles of these proteases in Schistosoma species have not yet been systematically analyzed. We retrieved and culled the redundant protease sequences of Schistosoma japonicum, Schistosoma mansoni, Echinococcus multilocularis, and Clonorchis sinensis from public databases utilizing bioinformatic approaches. The degradomes of the four parasitic organisms and Homo sapiens were then comparatively analyzed. A total of 262 S. japonicum protease sequences were obtained and the expression profiles generated using whole-genome microarray. Four main clusters of protease genes with different expression patterns were identified: proteases up-regulated in hepatic schistosomula and adult worms, egg-specific or predominantly expressed proteases, cercaria-specific or predominantly expressed proteases, and constantly expressed proteases. A subset of protease genes with different expression patterns were further validated using real-time quantitative PCR. The present study represents the most comprehensive analysis of a degradome in Schistosoma species to date. These results provide a firm foundation for future research on the specific function(s of individual proteases and may help to refine anti-proteolytic strategies in blood flukes.
G.O. Silva; A.F. Carvalho; S. Miyashiro; A.F.C. Nassar; R.M. Piatti; E. Scarcelli
2012-01-01
Isolaram-se estirpes de Campylobacter spp. em amostras de carcaças (n=65), fezes (n=65) e linfonodos mesentéricos (n=65) de suínos abatidos em frigoríficos do estado de São Paulo e detectaram, pela técnica da Multiplex-PCR, a presença do complexo de genes cdt, responsáveis pela expressão do fator de virulência da toxina CDT. Do total de 195 amostras de origem suína, Campylobacter spp. foi isolado de 31 (15,9%), sendo 29 (93,6%) de amostras de suabe retal, 1/65 (3,2%) de suabe de carcaça e um ...
Peng, Jinbiao; Gobert, Geoffrey N.; Hong, Yang; Jiang, Weibin; Han, Hongxiao; McManus, Donald P.; Wang, Xinzhi; Liu, Jinming; Fu, Zhiqiang; Shi, Yaojun; Lin, Jiaojiao
2011-01-01
The reed vole, Microtus fortis, is the only known mammalian host in which schistosomes of Schistosoma japonicum are unable to mature and cause significant pathogenesis. However, little is known about how Schistosoma japonicum maturation (and, therefore, the development of schistosomiasis) is prevented in M. fortis. In the present study, the ultrastructure of 10 days post infection schistosomula from BALB/c mice and M. fortis were first compared using scanning electron microscopy and transmission electron microscopy. Electron microscopic investigations showed growth retardation and ultrastructural differences in the tegument and sub-tegumental tissues as well as in the parenchymal cells of schistosomula from M. fortis compared with those in BALB/c mice. Then, microarray analysis revealed significant differential expression between the schistosomula from the two rodents, with 3,293 down-regulated (by ≥2-fold) and 71 up-regulated (≥2 fold) genes in schistosomula from the former. The up-regulated genes included a proliferation-related gene encoding granulin (Grn) and tropomyosin. Genes that were down-regulated in schistosomula from M. fortis included apoptosis-inhibited genes encoding a baculoviral IAP repeat-containing protein (SjIAP) and cytokine-induced apoptosis inhibitor (SjCIAP), genes encoding molecules involved in insulin metabolism, long-chain fatty acid metabolism, signal transduction, the transforming growth factor (TGF) pathway, the Wnt pathway and in development. TUNEL (terminal deoxynucleotidyl transferase dUTP nick end labeling) and PI/Annexin V-FITC assays, caspase 3/7 activity analysis, and flow cytometry revealed that the percentages of early apoptotic and late apoptotic and/or necrotic cells, as well as the level of caspase activity, in schistosomula from M. fortis were all significantly higher than in those from BALB/c mice. PMID:21731652
Directory of Open Access Journals (Sweden)
Lihui Zhu
2016-02-01
Full Text Available Schistosomes, blood flukes, are an important global public health concern. Paired adult female schistosomes produce large numbers of eggs that are primarily responsible for the disease pathology and critical for dissemination. Consequently, understanding schistosome sexual maturation and egg production may open novel perspectives for intervening with these processes to prevent clinical symptoms and to interrupt the life-cycle of these blood-flukes. microRNAs (miRNAs are key regulators of many biological processes including development, cell proliferation, metabolism, and signal transduction. Here, we report on the identification of Schistosoma japonicum miRNAs using small RNA deep sequencing in the key stages of male-female pairing, gametogenesis, and egg production. We identified 38 miRNAs, including 10 previously unknown miRNAs. Eighteen of the miRNAs were differentially expressed between male and female schistosomes and during different stages of sexual maturation. We identified 30 potential target genes for 16 of the S. japonicum miRNAs using antibody-based pull-down assays and bioinformatic analyses. We further validated some of these target genes using either in vitro luciferase assays or in vivo miRNA suppression experiments. Notably, suppression of the female enriched miRNAs bantam and miR-31 led to morphological alteration of ovaries in female schistosomes. These findings uncover key roles for specific miRNAs in schistosome sexual maturation and egg production.
Zhu, Lihui; Zhao, Jiangping; Wang, Jianbin; Hu, Chao; Peng, Jinbiao; Luo, Rong; Zhou, Chunjing; Liu, Juntao; Lin, Jiaojiao; Jin, Youxin; Davis, Richard E; Cheng, Guofeng
2016-02-01
Schistosomes, blood flukes, are an important global public health concern. Paired adult female schistosomes produce large numbers of eggs that are primarily responsible for the disease pathology and critical for dissemination. Consequently, understanding schistosome sexual maturation and egg production may open novel perspectives for intervening with these processes to prevent clinical symptoms and to interrupt the life-cycle of these blood-flukes. microRNAs (miRNAs) are key regulators of many biological processes including development, cell proliferation, metabolism, and signal transduction. Here, we report on the identification of Schistosoma japonicum miRNAs using small RNA deep sequencing in the key stages of male-female pairing, gametogenesis, and egg production. We identified 38 miRNAs, including 10 previously unknown miRNAs. Eighteen of the miRNAs were differentially expressed between male and female schistosomes and during different stages of sexual maturation. We identified 30 potential target genes for 16 of the S. japonicum miRNAs using antibody-based pull-down assays and bioinformatic analyses. We further validated some of these target genes using either in vitro luciferase assays or in vivo miRNA suppression experiments. Notably, suppression of the female enriched miRNAs bantam and miR-31 led to morphological alteration of ovaries in female schistosomes. These findings uncover key roles for specific miRNAs in schistosome sexual maturation and egg production.
2010-01-01
В статье приведены результаты работы за 2007 год, когда после аномально теплой зимы, впервые за 110 лет интродукции Acer japonicum (клён японский, входит в Красную книгу России) в ботаническом саду Санкт-Петербургской лесотехнической академии были получены его семена, и из них выращено семенное потомство. На фоне потепления климата в начале XXI века клён японский стал меньше обмерзать, отдельные экземпляры из жизненной формы кустарника стали расти деревом. Этот вид достиг здесь рекордных разм...
Directory of Open Access Journals (Sweden)
Guo Chen
2011-09-01
Full Text Available BACKGROUND: Schistosomiasis japonica is a zoonotic parasitic disease and oral vaccine delivery system would be benefit for prevention of this disease. Although attenuated salmonella has been used as an antigen expression vector for oral vaccine development, the membrane-bound vacuoles in which bacteria reside hinders the presentation of expressed heterologous antigens to the major histocompatibility complex (MHC molecules. The present work used an attenuated Salmonella typhimurium strain VNP20009 to secretory expression of Sj23LHDGST bivalent antigen from Schistosoma japonicum and tested the protective efficacy against S. japonicum infection in orally immunized mice. METHODOLOGY/PRINCIPAL FINDINGS: Promoters (nirB or pagC were used to express the antigen (Sj23LHDGST and the Salmonella type III or α-hemolysin secretion system was employed to secrete it. The immunoblotting analysis and fluorescent microscopy revealed that the antigen was effectively expressed and delivered to the cytosol of macrophages in vitro. Among recombinant vaccine strains, an engineered VNP20009 which expressed the antigen by nirB promoter and secreted it through type III secretion system (nirB-sopE(1-104-Sj23LHD-GST efficiently protected against S. japonicum infection in a mouse model. This strain elicited a predominantly IgG(2a antibody response and a markedly increase in the production of IL-12 and IFN-γ. The flow cytometric analysis demonstrated that this strain caused T cell activation as evidenced by significantly increased expression of CD44 and CD69. CONCLUSION/SIGNIFICANCE: Oral delivery of antigen by nirB-driven Salmonella typhimurium type III secretion system is a novel, safe, inexpensive, efficient and convenient approach for schistosome vaccine development.
Inhibition of hydrogenase synthesis by DNA gyrase inhibitors in Bradyrhizobium japonicum
International Nuclear Information System (INIS)
Novak, P.D.; Maier, R.J.
1987-01-01
Derepression of an uptake hydrogenase in Bradyrhizobium japonicum is dependent on a microaerophilic environment. Addition of DNA gyrase inhibitors during derepression of hydrogenase specifically prevented expression of the hydrogenase enzyme. Antibodies to individual hydrogenase subunits failed to detect the protein after derepression in the presence of inhibitors, although there was no general inhibition of protein synthesis. The general pattern of proteins synthesized from 14 C-labeled amino acids during derepression was no significantly different whether proteins were labeled in the presence or in the absence of gyrase inhibitors. In contrast, if transcription or translation was inhibited by addition of inhibitors of those functions, virtually no proteins were labeled during derepression. This indicated that most of the 14 C-labeled proteins were synthesized de novo during derepression, synthesis of most proteins was unaffected by gyrase inhibitors, and the dependence of hydrogenase synthesis on gyrase activity was a specific one
Kumagai, Takashi; Furushima-Shimogawara, Rieko; Ohmae, Hiroshi; Wang, Tian-Ping; Lu, Shaohong; Chen, Rui; Wen, Liyong; Ohta, Nobuo
2010-09-01
Polymerase chain reaction (PCR) with the specific primer set amplifying 28S ribosomal DNA (rDNA) of Schistosoma japonicum was able to detect genomic DNA of S. japonicum, but not S. mansoni, at 100 fg. This procedure enabled us to detect the DNA from a single miracidium and a snail infected with one miracidium at just 1 day after infection. We compared these results with those from loop-mediated isothermal amplification (LAMP) targeting 28S rDNA and found similar results. The LAMP could amplify the specific DNA from a group of 100 normal snails mixed with one infected snail A PCR screening of infected snails from endemic regions in Anhui Province revealed schistosomal DNA even in snails found negative by microscopy. PCR and LAMP show promise for monitoring the early infection rate in snails, and they may be useful for predicting the risk of infection in the endemic places.
Approaches to genotyping individual miracidia of Schistosoma japonicum.
Xiao, Ning; Remais, Justin V; Brindley, Paul J; Qiu, Dong-Chuan; Carlton, Elizabeth J; Li, Rong-Zhi; Lei, Yang; Blair, David
2013-12-01
Molecular genetic tools are needed to address questions as to the source and dynamics of transmission of the human blood fluke Schistosoma japonicum in regions where human infections have reemerged, and to characterize infrapopulations in individual hosts. The life stage that interests us as a target for collecting genotypic data is the miracidium, a very small larval stage that consequently yields very little DNA for analysis. Here, we report the successful development of a multiplex format permitting genotyping of 17 microsatellite loci in four sequential multiplex reactions using a single miracidium held on a Whatman Classic FTA indicating card. This approach was successful after short storage periods, but after long storage (>4 years), considerable difficulty was encountered in multiplex genotyping, necessitating the use of whole genome amplification (WGA) methods. WGA applied to cards stored for long periods of time resulted in sufficient DNA for accurate and repeatable genotyping. Trials and tests of these methods, as well as application to some field-collected samples, are reported, along with the discussion of the potential insights to be gained from such techniques. These include recognition of sibships among miracidia from a single host, and inference of the minimum number of worm pairs that might be present in a host.
Evolutionary Instability of Symbiotic Function in Bradyrhizobium japonicum
Sachs, Joel L.; Russell, James E.; Hollowell, Amanda C.
2011-01-01
Bacterial mutualists are often acquired from the environment by eukaryotic hosts. However, both theory and empirical work suggest that this bacterial lifestyle is evolutionarily unstable. Bacterial evolution outside of the host is predicted to favor traits that promote an independent lifestyle in the environment at a cost to symbiotic function. Consistent with these predictions, environmentally-acquired bacterial mutualists often lose symbiotic function over evolutionary time. Here, we investigate the evolutionary erosion of symbiotic traits in Bradyrhizobium japonicum, a nodulating root symbiont of legumes. Building on a previous published phylogeny we infer loss events of nodulation capability in a natural population of Bradyrhizobium, potentially driven by mutation or deletion of symbiosis loci. Subsequently, we experimentally evolved representative strains from the symbiont population under host-free in vitro conditions to examine potential drivers of these loss events. Among Bradyrhizobium genotypes that evolved significant increases in fitness in vitro, two exhibited reduced symbiotic quality, but no experimentally evolved strain lost nodulation capability or evolved any fixed changes at six sequenced loci. Our results are consistent with trade-offs between symbiotic quality and fitness in a host free environment. However, the drivers of loss-of-nodulation events in natural Bradyrhizobium populations remain unknown. PMID:22073160
Giri, Bikash Ranjan; Du, Xiaoli; Xia, Tianqi; Chen, Yongjun; Li, Hao; Cheng, Guofeng
2017-07-01
Pluripotent stem cells, called neoblasts, are well known for the regenerative capability and developmental plasticity in flatworms. Impressive advancement has been made in free-living flatworms, while in case of its parasitic counterpart, neoblast-like stem cells have attracted recent attention for its self-renewal and differentiation capacity. Nanos is a key conserved post-transcriptional regulator critical for the formation, development, and/or maintenance of the pluripotent germ line stem cell systems in many metazoans including schistosomes. In the present study, we report the molecular cloning and expression of nanos orthologous genes nanos in Schistosoma japonicum (Sjnanos). The cDNA of Sjnanos is 826 bp long, containing an open reading frame (ORF) for 223 amino acid long protein. qRT-PCR analysis shown that Sjnanos was differently expressed in several stages of schistosomes with relatively high level in schistosomula. Additionally, Sjnanos was expressed highly in adult females compared to adult males. Transfection of recombinant plasmid for expressing Sjnanos resulted in significant proliferation and increased expression of several stem cell factors in mammalian cells. Overall, our preliminary study provides the molecular basis to further functionally characterize Sjnanos in S. japonicum.
International Nuclear Information System (INIS)
Shi, Y.-E.; Jiang, C.-F.; Han, J.-J.; Li, Y.-L.
1993-01-01
Since pigs are important in the zoonotic transmission of schistosomiasis japonica in China, a veterinary vaccine might contribute to the control of the disease in humans. Pigs were immunized with three doses each of 10 000 cercariae of Schistosoma japonicum attenuated with ultraviolet light (400 μWatt.min/cm 2 ). The experiment was performed with portable irradiation equipment in a rural area of the Hubei Province (P.R. China). A challenge infection of 1000 untreated cercariae was given 2.5 or 6 months after the last immunization, and age-matched naive pigs were challenged as a control. Immunized pigs developed about 90% resistance against the challenge. The liver egg load of these animals was reduced by over 90%. Less than 0.01% of the immunizing cercariae developed to adult parasites and the vaccination had no apparent adverse influence on the pig's health. (Author)
Nickel accumulation and storage in bradyrhizobium japonicum
International Nuclear Information System (INIS)
Maier, R.J.; Pihl, T.D.; Stults, L.; Sray, W.
1990-01-01
Hydrogenase-depressed (chemolithotrophic growth conditions) and heterotrophically grown cultures of Bradyrhizobium japonicum accumulated nickel about equally over a 3-h period. Both types of cultures accumulated nickel primarily in a form that was not exchangeable with NiCl 2 , and they accumulated much more Ni than would be needed for the Ni-containing hydrogenase. The nickel accumulated by heterotrophically incubated cultures could later be mobilized to allow active hydrogenase synthesis during derepression in the absence of nickel, while cells both grown with Ni and the derepressed without nickel had low hydrogenase activities. The level of activity in cells grown with Ni and then derepressed without nickel was about the same as that in cultures derepressed in the presence of nickel. The Ni accumulated by heterotrophically grown cultures was associated principally with soluble proteins rather than particulate material, and this Ni was not lost upon dialyzing an extract containing the soluble proteins against either Ni-containing or EDTA-containing buffer. However, this Ni was lost upon pronase or low pH treatments. The soluble Ni-binding proteins were partially purified by gel filtration and DEAE chromatography. They were not antigenically related to hydrogenase peptides. Much of the 63 Ni eluted as a single peak of 48 kilodaltons. Experiments involving immunuprecipitation of 63 Ni-containing hydrogenase suggested that the stored source of Ni in heterotrophic cultures that could later be mobilized into hydrogenase resided in the nonexchangeable Ni-containing fraction rather than in loosely bound or ionic forms
Directory of Open Access Journals (Sweden)
Spear Robert
2011-02-01
Full Text Available Abstract Re-emergence of schistosomiasis in regions of China where control programs have ceased requires development of molecular-genetic tools to track gene flow and assess genetic diversity of Schistosoma populations. We identified many microsatellite loci in the draft genome of Schistosoma japonicum using defined search criteria and selected a subset for further analysis. From an initial panel of 50 loci, 20 new microsatellites were selected for eventual optimization and application to a panel of worms from endemic areas. All but one of the selected microsatellites contain simple tri-nucleotide repeats. Moderate to high levels of polymorphism were detected. Numbers of alleles ranged from 6 to 14 and observed heterozygosity was always >0.6. The loci reported here will facilitate high resolution population-genetic studies on schistosomes in re-emergent foci.
Molehin, Adebayo J; Sennoune, Souad R; Zhang, Weidong; Rojo, Juan U; Siddiqui, Arif J; Herrera, Karlie A; Johnson, Laura; Sudduth, Justin; May, Jordan; Siddiqui, Afzal A
2017-11-01
Schistosomiasis remains a major global health problem. Despite large-scale schistosomiasis control efforts, clear limitations such as possible emergence of drug resistance and reinfection rates highlight the need for an effective schistosomiasis vaccine. Schistosoma mansoni large subunit of calpain (Sm-p80)-based vaccine formulations have shown remarkable efficacy in protecting against S. mansoni challenge infections in mice and baboons. In this study, we evaluated the cross-species protective efficacy of Sm-p80 vaccine against S. japonicum and S. haematobium challenge infections in rodent models. We also elucidated the expression of Sm-p80 and Sm-p80 ortholog proteins in different developmental stages of S. mansoni, S. haematobium, and S. japonicum. Immunization with Sm-p80 vaccine reduced worm burden by 46.75% against S. japonicum challenge infection in mice. DNA prime/protein boost (1 + 1 dose administered on a single day) resulted in 26.95% reduction in worm burden in S. haematobium-hamster infection/challenge model. A balanced Th1 (IFN-γ, TNF-α, IL-2, and IL-12) and Th2 (IL-4, IgG1) type of responses were observed following vaccination in both S. japonicum and S. haematobium challenge trials and these are associated with the prophylactic efficacy of Sm-p80 vaccine. Immunohistochemistry demonstrated that Sm-p80/Sm-p80 ortholog proteins are expressed in different life cycle stages of the three major human species of schistosomes studied. The data presented in this study reinforce the potential of Sm-p80-based vaccine for both hepatic/intestinal and urogenital schistosomiasis occurring in different geographical areas of the world. Differential expression of Sm-p80/Sm-p80 protein orthologs in different life cycle makes this vaccine potentially useful in targeting different levels of infection, disease, and transmission.
Initial Integrated Strategic Sustainability Plan for Fort Leonard Wood
2012-05-01
and quantify the benefits of various sustainable workforce staffing tools (e.g., flex time, job sharing, telecommuting , etc.). CPAC 0.1 3Q - 4Q...desk tops NEC G6 1Q — Track telecommuting hours CPAC 1Q — Calculate benefits - miles
Directory of Open Access Journals (Sweden)
Darren J Gray
2009-06-01
Full Text Available Zoonotic schistosomiasis japonica is a major public health problem in China. Bovines, particularly water buffaloes, are thought to play a major role in the transmission of schistosomiasis to humans in China. Preliminary results (1998-2003 of a praziquantel (PZQ-based pilot intervention study we undertook provided proof of principle that water buffaloes are major reservoir hosts for S. japonicum in the Poyang Lake region, Jiangxi Province.Here we present the results of a cluster-randomised intervention trial (2004-2007 undertaken in Hunan and Jiangxi Provinces, with increased power and more general applicability to the lake and marshlands regions of southern China. The trial involved four matched pairs of villages with one village within each pair randomly selected as a control (human PZQ treatment only, leaving the other as the intervention (human and bovine PZQ treatment. A sentinel cohort of people to be monitored for new infections for the duration of the study was selected from each village. Results showed that combined human and bovine chemotherapy with PZQ had a greater effect on human incidence than human PZQ treatment alone.The results from this study, supported by previous experimental evidence, confirms that bovines are the major reservoir host of human schistosomiasis in the lake and marshland regions of southern China, and reinforce the rationale for the development and deployment of a transmission blocking anti-S. japonicum vaccine targeting bovines.Australian New Zealand Clinical Trials Registry ACTRN12609000263291.
Czech Academy of Sciences Publication Activity Database
De Oliveira, F.M.B.; Da Silva, I.C.dA.; Rumjanek, F.D.; Dias-Neto, E.; Guimaraes, P.E.M.; Verjovski-Almeida, S.; Štros, Michal; Fantappié, M.R.
2006-01-01
Roč. 377, - (2006), s. 33-45 ISSN 0378-1119 R&D Projects: GA ČR(CZ) GA204/05/2031 Institutional research plan: CEZ:AV0Z50040507 Keywords : HMGB1 * Schistosoma mansoni * Schistosoma japonicum Subject RIV: BO - Biophysics Impact factor: 2.721, year: 2006
Directory of Open Access Journals (Sweden)
Vipin Kaithwas
2017-06-01
Full Text Available In this study the proteome response of the two diazotrophic organism’s viz. Nostoc muscorum and Bradyrhizobium japonicum exposed to salt (NaCl and osmotic (sucrose stresses was compared. Out of the total over expressed proteins; we have selected only three over expressed proteins viz. GroEL chaperonin, nitrogenase Mo-Fe protein and argininosuccinate synthase for further analysis, and then we analyzed the amino acid frequencies of all the three over expressed proteins. That led to the conclusion that amino acids e.g. alanine, glycine and valine that were energetically cheaper to produce were showing higher frequencies. This study would help in tracing the phylogenetic relationship between protein families.
Morales, Chelsea T; Muzquiz, LeeAnna I; Howlett, Kevin; Azure, Bernie; Bodnar, Brenda; Finley, Vernon; Incashola, Tony; Mathias, Cheryl; Laukes, Cindi; Beatty, Patrick; Burke, Wylie; Pershouse, Mark A; Putnam, Elizabeth A; Trinidad, Susan Brown; James, Rosalina; Woodahl, Erica L
2016-01-01
Inclusion of American Indian and Alaska Native (AI/AN) populations in pharmacogenetic research is key if the benefits of pharmacogenetic testing are to reach these communities. Community-based participatory research (CBPR) offers a model to engage these communities in pharmacogenetics. An academic-community partnership between the University of Montana (UM) and the Confederated Salish and Kootenai Tribes (CSKT) was established to engage the community as partners and advisors in pharmacogenetic research. A community advisory committee, the Community Pharmacogenetics Advisory Council (CPAC), was established to ensure community involvement in the research process. To promote bidirectional learning, researchers gave workshops and presentations about pharmacogenetic research to increase research capacity and CPAC members trained researchers in cultural competencies. As part of our commitment to a sustainable relationship, we conducted a self-assessment of the partnership, which included surveys and interviews with CPAC members and researchers. Academic and community participants agree that the partnership has promoted a bidirectional exchange of knowledge. Interviews showed positive feedback from the perspectives of both the CPAC and researchers. CPAC members discussed their trust in and support of the partnership, as well as having learned more about research processes and pharmacogenetics. Researchers discussed their appreciation of CPAC involvement in the project and guidance the group provided in understanding the CSKT community and culture. We have created an academic-community partnership to ensure CSKT community input and to share decision making about pharmacogenetic research. Our CBPR approach may be a model for engaging AI/AN people, and other underserved populations, in genetic research.
Directory of Open Access Journals (Sweden)
Marcos Roberto Dobler Stroschein
2010-12-01
Full Text Available Legume species belonging to the genus Lupinus are annual herb plants. The majority of them are indigenous to the Americas. They are known for nitrogen-fixing symbioses with soil bacteria collectively called rhizobia. The aim of this study was to characterize a rhizobium strain isolated from Lupinus albescens using phenotypic, symbiotic and molecular approaches. Strain UFSM LA 1.3 was tested in vitro according to several parameters: colony size, color and growing rate; acid or alkaline reaction in yeast mannitol media supplemented with bromothymol blue; gum production. Molecular characterization was evaluated by PCR technique using primers BOX A1-R and sequence analysis of the 16S-23S rDNA intergenic region (ITS. ITS sequencing fragments showed genetic similarity with Bradyrhizobium sp. The polymorphism observed by BOX-PCR have shown that strain differs from the reference strain SEMIA 928 and SEMIA 938. The symbiotic efficiency under axenic conditions of UFSM LA 1.3 was 94.6%, without statistical differences compared to the mineral nitrogen fertilized control, to which was applied solution of 400 mg of ammonium nitrate.Espécies de leguminosas pertencentes ao gênero Lupinus são plantas herbáceas anuais. A maioria é originária das Américas. Estas plantas estabelecem simbioses com bactérias do solo que realizam fixação biológica de nitrogênio coletivamente chamada de rizóbios. Caracterizou-se uma estirpe isolada de Lupinus albescens por meio de características fenotípicas, simbióticas e moleculares. A estirpe UFSM LA 1.3 foi testada in vitro de acordo com os parâmetros: tamanho de colônia; cor e taxa de crescimento; reação ácida ou básica em meio levedura manitol suplementado com azul de bromotimol; produção de goma. A caracterização molecular foi feita pela técnica de PCR usando os oligonucleotídeos BOX A1-R e seqüenciamento da região ITS. A análise da seqüência dos fragmentos da região intergênica (ITS 16S-26S r
Ultrasonic and x-ray tomographic findings of Schistosomiasis Japonicum
International Nuclear Information System (INIS)
Nagata, Osamu; Uto, Koji; Sugihara, Hisayo; Takii, Masaru; Nohara, Yumiko; Tominaga, Hidetoshi; Kaji, Masaro; Koga, Teruto.
1986-01-01
In the present study, attempts were made to classify the ultrasonic patterns of the liver infected with Schistosoma Japonicum. The calcification and fibrosis of the liver were evaluated by comparative investigation with an ultrasonogram and computed tomography (CT). Schistosomiasis Japonica was examined in 23 patients who were more than 45 years of age. It was diagnosed by liver needle biopsy, an intracutaneous test, or autopsy. The cases with a fish scale and network pattern had attenuation of the liver on ultrasonography and were unspecific on CT. Histological findings demonstrated moderate liver fibrosis. The cases with a sieve pattern had attenuation on ultrasonography, and the CT disclosed a retractive liver and the CT number of that liver was increased. Histological findings demonstrated a severe fibrotic liver. The cases with a mottled pattern had increased reflective spotty echo with an acoustic shadow, and the CT disclosed calcification. The histological findings demonstrated a marked calcification of the eggs. The cases with a mixed pattern, which consisted of mottled and sieve based on fish scale and network, had no retraction with less increase in the CT number. These results suggest that the peculiar reflective echo pattern of Schistosomiasis Japonica was due to not only calcification but also fibrosis of the liver. (author)
Directory of Open Access Journals (Sweden)
Pengfei Cai
2016-04-01
Full Text Available Schistosomiasis is a chronic and debilitating disease caused by blood flukes (digenetic trematodes of the genus Schistosoma. Schistosomes are sexually dimorphic and exhibit dramatic morphological changes during a complex lifecycle which requires subtle gene regulatory mechanisms to fulfil these complex biological processes. In the current study, a 41,982 features custom DNA microarray, which represents the most comprehensive probe coverage for any schistosome transcriptome study, was designed based on public domain and local databases to explore differential gene expression in S. japonicum. We found that approximately 1/10 of the total annotated genes in the S. japonicum genome are differentially expressed between adult males and females. In general, genes associated with the cytoskeleton, and motor and neuronal activities were readily expressed in male adult worms, whereas genes involved in amino acid metabolism, nucleotide biosynthesis, gluconeogenesis, glycosylation, cell cycle processes, DNA synthesis and genome fidelity and stability were enriched in females. Further, miRNAs target sites within these gene sets were predicted, which provides a scenario whereby the miRNAs potentially regulate these sex-biased expressed genes. The study significantly expands the expressional and regulatory characteristics of gender-biased expressed genes in schistosomes with high accuracy. The data provide a better appreciation of the biological and physiological features of male and female schistosome parasites, which may lead to novel vaccine targets and the development of new therapeutic interventions.
Cai, Pengfei; Liu, Shuai; Piao, Xianyu; Hou, Nan; Gobert, Geoffrey N; McManus, Donald P; Chen, Qijun
2016-04-01
Schistosomiasis is a chronic and debilitating disease caused by blood flukes (digenetic trematodes) of the genus Schistosoma. Schistosomes are sexually dimorphic and exhibit dramatic morphological changes during a complex lifecycle which requires subtle gene regulatory mechanisms to fulfil these complex biological processes. In the current study, a 41,982 features custom DNA microarray, which represents the most comprehensive probe coverage for any schistosome transcriptome study, was designed based on public domain and local databases to explore differential gene expression in S. japonicum. We found that approximately 1/10 of the total annotated genes in the S. japonicum genome are differentially expressed between adult males and females. In general, genes associated with the cytoskeleton, and motor and neuronal activities were readily expressed in male adult worms, whereas genes involved in amino acid metabolism, nucleotide biosynthesis, gluconeogenesis, glycosylation, cell cycle processes, DNA synthesis and genome fidelity and stability were enriched in females. Further, miRNAs target sites within these gene sets were predicted, which provides a scenario whereby the miRNAs potentially regulate these sex-biased expressed genes. The study significantly expands the expressional and regulatory characteristics of gender-biased expressed genes in schistosomes with high accuracy. The data provide a better appreciation of the biological and physiological features of male and female schistosome parasites, which may lead to novel vaccine targets and the development of new therapeutic interventions.
Directory of Open Access Journals (Sweden)
Lifu Wang
2017-09-01
Full Text Available Exosomes are 30–150 nm small membrane vesicles that are released into the extracellular medium via cells that function as a mode of intercellular communication. Dendritic cell (DC-derived exosomes modulate immune responses and prevent the development of autoimmune diseases. Moreover, Schistosoma japonicum eggs show modulatory effects in a mouse model of colitis. Therefore, we hypothesized that exosomes derived from DCs treated with S. japonicum soluble eggs antigen (SEA; SEA-treated DC exosomes would be useful for treating inflammatory bowel disease (IBD. Exosomes were purified from the supernatant of DCs treated or untreated with SEA and identified via transmission electron microscopy, western blotting and NanoSight. Acute colitis was induced via the administration of dextran sulfate sodium (DSS in drinking water (5.0%, wt/vol. Treatment with exosomes was conducted via intraperitoneal injection (i.p.; 50 μg per mouse from day 0 to day 6. Clinical scores were calculated based on weight loss, stool type, and bleeding. Colon length was measured as an indirect marker of inflammation, and colon macroscopic characteristics were determined. Body weight loss and the disease activity index of DSS-induced colitis mice decreased significantly following treatment with SEA-treated DC exosomes. Moreover, the colon lengths of SEA-treated DC exosomes treated colitis mice improved, and their mean colon macroscopic scores decreased. In addition, histologic examinations and histological scores showed that SEA-treated DC exosomes prevented colon damage in acute DSS-induced colitis mice. These results indicate that SEA-treated DC exosomes attenuate the severity of acute DSS-induced colitis mice more effectively than DC exosomes. The current work suggests that SEA-treated DC exosomes may be useful as a new approach to treat IBD.
International Nuclear Information System (INIS)
Vauclare, Pierre; Bligny, Richard; Gout, Elisabeth; Widmer, Francois
2013-01-01
Bradyrhizobium japonicum is a symbiotic nitrogen-fixing soil bacteria that induce root nodules formation in legume soybean (Glycine max.). Using 13 C- and 31 P-nuclear magnetic resonance (NMR) spectroscopy, we have analysed the metabolite profiles of cultivated B. japonicum cells and bacteroids isolated from soybean nodules. Our results revealed some quantitative and qualitative differences between the metabolite profiles of bacteroids and their vegetative state. This includes in bacteroids a huge accumulation of soluble carbohydrates such as trehalose, glutamate, myo-inositol and homo-spermidine as well as Pi, nucleotide pools and intermediates of the primary carbon metabolism. Using this novel approach, these data show that most of the compounds detected in bacteroids reflect the metabolic adaptation of rhizobia to the surrounding microenvironment with its host plant cells. (authors)
Directory of Open Access Journals (Sweden)
Liu Feng
2010-11-01
Full Text Available Abstract Background Schistosomiasis remains a major public health problem in endemic countries and is caused by infections with any one of three primary schistosome species. Although there are no vaccines available to date, this strategy appears feasible since natural immunity develops in individuals suffering from repeated infection during a lifetime. Since vaccinations resulting in both Th1- and Th2-type responses have been shown to contribute to protective immunity, a vaccine formulation with the capacity for stimulating multiple arms of the immune response will likely be the most effective. Previously we developed partially protective, single Th- and B cell-epitope-based peptide-DNA dual vaccines (PDDV (T3-PDDV and B3-PDDV, respectively capable of eliciting immune responses against the Schistosoma japonicum 22.6 kDa tegument antigen (Sj22.6 and a 62 kDa fragment of myosin (Sj62, respectively. Results In this study, we developed PDDV cocktails containing multiple epitopes of S. japonicum from Sj22.6, Sj62 and Sj97 antigens by predicting cytotoxic, helper, and B-cell epitopes, and evaluated vaccine potential in vivo. Results showed that mice immunized with a single-epitope PDDV elicited either Tc, Th, or B cell responses, respectively, and mice immunized with either the T3- or B3- single-epitope PDDV formulation were partially protected against infection. However, mice immunized with a multicomponent (3 PDDV components formulation elicited variable immune responses that were less immunoprotective than single-epitope PDDV formulations. Conclusions Our data show that combining these different antigens did not result in a more effective vaccine formulation when compared to each component administered individually, and further suggest that immune interference resulting from immunizations with antigenically distinct vaccine targets may be an important consideration in the development of multicomponent vaccine preparations.
Rasulov, Bakhtiyor; Rustamova, Nigora; Yili, Abulimiti; Zhao, Hai-Qing; Aisa, Haji A
2016-07-01
Silver nanoparticles (SNPs) were synthesized on the basis of exopolysaccharides (low and high molar mass) of diazotrophic Bradyrhizobium japonicum 36 strain. The synthesis of SNPs was carried out by direct reduction of silver nitrate with ethanol-insoluble (high molar mass, HMW) and ethanol-soluble (low molar mass, LMW) fractions of exopolysaccharides (EPS), produced by diazotrophic strain B. japonicum 36. SNPs were characterized using UV-vis spectroscopy, transmission electron microscopy (TEM), X-ray diffraction (XRD), and Fourier transform infrared spectroscopy (FTIR). SNPs synthesized on the basis of LMW EPS absorbed radiation in the visible regions of 420 nm, whereas SNPs based on the HMW EPS have a wavelength maximum at 450 nm because of the strong SPR transition. Moreover, the antibacterial and antifungal activities of the SNPs were examined in vitro against Escherichia coli, Staphylococcus aureus, and Candida albicans. SNPs synthesized on the basis of LMW EPS were active than those synthesized on the basis of HMW EPS. Besides, UV-visible spectroscopic evaluation confirmed that SNPs synthesized on the basis of LMW EPS were far more stable than those obtained on the basis of HMW EPS.
[Preservation of live eggs of Schistosoma japonicum].
Lan, Wei-ming; Xie, Shu-ying; Wang, Qin; Jiang, Wei-sheng; Hu, Ren-mei; Ge, Jun; Zeng, Xiao-jun
2015-10-01
To observe the preservation time and activity of miracidium hatching from schistosome eggs preserved in different solutions, so as to obtain the optimal preservation conditions and then provide quality control products for field application. The rectum stool of rabbits infected with Schistosoma japonicum was collected and the coarse fecal residue was removed with a series of sample sieves of 80, 100, 160 and 200 meshes respectively, and then the schistosome eggs were concentrated with the sample sieve of 260 meshes. The concentrated eggs were preserved in 0.9% sodium chloride solution, 1.2% sodium chloride solution, phosphate buffered saline solution (PBS, PH 7.2), 1.0% sucrose solution, and Mili-Q water, respectively, and then were conserved in a 4 °C refrigerator and 15 °C constant temperature incubator, respectively. The preserved eggs were hatched in different time (7-day interval) , the vitality and quantity of the miracidia were observed, and the hatching rates were calculated. Under the condition of 4 °C, the hatching rates of eggs dropped to 0 in 1.0% sucrose solution and 1.2% sodium chloride solution at the 49th and 126th day, respectively, and the hatching rates of eggs in the 0.9% sodium chloride solution and PBS solution dropped to 10% at the 112th day, and the activity of miracidium was weakened since 140th. In the Mili-Q water, the hatching rate dropped less than 10% at the 196th day and the activity of miracidia was weakened since the 280th day. Under the condition of 15 °C, the hatching rate of eggs in different solutions gradually dropped to 0 from the 49th day to 105th day. The eggs preserved in Mili-Q water at the temperature of 4 °C can be used as the positive reference for hatching tests within 196 days.
Directory of Open Access Journals (Sweden)
Leandro Barbiéri de Carvalho
2010-04-01
Full Text Available Studies have shown that ticks are susceptible to infection by entomopathogenic nematodes. These studies indicate different susceptibilities of ticks to infection by these fungi, depending on the tick species, development phase, entomopathogenic nematodes species and strains and the time the ticks are exposed to them. Usually this period ranges from 24 to 72 hours. The aim of this study was to evaluate the infection times in vitro of engorged Rhipicephalus (Boophilus microplus females by the entomopathogenic nematodes Steinernema glaseri CCA strain, by analysis of the ticks' biological parameters. The results show that a 2-hour exposure time was sufficient for the engorged R. microplus females to be infected by S. glaseri CCA, but that a minimum exposure time of 24 hours was necessary to generate treatment efficacy above 90%.Os carrapatos são susceptíveis à infecção por nematoides entomopatogênicos. Essa susceptibilidade diverge quanto às espécies de carrapato estudadas, à fase evolutiva, às espécies e estirpes dos nematoides e ao tempo ao qual os carrapatos ficam expostos a estes. O presente trabalho teve como objetivo avaliar os tempos de infecção in vitro de fêmeas ingurgitadas de Rhipicephalus (Boophilus microplus pelo nematoide entomopatogênico Steinernema glaseri estirpe CCA, pela análise dos parâmetros biológicos do carrapato. Os resultados obtidos demonstraram que um período de duas horas de exposição foi suficiente para que fêmeas ingurgitadas de R. microplus fossem infectadas por S. glaseri CCA e que um período de exposição mínimo de 24h foi necessário para que houvesse infecção de fêmeas ingurgitadas de R. microplus por S. glaseri estirpe CCA, capaz de gerar, in vitro, eficácia no tratamento superior a 90%.
Gao, Yan Ru; Huang, Wen Ling; Tang, Chun Lian; Liu, Rong; Zhao, Qin Ping; Ming, Zhen Ping; Dong, Hui Fen
2018-01-18
Schistosomiasis caused by Schistosoma japonicum is among the most serious endemic zoonoses in China. To study interactions between schistosomula, the pre-adult juvenile stage, and hosts, it is important to study the functions of key genes involved in schistosomula growth and development. Programmed cell death protein 10 (pcdp10) is an important apoptosis-related gene with various biological functions. This study described the molecular characterization of S. japonicum PCDP10 (SjPCDP10) and evaluated its functions in schistosomula. Real-time quantitative polymerase chain reaction (qPCR) and western blot were used to detect Sjpcdp10 mRNA and protein levels, respectively, at different developmental stages. Immunolocalization was performed to determine SjPCDP10 expression in the parasite. RNA interference (RNAi) experiments were used to assess gene functions associated with SjPCDP10 in schistosomula growth and development. Real-time qPCR revealed that Sjpcdp10 was expressed during all investigated developmental stages and upregulated during schistosomula growth and development. Histochemical localization showed that SjPCDP10 was mainly distributed in the teguments of schistosomula in all investigated stages and part of the parenchymal area of 14-, 18-, and 21-day-old schistosomula. Following Sjpcdp10 knockdown by RNAi, the lengths, widths, areas, and volumes of schistosomula were significantly lower than those in the control group. Scanning electron microscopy showed that the body surfaces of schistosomula subjected to RNAi were seriously damaged, with few tegumental spines and sensory papillae. Transmission electron microscopy indicated that the teguments of Sjpcdp10-knockdown schistosomula were incomplete, the number of layers was reduced, and the thickness decreased significantly as compared with those in the control group. Furthermore, terminal deoxynucleotidyl transferase dUTP nick-end labelling results showed that the rate of apoptosis in Sjpcdp10-knockdown
Los Vidal, una estirpe de negociantes catalanes del siglo XVIII
Directory of Open Access Journals (Sweden)
Assumpta Muset Pons
1998-01-01
Full Text Available El objetivo de este artículo es el de analizar la evolución de una dinastía de negociantes catalanes, los Vidal, a lo largo del siglo xviii y primera mitad del XIX. Es decir, desde su aparición en Copons, esta fecunda población de la Cataluña rural, pasando por su etapa de reputados hombres del comercio castellano, hasta su definitivo retorno al Principado. La suya fue una trayectoria brillante. Fruto de una compleja red de alianzas tejidas a partir de pactos asociativos y familiares minuciosamente calculados. Sus actividades comerciales se desarrollaron dentro del marco de la compañía de Manuel, Juan Vidal y Cía, una de las de más renombre del panorama vallisoletano del Setecientos. Sus intereses les llevaron a emparentar y a aliarse, a veces de forma reiterada, con otras destacadas estirpes: los Ramón y los Jover. Originarios de Copons y residentes en Valladolid. Esta fuerte endogamia se convirtió en un arma de doble filo, que contribuyó decisivamente a debilitar su capacidad de maniobra. La extinción de una de las dos ramas familiares permitió a los Jover tiacerse con el control de la firma patrimonial. Ivlientras que la otra prefirió reinstalarse en Copons, donde organizó nuevos pactos matrimoniales y asociativos dentro del ámbito de la próspera industria algodonera comarcal.The aim of this article is to analyze the evolution of a Catalán businessmen dinasty, the Vidal, throughout the 18th century and the first half of the 19th century. Firstly the beginning of the dinasty in Copons, a fecund village from the rural Catalonia, will be described. Secontly the period of reputable castilian businessmen will also be reportard. And, finally, their return to their original country. The Vidal dinasty followed a sucessful trajectory which was the result of a complex network of alliances. Those businessmen calculated their associative and family agreements in a very detailed way. Their commercial activities were developed into the
Karr, Dale B.; Waters, James K.; Emerich, David W.
1983-01-01
Ion-exclusion high-pressure liquid chromatography (HPLC) was used to measure poly-β-hydroxybutyrate (PHB) in Rhizobium japonicum bacteroids. The products in the acid digest of PHB-containing material were fractionated by HPLC on Aminex HPX-87H ion-exclusion resin for organic acid analysis. Crotonic acid formed from PHB during acid digestion was detected by its intense absorbance at 210 nm. The Aminex-HPLC method provides a rapid and simple chromatographic technique for routine analysis of organic acids. Results of PHB analysis by Aminex-HPLC were confirmed by gas chromatography and spectrophotometric analysis. PMID:16346443
Hide, Geoff; Hughes, Jacqueline M; McNuff, Robert
2003-01-01
Background The rapid expansion in the availability of genome and DNA sequence information has opened up new possibilities for the development of methods for detecting free-living protozoa in environmental samples. The protozoan Blepharisma japonicum was used to investigate a rapid and simple detection system based on polymerase chain reaction amplification (PCR) from organisms immobilised on FTA paper. Results Using primers designed from the α-tubulin genes of Blepharisma, specific and sensitive detection to the equivalent of a single Blepharisma cell could be achieved. Similar detection levels were found using water samples, containing Blepharisma, which were dried onto Whatman FTA paper. Conclusion This system has potential as a sensitive convenient detection system for Blepharisma and could be applied to other protozoan organisms. PMID:14516472
Directory of Open Access Journals (Sweden)
Yan Cao
2013-01-01
Full Text Available Schistosomiasis, caused by infection with Schistosoma species, remains an important parasitic zoonosis. Thioredoxin glutathione reductase of Schistosoma japonicum (SjTGR plays an important role in the development of the parasite and for its survival. Here we present a recombinant plasmid DNA vaccine, pVAX1/SjTGR, to estimate its protection against S. japonicum in BALB/c mice. The DNA vaccine administrated by particle bombardment induced higher protection than by intramuscular injection. All animals vaccinated with pVAX1/SjTGR developed significant specific anti-SjTGR antibodies than control groups. Moreover, animals immunized by gene gun exhibited a splenocyte proliferative response, with an increase in IFN-γ and IL-4. The recombinant plasmid administrated by gene gun achieved a medium protective efficacy of 27.83–38.83% ( of worm reduction and 40.38–44.51% ( of liver egg count reduction. It suggests that different modes of administering a DNA vaccine can influence the protective efficacy induced by the vaccine. Interestingly, from the enzymatic activity results, we found that worms obtained from pVAX1/SjTGR-vaccinated animals expressed lower enzymatic activity than the control group and the antibodies weakened the enzymatic activity of SjTGR in vitro, too. It implies that the high-level antibodies may contribute to the protective effects.
Dang-Trinh, Minh-Anh; Angeles, Jose Ma M; Moendeg, Kharleezelle J; Macalanda, Adrian Miki C; Higuchi, Luna; Oto, Chiho; Kirinoki, Masashi; Chigusa, Yuichi; Kawazu, Shin-Ichiro
2018-06-01
Schistosoma japonicum, causing zoonotic intestinal schistosomiasis, is found in China, the Philippines and parts of Indonesia. Severe disease manifestations are basically due to the deposition of eggs in some vital organs such as the liver, spleen and brain. Traditionally, histopathological microscopic examination of the egg burden was used to evaluate the intensity of infection in the affected organs. However, this technique is laborious, time-consuming and requires trained personnel. In this study, real time PCR targeting the mitochondrial NADH dehydrogenase I gene was used to compare with microscopic examination of tissue sections in evaluating the egg burdens in different affected organs. Livers, spleens and brains of the S. japonicum infected mice after 8 and 18 weeks post-infection (p.i) were harvested and examined. Results showed that there were statistically significant correlations between the egg burden evaluated by tissue section examination, and the Ct values of the real time PCR of livers with heavy egg burden at 8 (r = -0.81) and 18 (r = -0.80) weeks p.i. Furthermore, a correlation (r = -0.56) between the egg burden assessed by the microscopic examination and Ct value of the real time PCR of spleens with moderate egg burden after 18 weeks p.i and not 8 weeks p.i was also observed. Brains with low egg burden showed no schistosome eggs in the microscopic examination, however one sample tested positive by real time PCR. These results suggested that real time PCR is useful in evaluating schistosome egg burden in the organs of the experimentally infected mice model that will give further insights into the pathology of schistosomiasis. Copyright © 2018 Elsevier Inc. All rights reserved.
Shin, Myoung-Sook; Park, Jun Yeon; Lee, Jaemin; Yoo, Hye Hyun; Hahm, Dae-Hyun; Lee, Sang Cheon; Lee, Sanghyun; Hwang, Gwi Seo; Jung, Kiwon; Kang, Ki Sung
2017-07-15
In this study, we investigated the anti-inflammatory effects and mechanisms of cirsimaritin isolated from an ethanol extract of the aerial parts of Cirsium japonicum var. maackii Maxim. using RAW264.7 cells. The extract and its flavonoid cirsimaritin inhibited nitric oxide (NO) production and inducible nitric oxide synthase expression in RAW264.7 cells. Cirsimaritin inhibited interleukin-6, tumor necrosis factor-α, and NO production in a concentration-dependent manner in lipopolysaccharide (LPS)-stimulated RAW264.7 cells. From a western blot study, pretreatment with cirsimaritin inhibited phosphorylation/degradation of IκBα and phosphorylation of Akt in LPS-stimulated RAW264.7 cells. Moreover, cirsimaritin suppressed activation of LPS-induced transcription factors, such as c-fos and signal transducer and activator of transcription 3 (STAT3), in RAW264.7 cells. Collectively, these results show that cirsimaritin possesses anti-inflammatory activity, which is regulated by inhibition of c-fos and STAT3 phosphorylation in RAW264.7 cells. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Pengfei Cai
Full Text Available BACKGROUND: The complex life cycle of the genus Schistosoma drives the parasites to employ subtle developmentally dependent gene regulatory machineries. Small non-coding RNAs (sncRNAs are essential gene regulatory factors that, through their impact on mRNA and genome stability, control stage-specific gene expression. Abundant sncRNAs have been identified in this genus. However, their functionally associated partners, Argonaute family proteins, which are the key components of the RNA-induced silencing complex (RISC, have not yet been fully explored. METHODOLOGY/PRINCIPAL FINDINGS: Two monoclonal antibodies (mAbs specific to Schistosoma japonicum Argonaute protein Ago2 (SjAgo2, but not SjAgo1 and SjAgo3, were generated. Soluble adult worm antigen preparation (SWAP was subjected to immunoprecipitation with the mAbs and the captured SjAgo2 protein was subsequently confirmed by Western blot and mass spectrometry (MS analysis. The small RNA population associated with native SjAgo2 in adult parasites was extracted from the immunoprecipitated complex and subjected to library construction. High-through-put sequencing of these libraries yielded a total of ≈50 million high-quality reads. Classification of these small RNAs showed that endogenous siRNAs (endo-siRNAs generated from transposable elements (TEs, especially from the subclasses of LINE and LTR, were prominent. Further bioinformatics analysis revealed that siRNAs derived from ten types of well-defined retrotransposons were dramatically enriched in the SjAgo2-specific libraries compared to small RNA libraries constructed with total small RNAs from separated adult worms. These results suggest that a key function of SjAgo2 is to maintain genome stability through suppressing the activities of retrotransposons. CONCLUSIONS/SIGNIFICANCE: In this study, we identified and characterized one of the three S. japonicum Argonautes, SjAgo2, and its associated small RNAs were found to be predominantly derived
Almeida, Marta Neves Rebelo de
2016-01-01
Trabalho Final de Mestrado para obtenção do grau de Mestre em Engenharia Química e Biológica O presente trabalho teve como objectivo a optimização do cultivo de várias estirpes mutantes bacterianas Pseudomonas aeruginosa da estirpe AI3(P. aeruginosa AI3), estirpe Ph3B (P. aeruginosa Ph3B) e estirpe L10 (P. aeruginosa L10) e fúngicas (Phlebia rufa (PM), Ganoderma lucidum violeta(GV), Pleurotus ostreatus (PO) e Ganoderma carnosum (G)), para a produ...
Nakajima, Hiromitsu; Yamamoto, Yoshikazu; Yoshitani, Azusa; Itoh, Kiminori
2013-11-01
To understand the ecology and physiology of metal-accumulating lichens growing in Cu-polluted sites, we investigated lichens near temple and shrine buildings with Cu roofs in Japan and found that Stereocaulon japonicum Th. Fr. and Cladonia humilis (With.) J. R. Laundon grow in Cu-polluted sites. Metal concentrations in the lichen samples collected at some of these sites were determined by inductively coupled plasma mass spectroscopy (ICP-MS). UV-vis absorption spectra of pigments extracted from the lichen samples were measured, and the pigment concentrations were estimated from the spectral data using equations from the literature. Secondary metabolites extracted from the lichen samples were analyzed by high-performance liquid chromatography (HPLC) with a photodiode array detector. We found that S. japonicum and C. humilis are Cu-hyperaccumulating lichens. Differences in pigment concentrations and their absorption spectra were observed between the Cu-polluted and control samples of the 2 lichens. However, no correlation was found between Cu and pigment concentrations. We observed a positive correlation between Al and Fe concentrations and unexpectedly found high negative correlations between Al and pigment concentrations. This suggests that Al stress reduces pigment concentrations. The concentrations of secondary metabolites in C. humilis growing in the Cu-polluted sites agreed with those in C. humilis growing in the control sites. This indicates that the metabolite concentrations are independent of Cu stress. Copyright © 2013 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Eduardo Romano
2001-07-01
Full Text Available The coat protein (CP gene of the potato virus Y strain "o" (PVY O was introduced into potato, cultivar Achat, via Agrobacterium tumefaciens-mediated transformation. Sixty three putative transgenic lines were challenged against the Brazilian strains PVY-OBR and PVY-NBR. An extremely resistant phenotype, against the two strains, was observed in one line, denominated 1P. No symptoms or positive ELISA results were observed in 16 challenged plants from this line. Another clone, named as 63P, showed a lower level of resistance. Southern blot analysis showed five copies of the CP gene in the extremely resistant line and at least three copies in the other resistant line. The stability of the integrated transgenes in the extreme resistant line was examined during several in vitro multiplications over a period of three years, with no modification in the Southern pattern was observed. The stability of the transgenes, the absence of primary infections and the relatively broad spectrum of resistance suggest that the extremely resistant line obtained in this work can be useful for agricultural purposes.O gene da capa protéica (CP do Potato virus Y estirpe "o", foi introduzido em batata cultivar Achat, via Agrobacterium tumefaciens. Sessenta e três linhas possivelmente transgênicas foram desafiadas com as estirpes brasileiras PVY-OBR e PVY-NBR. Uma linha apresentou extrema resistência às duas estirpes inoculadas, e foi denominado clone 1P. Não foram observados sintomas sistêmicos de infecção e as plantas foram negativas em Elisa. Outra linha, denominada clone 63P, mostrou algum nível de resistência. Análises por Southern blot indicaram a presença de pelo menos cinco cópias do gen CP no clone 1P e pelo menos três cópias no clone 63P. A estabilidade do gene introduzido no clone 1P foi avaliada durante três anos, após várias multiplicações in vitro. Não foram observadas mudanças no padrão do Southern blot. A estabilidade do transgene, na
Camacho-Muñoz, Dolores; Petrie, Bruce; Castrignanò, Erika; Kasprzyk-Hordern, Barbara
2016-01-01
The issue of drug chirality is attracting increasing attention among the scientific community. The phenomenon of chirality has been overlooked in environmental research (environmental occurrence, fate and toxicity) despite the great impact that chiral pharmacologically active compounds (cPACs) can provoke on ecosystems. The aim of this paper is to introduce the topic of chirality and its implications in environmental contamination. Special attention has been paid to the most recent advances in chiral analysis based on liquid chromatography coupled with mass spectrometry and the most popular protein based chiral stationary phases. Several groups of cPACs of environmental relevance, such as illicit drugs, human and veterinary medicines were discussed. The increase in the number of papers published in the area of chiral environmental analysis indicates that researchers are actively pursuing new opportunities to provide better understanding of environmental impacts resulting from the enantiomerism of cPACs. PMID:27713682
Developmental gene expression profiles of the human pathogen Schistosoma japonicum
Directory of Open Access Journals (Sweden)
McManus Donald P
2009-03-01
Full Text Available Abstract Background The schistosome blood flukes are complex trematodes and cause a chronic parasitic disease of significant public health importance worldwide, schistosomiasis. Their life cycle is characterised by distinct parasitic and free-living phases involving mammalian and snail hosts and freshwater. Microarray analysis was used to profile developmental gene expression in the Asian species, Schistosoma japonicum. Total RNAs were isolated from the three distinct environmental phases of the lifecycle – aquatic/snail (eggs, miracidia, sporocysts, cercariae, juvenile (lung schistosomula and paired but pre-egg laying adults and adult (paired, mature males and egg-producing females, both examined separately. Advanced analyses including ANOVA, principal component analysis, and hierarchal clustering provided a global synopsis of gene expression relationships among the different developmental stages of the schistosome parasite. Results Gene expression profiles were linked to the major environmental settings through which the developmental stages of the fluke have to adapt during the course of its life cycle. Gene ontologies of the differentially expressed genes revealed a wide range of functions and processes. In addition, stage-specific, differentially expressed genes were identified that were involved in numerous biological pathways and functions including calcium signalling, sphingolipid metabolism and parasite defence. Conclusion The findings provide a comprehensive database of gene expression in an important human pathogen, including transcriptional changes in genes involved in evasion of the host immune response, nutrient acquisition, energy production, calcium signalling, sphingolipid metabolism, egg production and tegumental function during development. This resource should help facilitate the identification and prioritization of new anti-schistosome drug and vaccine targets for the control of schistosomiasis.
Directory of Open Access Journals (Sweden)
Qin Ping Zhao
Full Text Available BACKGROUND: Oncomelania hupensis is the unique intermediate host of Schistosoma japonicum, which causes schistosomiasis endemic in the Far East, and especially in mainland China. O. hupensis largely determines the parasite's geographical range. How O. hupensis's genetic diversity is distributed geographically in mainland China has never been well examined with DNA sequence data. METHODOLOGY/PRINCIPAL FINDINGS: In this study we investigate the genetic variation among O. hupensis from different geographical origins using the combined complete internal transcribed spacer 1 (ITS1 and ITS2 regions of nuclear ribosomal DNA. 165 O. hupensis isolates were obtained in 29 localities from 7 provinces across mainland China: lake/marshland and hill regions in Anhui, Hubei, Hunan, Jiangxi and Jiangsu provinces, located along the middle and lower reaches of Yangtze River, and mountainous regions in Sichuan and Yunnan provinces. Phylogenetic and haplotype network analyses showed distinct genetic diversity and no shared haplotypes between populations from lake/marshland regions of the middle and lower reaches of the Yangtze River and populations from mountainous regions of Sichuan and Yunnan provinces. The genetic distance between these two groups is up to 0.81 based on Fst, and branch time was estimated as 2-6 Ma. As revealed in the phylogenetic tree, snails from Sichuan and Yunnan provinces were also clustered separately. Geographical separation appears to be an important factor accounting for the diversification of the two groups of O. hupensis in mainland China, and probably for the separate clades between snails from Sichuan and Yunnan provinces. In lake/marshland and hill regions along the middle and lower reaches of the Yangtze River, three clades were identified in the phylogenetic tree, but without any obvious clustering of snails from different provinces. CONCLUSIONS: O. hupensis in mainland China may have considerable genetic diversity, and a more
International Nuclear Information System (INIS)
Li-Hsue, S.Y.; Hsue, H.F.; Hanson, H.O.
1981-01-01
Skin sections of Rhesus monkeys immunized with X-irradiated Schistosoma japonicum cercariae were stained by an unlabeled antibody enzyme method for the detection of IgG, IgM, IgA, IgE, and C3. While all of them could be found in the skin lesions, their distribution patterns varied with time and reactions. In whealing reaginic reactions, IgE appeared prominent, having an affinity to the mast cells. In Arthus-like reactions, IgG was predominant. IgG complexes were found on the schistosomula, on the walls of blood vessels, and in granulocytes near the schistosomula. In the late stage of Arthus-like reactions and in delayed hypersensitive reactions, IgA was predominant in granulocytes, mononuclear cells, and macrophages. Characteristics of each immunoglobulin pattern seemed to reflect its function in the effector mechanism. It may be speculated that these immunoglobulins and C3, together with effector cells, synergistically and sequentially destroy schistosomula in the skin. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Li-Hsue, S.Y.; Hsue, H.F.; Hanson, H.O.
1981-01-01
Skin sections of Rhesus monkeys immunized with X-irradiated Schistosoma japonicum cercariae were stained by an unlabeled antibody enzyme method for the detection of IgG, IgM, IgA, IgE, and C3. While all of them could be found in the skin lesions, their distribution patterns varied with time and reactions. In whealing reaginic reactions, IgE appeared prominent, having an affinity to the mast cells. In Arthus-like reactions, IgG was predominant. IgG complexes were found on the schistosomula, on the walls of blood vessels, and in granulocytes near the schistosomula. In the late stage of Arthus-like reactions and in delayed hypersensitive reactions, IgA was predominant in granulocytes, mononuclear cells, and macrophages. Characteristics of each immunoglobulin pattern seemed to reflect its function in the effector mechanism. It may be speculated that these immunoglobulins and C3, together with effector cells, synergistically and sequentially destroy schistosomula in the skin.
Gurunathan, Sangiliyandi; Raman, Jegadeesh; Malek, Sri Nurestri Abd; John, Priscilla A; Vikineswary, Sabaratnam
2013-01-01
Background Silver nanoparticles (AgNPs) are an important class of nanomaterial for a wide range of industrial and biomedical applications. AgNPs have been used as antimicrobial and disinfectant agents due their detrimental effect on target cells. The aim of our study was to determine the cytotoxic effects of biologically synthesized AgNPs using hot aqueous extracts of the mycelia of Ganoderma neo-japonicum Imazeki on MDA-MB-231 human breast cancer cells. Methods We developed a green method for the synthesis of water-soluble AgNPs by treating silver ions with hot aqueous extract of the mycelia of G. neo-japonicum. The formation of AgNPs was characterized by ultraviolet-visible absorption spectroscopy, X-ray diffraction, dynamic light scattering, and transmission electron microscopy. Furthermore, the toxicity of synthesized AgNPs was evaluated using a series of assays: such as cell viability, lactate dehydrogenase leakage, reactive oxygen species generation, caspase 3, DNA laddering, and terminal deoxynucleotidyl transferase deoxyuridine triphosphate nick-end labeling in human breast cancer cells (MDA-MB-231). Results The ultraviolet-visible absorption spectroscopy results showed a strong resonance centered on the surface of AgNPs at 420 nm. The X-ray diffraction analysis confirmed that the synthesized AgNPs were single-crystalline, corresponding with the result of transmission electron microscopy. Treatment of MDA-MB-231 breast cancer cells with various concentrations of AgNPs (1–10 μg/mL) for 24 hours revealed that AgNPs could inhibit cell viability and induce membrane leakage in a dose-dependent manner. Cells exposed to AgNPs showed increased reactive oxygen species and hydroxyl radical production. Furthermore, the apoptotic effects of AgNPs were confirmed by activation of caspase 3 and DNA nuclear fragmentation. Conclusion The results indicate that AgNPs possess cytotoxic effects with apoptotic features and suggest that the reactive oxygen species generated by
International Nuclear Information System (INIS)
Kurdali, F.; Mir-Ali, N.; Al-Nabulsi, I.
2002-11-01
A pot experiment was conducted to study the symbiotic performance of two soybean varieties and some of their mutants (that were obtained as a result of a previous mutation breeding program) with two bradyrhizobium japonicum strains (RG and FA3) using 15 N isotopic dilution method. Random amplified polymorphic DNA technique (RAPD) was used to study the genetic relationships among the soybean genotypes and to make sure that the two rhizobial strains are different. The 25 random primers used discriminated the different soybean genotypes and the dendrogram resultants from shared polymorphic fragments put each variety and its mutants in two separate clusters asserting that the mutants and their mother lines are different. Both strains of B. japonicum were able to form effective nodules on all soybean plants. However, number of nodules, dry matter yield and N-uptake from the available sources by soybeans were affected by both plant genotype and rhizobial strains. N 2 -fixation was affected to a large extent by different strain and plant genotype combinations. Percentage of fixed N 2 (N dfa) ranged between 35 and 49%; whereas, the actual amounts of fixed N 2 were between 105 and 210 mg N/pot. Amounts of N 2 -fixed by FA3 strain were higher than of RG in both soybean varieties, whereas, the latter strain showed higher performance in the mutant lines. The results showed that total plant N estimation may not be a sufficient indicator for high N 2 -fixation. the results also showed that it is very important to determine both the amount of nitrogen derived from N 2 -fixation and N derived from soil for evaluating the symbiotic performance ability. Moreover, the performance of symbiotic N 2 -fixation in soybean was shown to depend on both plant genotype and rhizobial strain and the amount of N 2 -fixation can be increased by combining the best plant genotypes and the most adapted strain. (author)
Directory of Open Access Journals (Sweden)
Elaine Martins da Costa
2013-09-01
Full Text Available O objetivo deste trabalho foi avaliar o potencial de promoção do crescimento vegetal e a diversidade genética de bactérias isoladas de nódulos de feijão-caupi cultivado em solos do Cerrado piauiense. Avaliaram-se 26 estirpes quanto à capacidade de fixar nitrogênio em vida livre, solubilizar fosfatos inorgânicos, produzir ácido-3-indolacético (AIA na ausência e na presença do aminoácido triptofano (100 mg L-1, produzir nódulos e promover o crescimento de feijão-caupi em vasos Leonard. Nenhuma estirpe fixou nitrogênio em vida livre, e 69% foram capazes de solubilizar fosfato de cálcio in vitro. Na presença de triptofano, todas as estirpes foram capazes de sintetizar o AIA em meio 79, e 80% sintetizaram o AIA em meio DYGS. Apenas quatro estirpes nodularam o feijão-caupi. O sequenciamento do gene 16S rRNA identificou as estirpes nodulíferas como pertencentes aos gêneros Bradyrhizobium, Rhizobium, Bacillus e Paenibacillus. Entre as estirpes não nodulíferas promotoras do crescimento do feijão-caupi, estão os gêneros Bacillus e Paenibacillus.
Conservation Genetics of an Endangered Lady’s Slipper Orchid: Cypripedium japonicum in China
Qian, Xin; Li, Quan-Jian; Liu, Fen; Gong, Mao-Jiang; Wang, Cai-Xia; Tian, Min
2014-01-01
Knowledge about the population genetic variation of the endangered orchid, Cypripedium japonicum, is conducive to the development of conservation strategies. Here, we examined the levels and partitioning of inter-simple sequence repeat (ISSR) diversity (109 loci) in five populations of this orchid to gain insight into its genetic variation and population structure in Eastern and Central China. It harbored considerably lower levels of genetic diversity both at the population (percentage of polymorphic loci (PPL) = 11.19%, Nei’s gene diversity (H) = 0.0416 and Shannon’s information index (I) = 0.0613) and species level (PPL = 38.53%, H = 0.1273 and I = 0.1928) and a significantly higher degree of differentiation among populations (the proportion of the total variance among populations (Φpt) = 0.698) than those typical of ISSR-based studies in other orchid species. Furthermore, the Nei’s genetic distances between populations were independent of the corresponding geographical distances. Two main clusters are shown in an arithmetic average (UPGMA) dendrogram, which is in agreement with the results of principal coordinate analysis (PCoA) analysis and the STRUCTURE program. In addition, individuals within a population were more similar to each other than to those in other populations. Based on the genetic data and our field survey, the development of conservation management for this threatened orchid should include habitat protection, artificial gene flow and ex situ measures. PMID:24983476
Conservation Genetics of an Endangered Lady’s Slipper Orchid: Cypripedium japonicum in China
Directory of Open Access Journals (Sweden)
Xin Qian
2014-06-01
Full Text Available Knowledge about the population genetic variation of the endangered orchid, Cypripedium japonicum, is conducive to the development of conservation strategies. Here, we examined the levels and partitioning of inter-simple sequence repeat (ISSR diversity (109 loci in five populations of this orchid to gain insight into its genetic variation and population structure in Eastern and Central China. It harbored considerably lower levels of genetic diversity both at the population (percentage of polymorphic loci (PPL = 11.19%, Nei’s gene diversity (H = 0.0416 and Shannon’s information index (I = 0.0613 and species level (PPL = 38.53%, H = 0.1273 and I = 0.1928 and a significantly higher degree of differentiation among populations (the proportion of the total variance among populations (Φpt = 0.698 than those typical of ISSR-based studies in other orchid species. Furthermore, the Nei’s genetic distances between populations were independent of the corresponding geographical distances. Two main clusters are shown in an arithmetic average (UPGMA dendrogram, which is in agreement with the results of principal coordinate analysis (PCoA analysis and the STRUCTURE program. In addition, individuals within a population were more similar to each other than to those in other populations. Based on the genetic data and our field survey, the development of conservation management for this threatened orchid should include habitat protection, artificial gene flow and ex situ measures.
Directory of Open Access Journals (Sweden)
Gina Rivera Hernández
2011-08-01
Full Text Available En los últimos años se ha despertado un gran interés por revalorar la historia de las regiones costarricenses, y dentro de este esfuerzo colectivo, la provincia de Guanacaste se nos muestra como un terreno fértil, para el análisis de diferentes aristas En esta perspectiva nos hemos planteado el analizar dos novelas ambientadas en las relaciones sociales, políticas, de género y productivas que se dan en el ámbito del desarrollo de la unidad de fundiaria básica de la zona, como lo es la Hacienda Ganadera. Buscamos con ello el comparar las visiones discordantes y concordantes de la narrativa determinada por "El festín de los Coyotes" de Víctor Quirós (1990 y " La Estirpe del Volcàn " de Rocio Pazos (2002, como fuentes para comprender particulares interpretaciones de la realidad e inspiración literaria que genera la hacienda ganadera en diversos sectores sociales de la provincia de Guanacaste, con el contraste de la realidad histórica dada por textos como lo son Lowell Gudmunson, Wilder Sequeira y Marc Edelman entre otros.
Directory of Open Access Journals (Sweden)
Klaus E. Stewien
1977-03-01
Full Text Available Foram estudadas de modo comparativo a macro e a microtécnica em provas de identificação sorológica intratípica de 28 estirpes de poliovírus dos tipos 1 e 3, segundo o método da "comparação dos índices de neutralização". Os resultados alcançados mostraram uma correlação elevada entre os índices de neutralização obtidos com ambas as técnicas empregadas - 0,931 e 0,971 após incubação de três e cinco dias, respectivamente - e correspondência total na identificação das estirpes examinadas. Conclui-se que a microtécnica pode ser utilizada em substituição da macrotécnica tradicional na identificação intratípica de poliovírus dos tipos 1 e 3, com, a vantagem da economia de meios e reagentes, e até mesmo com sensível redução de esforços humanos e tempo de execução das provas.The microtechnique was compared to the conventional macrotechnique for intratypic serodifferentiation of 28 type 1 and 3 poliovirus strains by the method of comparison of neutralization indices. The results of the tests showed a high correlation between the neutralization indices - 0.931 and 0.971 after incubation periods of three and five days, respectively - and all the strains were equally identified by both techniques studied. It is concluded that the microtechnique can be used as an alternative of the macrotechnique for intratypic serodifferentiation of type 1 and 3 poliovirus strains, with the advantage of economy of media and reagents and even with a marked saving in both time and effort.
International Nuclear Information System (INIS)
Balasubramanian, A.; Nilakantan, Gita
1976-01-01
In vitro studies on the effect of aldicarb (2-methyl-2-(methyl thio) propionaldehde-o-methyl carbamoyl oxime), a soil applied systemic insecticide, on Rhizobium japonicum revealed that the chemical (at 1,2 and 5 ppm levels) stimulated the growth of the organism initially upto 48 hr which declined thereafter upto 72 hr. The incorporation of 14 C-glucose by the cells considerably reduced due to the insecticide treatment. The production of extracellular, water-soluble slime (polysacchardes) was also reduced considerably with increased concentrations of the chemical. However, the incorporation of 14 C-radio-activity in the extracellular slime generally enhanced due to the treatment, upto 6 hr after injection of the radioactivity, which declined significantly later at 15 hr, indicating a qualitative difference in the extracellular polysaccharides produced by the insecticide treated cells. The insecticide treatment drastically reduced the incorporation of 32 P-disodium hydrogen phosphate into Rhizobium cells, but enhanced the specific activity of the extracellular polysacchrides. (author)
Studies concerning the photoreceptor pigments of stentor coeruleus and blepharisma japonicum
International Nuclear Information System (INIS)
Dax, T.G.
2000-05-01
In the presence of 1,8-bis-(dimethylamino)-naphthalene, solutions of 3-O-benzyl hypericin and 3,4-di-O-benzyl hypericin in aromatic solvents like benzene or toluene have shown to be photoreactive, whereas in the dark no reactions occurred. 3-O-benzyl hypericin was found to enter a photorearrangement reaction leading to a product species, whose structural details could be elicited by UV/VIS, NMR, and mass spectroscopy together with spectrophotometric titrations. Investigation results led to a 11-phenyl-11H-benz{4,10}anthra{2,1,9,8-nopqa}pleiadene skeleton forming the backbone of the photoproduct. This fundamental system is the more of interest since it highly resembles the parent compound of the blepharismins, the photoreceptor pigments of Blepharisma japonicum. In analogy to blepharismin C, which can be converted photochemically into oxyblepharismin C and further on into stentorin by treatment with acid, the photoproduct could be transformed into hypericin upon irradiation and additional acidic work up. As the photoproduct incorporates several equilibrium systems, computer aided calculations were executed to achieve an idea about the relative stability of the photoproduct's various isomeric forms. The described photoreaction represents a possible route for the total synthesis of blepharismins and oxyblepharismins. Furthermore, it could shed some light on the biogenesis of these photosensing pigments. Irradiation of 3,4-di-O-benzyl hypericin in benzene solution together with a large excess of 1,8-bis-(dimethylamino)-naphthalene produced a species exhibiting a tremendous absorption band in the near IR. By means of EPR spectroscopy it could be stated that this primary photoproduct was of radical nature. The product was examined by means of UV/VIS, NMR, IR and mass spectroscopy. (author)
NCBI nr-aa BLAST: CBRC-MMUR-01-0199 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUR-01-0199 emb|CAX76110.1| putative tubulin, beta, 2 [Schistosoma japonicum]... emb|CAX76111.1| putative tubulin, beta, 2 [Schistosoma japonicum] emb|CAX76112.1| putative tubulin, beta, 2 [Schistosoma jap...onicum] emb|CAX76113.1| putative tubulin, beta, 2 [Schistosoma japonicum] emb|CAX76114.1| p...utative tubulin, beta, 2 [Schistosoma japonicum] emb|CAX76115.1| putative tubulin..., beta, 2 [Schistosoma japonicum] emb|CAX76116.1| putative tubulin, beta, 2 [Schistosoma japonicum] CAX76110.1 2e-31 82% ...
Energy Technology Data Exchange (ETDEWEB)
Zauderer, B. Ashley; Bolatto, Alberto D.; Vogel, Stuart N.; Curley, Roger; Pound, Marc W.; Mundy, Lee G.; Teng, Stacy H.; Teuben, Peter J. [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Carpenter, John M. [California Institute of Technology, Department of Astronomy, MC 249-17, Pasadena, CA 91125 (United States); Peréz, Laura M. [National Radio Astronomy Observatory, P.O. Box 0, Socorro, NM 87801 (United States); Lamb, James W.; Woody, David P.; Leitch, Erik M.; Muchovej, Stephen J.; Volgenau, Nikolaus H. [California Institute of Technology, Owens Valley Radio Observatory, Big Pine, CA 93513 (United States); Bock, Douglas C.-J. [CSIRO Astronomy and Space Science, P.O. Box 76, Epping NSW 1710 (Australia); Carlstrom, John E.; Culverhouse, Thomas L. [Department of Astronomy and Astrophysics, University of Chicago, 5640 S. Ellis Ave., Chicago, IL 60637 (United States); Plambeck, Richard L. [Radio Astronomy Laboratory, University of California, Berkeley, 601 Campbell Hall, Berkeley, CA 94720 (United States); Marrone, Daniel P. [Department of Astronomy, Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); and others
2016-01-15
Phase fluctuations introduced by the atmosphere are the main limiting factor in attaining diffraction limited performance in extended interferometric arrays at millimeter and submillimeter wavelengths. We report the results of C-PACS, the Combined Array for Research in Millimeter-Wave Astronomy Paired Antenna Calibration System. We present a systematic study of several hundred test observations taken during the 2009–2010 winter observing season where we utilize CARMA's eight 3.5 m antennas to monitor an atmospheric calibrator while simultaneously acquiring science observations with 6.1 and 10.4 m antennas on baselines ranging from a few hundred meters to ∼2 km. We find that C-PACS is systematically successful at improving coherence on long baselines under a variety of atmospheric conditions. We find that the angular separation between the atmospheric calibrator and target source is the most important consideration, with consistently successful phase correction at CARMA requiring a suitable calibrator located ≲6° away from the science target. We show that cloud cover does not affect the success of C-PACS. We demonstrate C-PACS in typical use by applying it to the observations of the nearby very luminous infrared galaxy Arp 193 in {sup 12}CO(2-1) at a linear resolution of ≈70 pc (0.″12 × 0.″18), 3 times better than previously published molecular maps of this galaxy. We resolve the molecular disk rotation kinematics and the molecular gas distribution and measure the gas surface densities and masses on 90 pc scales. We find that molecular gas constitutes ∼30% of the dynamical mass in the inner 700 pc of this object with a surface density ∼10{sup 4} M{sub ⊙} pc{sup −2}; we compare these properties to those of the starburst region of NGC 253.
Evans, Sian E; Davies, Paul; Lubben, Anneke; Kasprzyk-Hordern, Barbara
2015-07-02
This is the first study presenting a multi-residue method allowing for comprehensive analysis of several chiral pharmacologically active compounds (cPACs) including beta-blockers, antidepressants and amphetamines in wastewater and digested sludge at the enantiomeric level. Analysis of both the liquid and solid matrices within wastewater treatment is crucial to being able to carry out mass balance within these systems. The method developed comprises filtration, microwave assisted extraction and solid phase extraction followed by chiral liquid chromatography coupled with tandem mass spectrometry to analyse the enantiomers of 18 compounds within all three matrices. The method was successfully validated for 10 compounds within all three matrices (amphetamine, methamphetamine, MDMA, MDA, venlafaxine, desmethylvenlafaxine, citalopram, metoprolol, propranolol and sotalol), 7 compounds validated for the liquid matrices only (mirtazapine, salbutamol, fluoxetine, desmethylcitalopram, atenolol, ephedrine and pseudoephedrine) and 1 compound (alprenolol) passing the criteria for solid samples only. The method was then applied to wastewater samples; cPACs were found at concentration ranges in liquid matrices of: 1.7 ng L(-1) (metoprolol) - 1321 ng L(-1) (tramadol) in influent,
Energy Technology Data Exchange (ETDEWEB)
Balasubramanian, A; Nilakantan, G [University of Agricultural Sciences, Bangalore (India). Radiotracer Lab.
1976-01-01
In vitro studies on the effect of aldicarb (2-methyl-2-(methyl thio) propionaldehde-o-methyl carbamoyl oxime), a soil applied systemic insecticide, on Rhizobium japonicum revealed that the chemical (at 1,2 and 5 ppm levels) stimulated the growth of the organism initially upto 48 hr which declined thereafter upto 72 hr. The incorporation of /sup 14/C-glucose by the cells considerably reduced due to the insecticide treatment. The production of extracellular, water-soluble slime (polysacchardes) was also reduced considerably with increased concentrations of the chemical. However, the incorporation of /sup 14/C-radio-activity in the extracellular slime generally enhanced due to the treatment, upto 6 hr after injection of the radioactivity, which declined significantly later at 15 hr, indicating a qualitative difference in the extracellular polysaccharides produced by the insecticide treated cells. The insecticide treatment drastically reduced the incorporation of /sup 32/P-disodium hydrogen phosphate into Rhizobium cells, but enhanced the specific activity of the extracellular polysacchrides.
Directory of Open Access Journals (Sweden)
Fernandes Marcelo Ferreira
2003-01-01
Full Text Available O objetivo deste trabalho foi caracterizar geneticamente sete estirpes de rizóbios nativos dos tabuleiros costeiros de Sergipe com alta eficiência de fixação biológica do N2 em associação com guandu (Cajanus cajan e caupi (Vigna unguiculata. A amplificação do DNA pela técnica de PCR (polymerase chain reaction com o oligonucleotídeo específico BOX indicou um grau elevado de diversidade genética, uma vez que todas as estirpes apresentaram perfis únicos de DNA. A análise por BOX-PCR revelou, ainda, que essa metodologia é eficiente para diferenciar estirpes, mas não para a diferenciação de espécies de rizóbio. Pela técnica do RFLP (restriction fragment length polymorphism da região do DNA que codifica o gene 16S rRNA e da região intergênica entre os genes 16S e 23S rRNA, com cinco enzimas de restrição, bem como pelo seqüenciamento parcial da região do 16S rRNA, foi possível classificar as estirpes nos gêneros Bradyrhizobium e Rhizobium. Houve coerência entre as análises envolvendo a região do 16S rRNA, mas o agrupamento com uma das estirpes diferiu pela análise do espaço intergênico. Os resultados obtidos com a estirpe R11 indicam variabilidade genética elevada em relação às espécies de rizóbios descritas, inclusive diferindo em diversas bases da região do 16S rRNA, e podem indicar uma nova espécie.
Liang, You-Sheng; Wang, Wei; Li, Hong-Jun; Shen, Xue-Hui; Xu, Yong-Liang; Dai, Jian-Rong
2012-03-20
The South-to-North Water Diversion Project (SNWDP) is the largest national water conservancy project in China. However, the Eastern Route Project (ERP) of SNWDP will refer to the habitats of Oncomelania hupensis, the intermediate host of Schistosoma japonicum. The present study was aimed at investigating the effects of some factors relating to the water diversion pattern on the spread north of O. hupensis and transmission of S. japonicum. Marked snails were attached to the floating debris, and then placed on the water surface, the passage of snails through water pumps was observed. Some marked living adult snails were placed under water in the 5 spots, 15, 30, 60, 90 and 120 days later, their survival and transfer under water were investigated. 2, 4, 8, 16, 32, 64 and 128 juvenile snails, with a male: female ratio of about 1, were caged, 1 year later, their reproductions were calculated. The snails attached on the floating debris at 100-, 50- and 20-cm-distance from the inlet pipe of the big pump (with a diameter of 80 cm), could be absorbed into the pumps, with passing rates of 2.45%, 3.93% and 43.46%, respectively, compared with 72.07% and 91.00% for the snails at 20 cm and 10 cm-distance from the inlet pipe of the small pump (with a diameter of 20 cm). A total of 36,600 marked living snails were put into 5 ponds and ditches, with the water depths of 1-1.6 m, 15-120 days later, no marked ones were found along the ponds and ditches or in the straw packages. The juvenile snails did not reproduce until their density reached up to 8 snails (ratio of male: female of 1)/0.16 m2. During the construction of ERP of SNWDP, the risk of northward spread of schistosomiasis japonica will be decreased or eliminated as long as long-term reliable interventions for snail control are implemented.
Directory of Open Access Journals (Sweden)
Manami Tanaka
1992-01-01
Full Text Available We have identified the specific ultrasonographical (US changes in Schistosoma japonicum infected patients with the serological changes in general liver function markers. The US examination with the following haematological and biochemical serum analysis was performed on 102 patients in Shistosomiasis Hospital, Leyte, Philippines. The US liver images were classified into 4 patterns according to the development of periportal fibrosis and the patterns of echogenic bands. Among various haematological and biochemical serum parameters of liver damage. The serum levels of total bile acid (TBA and procollagen-III-peptide (P-III-P correlated well with the development of hepatic fibrosis and the portal hypertension. These patients were subsequently treated with praziquantel (3 x 20 mg/kg, and improvement of the thickening of the portal vein wall and the dintensity of the echogenic band formation was detected 6 months after treatment. The significant US changes could not be detected in the patients with severe hepatic fibrosis caused in the long term infection. The results revealed that the US examination with the serum TBa level would provider a sensitive tool monitor the severity of the infection and also the improvement occured shortly after praziquantel treatment.
Chen, Long; Chen, Peng-Yan; Xue, Xiao-Feng; Hua, Hai-Qing; Li, Yuan-Xi; Zhang, Fan; Wei, Shu-Jun
2018-05-04
Animal mitochondrial genomes usually exhibit conserved gene arrangement across major lineages, while those in the Hymenoptera are known to possess frequent rearrangements, as are those of several other orders of insects. Here, we sequenced two complete mitochondrial genomes of Trichogramma japonicum and Trichogramma ostriniae (Hymenoptera: Chalcidoidea: Trichogrammatidae). In total, 37 mitochondrial genes were identified in both species. The same gene arrangement pattern was found in the two species, with extensive gene rearrangement compared with the ancestral insect mitochondrial genome. Most tRNA genes and all protein-coding genes were encoded on the minority strand. In total, 15 tRNA genes and seven protein-coding genes were rearranged. The rearrangements of cox1 and nad2 as well as most tRNA genes were novel. Phylogenetic analysis based on nucleotide sequences of protein-coding genes and on gene arrangement patterns produced identical topologies that support the relationship of (Agaonidae + Pteromalidae) + Trichogrammatidae in Chalcidoidea. CREx analysis revealed eight rearrangement operations occurred from presumed ancestral gene order of Chalcidoidea to form the derived gene order of Trichogramma. Our study shows that gene rearrangement information in Chalcidoidea can potentially contribute to the phylogeny of Chalcidoidea when more mitochondrial genome sequences are available.
Directory of Open Access Journals (Sweden)
Bethânia Figueiredo Barbosa de Toledo
2009-04-01
Full Text Available O objetivo deste trabalho foi confrontar as sequências parciais do gene 16S rRNA de estirpes padrão de rizóbios com as de estirpes recomendadas para a produção de inoculantes no Brasil, com vistas à verificação da confiabilidade do sequenciamento parcial desse gene para a identificação rápida de estirpes. Foram realizados sequenciamentos através de reação em cadeia da polimerase (PCR com iniciadores relativos à região codificadora do gene 16S rRNA entre as bactérias estudadas. Os resultados foram analisados pela consulta de similaridade de nucleotídeos aos do "Basic Local Alignment Search Tool" (Blastn e por meio da interpretação de árvores filogenéticas geradas usando ferramentas de bioinformática. A classificação taxonômica das estirpes Semia recomendadas para inoculação de leguminosas com base em propriedades morfológicas e especificidade hospedeira não foi confirmada em todas as estirpes. A maioria das estirpes estudadas, consultadas no Blastn, é consistente com a classificação proposta pela construção de árvores filogenéticas das sequências destas estirpes, com base na similaridade pelo sequenciamento parcial do gene considerado.The aim of this work was to compare the partial sequences of 16S rRNA gene of rhizobia strain patterns already classified with strains recommended for the production of inoculants in Brazil, in order to verify the reliability of partial sequencing of the gene for the purpose of rapid identification of strains. Polymerase Chain Reaction (PCR sequencing using primers on the coding region of the 16S rRNA gene among the bacteria studied was conducted. The results were analyzed by consulting the nucleotides' similarity based on Basic Local Alignment Search Tool (Blastn and by interpreting the phylogenetic trees generated by bioinformatic tools. The taxonomic classification of Semia strains recommended for legume inoculation based on morphological properties and host specificity was
Directory of Open Access Journals (Sweden)
Nisha Kadian
2014-08-01
Full Text Available A pot experiment was conducted under polyhouse conditions, to evaluate the effect of two different arbuscular mycorrhizal fungi (G. mosseae and A. laevis in combination with Bradyrhizobium japonicum on growth and nutrition of mungbean plant grown under different salt stress levels (4 dS m−1, 8dS m−1 and 12 dS m−1. It was found that under saline conditions, mycorrhizal fungi protect the host plant against the detrimental effect of salinity. The AM inoculated plants showed positive effects on plant growth, dry biomass production, chlorophyll content, mineral uptake, electrolyte leakage, proline, protein content and yield of mungbean plants in comparison to non-mycorrhizal ones but the extent of response varied with the increasing level of salinity. In general, the reduction in Na uptake along with associated increase in P, N, K, electrolyte leakage and high proline content were also found to be better in inoculated ones. The overall results demonstrate that the co-inoculation of microbes with AM fungi promotes salinity tolerance by enhancing nutrient acquisition especially phosphorus (P, producing plant growth hormones, improving rhizospheric and condition of soil by altering the physiological and biochemical properties of the mungbean plant.
Lifescience Database Archive (English)
Full Text Available E00579 Processed aconitum japonicum tuberous root Crude drug ... Aconitum japonicum, ...Aconitum [TAX:49188] ... Ranunculaceae (buttercup family) Aconitum japonicum tuberous root soaked in brine and coat with caustic lime (dried) ...
Directory of Open Access Journals (Sweden)
Robert Spear
2017-08-01
Full Text Available Rural development has been a critical component of China’s economic miracle since the start of economic reform in the early 1980s, both benefiting from and contributing to the nation’s rapid economic growth. This development has yielded substantial improvements of public health relevance, including contributing to major reductions in schistosomiasis prevalence. The history of schistosomiasis elimination in Japan suggests that development played a dominant causal role in that nation. We argue that it is highly probable that a similar story is playing out in at least some large regions of China. In particular, we summarize evidence from Sichuan Province which supports the case that economic development has led to improvements in rural irrigation and water supply which, together with changes in crop selection and agricultural mechanization, have all contributed to sustainable reductions in the prevalence of Schistosoma japonicum. The two major factors that have experienced major reductions are the area of snail habitat and the degree of human exposure, both through a variety of mechanisms which differ by region and economic circumstance. However, hotspots of transmission remain. Overall, however, economic development in traditionally endemic areas has provided the resources to carry out projects that have had major beneficial impacts on disease transmission that are likely to be sustainable.
Directory of Open Access Journals (Sweden)
M.G. Ribeiro
2004-10-01
Full Text Available A concentração inibitória mínima-MIC em 30 estirpes de Pseudomonas aeruginosa isoladas de mastite bovina foi avaliada utilizando o E-test padrão e o método modificado, pela adição de Tris-EDTA e DMSO. Os métodos modificados apresentaram redução significativa da MIC das estirpes utilizando a gentamicina, a ciprofloxacina e a norfloxacina.
Directory of Open Access Journals (Sweden)
Patrícia Pereira Pinto
2004-09-01
Full Text Available The genetic relationships of 85 Arachis pintoi nodulating Rhizobium strains were determined using the random amplified polymorphic DNA (RAPD methods. The analysis included 75 strains isolated from Cerrado soils and 10 other ones of different origins. The results indicated that there is a high level of similarity between these strains and that geographic distribution may affect their phylogenetic relationship. In addition, the results allowed the selection of the most suitable primers for characterisation of these Rhizobium strains which will be useful for implementation of competitiveness studies in Cerrado soils.As relações genéticas de 85 estirpes de Rhizobium capazes de nodular Arachis pintoi foram determinadas usando o método de "RAPD" (Random Amplified Polymorphic DNA. As análises incluíram 75 estirpes isoladas de solos de Cerrado e 10 de diferentes origens. Os resultados indicaram que existe um alto grau de similaridade entre estas estirpes e que a distribuição geográfica pode afetar suas relações filogenéticas. Além disso, os resultados permitiram a seleção de "primers" mais adequados para a caracterização dessas estirpes de Rhizobium, os quais serão úteis para a implementação de estudos de competitividade nos solos de Cerrado.
NCBI nr-aa BLAST: CBRC-MMUR-01-0199 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUR-01-0199 emb|CAX75788.1| Tubulin beta-2C chain [Schistosoma japonicum] emb...|CAX75790.1| Tubulin beta-2C chain [Schistosoma japonicum] emb|CAX75791.1| Tubulin beta-2C chain [Schistosoma japonicum] CAX75788.1 2e-31 82% ...
Li, Shenshen; Wu, Yangfeng; Du, Xin; Li, Xian; Patel, Anushka; Peterson, Eric D; Turnbull, Fiona; Lo, Serigne; Billot, Laurent; Laba, Tracey; Gao, Runlin
2015-03-01
Acute coronary syndromes (ACSs) are a major cause of morbidity and mortality, yet effective ACS treatments are frequently underused in clinical practice. Randomized trials including the CPACS-2 study suggest that quality improvement initiatives can increase the use of effective treatments, but whether such programs can impact hard clinical outcomes has never been demonstrated in a well-powered randomized controlled trial. The CPACS-3 study is a stepped-wedge cluster-randomized trial conducted in 104 remote level 2 hospitals without PCI facilities in China. All hospitalized ACS patients will be recruited consecutively over a 30-month period to an anticipated total study population of more than 25,000 patients. After a 6-month baseline period, hospitals will be randomized to 1 of 4 groups, and a 6-component quality improvement intervention will be implemented sequentially in each group every 6months. These components include the following: establishment of a quality improvement team, implementation of a clinical pathway, training of physicians and nurses, hospital performance audit and feedback, online technical support, and patient education. All patients will be followed up for 6months postdischarge. The primary outcome will be the incidence of in-hospital major adverse cardiovascular events comprising all-cause mortality, myocardial infarction or reinfarction, and nonfatal stroke. The CPACS-3 study will be the first large randomized trial with sufficient power to assess the effects of a multifaceted quality of care improvement initiative on hard clinical outcomes, in patients with ACS. Copyright © 2014 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Rachel Pinton
2010-03-01
Full Text Available O objetivo deste trabalho foi caracterizar e agrupar rizobactérias, isoladas de hortaliças, quanto à morfologia cultural, riqueza e diversidade e avaliar a biossíntese de autoindutores N-acil lactonas homoserinas (ALH e a capacidade de formação de biofilmes. Sete estirpes também foram avaliadas quanto ao potencial de promoção de crescimento de Brassica oleraceae var. acephala em casa de vegetação. Para verificar a produção de ALH, foram realizados ensaios com Agrobacterium tumefaciens estirpe NT1 como sistema repórter. A formação de biofilme foi avaliada pelo cultivo do isolado em meio líquido. A promoção do crescimento foi avaliada após inoculação das estirpes em plantas de couve-de-folha pela determinação da produção de massa de matérias fresca e seca. A maior diversidade morfocultural foi encontrada entre as estirpes isoladas de couve-de-folha. De um total de 112 estirpes testadas, 13% foram positivas quanto à produção de ALH; de 91 estirpes, 96% foram capazes de formar biofilmes; e de 79 estirpes, 11% foram positivas para ambas as características. Foram observadas diferenças significativas na massa de matéria seca das raízes com inoculação de 10(9 UFC mL-1 da estirpe R142, que incrementou em 55% a massa de matéria seca das raízes de couve, em relação ao controle. Não há relação entre a capacidade de formar biofilme e a detecção de ALH produzidos pelas rizobactérias avaliadas.The objective of this work was to characterize and group rhizobacteria isolated from vegetable crops for culture morphology, richness and diversity, and to evaluate the biosynthesis of N-acyl homoserine lactone (AHL autoinducers and the capacity to form biofilms. Seven strains were also assessed for their potential to promote plant growth of Brassica oleraceae var. acephala in greenhouse. To test the production of AHL, the indicator strain Agrobacterium tumefaciens NT1 was used. The formation of biofilms was evaluated by
Directory of Open Access Journals (Sweden)
Yeqing Chao
Full Text Available Serine protease inhibitors, or serpins, are a group of widely distributed proteins with similar structures that use conformational change to inhibit proteases. Antithrombin (AT is a member of the serine protease inhibitor superfamily and a major coagulation inhibitor in all vertebrates, but its evolutionary origin remains elusive. In this study we isolated for the first time a cDNA encoding an antithrombin homolog, BjATl, from the protochordate Branchiostoma japonicum. The deduced protein BjATl consisted of 338 amino acids sharing 36.7% to 41.1% identity to known vertebrate ATs. BjATl contains a potential N-linked glycosylation site, two potential heparin binding sites and the reactive center loop with the absolutely conserved sequence Gly-Arg-Ser; all of these are features characteristic of ATs. All three phylogenetic trees constructed using Neighbor-Joining, Maximum-Likelihood and Bayesian-Inference methods also placed BjATl together with ATs. Moreover, BjATl expressed in yeast cells was able to inhibit bovine thrombin activity by forming a SDS-stable BjATl-thrombin complex. It also displays a concentration-dependent inhibition of thrombin that is accelerated by heparin. Furthermore, BjATl was predominantly expressed in the hepatic caecum and hind-gut, agreeing with the expression pattern of AT in mammalian species. All these data clearly demonstrate that BjATl is an ortholog of vertebrate ATs, suggesting that a primitive coagulation system emerged in the protochordate.
Directory of Open Access Journals (Sweden)
Kun Yang
2013-11-01
Full Text Available The risk for Schistosoma japonicum infection in Jiangsu province, People’s Republic of China, was investigated by a mouse bioassay. Various investigations were conducted in the period 2009-2011 with the presentation here representing the summary of the results from 45-50 sites in the marshlands along the Yangtze River’s course through the province. Indices representing three aspects of the infection were collected to assess risk: (i the proportion of sentinel points where at least one mouse infection was recorded; (ii the proportion of infected mice at each of these sites; and (iii the average worm burdens. Directional distribution analysis and scan statistics were used to explore the spatio-temporal risk pattern. The spatial distribution was oriented along the Yangtze River and the directional distributions for the proportion of infected mice and mean worm burdens were similar for the positive sentinel sites. Four statistically significant clusters were detected in 2009, but only one in 2010 and 2011, respectively. Temporal windows for infection risk were seen in June and September. The study illustrates the utility of spatio-temporal analysis in assessing the risk for schistosomiasis. This approach should be useful with respect to surveillance and response that can be expected to be increasingly applied when moving from morbidity control to transmission control.
Growth, nodulation and yield response of soybean to biofertilizers and organic manures
International Nuclear Information System (INIS)
Javaid, A.; Mahmood, N.
2010-01-01
A field experiment was conducted to investigate the effect of a symbiotic nitrogen fixing bacterium Bradyrhizobium japonicum strain TAL-102 and a commercial biofertlizer EM (effective microorganisms) on growth, nodulation and yield of soybean [Glycine max (L.) Wilczek] in soils amended either with farmyard manure or Trifolium alexandrinum L. green manure at the rate 20 tons ha/sup -1/ each. In green manure amendment, B. japonicum inoculation significantly enhanced number and biomass of nodules resulting in a significant increase of 27, 65 and 55% in shoot biomass and number and biomass of pods, respectively. In farmyard manure amended soil, B. japonicum inoculation significantly enhanced fresh biomass of nodules. As a result a significant increase of 45 and 47% in shoot biomass and number of pods was recorded, respectively. Generally, the effect of sole EM application on various studied parameters was insignificant in both the soil amendment systems. Combined application of EM and B. japonicum in green manure amended soil reduced shoot growth and number of pods as compared to sole B. japonicum inoculation. Conversely, in farmyard manure amendment, plants co-inoculated with B. japonicum and EM exhibited highest and significantly greater shoot biomass, and number and biomass of pods as compared to all other treatments. The present study concludes that soybean yield can be significantly enhanced by the application of B. japonicum and EM in farmyard manure amendment. (author)
SU-E-T-512: Electromagnetic Simulations of the Dielectric Wall Accelerator
Energy Technology Data Exchange (ETDEWEB)
Uselmann, A; Mackie, T [University of Wisconsin and Morgridge Institute for Research, Madison, WI (United States)
2014-06-01
low cost. Funding: Morgridge Institute for Research, Madison WI; Conflict of Interest: Dr. Mackie is an investor and board member at CPAC, a company developing compact accelerator designs similar to those discussed in this work, but designs discussed are not directed by CPAC. Funding: Morgridge Institute for Research, Madison WI; Conflict of Interest: Dr. Mackie is an investor and board member at CPAC, a company developing compact accelerator designs similar to those discussed in this work, but designs discussed are not directed by CPAC.
Zuo, Guo-Ying; An, Jing; Han, Jun; Zhang, Yun-Ling; Wang, Gen-Chun; Hao, Xiao-Yan; Bian, Zhong-Qi
2012-01-01
Through bioassay-guided fractionation of the extracts from the aerial parts of the Chinese herb Hypericum japonicum Thunb. Murray, Isojacareubin (ISJ) was characterized as a potent antibacterial compound against the clinical methicillin-resistant Staphylococcus aureus (MRSA). The broth microdilution assay was used to determine the minimal inhibitory concentrations (MICs) and minimal bactericidal concentrations (MBCs) of ISJ alone. The results showed that its MICs/MBCs ranged from 4/16 to 16/64 μg/mL, with the concentrations required to inhibit or kill 50% of the strains (MIC(50)/MBC(50)) at 8/16 μg/mL. Synergistic evaluations of this compound with four conventional antibacterial agents representing different types were performed by the chequerboard and time-kill tests. The chequerboard method showed significant synergy effects when ISJ was combined with Ceftazidime (CAZ), Levofloxacin (LEV) and Ampicillin (AMP), with the values of 50% of the fractional inhibitory concentration indices (FICI(50)) at 0.25, 0.37 and 0.37, respectively. Combined bactericidal activities were also observed in the time-kill dynamic assay. The results showed the ability of ISJ to reduce MRSA viable counts by log(10)CFU/mL at 24 h of incubation at a concentration of 1 × MIC were 1.5 (LEV, additivity), 0.92 (CAZ, indifference) and 0.82 (AMP, indifference), respectively. These in vitro anti-MRSA activities of ISJ alone and its synergy with conventional antibacterial agents demonstrated that ISJ enhanced their efficacy, which is of potential use for single and combinatory therapy of patients infected with MRSA.
The in vitro comparative cytopathology of a porcine rotavirus and the simian prototype (SA-11
Directory of Open Access Journals (Sweden)
Lonien S.C.H.
2001-01-01
Full Text Available A citopatologia in vitro de uma cepa de rotavírus porcino adaptado em cultura de células foi comparada à estirpe-protótipo símia (SA-11. O efeito citopático (ECP produzido pelos vírus foi semelhante embora a estirpe porcina tivesse apresentado algumas alterações diferentes, como o acentuado estreitamento do citoplasma, com grande perda do volume citoplasmático. O vírus porcino apresentou menor número de plaques de ECP porém com diâmetro maior em relação ao vírus símio, demonstrando maior capacidade de disseminação célula-célula, quase oito vezes mais, a julgar pelo diâmetro dos plaques de ECP. Os elementos do citoesqueleto das células infectadas revelaram uma reorganização semelhante para ambas as estirpes, não sendo possível observar nenhuma diferença, embora o ECP do vírus porcino tenha sido mais acentuado.
Directory of Open Access Journals (Sweden)
Maria Cecília Fachine Dato
2005-03-01
Full Text Available The aim of this study is to compare the composition of "cachaças" produced in 10 fermentation cycles by Saccharomyces cerevisiae (Sc and wild yeast strains [Pichia silvicola (Ps, Pichia anomala 1 (Pa1, Pichia anomala 2 (Pa2 and Dekkera bruxelensis (Db], isolated from distilleries in Jaboticabal - SP, Brazil. The secondary components of the heart fraction were determined by gas chromatography. The levels of secondary components were influenced by the wine pH, which varied among yeast strains. S. cerevisiae showed slightly more secondary components, whereas wild strains produced more higher alcohols. Wild yeast strains were shown to be adequate for the production of a high quality "cachaça".O presente trabalho visou estabelecer uma comparação entre composição de cachaças produzidas por Saccharomyces cerevisiae (Sc e estirpes de leveduras selvagens [Pichia silvicola (Ps, Pichia anomala 1 (Pa1, Pichia anomala 2 (Pa2 e Dekkera bruxelensis (Db], isoladas em destilarias da região de Jaboticabal-SP. Os componentes secundários da fração denominada coração foram determinados por cromatografia gasosa. Os níveis dos componentes secundários foram influenciados pelo pH dos respectivos vinhos, os quais dependem da estirpe de levedura empregada no processo fermentativo. A Saccharomyces cerevisiae apresentou valores ligeiramente superiores de componentes secundários, enquanto as estirpes selvagens produziram maiores teores de álcoois superiores. As estirpes selvagens de leveduras mostraram-se adequadas para obtenção de uma cachaça de boa qualidade.
Tokuhiro, Shinji; Uda, Kouji; Yano, Hiroko; Nagataki, Mitsuru; Jarilla, Blanca R; Suzuki, Tomohiko; Agatsuma, Takeshi
2013-04-01
Phosphagen kinases (PKs) play a major role in the regulation of energy metabolism in animals. Creatine kinase (CK) is the sole PK in vertebrates, whereas several PKs are present in invertebrates. Here, we report the enzymatic properties and gene structure of PK in the trematode Schistosoma japonicum (Sj). SjPK has a unique contiguous dimeric structure comprising domain 1 (D1) and domain 2 (D2). The three states of the recombinant SjPK (D1, D2, and D1D2) show a specific activity for the substrate taurocyamine. The comparison of the two domains of SjPK revealed that D1 had a high turnover rate (kcat=52.91) and D2 exhibited a high affinity for taurocyamine (Km(Tauro) =0.53±0.06). The full-length protein exhibited higher affinity for taurocyamine (Km(Tauro) =0.47±0.03) than the truncated domains (D1=1.30±0.10, D2=0.53±0.06). D1D2 also exhibited higher catalytic efficiency (kcat/Km(Tauro) =82.98) than D1 (40.70) and D2 (29.04). These results demonstrated that both domains of SjTKD1D2 interacted efficiently and remained functional. The three-dimensional structure of SjPKD1 was constructed by the homology modeling based on the transition state analog complex state of Limulus AK. This protein model of SjPKD1 suggests that the overall structure is almost conserve between SjPKD1 and Limulus AK except for the flexible loops, that is, particularly guanidino-specificity (GS) region, which is associated with the recognition of the corresponding guanidino substrate. The constructed NJ tree and the comparison of exon/intron organization suggest that SjTK has evolved from an arginine kinase (AK) gene. SjTK has potential as a novel antihelminthic drug target as it is absent in mammals and its strong activity may imply a significant role for this protein in the energy metabolism of the parasite. Copyright © 2013 Elsevier B.V. All rights reserved.
Mel'nikova, N N; Bulavenko, L V; Kurdish, I K; Titova, L V; Kots', S Ia
2002-01-01
The effects of bacteria belonging to the genera Azotobacter and Bacillus in a mixed culture with Bradyrhizobium japonicum strains on formation and function of the legume-rhizobium symbiosis of soybean plants were studied. The data showed that the bacterial compositions B. japonicum 634b + B. subtilis 5, B. japonicum 634b + A. chroococcum 20, and B. japonicum 10k + A. vinelandii 56 with a cell ratio of 1:0.1 increased the number and weight of root nodules as well as the height and weight of the aboveground plant parts in almost all the cases by 22-105% compared with the control variants. These binary microbial cultures may be used for development of combined bacterial preparations for soybean.
Directory of Open Access Journals (Sweden)
Laura A Kresty
2011-01-01
Full Text Available Background: Aberrant expression of small noncoding endogenous RNA molecules known as microRNAs (miRNAs is documented to occur in multiple cancer types including esophageal adencarcinoma (EAC and its only known precursor, Barrett′s esophagus (BE. Recent studies have linked dysregulation of specific miRNAs to histological grade, neoplastic progression and metastatic potential. Materials and Methods: Herein, we present a summary of previously reported dysregulated miRNAs in BE and EAC tissues as well as EAC cell lines and evaluate a cranberry proanthocyanidin rich extract′s (C-PAC ability to modulate miRNA expression patterns of three human EAC cell lines (JHEso-Ad-1, OE33 and OE19. Results: A review of 13 published studies revealed dysregulation of 87 miRNAs in BE and EAC tissues, whereas 52 miRNAs have been reported to be altered in BE or EAC cell lines, with 48% overlap with miRNA changes reported in tissues. We report for the first time C-PAC-induced modulation of five miRNAs in three EAC cell lines resulting in 26 validated gene targets and identification of key signaling pathways including p53, angiogenesis, T-cell activation and apoptosis. Additionally, mutiple cancer related networks were ideintified as modulated by C-PAC utilizing Kyoto Encyclopedia of Genes and Genomes (KEGG, Protein Analysis Through Evolutionary Relationships (PANTHER, and MetaCore analysis tools. Conclusions: Study results support the cancer inhibitory potential of C-PAC is in part attributable to C-PAC′s ability to modify miRNA profiles within EAC cells. A number of C-PAC-modulated miRNAs have been been identified as dysregulated in BE and EAC. Further insights into miRNA dysregulation and modulation by select cancer preventive agents will support improved targeted interventions in high-risk cohorts.
Adsorption of malachite green on groundnut shell waste based powdered activated carbon
International Nuclear Information System (INIS)
Malik, R.; Ramteke, D.S.; Wate, S.R.
2007-01-01
In the present technologically fast changing situation related to waste management practices, it is desirable that disposal of plant waste should be done in a scientific manner by keeping in view economic and pollution considerations. This is only possible when the plant waste has the potential to be used as raw material for some useful product. In the present study, groundnut shell, an agricultural waste, was used for the preparation of an adsorbent by chemical activation using ZnCl 2 under optimized conditions and its comparative characterisation was conducted with commercially available powdered activated carbon (CPAC) for its physical, chemical and adsorption properties. The groundnut shell based powdered activated carbon (GSPAC) has a higher surface area, iodine and methylene blue number compared to CPAC. Both of the carbons were used for the removal of malachite green dye from aqueous solution and the effect of various operating variables, viz. adsorbent dose (0.1-1 g l -1 ), contact time (5-120 min) and adsorbate concentrations (100-200 mg l -1 ) on the removal of dye, has been studied. The experimental results indicate that at a dose of 0.5 g l -1 and initial concentration of 100 mg l -1 , GSPAC showed 94.5% removal of the dye in 30 min equilibrium time, while CPAC removed 96% of the dye in 15 min. The experimental isotherm data were analyzed using the linearized forms of Freundlich, Langmuir and BET equations to determine maximum adsorptive capacities. The equilibrium data fit well to the Freundlich isotherm, although the BET isotherm also showed higher correlation for both of the carbons. The results of comparative adsorption capacity of both carbons indicate that groundnut shell can be used as a low-cost alternative to commercial powdered activated carbon in aqueous solution for dye removal
Woodruff, D S; Merenlender, A M; Upatham, E S; Viyanant, V
1987-03-01
Electrophoretically-detected allozyme variation is described in strains of Schistosoma japonicum (4 Philippine strains), S. mekongi (Laos), and an undescribed anthropophilic S. japonicum-like schistosome from Peninsular Malaysia. Result, together with those reported previously for 8 other strains (S. japonicum, China, Formosa, Japan, Philippines; S. mekongi, 2 substrains; Malaysian schistosome, 2 strains) permit a composite genetic characterization of 15 strains of Asian schistosomes at 9-18 presumptive loci. The proportion of polymorphic loci (P) and the mean heterozygosity per locus (H) were zero in all strains. Although this was expected for strains that had been in laboratory culture for up to 50 years, we expected to detect variation in strains based on 10-50 recently field-collected infected snails. We expected S. japonicum to be as variable as S. mansoni (P = 0.13 (0-0.33), H = 0.04, 18 loci, 22 strains) as it is believed to reproduce sexually, has an evolutionary history of several million years, inhabits a wide geographic range, coevolved with a genetically variable intermediate snail host, and has a diversity of mammalian hosts. No differences were detected between the 5 S. japonicum strains from Leyte and Luzon (Philippines), between the 3 S. mekongi strains, or between the 3 Malaysian schistosome strains; these groups and the remaining S. japonicum strains representing Mindoro (Philippines), China, Formosa, and Japan each have distinctive multilocus electromorphic patterns. Nei's genetic distances (D) were calculated to estimate interstrain and interspecific divergence. Interstrain genetic distances in S. japonicum averaged greater than 0.3; much higher than those reported previously for S. mansoni (D = 0.06, D(max) = 0.24). S. japonicum (Mindoro) was moderately differentiated from the Leyte-Luzon strains (D = 0.29, 12 loci). Estimates of the S. japonicum China-Philippine distance (D greater than 0.4, 11 loci) are high for conspecific populations and
Directory of Open Access Journals (Sweden)
Aline F. Barry
2008-01-01
Full Text Available Sapovirus of the Caliciviridae family is an important agent of acute gastroenteritis in children and piglets. The Sapovirus genus is divided into seven genogroups (G, and strains from the GIII, GVI and GVII are associated with infections in swine. Despite the high prevalence in some countries, there are no studies related to the presence of porcine enteric sapovirus infections in piglets in Brazil. In the present study, 18 fecal specimens from piglets up to 28 days were examined to determine the presence of sapovirus genome by RT-PCR assay, using primers designed to amplify a 331 bp segment of the RNA polymerase gene. In 44.4% (8/18 of fecal samples, an amplified DNA fragment was obtained. One of these fragments was sequenced and submitted to molecular and phylogenetic analysis. This analysis revealed high similarity, with nucleotides (87% and amino acids (97.8%, to the Cowden strain, the GIII prototype of porcine enteric calicivirus. This is the first description of sapovirus in Brazilian swine herds.O sapovírus classificado na família Caliciviridae é um importante causador de gastroenterite aguda em crianças e leitões. O gênero Sapovirus é dividido em sete genogrupos (G, sendo que as estirpes dos GIII, GVI e GVII estão associadas com infecção em suínos. Apesar da alta prevalência da infecção em alguns países, ainda não existem estudos referentes à presença do calicivírus entérico suíno nos rebanhos brasileiros. No presente estudo 18 amostras de fezes de leitões com até 28 dias foram avaliadas pela RT-PCR para a presença do genoma do sapovírus, utilizando os primers desenvolvidos para amplificar um segmento de 331 pb do gene da RNA polimerase viral. Em 44,4% (8/18 das amostras foi amplificado um fragmento de DNA. Um desses amplicons foi seqüenciado e pela análise molecular e filogenética foi verificada similaridade de 87% em nucleotídeos e 97,8% em aminoácidos com a estirpe Cowden, protótipo do GIII. Esta é a
Directory of Open Access Journals (Sweden)
Klaus Eberhard Stewien
1971-12-01
Full Text Available O método da comparação dos índices de neutralização (SMIT & WILTERDINK, 1966 foi utilizado na identificação sorológica intratípica de 49 poliovírus, pertencentes aos três tipos imunológicos e isolados de casos clínicos com e sem contato conhecido com a vacina oral de Sabin. O método foi também comparado com o método de Wecker e com o marcador RCT40 no estudo da identificação intratípica das estirpes do tipo 3. Os soros imunes necessários às reações de neutralização foram preparados em cobaias com as estirpes vacinais LSc2ab, P712Ch2ab e Leon 12a1b. As estirpes - dos tipos 1 e 3 - isoladas dos indivíduos sem contato conhecido com a vacina oral, foram todas identificadas como heterólogas às respectivas estirpes vacinais e as provenientes dos indivíduos com contato (recém-vacinados e contatos foram identificadas como isólogas às respectivas estirpes vacinais, exceto duas, das quais uma (do tipo 1 foi identificada como intermediária e a outra (do tipo 3 como heteróloga. Não foi possível interpretar convenientemente os resultados das provas de identificação das estirpes do tipo 2, porque o índice de neutralização do protótipo Lansing, ao contrário dos índices das estirpes de referência dos tipos 1 e 3, não deu resultados constantes em provas consecutivas na presença do sôro anti-P712Ch2ab. No estudo da identificação intratípica dos poliovírus do tipo 3, o método da comparação dos índices de neutralização forneceu resultados plenamente concordantes com os obtidos pelo método de Wecker, com isto evidenciando ser um método igualmente satisfatório e, devido à relativa simplicidade de sua técnica, melhor indicado para inquéritos epidemiológicos, quando se examina a procedência de numerosas estirpes. Os resultados obtidos com o marcador RCT40 mostraram a importância de utilizar provas de diferenciação sorológica intratípica na identificação dos vírus da poliomielite em áreas de
Directory of Open Access Journals (Sweden)
Daniel Figueiredo
2006-06-01
Full Text Available A técnica de PCR utilizando-se "primers" degenerados para o gênero Badnavirus foi utilizada para a detecção e análise da variabilidade de seqüências do Banana streak virus (BSV provenientes de bananeiras. A partir desta metodologia seqüências do vírus puderam ser detectadas em cultivares diplóides (AA, triplóides (AAA; AAB e tetraplóides (AAAB. Foram encontrados quatro padrões de seqüência do BSV (estirpes BSVBR-1, BSVBR-2, BSVBR-3 e BSVBR-4, diferenciadas através da análise do perfil eletroforético das amostras amplificadas. A estirpe BSVBR-1 prevalece nos estados do Acre, Amazonas, Bahia, Ceará, Goiás, Minas Gerais, Piauí, Rio de Janeiro, Rondônia, Santa Catarina, e São Paulo, enquanto que, a estirpe BSVBR-2 foi encontrada em amostras oriundas do Amazonas e do Ceará. As estirpes BSVBR-3 e BSVBR-4 foram encontradas apenas no Ceará. Este trabalho revela a presença de diferentes estirpes do BSV no Brasil, bem como a existência de cultivares de bananeiras sadias e livres de seqüências virais do BSV integradas ao seu genoma.PCR assay using degenerate primers, designed to Badnavirus genus, was used to detect and analyse the variability of BSV strains sequences from banana. The virus was detected in diploid (AA, triploids (AAA; AAB and tetraploids (AAAB banana cultivars. Four BSV sequences patterns (BSVBR-1, BSVBR-2, BSVBR-3 and BSVBR-4 strains were found, and distinguished by eletrophoresis. The strain BSVBR-1 was found in the states of Acre, Amazonas, Bahia, Ceará, Goiás, Minas Gerais, Piauí, Rio de Janeiro, Rondônia, Santa Catarina and São Paulo, while BSVBR-2 strain was detected in the states of Amazonas and Ceará. BSVBR-3 and BSVBR-4 strains were found only in the state of Ceará. This work demonstrated the presence of different BSV strains in Brazil and the existence of health banana cultivars as well as cultivars free of BSV integrated sequences.
2013-04-01
galli Barnyard grass Imperata cylindrica Cogongrass Ligustrum japonicum Japanese privet Ligustrum sinense Chinese Privet Lonicera japonica... Imperata cylindrica Cogongrass Ligustrum japonicum Japanese privet Ligustrum sinense Chinese Privet Lonicera japonica Japanese Honeysuckle...crus-galli Barnyard grass Imperata cylindrica Cogongrass Ligustrum japonicum Japanese privet Ligustrum sinense Chinese Privet Lonicera
International Nuclear Information System (INIS)
Cakici, Ozgur; Sikorski, Michal; Stepkowski, Tomasz; Bujacz, Grzegorz; Jaskolski, Mariusz
2008-01-01
The NodS N-methyltransferase, an enzyme participating in the biosynthesis of the bacterial nodulation (Nod) factor necessary to establish symbiotic nitrogen fixation with a legume plant host, has been crystallized in the apo form as well as in complex with SAH. SAH is a byproduct of SAM degradation during the SAM-dependent methylation reaction. The Nod factor (NF) is a rhizobial signal molecule that is involved in recognition of a legume host and the formation of root and stem nodules. Some unique enzymes are involved in the biosynthesis of NF, which is a variously but specifically substituted lipochitooligosaccharide. One of these enzymes is NodS, an N-methyltransferase that methylates end-deacetylated chitooligosaccharide substrates. In the methylation reaction, NodS uses S-adenosyl-l-methionine (SAM) as a methyl donor. To date, no structural information is available about NodS from any rhizobium. X-ray crystallographic studies of the NodS protein from Bradyrhizobium japonicum WM9, which infects the legumes lupin and serradella, have been undertaken. The nodS gene was cloned and the recombinant protein was expressed in Escherichia coli cells using natural amino acids and as an SeMet derivative. NodS without ligands was crystallized in the presence of PEG 3350 and MgCl 2 . The protein was also crystallized in complex with S-adenosyl-l-homocysteine (SAH) in the presence of PEG 8000 and MgCl 2 . SAH is produced from SAM as a byproduct of the methylation reaction. The crystals of apo NodS are tetragonal and diffracted X-rays to 2.42 Å resolution. The NodS–SAH complex crystallizes in an orthorhombic space group and the crystals diffracted X-rays to 1.85 Å resolution
Cai, Wen; Zhao, Lei; Li, Hua-rong; Zhang, Shu-ling
2014-08-01
To investigate the influence of kaempferol on transforming growth factor(TGF-β1/Smads signal tiransduction in liver tissue of mice with schistosomiasis liver fibrosis. Forty BALB/c mice were randomly divided into a normal control group (8 mice), a praziquantel group (8 mice ), and 4 praziquantel + kaempferol groups with different kaempferol dosages (5, 10, 15, 20 mg/kg respectively, 6 mice each group). Besides the normal control group, all the mice in the other 5 groups were infected with Schistosoma japonicum. After the infection for 6 weeks, the praziquantel group and the 4 praziquantel + kaempferol groups were treated with praziquantel 500 mg/(kg.d) for 2 d, then the mice in the praziquantel group were drenched with normal saline for 6 weeks, and those in the 4 praziquantel + kaempferol groups were drenched with kaempferol 5, 10, 15, 20 mg/kg respectively for 6 weeks. After the treatment, all the animals were sacrificed by the cervical dislocation method, and the area of egg granuloma and the degree of fibrosis in the livers of the mice were observed by HE and Masson staining. The expressions of TGF-β1, Smad2/3, Smad7 proteins were measured by the immunohistochemical method, and the mRNA levels of the 3 proteins were detected by RT-PCR. Compared with the mice in the praziquantel group, the areas of egg granuloma of the liver of the mice in the 4 praziquantel + kaempferol groups were smaller, and the degrees of the hepatic fibrosis of the mice were lesser, and their expressions of Smad2 and Smad3 at protein and their mRNA levels were significantly lower (all P kaempferol can significantly reduce the degrees of hepatic fibrosis and granuloma caused by schistosome eggs after the praziquantel treatment.
Directory of Open Access Journals (Sweden)
Rafaela Simão Abrahão Nóbrega
2004-08-01
Full Text Available A busca de estirpes de bactérias diazotróficas simbióticas tolerantes à salinidade, em conjunto com a seleção de hospedeiros, tem por objetivo aumentar o desempenho da simbiose e manter a produtividade vegetal de forma sustentada em condições de estresse salino. Doze estirpes de bactérias diazotróficas de diferentes procedências foram estudadas quanto à tolerância a diferentes concentrações de NaCl em meios de cultura 79 e LB. As estirpes que apresentaram maior tolerância à salinidade (30 g L-1 em meio 79 foram: BR 6806 e BR 4007, ambas de crescimento rápido isoladas de solos do nordeste brasileiro, UFLA 03-51 e UFLA 03-65, de crescimento rápido e UFLA 03-84, de crescimento lento, sendo as três últimas oriundas da região Amazônica. Essas também estiveram entre as mais tolerantes em meio de cultura LB. A estirpe UFLA 03-84, selecionada em trabalhos prévios por sua alta eficiência para caupi (Vigna unguiculata, pode ser indicada para estudos de inoculação, visando a aumentar o rendimento dessa cultura em solos salinos. Os meios de cultura 79 e LB foram eficientes para avaliar a tolerância relativa de rizóbio a NaCl, mas o meio 79 é mais indicado, pois permite o crescimento de todas as estirpes. Pelos resultados, infere-se haver relação entre tolerância in vitro à salinidade e origem dos microssimbiontes, pois as estirpes BR 4007 e BR 6806, oriundas do Ceará, estiveram entre as mais tolerantes.Tolerance to salinity of diazotrophic bacteriaand their host species could increase plant growth and sustainability in salt stressed soils. Twelve diazotrophic bacteria strains were studied regarding their tolerance to different NaCl concentrations in 79 and LB media. More tolerant (30 g L-1 strains in 79 medium were: the fast growers BR 6806 and BR 4007, isolated from northeast Brazil, UFLA 03-51 and UFLA 03-65, and slow growing strain UFLA03-84, being these last three isolated from Amazon region. These strains were among
Directory of Open Access Journals (Sweden)
Yan-Yan Chen
Full Text Available Schistosomiasis remains a major public health problem in China. The major endemic areas are located in the lake and marshland regions of southern China, particularly in areas along the middle and low reach of the Yangtze River. Spatial analytical techniques are often used in epidemiology to identify spatial clusters in disease regions. This study assesses the spatial distribution of schistosomiasis and explores high-risk regions in Hubei Province, China to provide guidance on schistosomiasis control in marshland regions.In this study, spatial autocorrelation methodologies, including global Moran's I and local Getis-Ord statistics, were utilized to describe and map spatial clusters and areas where human Schistosoma japonicum infection is prevalent at the county level in Hubei province. In addition, linear logistic regression model was used to determine the characteristics of spatial autocorrelation with time.The infection rates of S. japonicum decreased from 2009 to 2013. The global autocorrelation analysis results on the infection rate of S. japonicum for five years showed statistical significance (Moran's I > 0, P < 0.01, which suggested that spatial clusters were present in the distribution of S. japonicum infection from 2009 to 2013. Local autocorrelation analysis results showed that the number of highly aggregated areas ranged from eight to eleven within the five-year analysis period. The highly aggregated areas were mainly distributed in eight counties.The spatial distribution of human S. japonicum infections did not exhibit a temporal change at the county level in Hubei Province. The risk factors that influence human S. japonicum transmission may not have changed after achieving the national criterion of infection control. The findings indicated that spatial-temporal surveillance of S. japonicum transmission plays a significant role on schistosomiasis control. Timely and integrated prevention should be continued, especially in the Yangtze
Histological Examination of Precious Corals from the Ryukyu Archipelago
Directory of Open Access Journals (Sweden)
Masanori Nonaka
2012-01-01
Full Text Available In this paper we examined the histology of three commercially valuable species of precious corals (Paracorallium japonicum, Corallium elatius, and C. konojoi from the Ryukyu Archipelago. In order to observe their inner structure, samples were thin sectioned and examined with a digital light microscope. Colonies of C. konojoi had thicker coenenchyme and larger autozooids than those of C. elatius and P. japonicum. The sclerites of the three species tended to be concentrated in the outer layers of coenenchyme. The gastric cavities of autozooids of all three species were found to be relatively empty. Some symbiotic polychates were observed in the axis of P. japonicum. As well, a zoanthid (Corallizoanthus tsukaharai was often observed living on the coenenchyme surface of P. japonicum. It is hoped our observations will provide a good foundation of future study of Japanese Coralliidae corals.
Directory of Open Access Journals (Sweden)
H. A. A. Mascarenhas
1968-01-01
Full Text Available Em solo Latosol Roxo, estudou-se o comportamento de cinco variedades de soja cujas sementes foram inoculadas, ou não, com diferentes misturas de estirpes de Rhizobium. Na produção de sementes, a variedade Hardee foi equivalente à IAC-1 e superior às variedades E-2006, L-571 e Bienville. IAC-1 também foi superior a Bienville. A adubação nitrogenada não aumentou a produção, e as pequenas respostas aos inoculantes não foram significativas. Conquanto a área experimental nunca tivesse cultura de soja, a nodulação foi intensa em todos os canteiros, e não se notou aumento em conseqüência da inoculação experimental.The performance of five soybean varieties whose seeds were inoculated with four different mixtures of Rhizobiumstrains was studied at Ribeirão Prêto, State of São Paulo. In the seed yields, Hardee was statistically equivalent to IAC-1 and superior to L-2006, L-571 and Bienville. Mineral nitrogen did not increase the seed yields and the small responses to the inoculants were not significant. Although the experimental field had never been cropped with soybeans, the nodule formation was very good in all of the plots, so that no increase due to the experimental inoculants was observed.
Desempenho agronômico de maracujazeiros tratados com produtos alternativos e fertilizantes foliares
Directory of Open Access Journals (Sweden)
Keize Pereira Junqueira
2011-03-01
Full Text Available A resistência induzida é um método alternativo de controle de doenças. Entretanto, há poucos estudos relacionando o uso destes produtos e outros métodos alternativos à produtividade das plantas e às características físicas e químicas dos frutos. Objetivou-se avaliar a severidade de doenças, as características físicas e químicas de frutos e a produtividade de plantas tratadas com produtos alternativos e fertilizantes foliares. Plantas de maracujazeiro BRS Gigante Amarelo clonadas, em campo, foram submetidas, por um ano, a pulverizações quinzenais com: água (testemunha, Cuprozeb® (fungicida-padrão, acibenzolar-S-metil - ASM, Agro-mos®, fosfito de potássio, fosetyl-Al, gesso agrícola e CPAC-GE (produto em teste. O delineamento foi o em blocos casualizados, com quatro repetições e 20 frutos por repetição. Para o estudo da produtividade, utilizaram-se quatro repetições e seis plantas úteis por parcela. As colheitas ocorreram de novembro/2008 a abril/2009. As severidades foram avaliadas com escala de notas. Houve redução da severidade da virose, verrugose e bacteriose em todos os tratamentos, com exceção do Cuprozeb® para virose. Não foi observada redução da antracnose. Frutos com maior massa fresca foram obtidos com aplicações de gesso agrícola (236,83 g, CPAC-GE (234,10 g, fosetyl-Al ( 233,79 g, fosfito de potássio (230,64 g e Agro-mos® (221,15 g. Os mesmos resultados foram observados para diâmetro transversal e massa de polpa. Não houve diferenças significativas entre tratamentos para diâmetro longitudinal e espessura de casca. Quanto às características químicas dos frutos, com exceção do Cuprozeb®, que não diferiu significativamente da testemunha, todos os produtos proporcionaram incremento no teor de sólidos solúveis. Maior acidez titulável foi obtida com Cuprozeb®, gesso agrícola, Agro-mos®, fosetyl-Al e ASM. Não foi constatada alteração no pH dos frutos. Em relação
Directory of Open Access Journals (Sweden)
Dušica Delić
2010-04-01
Full Text Available In pot experiment, one isolate Knj from a Serbian soil, four strains of Bradyrhizobium japonicum and three strains of Bradyrhizobium spp. were examined for the effect on adzuki bean nodulation and effectiveness in symbiotic N2 fixation. All the tested strains produced root nodules in adzuki bean. Strains of B. japonicum showed high potential of N2 fixation, particularly 525 and 542. B. japonicum strains resulted 65-71% shoot dry weight and 99-138% total N content of uninoculated control with full N content (100%. No significant difference was found between the plants inoculated with Bradyrhizobium spp. strains and uninoculated control plants without N (40-42 and 42% shoot dry weight, respectively, which indicated symbiotic N2 fixation inactivity of the Bradyrhizobium spp. strains. Knj strain had the middle position (56% shoot dry weight. These data showed that B. japonicum 525 and 542 strains could be used in further investigations in order to apply them as inoculants in microbiological N fertilizers.
Sankari, Siva; O'Brian, Mark R
2016-07-22
The bacterium Bradyrhizobium japonicum USDA110 does not synthesize siderophores for iron utilization in aerobic environments, and the mechanism of iron uptake within symbiotic soybean root nodules is unknown. An mbfA bfr double mutant defective in iron export and storage activities cannot grow aerobically in very high iron medium. Here, we found that this phenotype was suppressed by loss of function mutations in the feoAB operon encoding ferrous (Fe(2+)) iron uptake proteins. Expression of the feoAB operon genes was elevated under iron limitation, but mutants defective in either gene were unable to grow aerobically over a wide external ferric (Fe(3+)) iron (FeCl3) concentration range. Thus, FeoAB accommodates iron acquisition under iron limited and iron replete conditions. Incorporation of radiolabel from either (55)Fe(2+) or (59)Fe(3+) into cells was severely defective in the feoA and feoB strains, suggesting Fe(3+) reduction to Fe(2+) prior to traversal across the cytoplasmic membrane by FeoAB. The feoA or feoB deletion strains elicited small, ineffective nodules on soybean roots, containing few bacteria and lacking nitrogen fixation activity. A feoA(E40K) mutant contained partial iron uptake activity in culture that supported normal growth and established an effective symbiosis. The feoA(E40K) strain had partial iron uptake activity in situ within nodules and in isolated cells, indicating that FeoAB is the iron transporter in symbiosis. We conclude that FeoAB supports iron acquisition under limited conditions of soil and in the iron-rich environment of a symbiotic nodule. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
Directory of Open Access Journals (Sweden)
M. Tajik Khaveh
2016-05-01
Full Text Available In order to evaluate the effects of biofertilizer on soybean (Glycine max L. seed vigor that produced under water deficit condition and related traits, an experiment was conducted in a factorial layout based of complete randomized block design with four replications at the research greenhouse of Aboureihan campus- Tehran University, Iran. Experimental treatments were include biofertilizer (seed inoculation with Bradyrhizobium japonicum, co-inoculation with Bradyrhizobium japonicum and Pseudomonas fluorescens, co-inoculation with Bradyrhizobium japonicum and Glomus mosseae, Cultivar (Zalta Zalha and Clark×Hobbit line and water deficit stress [irrigation plants after 50 (normal irrigation, 100 (medium stress, 150 (sever stress mm evaporation from pan class A, in parents field]. Results showed that the water deficit stress had negative effects on seed quality and seedling emergence percentage, mean daily seedling emergence, root, leaf and shoot dry weight, number of nodule were decreased. ZaltaZalha cultivar had higher shoot dry weight and number of leaf compared with other cultivars. Applications of biofertilzer was effective on stem diameter, root, leaf and shoot dry weight, number of leaf and nodule and those attributes increased by co-inoculation of Bradyrhizobium japonicum and Glomus mosseae. Also, use of biofertilizer in stress levels was effective on stem dry weight. Stem dry weight was increased by Co-inoculation of cultivar seeds with Bradyrhizobium japonicum and Glomus mosseae.
Directory of Open Access Journals (Sweden)
Edilene Alves Barbosa
2006-05-01
Full Text Available O objetivo deste trabalho foi quantificar a população de Gluconactobacter diazotrophicus presente em plântulas de 34 variedades de cana-de-açúcar, e caracterizar os isolados quanto à capacidade de utilizar diversas fontes de carbono e formar pigmento róseo em presença de luz. A população de G. diazotrophicus foi quantificada pela técnica do número mais provável e isolada em meios de cultura semi-seletivos. A população de G. diazotrophicus foi maior no sistema radicular do que na parte aérea, e maior nas variedades brasileiras de cana-de-açúcar. Os isolados utilizaram poucas fontes de carbono, e aqueles obtidos do sistema radicular utilizaram maior número de fontes, em comparação aos da parte aérea. Apenas a estirpe padrão Ppe-4 e quatro outros isolados formam pigmento róseo em presença de luz. A baixa variação observada pode estar relacionada com o habitat ou com a adaptação dessa população às condições específicas do interior das plantas e, por isso, a estrutura genética da população dessas bactérias é limitada e conservada.The objective of this work was to quantify the population of Gluconacetobacter diazotrophicus present in plantlets of 34 sugarcane varieties and to characterize the isolates according to their capacity to use carbon sources and produce pink pigments under light. G. diazotrophicus population was estimated using the most probable number technique, and then, isolated in semi-selective culture media. The highest population number of G. diazotrophicus was found in the roots; Brazilian varieties presented the highest population. The isolates used little carbon sources, and those strains obtained from the root used the highest number of carbon sources. Only the strain Ppe-4 and four other ones produce pink pigments under light. The low variation observed may be related to the habitat or to the adaptation of this population to specific internal plant conditions, and for this reason, the
Canadian Cancer Risk Management Model: evaluation of cancer control.
Evans, William K; Wolfson, Michael C; Flanagan, William M; Shin, Janey; Goffin, John; Miller, Anthony B; Asakawa, Keiko; Earle, Craig; Mittmann, Nicole; Fairclough, Lee; Oderkirk, Jillian; Finès, Philippe; Gribble, Stephen; Hoch, Jeffrey; Hicks, Chantal; Omariba, D Walter R; Ng, Edward
2013-04-01
The aim of this study was to develop a decision support tool to assess the potential benefits and costs of new healthcare interventions. The Canadian Partnership Against Cancer (CPAC) commissioned the development of a Cancer Risk Management Model (CRMM)--a computer microsimulation model that simulates individual lives one at a time, from birth to death, taking account of Canadian demographic and labor force characteristics, risk factor exposures, and health histories. Information from all the simulated lives is combined to produce aggregate measures of health outcomes for the population or for particular subpopulations. The CRMM can project the population health and economic impacts of cancer control programs in Canada and the impacts of major risk factors, cancer prevention, and screening programs and new cancer treatments on population health and costs to the healthcare system. It estimates both the direct costs of medical care, as well as lost earnings and impacts on tax revenues. The lung and colorectal modules are available through the CPAC Web site (www.cancerview.ca/cancerrriskmanagement) to registered users where structured scenarios can be explored for their projected impacts. Advanced users will be able to specify new scenarios or change existing modules by varying input parameters or by accessing open source code. Model development is now being extended to cervical and breast cancers.
Xiao, Jin; Yu, Bailie; Zhong, Qifan; Yuan, Jie; Yao, Zhen; Zhang, Liuyun
2017-10-01
This paper examines a novel method of regenerating saturated activated carbon after adsorption of complex phenolic, polycyclic aromatic hydrocarbons with low energy consumption by using superheated water pretreatment combined with CO 2 activation. The effects of the temperature of the superheated water, liquid-solid ratio, soaking time, activation temperature, activation time, and CO 2 flow rate of regeneration and adsorption of coal-powdered activated carbon (CPAC) were studied. The results show that the adsorption capacity of iodine values on CPAC recovers to 102.25% of the fresh activated carbon, and the recovery rate is 79.8% under optimal experimental conditions. The adsorption model and adsorption kinetics of methylene blue on regenerated activated carbon (RAC) showed that the adsorption process was in accordance with the Langmuir model and the pseudo-second-order kinetics model. Furthermore, the internal diffusion process was the main controlling step. The surface properties, Brunauer-Emmett-Teller (BET) surface area, and pore size distribution were characterized by Fourier transform infrared spectroscopy (FT-IR) and BET, which show that the RAC possesses more oxygen-containing functional groups with a specific surface area of 763.39 m 2 g -1 and a total pore volume of 0.3039 cm 3 g -1 . Micropores account for 79.8% and mesopores account for 20.2%.
Directory of Open Access Journals (Sweden)
Gen-Chun Wang
2012-07-01
Full Text Available Through bioassay-guided fractionation of the extracts from the aerial parts of the Chinese herb Hypericum japonicum Thunb. Murray, Isojacareubin (ISJ was characterized as a potent antibacterial compound against the clinical methicillin-resistant Staphylococcus aureus (MRSA. The broth microdilution assay was used to determine the minimal inhibitory concentrations (MICs and minimal bactericidal concentrations (MBCs of ISJ alone. The results showed that its MICs/MBCs ranged from 4/16 to 16/64 μg/mL, with the concentrations required to inhibit or kill 50% of the strains (MIC50/MBC50 at 8/16 μg/mL. Synergistic evaluations of this compound with four conventional antibacterial agents representing different types were performed by the chequerboard and time-kill tests. The chequerboard method showed significant synergy effects when ISJ was combined with Ceftazidime (CAZ, Levofloxacin (LEV and Ampicillin (AMP, with the values of 50% of the fractional inhibitory concentration indices (FICI50 at 0.25, 0.37 and 0.37, respectively. Combined bactericidal activities were also observed in the time-kill dynamic assay. The results showed the ability of ISJ to reduce MRSA viable counts by log10CFU/mL at 24 h of incubation at a concentration of 1 × MIC were 1.5 (LEV, additivity, 0.92 (CAZ, indifference and 0.82 (AMP, indifference, respectively. These in vitro anti-MRSA activities of ISJ alone and its synergy with conventional antibacterial agents demonstrated that ISJ enhanced their efficacy, which is of potential use for single and combinatory therapy of patients infected with MRSA.
Partial characterization of amylases of two indigenous Central Amazonian rhizobia strains
Directory of Open Access Journals (Sweden)
Arlem Nascimento de Oliveira
2010-02-01
Full Text Available Amylase production and partial characterization of crude enzyme preparations from two rhizobia strains (R-926 and R-991 were evaluated. For both the strains, maximal amylase activities were achieved during the early-to-mid- exponential growth phase; both were active over a pH range from 4.5 to 8.5 and temperature from 30 to 50 ºC. None of the ions studied (K+, Na+, Ca2+, Hg2+, Mg2+, Mn2+, Cu2+ and Zn2+ was required for the catalytic activity of strain R-926; amylase activity of strain R-991 was stimulated in the presence of K+, Hg2+ and Zn2+. The surfactants SDS, Triton X-100 and Tween-80 did not have a pronounced inhibitory effect on enzyme activities; SDS and Tween-80 caused the highest stimulatory effects. Amylase activities from the rhizobia strains were reduced by up to 30% in the presence of EDTA; amylase activity of R-926 was also inhibited by HgCl2, suggesting that Ca2+and cysteine residues could be important for activity of this strain.A produção e parcial caracterização de extratos brutos de amilase de duas estirpes de rizóbio (R-926 e R-991 foram avaliadas. Para ambas as estirpes, as máximas atividades amilolíticas foram obtidas no início/meio da fase exponencial de crescimento. As amilases rizobiais foram ativas numa variação de pH de 4,5 a 8,5 e temperatura de 30 a 50 ºC. Nenhum dos íons testados (K+, Na+, Ca2+, Hg2+, Mg2+, Mn2+, Cu2+ e Zn2+ foi exigido para a atividade catalítica da estirpe R-926. A amilase produzida pelo R991 foi estimulada na presença de K+, Hg2+ e Zn2+. Os surfactantes SDS, Triton X-100 e Tween-80 não exerceram um pronunciado efeito inibitório sobre as atividades enzimáticas, e SDS e Tween-80 causaram os maiores efeitos estimulatórios. A atividade amilolítica rizobial foi reduzida em até 30% na presença de EDTA; a amilase produzida pela estirpe R-926 também foi inibida pelo HgCl2, sugerindo, ao menos em parte, a importância de Ca2+ e resíduos de cisteína na atividade amilolítica dessa
Evaluation of nitrogen fixation rates of soybean and species of rhizobia
International Nuclear Information System (INIS)
Ping Shuzhen; You Chongbiao
1993-01-01
Using 1 '5N dilution technique the nitrogen fixing rates were estimated from symbiosis between 20 varieties of soybean and 2 species of rhizobia: Bradyrhizobium japonicum and Sinorhizobium fredii. The nodulation status such as size and number of nodules differed among the varieties and species of bacteria. The Ndfa% of these varieties ranged from 40% ∼ 59% for S. fredii, 38% ∼ 62% for B. japonicum and 32% ∼ 56% for inoculant of the mixture of the species, respectively. Among 3 inoculants the B. japonicum is the best one. The variety of soybean, however, plays a significant role in the symbiosis. Therefore, improving the soybean and selecting a good partner for raising the yield and nitrogen fixation are important
Finkelstein, Julia L; Schleinitz, Mark D; Carabin, Hélène; McGarvey, Stephen T
2008-03-05
Schistosomiasis is among the most prevalent parasitic infections worldwide. However, current Global Burden of Disease (GBD) disability-adjusted life year estimates indicate that its population-level impact is negligible. Recent studies suggest that GBD methodologies may significantly underestimate the burden of parasitic diseases, including schistosomiasis. Furthermore, strain-specific disability weights have not been established for schistosomiasis, and the magnitude of human disease burden due to Schistosoma japonicum remains controversial. We used a decision model to quantify an alternative disability weight estimate of the burden of human disease due to S. japonicum. We reviewed S. japonicum morbidity data, and constructed decision trees for all infected persons and two age-specific strata, or =15 y. We conducted stochastic and probabilistic sensitivity analyses for each model. Infection with S. japonicum was associated with an average disability weight of 0.132, with age-specific disability weights of 0.098 ( or =15 y). Re-estimated disability weights were seven to 46 times greater than current GBD measures; no simulations produced disability weight estimates lower than 0.009. Nutritional morbidities had the greatest contribution to the S. japonicum disability weight in the disability weights for schistosomiasis urgently need to be revised, and species-specific disability weights should be established. Even a marginal increase in current estimates would result in a substantial rise in the estimated global burden of schistosomiasis, and have considerable implications for public health prioritization and resource allocation for schistosomiasis research, monitoring, and control.
Directory of Open Access Journals (Sweden)
Amara E Ezeamama
2008-06-01
Full Text Available To estimate the degree of synergism between helminth species in their combined effects on anemia.Quantitative egg counts using the Kato-Katz method were determined for Ascaris lumbricoides, hookworm, Trichuris trichiura, and Schistosoma japonicum in 507 school-age children from helminth-endemic villages in The Philippines. Infection intensity was defined in three categories: uninfected, low, or moderate/high (M+. Anemia was defined as hemoglobin <11 g/dL. Logistic regression models were used to estimate odds ratios (OR, 95% confidence intervals (CI, and synergy index for pairs of concurrent infections.M+ co-infection of hookworm and S. japonicum (OR = 13.2, 95% CI: 3.82-45.5 and of hookworm and T. trichiura (OR = 5.34, 95% CI: 1.76-16.2 were associated with higher odds of anemia relative to children without respective M+ co-infections. For co-infections of hookworm and S. japonicum and of T. trichiura and hookworm, the estimated indices of synergy were 2.9 (95% CI: 1.1-4.6 and 1.4 (95% CI: 0.9-2.0, respectively.Co-infections of hookworm and either S. japonicum or T. trichiura were associated with higher levels of anemia than would be expected if the effects of these species had only independent effects on anemia. This suggests that integrated anti-helminthic treatment programs with simultaneous deworming for S. japonicum and some geohelminths could yield a greater than additive benefit for reducing anemia in helminth-endemic regions.
Directory of Open Access Journals (Sweden)
Maria Lucia França Teixeira
2007-02-01
Full Text Available Larvas de 2° instar de Cerotoma arcuata foram avaliadas em relação à susceptibilidade aos fungos entomopatogênicos Beauveria bassiana, Metarhizium anisopliae e a bactéria Bacillus thuringiensis com as toxinas Cry3. Os insetos adultos foram mantidos em gaiolas e alimentados com plântulas de feijão (Phaseolus vulgaris L. e as larvas em "gerbox" com cotilédones de plântulas de feijão recém-germinadas. Das oito estirpes de B. bassiana avaliadas, CG 156 e CG 213 causaram 100% de mortalidade das larvas, as duas estirpes de M. anisopliae CG 210 e CG 321 foram patogênicas, eliminando 80 e 100% das larvas de C. arcuata, e, das cinco estirpes de B. thuringiensis testadas, o isolado CG 940 causou 70% de mortalidade das larvas.Second instar larvae of Cerotoma arcuata were evaluated concerning the susceptibility to fungi Beauveria bassiana and Metarhizium anisopliae and Bacillus thuringiensis strains containing Cry3 toxin. Adults of C. arcuata were kept in large cages and fed on bean seedlings and the larvae were reared in ‘gearbox’ feeding on germinated Phaseolus bean cotyledons. Strains CG 156 and CG 213 of B. bassiana killed 100% of the insect larvae and strains CG 210 and CG 321 of M. anisopliae killed 80 and 100% of the insect larvae. Strain CG 940 of B. thuringiensis killed 70% of the insect larvae.
Aspartic protease activities of schistosomes cleave mammalian hemoglobins in a host-specific manner
Directory of Open Access Journals (Sweden)
Jeffrey W Koehler
2007-02-01
Full Text Available We examined the efficiency of digestion of hemoglobin from four mammalian species, human, cow, sheep, and horse by acidic extracts of mixed sex adults of Schistosoma japonicum and S. mansoni. Activity ascribable to aspartic protease(s from S. japonicum and S. mansoni cleaved human hemoglobin. In addition, aspartic protease activities from S. japonicum cleaved hemoglobin from bovine, sheep, and horse blood more efficiently than did the activity from extracts of S. mansoni. These findings support the hypothesis that substrate specificity of hemoglobin-degrading proteases employed by blood feeding helminth parasites influences parasite host species range; differences in amino acid sequences in key sites of the parasite proteases interact less or more efficiently with the hemoglobins of permissive or non-permissive hosts.
Directory of Open Access Journals (Sweden)
Xiao-Hong Li
Full Text Available Rhesus macaques are unusual among schistosome hosts, self-curing from an established infection and thereafter manifesting solid immunity against a challenge, an ideal model for vaccine development. Previously, the immunological basis of self-cure was confirmed; surviving worms had ceased feeding but how immunological pressure achieved this was unclear. The schistosome esophagus is not simply a conduit for blood but plays a central role in its processing. Secretions from the anterior and posterior esophageal glands mix with incoming blood causing erythrocyte lysis and tethering and killing of leucocytes.We have analysed the self-cure process in rhesus macaques infected with Schistosoma japonicum. Faecal egg output and circulating antigen levels were used to chart the establishment of a mature worm population and its subsequent demise. The physiological stress of surviving females at perfusion was especially evident from their pale, shrunken appearance, while changes in the structure and function of the esophagus were observed in both sexes. In the anterior region electron microscopy revealed that the vesicle secretory process was disrupted, the tips of lining corrugations being swollen by greatly enlarged vesicles and the putative sites of vesicle release obscured by intense deposits of IgG. The lumen of the posterior esophagus in starving worms was occluded by cellular debris and the lining cytoplasmic plates were closely adherent, also potentially preventing secretion. Seven proteins secreted by the posterior gland were identified and IgG responses were detected to some or all of them. Intrinsic rhesus IgG colocalized with secreted SjMEGs 4.1, 8.2, 9, 11 and VAL-7 on cryosections, suggesting they are potential targets for disruption of function.Our data suggest that rhesus macaques self-cure by blocking esophagus function with antibody; the protein products of the glands provide a new class of potential vaccine targets.
Directory of Open Access Journals (Sweden)
Lizhen Ma
2017-11-01
Full Text Available Abstract Background It is well known that immunization of radiation-attenuated (RA schistosoma cercariae or schistosomula can induce high levels of protective immunity against schistosoma cercariae reinfection in many animals. Many studies have shown that the Th1 cellular immune response is crucial for the protective effect elicited by RA schistosomula. However, the molecular mechanism of this strong protective immunity remains unclear. Methods The expression profiles of Schistosoma japonicum calreticulin (SjCRT in RA and normal schistosoma-derived cells were investigated by flow cytometry. The effect of recombinant SjCRT (rSjCRT on mouse dendritic cells (DCs was determined by FACS, ELISA and RT-PCR analysis. We also analyzed the effects of SjCRT on the activation of spleen cells from mice immunized with rSjCRT by detecting lymphocyte proliferation and the cytokine profiles of splenocytes. Results We found that the expression level of SjCRT in the cells from RA larvae was significantly higher than that in cells from normal schistosomula at early stages of development (day 4. The results of effect of rSjCRT on mouse DCs showed that rSjCRT could induce phenotypic and functional maturation of DCs, and SjCRT bound to the surface of DCs through the CD91 receptor and could be engulfed by DCs. The results of activation of splenocytes from mice immunized with rSjCRT also demonstrate that rSjCRT can effectively stimulate the proliferative response of splenic lymphocytes, elicit splenocytes from immunized mice to secrete high levels of IFN-γ, TNF-α and IL-4, and activate CD4+ T cells to produce high levels of IFN-γ. Conclusion SjCRT is one of the immunostimulatory molecules released from RA schistosomula cells, might play a crucial role in conferring a Th1-polarized immune response induced by RA cercariae/schistosomula in mice, and is a candidate molecule responsible for the high levels of protective immunity induced by RA schistosomula.
Chaloupkova, Radka; Prokop, Zbynek; Sato, Yukari; Nagata, Yuji; Damborsky, Jiri
2011-08-01
The effect of pH and temperature on structure, stability, activity and enantioselectivity of haloalkane dehalogenase DbjA from Bradyrhizobium japonicum USDA110 was investigated in this study. Conformational changes have been assessed by circular dichroism spectroscopy, functional changes by kinetic analysis, while quaternary structure was studied by gel filtration chromatography. Our study shows that the DbjA enzyme is highly tolerant to pH changes. Its secondary and tertiary structure was not affected by pH in the ranges 5.3-10.3 and 6.2-10.1, respectively. Oligomerization of DbjA was strongly pH-dependent: monomer, dimer, tetramer and a high molecular weight cluster of the enzyme were distinguished in solution at different pH conditions. Moreover, different oligomeric states of DbjA possessed different thermal stabilities. The highest melting temperature (T(m) = 49.1 ± 0.2 °C) was observed at pH 6.5, at which the enzyme occurs in dimeric form. Maximal activity was detected at 50 °C and in the pH interval 7.7-10.4. While pH did not have any effect on enantiodiscriminination of DbjA, temperature significantly altered DbjA enantioselectivity. A decrease in temperature results in significantly enhanced enantioselectivity. The temperature dependence of DbjA enantioselectivity was analysed with 2-bromobutane, 2-bromopentane, methyl 2-bromopropionate and ethyl 2-bromobutyrate, and differential activation parameters Δ(R-S)ΔH and Δ(R-S)ΔS were determined. The thermodynamic analysis revealed that the resolution of β-bromoalkanes was driven by both enthalpic and entropic terms, while the resolution of α-bromoesters was driven mainly by an enthalpic term. Unique catalytic activity and structural stability of DbjA in a broad pH range, combined with high enantioselectivity with particular substrates, make this enzyme a very versatile biocatalyst. Enzyme EC3.8.1.5 haloalkane dehalogenase. © 2011 The Authors Journal compilation © 2011 FEBS.
PENULARAN SCHISTOSOMIASIS DI DESA DODOLO DAN MEKARSARI DATARAN TINGGI NAPU SULAWESI TENGAH
Directory of Open Access Journals (Sweden)
Rosmini Rosmini
2012-09-01
Full Text Available The transmission of schistosomiasis is still ongoing in Dodolo and Mekarsari Villages ofNapu highland, Poso District. The people who infected with Schistosoma japonicum, intermediate host. Oncomelania hnpensis lindoensis snails that infected by cercaria. infective stage of S. japonicum and reservoir host, rats, which infected by S. japonicum were still (bund. The purpose of this study was to identify the transmission of schistosomiasis at Dodolo and Mekarsari Villages, Napu highland. The epidemiological investigation was analyzed using observational study with cross sectional design. Data collections were conducted, including stool, snail and rat suryeys. Stool samples were examined by the Kato-Katz method and rats were dissected to identify the prevalence rate of schistosomiasis in human and rats. Snails were examined using crushing method to identify the infection rate of the snails. Prevalence rate of schistosomiasis in human, rats (Rattus exulans and infection rate O. hnpensis lindoensis snails in Dodolo were 6,9%, 8,3%, 2,8% and in Mekarsari were 6,1%, 10% 2,6% respectively. Prevalence of schistosomiasis in Dodolo and Mekarsari villages is still high, so we need continuous surveillance. Keywords: Schistosomiasis, Schistosoma japonicum, O. hupensis lindoensis, Dodolo, Mekarsari
Directory of Open Access Journals (Sweden)
Julia L Finkelstein
2008-03-01
Full Text Available Schistosomiasis is among the most prevalent parasitic infections worldwide. However, current Global Burden of Disease (GBD disability-adjusted life year estimates indicate that its population-level impact is negligible. Recent studies suggest that GBD methodologies may significantly underestimate the burden of parasitic diseases, including schistosomiasis. Furthermore, strain-specific disability weights have not been established for schistosomiasis, and the magnitude of human disease burden due to Schistosoma japonicum remains controversial. We used a decision model to quantify an alternative disability weight estimate of the burden of human disease due to S. japonicum. We reviewed S. japonicum morbidity data, and constructed decision trees for all infected persons and two age-specific strata, or =15 y. We conducted stochastic and probabilistic sensitivity analyses for each model. Infection with S. japonicum was associated with an average disability weight of 0.132, with age-specific disability weights of 0.098 ( or =15 y. Re-estimated disability weights were seven to 46 times greater than current GBD measures; no simulations produced disability weight estimates lower than 0.009. Nutritional morbidities had the greatest contribution to the S. japonicum disability weight in the <15 y model, whereas major organ pathologies were the most critical variables in the older age group. GBD disability weights for schistosomiasis urgently need to be revised, and species-specific disability weights should be established. Even a marginal increase in current estimates would result in a substantial rise in the estimated global burden of schistosomiasis, and have considerable implications for public health prioritization and resource allocation for schistosomiasis research, monitoring, and control.
Dicty_cDB: Contig-U10248-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available stosoma japonicum SJCHGC02833 ... 130 3e-34 AB241242_1( AB241242 |pid:none) Symbiotic protist of Reticuliter...FN320591 |pid:none) Schistosoma japonicum isolate Anhu... 130 7e-34 AB241243_1( AB241243 |pid:none) Symbiotic... 115 2e-32 CR932686_1( CR932686 |pid:none) Paramecium tetraurelia, Small GTPa... 124 2e-32 AB241241_1( AB241241 |pid:none) Symbiotic
International Nuclear Information System (INIS)
Piervali-Bieranvand, N.; Teimori, S.; Khorasani, A.
2004-01-01
To date significant contribution of atmospheric N fixation to soybean nutrition and growth, is approved. Nevertheless several studies have demonstrated that effectiveness of soybean -rhizobium symbiosis is medium compared with other legumes. The time course study of biological nitrogen fixation in soybean under field conditions has been shown that soybean has limited initial fixation and fixes substantially atmospheric nitrogen just during the reproductive periods (R1 until R 5).So there is the possibility of enhancing nitrogen fixation in soybean during vegetation growth. This could be done by improving inoculation methods or breeding for early nodulation. Hence, the present study was conducted to examine the effect of some Bradyrhizobium japonicum strains on early nodulation and biological nitrogen fixation three soybean cultivars by using a-value method. The experiment, was a factorial on randomized complete block design with three replications under proper glass house condition. Treatments were harvesting times(one , two and three weeks after flowering, respectively.)soybean cultivars(Chippewa, M 112 and clay )and Bradyrhizobium japonicum strains(J 1, J 3 and J 43). Ninety-plastic pots were filled with 1.5 kg of a compound of sand and soil(1:3). Rhizobial inoculation was performed by mixing 10 ml of a suspension(Yeast extract Manitol Broth) containing about 9X10 8 cells per ml to the soil of mixing pots were kept weed-free and watered with demineralized water as well as have received every two weeks 5 ml of a solution containing all the necessary nutrients except nitrogen. For measuring biological nitrogen fixation using a-value approach, two solutions of N-15 enriched ammonium sulfate containing 10.16 and %2 N-15 atom excess in amount of 5 and 25 mg N/Kg soil were mixed with soils in each pot containing fixing and reference plants, respectively. A non-nodulation isoline of soybean C v. M 129 for the all cultivars was used as a reference crop. First harvest was
Directory of Open Access Journals (Sweden)
Janaína Dartora
2013-10-01
Full Text Available Bactérias dos gêneros Azospirillum e Herbaspirillum são fixadoras de nitrogênio (N atmosférico e consideradas promotoras do crescimento vegetal. Desta forma, desenvolveu-se o presente trabalho com o objetivo de avaliar o desenvolvimento e a produtividade do milho em resposta à inoculação de A. brasilense e H. seropedicae associada à adubação nitrogenada. O experimento foi conduzido em delineamento experimental de blocos ao acaso em esquema fatorial 4 x 5, com quatro repetições. Os tratamentos foram constituídos da inoculação de sementes (testemunha, estirpe de A. brasilense - Ab-V5, estirpe de H. seropedicae - SmR1 e combinação Ab-V5 + SmR1 e doses de N (0, 40, 80, 120 e 160 kg ha-1 de N. Foram avaliados: diâmetro basal do colmo, altura de planta, matéria seca de parte aérea e área foliar, nas fases vegetativa e reprodutiva, e produtividade. A adubação nitrogenada favoreceu o desenvolvimento da cultura até a máxima dose estudada. A inoculação combinada das estirpes proporcionou incrementos de 12% na matéria seca de parte aérea e 7% na produtividade em relação à testemunha indicando benefícios da combinação de bactérias diazotróficas que interagem de forma diferenciada com a planta.
Energy Technology Data Exchange (ETDEWEB)
Albersheim, P.; Darvill, A.
1991-08-01
Research from the Complex Carbohydrates Research Center at the University of Georgia is presented. Topics include: Structural determination of soybean isoflavones which specifically induce Bradyrhizobium japonicum nodD1 but not the nodYABCSUIJ operon; structural analysis of the lipopolysaccharides (LPSs) from symbiotic mutants of Bradyrhizobium japonicum; structural characterization of lipooligosaccharides from Bradyrhizobium japonicum that are required for the specific nodulation of soybean; structural characterization of the LPSs from R. Leguminosarum biovar phaseoli, the symbiont of bean; characterization of bacteroid-specific LPS epitopes in R. leguminosarum biovar viciae; analysis of the surface polysaccharides of Rhizobium meliloti mutants whose lipopolysaccharides and extracellular polysaccharides can have the same function in symbiosis; characterization of a polysaccharide produced by certain Bradyrhizobium japonicum strains within soybean nodules; structural analysis of a streptococcal adhesin polysaccharide receptor; conformational studies of xyloglucan, the role of the fucosylated side chain in surface-specific cellulose-xyloglucan interactions; the structure of an acylated glucosamine oligosaccharide signal molecule (nod factor) involved in the symbiosis of Rhizobium leguminosarum biovar viciae with its host Vicia sativa; investigating membrane responses induced by oligogalacturonides in cultured cells; the polygalacturonase inhibitor protein; characterization of the self-incompatability glycoproteins from Petunia hybrida; investigation of the cell wall polysaccharide structures of Arabidopsis thaliana; and the glucan inhibition of virus infection of tabacco.
Energy Technology Data Exchange (ETDEWEB)
Albersheim, P.; Darvill, A.
1991-08-01
Research from the Complex Carbohydrates Research Center at the University of Georgia is presented. Topics include: Structural determination of soybean isoflavones which specifically induce Bradyrhizobium japonicum nodD1 but not the nodYABCSUIJ operon; structural analysis of the lipopolysaccharides (LPSs) from symbiotic mutants of Bradyrhizobium japonicum; structural characterization of lipooligosaccharides from Bradyrhizobium japonicum that are required for the specific nodulation of soybean; structural characterization of the LPSs from R. Leguminosarum biovar phaseoli, the symbiont of bean; characterization of bacteroid-specific LPS epitopes in R. leguminosarum biovar viciae; analysis of the surface polysaccharides of Rhizobium meliloti mutants whose lipopolysaccharides and extracellular polysaccharides can have the same function in symbiosis; characterization of a polysaccharide produced by certain Bradyrhizobium japonicum strains within soybean nodules; structural analysis of a streptococcal adhesin polysaccharide receptor; conformational studies of xyloglucan, the role of the fucosylated side chain in surface-specific cellulose-xyloglucan interactions; the structure of an acylated glucosamine oligosaccharide signal molecule (nod factor) involved in the symbiosis of Rhizobium leguminosarum biovar viciae with its host Vicia sativa; investigating membrane responses induced by oligogalacturonides in cultured cells; the polygalacturonase inhibitor protein; characterization of the self-incompatability glycoproteins from Petunia hybrida; investigation of the cell wall polysaccharide structures of Arabidopsis thaliana; and the glucan inhibition of virus infection of tabacco.
Directory of Open Access Journals (Sweden)
Evaristus Chibunna Mbanefo
Full Text Available BACKGROUND: We previously identified a novel gene family dispersed in the genome of Schistosoma japonicum by retrotransposon-mediated gene duplication mechanism. Although many transcripts were identified, no homolog was readily identifiable from sequence information. METHODOLOGY/PRINCIPAL FINDINGS: Here, we utilized structural homology modeling and biochemical methods to identify remote homologs, and characterized the gene products as SEA (sea-urchin sperm protein, enterokinase and agrin-domain containing proteins. A common extracellular domain in this family was structurally similar to SEA-domain. SEA-domain is primarily a structural domain, known to assist or regulate binding to glycans. Recombinant proteins from three members of this gene family specifically interacted with glycosaminoglycans with high affinity, with potential implication in ligand acquisition and immune evasion. Similar approach was used to identify a heme-binding site on the SEA-domain. The heme-binding mode showed heme molecule inserted into a hydrophobic pocket, with heme iron putatively coordinated to two histidine axial ligands. Heme-binding properties were confirmed using biochemical assays and UV-visible absorption spectroscopy, which showed high affinity heme-binding (K D = 1.605×10(-6 M and cognate spectroscopic attributes of hexa-coordinated heme iron. The native proteins were oligomers, antigenic, and are localized on adult worm teguments and gastrodermis; major host-parasite interfaces and site for heme detoxification and acquisition. CONCLUSIONS: The results suggest potential role, at least in the nucleation step of heme crystallization (hemozoin formation, and as receptors for heme uptake. Survival strategies exploited by parasites, including heme homeostasis mechanism in hemoparasites, are paramount for successful parasitism. Thus, assessing prospects for application in disease intervention is warranted.
Mbanefo, Evaristus Chibunna; Kikuchi, Mihoko; Huy, Nguyen Tien; Shuaibu, Mohammed Nasir; Cherif, Mahamoud Sama; Yu, Chuanxin; Wakao, Masahiro; Suda, Yasuo; Hirayama, Kenji
2014-01-01
Background We previously identified a novel gene family dispersed in the genome of Schistosoma japonicum by retrotransposon-mediated gene duplication mechanism. Although many transcripts were identified, no homolog was readily identifiable from sequence information. Methodology/Principal Findings Here, we utilized structural homology modeling and biochemical methods to identify remote homologs, and characterized the gene products as SEA (sea-urchin sperm protein, enterokinase and agrin)-domain containing proteins. A common extracellular domain in this family was structurally similar to SEA-domain. SEA-domain is primarily a structural domain, known to assist or regulate binding to glycans. Recombinant proteins from three members of this gene family specifically interacted with glycosaminoglycans with high affinity, with potential implication in ligand acquisition and immune evasion. Similar approach was used to identify a heme-binding site on the SEA-domain. The heme-binding mode showed heme molecule inserted into a hydrophobic pocket, with heme iron putatively coordinated to two histidine axial ligands. Heme-binding properties were confirmed using biochemical assays and UV-visible absorption spectroscopy, which showed high affinity heme-binding (K D = 1.605×10−6 M) and cognate spectroscopic attributes of hexa-coordinated heme iron. The native proteins were oligomers, antigenic, and are localized on adult worm teguments and gastrodermis; major host-parasite interfaces and site for heme detoxification and acquisition. Conclusions The results suggest potential role, at least in the nucleation step of heme crystallization (hemozoin formation), and as receptors for heme uptake. Survival strategies exploited by parasites, including heme homeostasis mechanism in hemoparasites, are paramount for successful parasitism. Thus, assessing prospects for application in disease intervention is warranted. PMID:24416467
Directory of Open Access Journals (Sweden)
J. Melo-Cristino
2006-01-01
Viriato é um estudo nacional, prospectivo e multicêntrico, de vigilância da susceptibilidade aos antimicrobianos de bactérias frequentemente responsáveis por infecções do aparelho respiratório adquiridas na comunidade. Nos anos de 2003 e 2004 participaram 29 laboratórios de todo o país. Isolaram-se 2945 microrganismos que foram estudados num laboratório coordenador. Das 513 estirpes de Streptococcus pyogenes de doentes com amigdalo-faringite aguda, todas eram susceptíveis à penicilina e outros antibióticos beta-lactâmicos, mas 18,9% eram resistentes à eritromicina, claritromicina e azitromicina. Nas estirpes resistentes foi mais frequente o fenótipo M (67,0% que confere resistência à eritromicina (CIM90 = 16 mg/L, claritromicina e azitromicina, mas susceptibilidade à clindamicina (CIM90 = 0,094 mg/L. De doentes com infecção do aparelho respiratório inferior estudaram-se 1300 estirpes de Streptococcus pneumoniae (pneumococos, 829 de Haemophilus influenzae e 303 de Moraxella catarrhalis. Em S. pneumoniae, 18,4% das estirpes eram resistentes à penicilina (3,5% com resistência elevada, 7,1% à cefuroxima, 0,5% à amoxicilina, 0,5% à amoxicilina/clavulanato, 18,8% à eritromicina, claritromicina e azitromicina, 14,5% à tetraciclina, 16,5% ao cotrimoxazol e 0,4% à levofloxacina. Nas estirpes resistentes aos macrólidos, dominou o fenótipo MLSB (83,7%, caracterizado por resistência elevada (CIM90>256 mg/L à eritromicina, claritromicina, azitromicina e clindamicina. Produziam beta--lactamase 10,0% de H. influenzae e 96,4% de M. catarrhalis. Em H. influenzae demonstrou-se 5,5% de resistência à claritromicina e 13,4% ao cotrimoxazol. A quase totalidade das estirpes era susceptível à amoxicilina / clavulanato, cefuroxima, azitromicina, tetraciclina e ciprofloxacina. Em M. catarrhalis a resistência ao co-trimoxazol foi de 27,1% e à tetraciclina de 1,0%. Todas as estirpes eram susceptíveis à amoxicilina / clavulanato, cefuroxima
Directory of Open Access Journals (Sweden)
Pedro Antonio Arraes Pereira
2002-06-01
Full Text Available The objective of this study was to determine if trehalose can effectively enhance the viability and storage lifetime of Rhizobium tropici and Rhizobium etli after lyophilization as compared to the traditional protective combination of sucrose and peptone. Two strains of bean-nodulating rhizobia were effectively preserved in the lyophilized state by 100 mM trehalose, and survived for at least 12 days, even when stored under non-ideal conditions. Trehalose provided better protection than the sucrose/peptone combination. When protective excipients were introduced inside the cells, strain CFN 42 was more sensitive to the type of additive used than strain CIAT 899, probably because CIAT 899 produces beta (1-2 glucan, which may have a protective effect. beta (1-2 glucan combined with sucrose protected better than trehalose against leakage from freeze-dried liposomes, but by itself it had no protective capability. There was a high level of unfrozen water associated with the hydrated glucan, in addition to a thermal event at approximately 70ºC, corresponding to an observed gel-sol transition in the glucan. These findings may shed light on the mechanism by which the glucan contributes to the protection of dried cells and liposomes, and may lead to further improvements in rhizobial inoculants.O objetivo deste estudo foi determinar se a trealose pode aumentar a viabilidade e o tempo de preservação de estirpes de Rhizobium tropici e Rhizobium etli após a liofilização, comparada com a proteção proporcionada pela combinação tradicional de sacarose e peptona. Duas estirpes de rizóbio para feijão foram preservadas liofilizadas com 100 mM de trealose e sobreviveram por pelo menos 12 dias, mesmo quando armazenadas sob condições não-ideais. A trealose proporcionou uma proteção superior à combinação de sacarose peptona. Quando agentes protetores foram introduzidos dentro da célula, a estirpe CFN 42 foi mais sensível em relação ao tipo de
Sobrevivência de Bradyrhizobium e Azorhizobium em misturas de solo contaminadas com metais pesados
Directory of Open Access Journals (Sweden)
A. Matsuda
2002-03-01
Full Text Available Estudos foram realizados no Departamento de Ciência do Solo da Universidade Federal de Lavras (MG, no período de novembro/1999 a janeiro/2000, com o objetivo de avaliar a sobrevivência de estirpe e isolados de rizóbio em solo contaminado com metais pesados e verificar a relação entre tolerância do rizóbio a metais pesados em meio de cultura e sua sobrevivência em solo contaminado. Foram utilizados os dois microrganismos mais tolerantes [BR-4406 (estirpe recomendada para Enterolobium spp. e UFLA-01-457 (isolado de solo contaminado, ambos pertencentes ao gênero Bradyrhizobium ] e os dois mais sensíveis (UFLA-01-486 e UFLA-01-510, isolados de solo contaminado, pertencentes ao gênero Azorhizobium , todos selecionados de um grupo de 60estirpes/isolados em estudos prévios deste laboratório, em meio de cultura suplementado com metais pesados.Empregaram-se misturas de um Latossolo Vermelho-Escuro (LE que continham 0, 15 e 45% (v/v de um Latossolo Vermelho-Amarelo plíntico contaminado com Zn, Cd, Pb e Cu. As misturas de solo contaminado foram inoculadas com 20mL de cultura em YM na fase log das estirpes mencionadas, as quais foram testadas separadamente com três repetições. A avaliação do número de células viáveis no solo, realizada aos 0, 7, 14, 21 e 28dias de incubação, pelo método das diluições sucessivas e inoculação em placas com meio YMA, revelou comportamento diferenciado entre os organismos estudados. O número médio de células que sobreviveram ao final de 28 dias de incubação foi de (em UFCg-1de solo: 10(10,36, 10(10,29 e 10(9,70, para Bradyrhizobium, e 10(9,36, 10(7,54 e 0, para Azorhizobium em misturas de 0, 15 e 45% de solo contaminado, respectivamente. Portanto, houve maior sobrevivência de Bradyrhizobium do que de Azorhizobium , indicando maior tolerância a metais pesados do primeiro gênero.Como Bradyrhizobium foi também mais tolerante "in vitro", os resultados indicam haver relação entre o
Directory of Open Access Journals (Sweden)
Sha Zhou
2016-10-01
Full Text Available More than 220 million people worldwide are chronically infected with schistosomes, causing severe disease or even death. The major pathological damage occurring in schistosomiasis is attributable to the granulomatous inflammatory response and liver fibrosis induced by schistosome eggs. The inflammatory response is tightly controlled and parallels immunosuppressive regulation, constantly maintaining immune homeostasis and limiting excessive immunopathologic damage in important host organs. It is well known that the activation of programmed death 1 (PD-1 signaling causes a significant suppression of T cell function. However, the roles of PD-1 signaling in modulating CD4+ T cell responses and immunopathology during schistosome infection, have yet to be defined.Here, we show that PD-1 is upregulated in CD4+ T cells in Schistosoma japonicum (S. japonicum-infected patients. We also show the upregulation of PD-1 expression in CD4+ T cells in the spleens, mesenteric lymph nodes, and livers of mice with S. japonicum infection. Finally, we found that the blockade of PD-1 signaling enhanced CD4+ T helper 2 (Th2 cell responses and led to more severe liver immunopathology in mice with S. japonicum infection, without a reduction of egg production or deposition in the host liver.Overall, our study suggests that PD-1 signaling is specifically induced to control Th2-associated inflammatory responses during schistosome infection and is beneficial to the development of PD-1-based control of liver immunopathology.
Directory of Open Access Journals (Sweden)
J. Melo-Cristino
2006-01-01
Full Text Available Resumo: O Estudo Viriato é um estudo nacional, prospectivo e multicêntrico, de vigilância da susceptibilidade aos antimicrobianos de bactérias frequentemente responsáveis por infecções do aparelho respiratório adquiridas na comunidade. Nos anos de 2003 e 2004 participaram 29 laboratórios de todo o país. Isolaram-se 2945 microrganismos que foram estudados num laboratório coordenador. Das 513 estirpes de Streptococcus pyogenes de doentes com amigdalo-faringite aguda, todas eram susceptíveis à penicilina e outros antibióticos beta-lactâmicos, mas 18,9% eram resistentes à eritromicina, claritromicina e azitromicina. Nas estirpes resistentes foi mais frequente o fenótipo M (67,0% que confere resistência à eritromicina (CIM90=16 mg/L, claritromicina e azitromicina, mas susceptibilidade à clindamicina (CIM90=0,094 mg/L. De doentes com infecção do aparelho respiratório inferior estudaram-se 1300 estirpes de Streptococcus pneumoniae (pneumococos, 829 de Haemophilus influenzae e 303 de Moraxella catarrhalis. Em S. pneumoniae, 18,4% das estirpes eram resistentes à penicilina (3,5% com resistência elevada, 7,1% à cefuroxima, 0,5% à amoxicilina, 0,5% à amoxicilina/clavulanato, 18,8% à eritromicina, claritromicina e azitromicina, 14,5 % à tetraciclina, 16,5% ao cotrimoxazol e 0,4% à levofloxacina. Nas estirpes resistentes aos macrólidos, dominou o fenótipo MLSB (83,7%, caracterizado por resistência elevada (CIM90 >256 mg/L à eritromicina, claritromicina, azitromicina e clindamicina. Produziam beta-lactamase 10,0% de H. influenzae e 96,4% de M. catarrhalis. Em H. influenzae demonstrou-se 5,5% de resistência à claritromicina e 13,4% ao cotrimoxazol. A quase totalidade das estirpes era susceptível à amoxicilina / clavulanato, cefuroxima, azitromicina, tetraciclina e ciprofloxacina. Em M. catarrhalis a resistência ao co-trimoxazol foi de 27,1% e à tetraciclina de 1,0%. Todas as estirpes eram susceptíveis à amoxicilina
Directory of Open Access Journals (Sweden)
Yaima Burgher Pulgarón
2015-12-01
Full Text Available As diferenças moleculares entre as estirpes de Mycoplasma hyopneumoniae presentes em pulmões de suínos com pneumonia tem sido estudadas. Porém, estudos comparativos relativos as estirpes presentes nos suínos aparentemente saudáveis não foram levados a cabo. O objetivo do estudo foi a detecção, quantificação e analise molecular de M. hyopneumoniae nos pulmões suínos com e sem lesões pneumônicas. Para a detecção de M. hyopneumoniae usaramse o PCR Multiplo (YAMAGUTI, 2008, o PCR a Tempo Real (STRAIT et al., 2008 e a amplificação de múltiplo VNTR (VRANCKX et al., 2011. A caracterização molecular das estirpes foi realizada mediante a análise do número de copias de VNTR em P97R1, P146R3, H2R1 e H4. O M. hyopneumoniae foi detectado em amostras de suínos saudáveis e pneumônicos e a quantidade de M. hyopneumoniae nas amostras positivas variou com o tipo de ensaio. O maior número de amostras positivas foi identificado pela amplificação de múltiplas VNTR combinado com a eletroforese de capilares. Usando o PCR a Tempo Real, 4.9*104 copias de genoma/mL de M. hyopneumoniae foram detectadas em pulmões aparentemente saudáveis. Uma quantidade média de 3.9*106 copias de genoma/mL de M. hyopneumoniae foi detectada em pulmões pneumônicos. A análise do número de copias de VNTR demonstrou uma elevada variabilidade.
Head, Jennifer R; Chang, Howard; Li, Qunna; Hoover, Christopher M; Wilke, Thomas; Clewing, Catharina; Carlton, Elizabeth J; Liang, Song; Lu, Ding; Zhong, Bo; Remais, Justin V
2016-12-01
While the dispersal of hosts and vectors-through active or passive movement-is known to facilitate the spread and re-emergence of certain infectious diseases, little is known about the movement ecology of Oncomelania spp., intermediate snail host of the parasite Schistosoma japonicum, and its consequences for the spread of schistosomiasis in East and Southeast Asia. In China, despite intense control programs aimed at preventing schistosomiasis transmission, there is evidence in recent years of re-emergence and persistence of infection in some areas, as well as an increase in the spatial extent of the snail host. A quantitative understanding of the dispersal characteristics of the intermediate host can provide new insights into the spatial dynamics of transmission, and can assist public health officials in limiting the geographic spread of infection. Oncomelania hupensis robertsoni snails (n = 833) were sampled from 29 sites in Sichuan, China, genotyped, and analyzed using Bayesian assignment to estimate the rate of recent snail migration across sites. Landscape connectivity between each site pair was estimated using the geographic distance distributions derived from nine environmental models: Euclidean, topography, incline, wetness, land use, watershed, stream use, streams and channels, and stream velocity. Among sites, 14.4% to 32.8% of sampled snails were identified as recent migrants, with 20 sites comprising >20% migrants. Migration rates were generally low between sites, but at 8 sites, over 10% of the overall host population originated from one proximal site. Greater landscape connectivity was significantly associated with increased odds of migration, with the minimum path distance (as opposed to median or first quartile) emerging as the strongest predictor across all environmental models. Models accounting for land use explained the largest proportion of the variance in migration rates between sites. A greater number of irrigation channels leading into a
Directory of Open Access Journals (Sweden)
Jennifer R Head
2016-12-01
Full Text Available While the dispersal of hosts and vectors-through active or passive movement-is known to facilitate the spread and re-emergence of certain infectious diseases, little is known about the movement ecology of Oncomelania spp., intermediate snail host of the parasite Schistosoma japonicum, and its consequences for the spread of schistosomiasis in East and Southeast Asia. In China, despite intense control programs aimed at preventing schistosomiasis transmission, there is evidence in recent years of re-emergence and persistence of infection in some areas, as well as an increase in the spatial extent of the snail host. A quantitative understanding of the dispersal characteristics of the intermediate host can provide new insights into the spatial dynamics of transmission, and can assist public health officials in limiting the geographic spread of infection.Oncomelania hupensis robertsoni snails (n = 833 were sampled from 29 sites in Sichuan, China, genotyped, and analyzed using Bayesian assignment to estimate the rate of recent snail migration across sites. Landscape connectivity between each site pair was estimated using the geographic distance distributions derived from nine environmental models: Euclidean, topography, incline, wetness, land use, watershed, stream use, streams and channels, and stream velocity. Among sites, 14.4% to 32.8% of sampled snails were identified as recent migrants, with 20 sites comprising >20% migrants. Migration rates were generally low between sites, but at 8 sites, over 10% of the overall host population originated from one proximal site. Greater landscape connectivity was significantly associated with increased odds of migration, with the minimum path distance (as opposed to median or first quartile emerging as the strongest predictor across all environmental models. Models accounting for land use explained the largest proportion of the variance in migration rates between sites. A greater number of irrigation channels
Jung, Hyun Ah; Abdul, Qudeer Ahmed; Byun, Jeong Su; Joung, Eun-Ji; Gwon, Wi-Gyeong; Lee, Min-Sup; Kim, Hyeung-Rak; Choi, Jae Sue
2017-09-14
Milk thistle leaves and flowers have been traditionally used as herbal remedy to alleviate liver diseases for decades. Korean milk thistle, Cirsium japonicum var. maackii (Maxim.) Matsum has been employed in traditional folk medicine as diuretic, antiphlogistic, hemostatic, and detoxifying agents. The aim of current investigation was to evaluate hepatoprotective properties of the MeOH extract of the roots, stems, leaves and flowers of Korean milk thistle as well as four isolated flavonoids, luteolin, luteolin 5-O-glucoside, apigenin and apigenin 7-O-glucuronide during t-BHP-induced oxidative stress in HepG2 cells. Hepatoprotective potential of the MeOH extracts and flavonoids derived from Korean milk thistle against t-BHP-induced oxidative stress in HepG2 cells were evaluated following MTT method. Incubating HepG2 cells with t-BHP markedly decreased the cell viability and increased the intracellular ROS generation accompanied by depleted GSH levels. Protein expression of heme oxygenase (HO-1) and nuclear factor-E2-related factor 2 (Nrf-2) was determined by Western blot. Our findings revealed that pretreating HepG2 cells with MeOH extracts and bioactive flavonoids significantly attenuated the t-BHP-induced oxidative damage, followed by increased cell viability in a dose-dependent manner. The results illustrate that excess ROS generation was reduced and GSH levels increased dose-dependently when HepG2 cells were pretreated with four flavonoids. Moreover, Western blotting analysis demonstrated that protein expressions of Nrf-2 and HO-1 were also up-regulated by flavonoids treatment. These results clearly demonstrate that the MeOH extracts and flavonoids from Korean milk thistle protected HepG2 cells against oxidative damage triggered by t-BHP principally by modulating ROS generation and restoring depleted GSH levels in addition to the increased Nrf-2/HO-1 signaling cascade. These flavonoids are potential natural antioxidative biomarkers against oxidative stress
Directory of Open Access Journals (Sweden)
M.G. Ribeiro
2006-10-01
Full Text Available Avaliou-se a ocorrência de fatores de virulência e do sorotipo O157:H7 em 120 linhagens de Escherichia coli, isoladas de 80 casos de mastite clínica bovina e 40 de mastite subclínica. Verificou-se alfa-hemolisina em oito (6,7% linhagens, isoladas de cinco casos de mastite clínica e três de mastite subclínica e em nenhuma das estirpes detectou-se enteroemolisina. A presença de sideróforos foi encontrada em 11 (9,2% linhagens, sete de mastite clínica e quatro de subclínica. Em duas (1,7% estirpes isoladas de mastite subclínica, identificou-se enterotoxina STa. Observou-se efeito citopático em células vero compatível com a produção de verotoxina-VT em cinco (4,2% linhagens, duas de mastite clínica e três subclínicas. Em uma (0,8% linhagem isolada de mastite clínica, detectou-se efeito citopático compatível com o fator necrosante citotóxico. Nenhuma estirpe apresentou-se sorbitol-negativa no MacConkey-sorbitol, tampouco aglutinou com o sorotipo O157:H7. Os antimicrobianos mais efetivos foram polimixina B (97,5% e norfloxacina (95,8%. Observou-se multi-resistência a dois ou mais antimicrobianos em 24 (20% estirpes, principalmente com o uso de ampicilina e ceftiofur.The occurrence of different virulence factors and O157:H7 serotype investigation in 120 Escherichia coli strains isolated from clinical (80 cases and subclinical (40 cases bovine mastitis was evaluated. Alpha-haemolysin was detected in 8 (6.7% strains (5 clinical and 3 subclinical cases. None strain showed enterohaemolysin production. E. coli growth under iron restriction conditions (siderophores production was observed in 11 (9.2% strains (7 clinical and 4 subclinical cases. STa enterotoxin was detected in 2 (1.7% strains from subclinical cases. Cytotoxic effect in vero cells compatible with verotoxin-VT production was observed in 5 (4.2% strains (2 clinical and 3 subclinical cases. One strain (0.8% isolated from clinical mastitis showed cytophatic effect in vero
Directory of Open Access Journals (Sweden)
Gunawan Gunawan
2015-01-01
Full Text Available AbstrakSchistosomiasis merupakan penyakit parasitik jaringan yang terabaikan. Schistosomiasis adalah penyakit parasitik yang bersifat zoonosis, selain menginfeksi manusia juga menginfeksi hewan mamalia lainnya. Ada 13 mamalia yang diketahui dapat terinfeksi oleh schistosomiasis antara lain sapi(Bos sundaicus, kerbau (Bubalus bubalis, kuda (Equus cabalus, anjing (Canis familiaris, babi (Sus sp, musang (Vivera tangalunga, rusa (Carvus timorensis, dan berbagai jenis tikus (Rattus exulans, R. hoffmani, R. chysomomusrallus, R. marmosurus, R norvegicus, R palallae. Di Indonesia schistosomiasis disebabkan oleh cacing Schistosoma japonicum dan hanya ditemukan endemik di Sulawesi Tengah yaitu di dataran tinggi Lindu, Napu dan Bada.Penelitian ini bertujuan untuk mengetahui kontribusi reservoir dalam penularan schistosomiasis di Kecamatan Lindu, Kabupaten Sigi, Propinsi Sulawesi Tengah. Metode penelitian ini adalah deskriptif observational dengan pendekatan cross sectional. Pengumpulan data primer dilakukan dengan mengobservasi mamalia yang berisiko,dengan pengambilan dan pemeriksaan sampel tinja hewan mamali tersebut. Sejumlah 219 sampel tinja hewan mamalia yang terdiri dari sapi, kerbau, anjing, babi dan kuda diperiksa dengan menggunakan metode sentrifugasi formalin-eter. Dari hasil pemeriksaan tinja yang dilakukan dilaboratorium Parasitologi Balai Litbang P2B2 Donggala sebanyak 54 sampel tinja hewan mamalia (sapi, kerbau, anjing, babi dan kuda positif terinfeksi S.japonicum.Kata kunci : Schistosomiasis, hewan mamalia, Schistosoma japonicumAbstractSchistosomiasis is one of neglected parasitic diseaseds and also a zoonosic disease, in addition to humans it also infect mammals. There were 13 known mammals that can be infected by schistosomiasis, i.e. cattle (Bos sundaicus, buffalo (Bubalus bubalis, horse (Equus Cabalus, dog (Canis familiaris, pig(Sus sp, civet cat(Vivera tangalunga, deer (Cervus timorensis, and various types of rat (Rattus exulans, R
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... japonicum USDA 110] ... Length = 101 ... Query: 1 ... MIPGELFIQDGEIELNAGRKTVTLTVANTGDRPIQVGSHYHFFETNP...ALKFERKKARGMR 60 ... MIPGELFIQDGEIELNAGRKTVTLTVANTGDRPIQVGSHYHFFETNPALKFER...KKARGMR Sbjct: 1 ... MIPGELFIQDGEIELNAGRKTVTLTVANTGDRPIQVGSHYHFFETNPALKFERKKARGMR 60 ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Bradyrhizobium japonicum USDA 110] ... Length = 264 ... Query: 19 ... EATDIVTAQLVMGLRATLFQEVGEPKKGDAAPFTVHWCLAQPVFPMS...MLGPDGHPTRGGF 78 ... EATDIVTAQLVMGLRATLFQEVGEPKKGDAAPFTVHWCLAQPVFPMS...MLGPDGHPTRGGF Sbjct: 1 ... EATDIVTAQLVMGLRATLFQEVGEPKKGDAAPFTVHWCLAQPVFPMSMLGPDGHPTRGGF 60 ... Q
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Bradyrhizobium japonicum USDA 110] ... Length = 387 ... Query: 4 ... VVIVSAARTPVGSFNGAFGALSAHELGAV...AIKGALDRAKVSPEDVDEVILGQVLSGGEGQ 63 ... VVIVSAARTPVGSFNGAFGALSAHELGAVAIKGAL...DRAKVSPEDVDEVILGQVLSGGEGQ Sbjct: 1 ... VVIVSAARTPVGSFNGAFGALSAHELGAVAIKGALDRAKVSPEDVDEVILGQVLSGGEGQ 60 ... Query:
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... japonicum USDA 110] ... Length = 164 ... Query: 2 ... SNDNKPYRPNVGIALFNAEGRVLIGHRFKGDGPEIILPGLDWQMPQGGV...DEGEDLRDAAM 61 ... SNDNKPYRPNVGIALFNAEGRVLIGHRFKGDGPEIILPGLDWQMPQGGVDEGEDL...RDAAM Sbjct: 1 ... SNDNKPYRPNVGIALFNAEGRVLIGHRFKGDGPEIILPGLDWQMPQGGVDEGEDLRDAAM 60 ... Query: 122 LTPQNGQPAEFDAWR
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available y protein ... [Bradyrhizobium japonicum USDA 110] ... Length = 108 ... Query: 208 DIAILHRASRFIDQN...LGRNDLSVATICREIGVSRSVLYRVFAPLAGVADYIRGRRLEAIH 267 ... DIAILHRASRFIDQNLGRND...LSVATICREIGVSRSVLYRVFAPLAGVADYIRGRRLEAIH Sbjct: 1 ... DIAILHRASRFIDQNLGRNDLSVATICREIGVSRSVLYRVFAPLAGVADYIRGRRLEAIH 60 ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Bradyrhizobium japonicum USDA 110] ... Length = 137 ... Query: 16 ... VLIDAKGLVVGRLATIVAMRLRGKHLPTYTPHVDC...GDNVIIINAQHAVLTGRKREQKTYY 75 ... VLIDAKGLVVGRLATIVAMRLRGKHLPTYTPHVDCGDNVI...IINAQHAVLTGRKREQKTYY Sbjct: 1 ... VLIDAKGLVVGRLATIVAMRLRGKHLPTYTPHVDCGDNVIIINAQHAVLTGRKREQKTYY 60 ... Query: 136
Patterns of resistance to β-lactams and β-lactamase inhibitors in ...
African Journals Online (AJOL)
hope&shola
2006-03-15
Mar 15, 2006 ... Grupo de Estudo. Multicêntrico de Vigilância da Susceptibilidade aos Antibióticos,. Mecanismos de resistência aos β-lactâmicos em estirpes de. Escherichia coli de origem clínica. Arq. Med. 14: 71. Féria C, E Ferreira, JD Correia, J Gonçalves, M Caniça (2002). Patterns and mechanisms of resistance to β ...
Desenvolvimento Inicial de Duas Variedades de Cana-de-açúcar Inoculadas com Bactérias Diazotróficas
Directory of Open Access Journals (Sweden)
Valfredo Almeida Chaves
2015-12-01
Full Text Available RESUMO A cana-de-açúcar é uma cultura de grande destaque na economia, em razão da produção de açúcar, etanol e energia. Tecnologias que possam contribuir para o aumento da produtividade e qualidade da cultura com mínimos danos ao meio ambiente são necessárias. Objetivou-se avaliar a produção de ácido indol acético de cinco estirpes de bactérias diazotróficas e o efeito da inoculação delas na brotação de duas variedades de cana-de-açúcar, RB867515 e IACSP95-5000. A produção de auxina foi determinada pelo teste colorimétrico, usando o reagente de Salkowski. Para avaliar a germinação, foi conduzido um experimento em casa de vegetação, utilizando-se delineamento experimental em blocos ao acaso com quatro repetições e sete tratamentos: controle não inoculado; inoculação mista com as cinco estirpes e inoculação individual com Gluconacetobacter diazotrophicus (Gd estirpe BR11281T(PAL-5T, Herbaspirillum seropedicae (Hs - BR11335 = HRC54, Herbaspirillum rubrisubalbicans (Hr - BR11504 = HCC103, Burkholderia tropica (Bt - BR11366T = PPe 8 T e Azospirillum amazonense (Aa - BR11145 = CBAMc. As bactérias mais eficientes na produção de auxina foram Hs e Hr, declinando 48 h após o crescimento. Hr, Aa e Bt aumentaram o índice de velocidade de germinação e o número de brotações nas duas variedades. Na var. RB867515, a velocidade de germinação ainda foi positivamente influenciada pela inoculação mista, sendo o mesmo observado pela inoculação de Gd na var. IACSP95-5000.
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available id sensor ... and regulator [Bradyrhizobium japonicum USDA 110] ... Length = 108 ... Query: 623 DRPLKVLVAEDDA...VNRLVVSKMLGAFDVELRVVTDGVEAVAAASEGDYDVVLMDVRMPDM 682 ... DRPLKVLVAEDDA...VNRLVVSKMLGAFDVELRVVTDGVEAVAAASEGDYDVVLMDVRMPDM Sbjct: 1 ... DRPLKVLVAEDDAVNRLVVSKMLGAFDVELRVVTDGVEAVAAASEGDYDVVLMDVRMPDM 60 ...
Cao, Z-G; Zhao, Y-E; Lee Willingham, A; Wang, T-P
2016-01-01
Schistosomiasis japonica, an endemic, zoonotic tropical parasitic disease caused by Schistosoma japonicum, remains an important public health concern in The People's Republic of China. Unlike other species of Schistosoma, over 40 species of wild and domestic animals can act as reservoir hosts of S. japonicum, which increases the difficulty for the control of this tropical disease. It is widely recognized that domestic animals, particularly water buffaloes and cattle, play an important role in the transmission of S. japonicum. Hence, since the 1950s when The People's Republic of China commenced fight against the disease, the control of animal schistosomiasis has been carried out almost synchronously with that of human schistosomiasis, such that great strides have been made over the past six decades. In this chapter, we review the history and current status of schistosomiasis control in domestic animals in The People's Republic of China. We thoroughly analyse the prevalence of domestic animal schistosomiasis at different stages of schistosomiasis control and the role of different species of domestic animals in transmission of the disease, summarize the control strategies and assess their effectiveness. Furthermore, the challenges ahead are discussed and recommendations for future direction are provided. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Hamed Hadi
2016-04-01
Full Text Available Effect of free and symbiotic nitrogen fixing bacteria on seed and seedling produced seeds under deficit irrigation was conducted in laboratory and field experiments in 2006. In laboratory of karaj’s Seed and Plant Research and Certificate Institute an experiment was conducted based on factorial in form of completely randomized design with four replications and in field’s of Islamic Azad University, Varamin Branch were split factorial in form of randomized completely block design with three replications. Treatments included water stress [Irrigation after 50 (Normal irrigation, 100 (Middle stress, 150 (Severe stress mm evaporation from pan class A], Cultivar [Manokin & Williams and SRF×T3 Line] and inoculation [Inoculation with Bradyrhizobium japonicum, Bradyrhizobium japonicum co-inoculated with Azotobacter chroococcum, No seed inoculation]. Results showed that drought stress decreased the uniformity and germination speed and seedling emergence. Bacteria increased leaf dry weight, stem dry weight, leaf area and seedling vigor index but had no effect on emergence. In irrigation levels inoculated treatments had higher seedling length, leaf, stem, seedling dry weight and seedling vigor. Severs stress seeds inoculated with Bradyrhizobium japonicum had higher root dry weight than control. Therefore in seeds which were produced under deficit irrigation conditions, bacteria increased seedlings vigor.
Rodrigues, E V; Daher, R F; Dos Santos, A; Vivas, M; Machado, J C; Gravina, G do A; de Souza, Y P; Vidal, A K; Rocha, A Dos S; Freitas, R S
2017-05-18
Brazil has great potential to produce bioenergy since it is located in a tropical region that receives high incidence of solar energy and presents favorable climatic conditions for such purpose. However, the use of bioenergy in the country is below its productivity potential. The aim of the current study was to select full-sib progenies and families of elephant grass (Pennisetum purpureum S.) to optimize phenotypes relevant to bioenergy production through mixed models (REML/BLUP). The circulating diallel-based crossing of ten elephant grass genotypes was performed. An experimental design using the randomized block methodology, with three repetitions, was set to assess both the hybrids and the parents. Each plot comprised 14-m rows, 1.40 m spacing between rows, and 1.40 m spacing between plants. The number of tillers, plant height, culm diameter, fresh biomass production, dry biomass rate, and the dry biomass production were assessed. Genetic-statistical analyses were performed through mixed models (REML/BLUP). The genetic variance in the assessed families was explained through additive genetic effects and dominance genetic effects; the dominance variance was prevalent. Families such as Capim Cana D'África x Guaçu/I.Z.2, Cameroon x Cuba-115, CPAC x Cuba-115, Cameroon x Guaçu/I.Z.2, and IAC-Campinas x CPAC showed the highest dry biomass production. The family derived from the crossing between Cana D'África and Guaçu/I.Z.2 showed the largest number of potential individuals for traits such as plant height, culm diameter, fresh biomass production, dry biomass production, and dry biomass rate. The individual 5 in the family Cana D'África x Guaçu/I.Z.2, planted in blocks 1 and 2, showed the highest dry biomass production.
Effect of an insecticide on growth and metabolism of some non-target soil micro-organisms
International Nuclear Information System (INIS)
Balasubramanian, A.; Nilakantan, Gita
1975-01-01
Aldicarb, a systemic insecticide, enhanced the growth of Rhizobium japonicum in vitro at 1 ppm concentration but inhibited it at 5 ppm level. The cell yields of Azotobacter chroococcum and Pseudomonas solanacearum were reduced by both the concentrations of the chemical. 1 and 5 ppm levels of the insecticide the incorporation of 14 C-glucose by R. japonicum, but it was stimulated in the case of R. chroococcum. In the case of P. solanacearum, however, 1 ppm level of the insecticide enhanced the incorporation of the label. Uptake of 32 P-di-potassium hydrogen phosphate by the cells was also significantly reduced indicating that the metabolic activities of these non-target soil micro-organisms are altered by the insecticide treatment. (author)
Directory of Open Access Journals (Sweden)
Maria do Carmo de Salvo Spares Novo
1992-01-01
Full Text Available O ensaio foi efetuado durante dois anos consecutivos na Estação Experimental de Ribeirão Preto, em latossolo roxo cultivado com soja IAC-11. O experimento foi em parcelas subdivididas com os tratamentos das parcelas principais dispostos em blocos ao acaso, com quatro repetições, sendo estudados os tratamentos seguintes: linuron, nas doses 1,00 e 2,00 kg/ha; orizalina, nas doses 1,875 e 3,75 kg/ha e duas testemunhas sem herbicidas; nas subparcelas, estudaram-se as épocas de amostragem. As sementes de todas as parcelas tratadas com herbicida e uma das testemunhas foram inoculadas com Bradyrhizobium japonicum estirpe SMS-443 (= 29W. Foi feita a comparação quanto à sensibilidade dos bioensaios usando os métodos de Parker e Santelman. Verificou-se que, para a detecção de orizalina, o método de Parker foi o mais sensível, ocorrendo o inverso para o linuron. Em condições de campo, a perda da atividade da orizalina, nas doses de 1,875 e 3,75 kg/ha, foi lenta, tendo persistido no primeiro ano até 112 dias após a aplicação, enquanto, no segundo ano, as mesmas doses ainda reduziam 50% o crescimento da planta-teste até 84 e 145 dias respectivamente. Neste segundo ensaio, o final da persistência no solo para ambas as doses de orizalina ocorreu aos 390 dias da aplicação. Quanto ao linuron, embora sua fitotoxicidade inicial fosse bastante elevada, no primeiro ano, aos 42 dias, não havia mais sintoma de fitotoxicidade devido a qualquer uma das doses. No segundo ano, na aplicação de 1,00 kg/ha, aos 28 dias, o produto havia-se degradado em nível não detectado pela planta-teste, o que ocorreu para a dose de 2,00 kg/ha somente aos 70 dias.The trial was carried out during two sequential years in Ribeirão Preto Experimental Station, State of São Paulo, Brazil, in a Dusky Red Latosol cultivated with soybean IAC-11. Using a split-plot design; two dosages of linuron (1.00 and 2.00 kg/ha and oryzalin (1.875 and 3.75 kg/ha were compared with
Effects of phosphate solubilizing microorganisms and Rhizobium sp ...
African Journals Online (AJOL)
STORAGESEVER
2009-08-04
Aug 4, 2009 ... nematode Meloidogyne incognita (Kofoid and White). Chitwood and .... Meloidogyne incognita was collected from chickpea field soil identi- fied with the help perineal pattern ..... japonicum on soybean. Phytopathology, 60: ...
Directory of Open Access Journals (Sweden)
Karl Ståhl
2009-01-01
Full Text Available Twenty-five BVDV strains, detected in serum from persistently infected cattle from Peru (n=15 and Chile (n=10 were genetically characterized. The phylogenetic analysis based on the 5' UTR showed that all 25 strains belonged to genotype 1. Twenty-three of the strains could further be subdivided into subtype 1b, and two out of ten Chilean strains into subtype 1a. In conclusion, in total 23 out of 25 strains analyzed were of genotype 1, subtype 1b. This is the predominant BVDV subtype in many countries all over the world, including USA. The close homology with previously described strains reflects the influence of livestock trade on the diversity of BVDV circulating within and between countries and continents. Peru and Chile have imported large numbers of cattle from USA and Europe, mostly with insufficient or lacking health documentation.Um total de 25 isolados do vírus da diarréia viral bovina (BVDV, sendo 15 originarias do Peru e 10 do Chile foram sujeitas a caracterização genética. A árvore filogenética baseada na análise da região proximal não-codificante (5'UTR do genoma viral demonstrou que as 25 estirpes pertencem ao genótipo 1 do vírus BVD. Vinte e três destas estirpes puderam adicionalmente ser subdivididas no subtipo 1b, enquanto duas das 10 estirpes isolados provenientes do Chile foram identificadas como pertencentes ao subtipo 1a. Em conclusão, 23 de um total de 25 isolados analisados pertencem ao genótipo 1, subtipo 1b. Este é o subtipo de BVDV predominante em muitos países do mundo, incluindo os EUA. A elevada similaridade genética com isolados descritos anteriormente em outras regiões do mundo realça o papel do comércio internacional de gado no estabelecimento de diversidade genética do vírus BVD. Tanto o Peru como o Chile têm historia de importação de grandes quantidades de gado dos Estados Unidos e da Europa, no entanto sem suficiente documentação comprovativa do estado sanitário no que concerne a esta
Paradiso, Roberta; Buonomo, Roberta; Dixon, Mike A; Barbieri, Giancarlo; De Pascale, Stefania
2015-01-01
Soybean is traditionally grown in soil, where root symbiosis with Bradyrhizobium japonicum can supply nitrogen (N), by means of bacterial fixation of atmospheric N2. Nitrogen fertilizers inhibit N-fixing bacteria. However, urea is profitably used in soybean cultivation in soil, where urease enzymes of telluric microbes catalyze the hydrolysis to ammonium, which has a lighter inhibitory effect compared to nitrate. Previous researches demonstrated that soybean can be grown hydroponically with recirculating complete nitrate-based nutrient solutions. In Space, urea derived from crew urine could be used as N source, with positive effects in resource procurement and waste recycling. However, whether the plants are able to use urea as the sole source of N and its effect on root symbiosis with B. japonicum is still unclear in hydroponics. We compared the effect of two N sources, nitrate and urea, on plant growth and physiology, and seed yield and quality of soybean grown in closed-loop Nutrient Film Technique (NFT) in growth chamber, with or without inoculation with B. japonicum. Urea limited plant growth and seed yield compared to nitrate by determining nutrient deficiency, due to its low utilization efficiency in the early developmental stages, and reduced nutrients uptake (K, Ca, and Mg) throughout the whole growing cycle. Root inoculation with B. japonicum did not improve plant performance, regardless of the N source. Specifically, nodulation increased under fertigation with urea compared to nitrate, but this effect did not result in higher leaf N content and better biomass and seed production. Urea was not suitable as sole N source for soybean in closed-loop NFT. However, the ability to use urea increased from young to adult plants, suggesting the possibility to apply it during reproductive phase or in combination with nitrate in earlier developmental stages. Root symbiosis did not contribute significantly to N nutrition and did not enhance the plant ability to use
Sun, Le-Ping; Wang, Wei; Zuo, Yin-Ping; Hong, Qing-Biao; Du, Guang-Lin; Ma, Yu-Cai; Wang, Jian; Yang, Guo-Jing; Zhu, Dao-Jian; Liang, You-Sheng
2017-03-14
Although great success has been achieved, schistosomiasis remains a major public health concern in China, and the remaining core endemic regions are concentrated along the middle and lower reaches of the Yangtze River. In this longitudinal study, we evaluated the effectiveness of a multidisciplinary, integrated approach for schistosomiasis elimination in a historically hyper-endemic region in the lower reaches of the Yangtze River, China over the 10-year period from 2005 through 2014. A three-step roadmap for schistosomiasis elimination was designed in the study site, and multidisciplinary, integrated interventions were implemented by the health, agriculture, water resources development, land and resources, and forestry sectors from 2005 to 2014, including chemotherapy for infected individuals, health education, management of the source of Schistosoma japonicum infection, and intermediate host snail control. The annual number of schistosomiasis patients, S. japonicum infection in humans, bovines and Oncomelania hupensis snails, and water infectivity were observed to assess the effectiveness of the multidisciplinary, integrated approach for the elimination of schistosomiasis. There was a tendency towards a gradual decline in both the number of schistosomiasis cases and the prevalence of S. japonicum human infection across the study period from 2005 through 2014. No S. japonicum human infection was detected since 2012, and no acute infection was seen since 2006. During the study period, no infection was found in bovines, and a 0.03% overall infection rate was observed in O. hupensis snails. Since 2009, no infected snails were identified, and the area of both snail habitats and infected snail habitats appeared a reduction over the study period. Following the 3-year multidisciplinary, integrated control, infection control was achieved, and transmission control was achieved after 6-year implementation, with all infected snails and water infectivity eliminated; in
Directory of Open Access Journals (Sweden)
Li Yue-Sheng
2011-03-01
Full Text Available Abstract Background Schistosoma japonicum is a major public health concern in the Peoples' Republic of China (PRC, with over one million people infected and another 50 million living in areas at risk of infection. Based on ecological, environmental, population genetic and molecular factors, schistosomiasis transmission in PRC can be categorised into four discrete ecosystems or transmission modes. It is predicted that the Three Gorges Dam (TGD will impact upon the transmission of schistosomiasis in the PRC, with varying degree across the four transmission modes. We undertook longitudinal surveillance from 2002 to 2006 in sentinel villages both above and below the TGD across five provinces (Hunan, Jiangxi, Hubei, Anhui and Sichuan to determine whether there was any impact of the TGD on schistosomiasis transmission during its construction. Here we present the results from a schistosomiasis-endemic village located above the dam in Sichuan Province. Results Baseline results showed a human S. japonicum prevalence of 42.0% (95% CI: 36.6-47.5. At follow-up, results showed that the incidence of S. japonicum infection in the selected human cohort in Shian decreased by three quarters from 46% in 2003 to 11.3% in 2006. A significant (P S. japonicum infection in bovines declined from 11.8% in the first year to zero in the final year of follow-up. Conclusions The substantial decrease in human (75% and bovine (100% incidence observed in Shian village can probably be attributed to the annual human and bovine PZQ treatment of positives; as seen in drug (PZQ intervention studies in other parts of PRC. If an increase in schistosome transmission had occurred as a result of the TGD, it would be of negligible size compared to the treatment induced decline seen here. It appears therefore that the construction of the TGD had virtually no impact on schistosomiasis transmission in Shian village over the period of study. Furthermore, contrary to previous reports from
Sobre el autor de "Viñetas y otros poemas"
Directory of Open Access Journals (Sweden)
Hector Rojas Herazo
1962-02-01
Full Text Available Cierto escepticismo de fina ley, asociado a una modestia señorial, son los responsables de que el país no conozca, en toda su dimensión, la obra, el espíritu y la significación humana de Donaldo Bossa Herazo. Pertenece él -por disciplina y por temperamento- a una estirpe de poetas eruditos cuyo ejemplo máximo podría ser entre nosotros Guillermo Valencia.
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...
Directory of Open Access Journals (Sweden)
Jairo V Vieira
2010-03-01
Full Text Available Verificou-se a eficiência de duas metodologias de avaliação em nove genótipos de melancia da resistência a três isolados de Papaya ringspot virus, estirpe melancia (PRSV-W, de três regiões brasileiras. O delineamento do experimento foi em blocos casualizados com quatro repetições. Cada parcela foi composta de um vaso com 5 kg de substrato com cinco plantas de melancia por vaso. Aos 10 e 13 dias após a semeadura, três isolados do PRSV-W coletados nos estados de Goiás, Pernambuco e São Paulo, foram inoculados mecanicamente. Aos 27 e 37 dias após a semeadura foram feitas avaliações visuais de sintomas de vírus. A confirmação da presença ou não do vírus nas plantas inoculadas foi feita através do teste sorológico Das-Elisa, utilizando anti-soro policlonal. Foram realizadas análises de variância, estimadas as herdabilidades, calculadas as correlações entre os caracteres, e efetuadas comparações das médias dos genótipos e dos diferentes inóculos. Pelo comportamento diferenciado dos genótipos em relação aos isolados avaliados, conclui-se que isolados provenientes de diferentes regiões devem ser testados nos programas de melhoramento de melancia. Os altos valores de herdabilidade para a maioria dos caracteres indicam que a característica em estudo está sob o controle de poucos loci e que, portanto, a possibilidade de seleção de materiais resistentes é alta. Em geral, os genótipos mostraram um nível de tolerância superior ao da cultivar predominante no mercado brasileiro (Crimson Sweet. Portanto, podem servir de base para a produção de cultivares mais tolerantes ao PRSV-W.The aim of this study was to assess the resistance of nine watermelon genotypes against three PRSV-W isolates originated from three Brazilian States (São Paulo, Goiás and Pernambuco. The experiment was carried out at Embrapa Hortaliças, Brasilia, Brazil, in April 2004. Nine watermelon genotypes were appraised, in a randomizated block
Ana Paula Matoso Teixeira
2004-01-01
A importância da cultura do meloeiro é crescente no Brasil, sobretudo na região Nordeste, tanto pelo volume comercializado como por ser estabelecida geralmente em pequenas propriedades. Diversas enfermidades acometem esta cultura, destacando-se as viroses. Dentre estas, o mosaico, causado pelo Papaya ringspot virus - estirpe melancia (PRSV-W) é das mais importantes. Dentre as estratégias de controle desta doença, o emprego de cultivares resistentes apresenta-se como um método prático e ...
Directory of Open Access Journals (Sweden)
Carlos López Narváez
1961-03-01
Full Text Available A la calidad sustantiva de los polígrafos, -estirpe de los Vergara, Eduardo Posada, Gustavo Arboleda, Otero Muñoz, Samper Ortega, Gómez Restrepo para nombrar solo algunos de los que "nos han precedido con la señal de la fe", como dice el sacro ritual, y en el servicio de las Letras patrias- pertenece con mérito eximio el prócer de la bibliografía colombiana, don Isidoro Laverde Amaya.
Li, Juan; Zhao, Guang-Hui; Lin, RuiQing; Blair, David; Sugiyama, Hiromu; Zhu, Xing-Quan
2015-11-01
Schistosomiasis, caused by blood flukes belonging to several species of the genus Schistosoma, is a serious and widespread parasitic disease. Accurate and rapid differentiation of these etiological agents of animal and human schistosomiasis to species level can be difficult. We report a real-time PCR assay coupled with a high-resolution melt (HRM) assay targeting a portion of the nuclear 18S rDNA to detect, identify, and distinguish between four major blood fluke species (Schistosoma japonicum, Schistosoma mansoni, Schistosoma haematobium, and Schistosoma mekongi). Using this system, the Schistosoma spp. was accurately identified and could also be distinguished from all other trematode species with which they were compared. As little as 10(-5) ng genomic DNA from a Schistosoma sp. could be detected. This process is inexpensive, easy, and can be completed within 3 h. Examination of 21 representative Schistosoma samples from 15 geographical localities in seven endemic countries validated the value of the HRM detection assay and proved its reliability. The melting curves were characterized by peaks of 83.65 °C for S. japonicum and S. mekongi, 85.65 °C for S. mansoni, and 85.85 °C for S. haematobium. The present study developed a real-time PCR coupled with HRM analysis assay for detection and differential identification of S. mansoni, S. haematobium, S. japonicum, and S. mekongi. This method is rapid, sensitive, and inexpensive. It has important implications for epidemiological studies of Schistosoma.
Directory of Open Access Journals (Sweden)
Jessica Ingram
2011-09-01
Full Text Available Skin invasion is the initial step in infection of the human host by schistosome blood flukes. Schistosome larvae have the remarkable ability to overcome the physical and biochemical barriers present in skin in the absence of any mechanical trauma. While a serine peptidase with activity against insoluble elastin appears to be essential for this process in one species of schistosomes, Schistosoma mansoni, it is unknown whether other schistosome species use the same peptidase to facilitate entry into their hosts.Recent genome sequencing projects, together with a number of biochemical studies, identified alternative peptidases that Schistosoma japonicum or Trichobilharzia regenti could use to facilitate migration through skin. In this study, we used comparative proteomic analysis of human skin treated with purified cercarial elastase, the known invasive peptidase of S. mansoni, or S. mansoni cathespin B2, a close homolog of the putative invasive peptidase of S. japonicum, to identify substrates of either peptidase. Select skin proteins were then confirmed as substrates by in vitro digestion assays.This study demonstrates that an S. mansoni ortholog of the candidate invasive peptidase of S. japonicum and T. regenti, cathepsin B2, is capable of efficiently cleaving many of the same host skin substrates as the invasive serine peptidase of S. mansoni, cercarial elastase. At the same time, identification of unique substrates and the broader species specificity of cathepsin B2 suggest that the cercarial elastase gene family amplified as an adaptation of schistosomes to human hosts.
Directory of Open Access Journals (Sweden)
Donald P McManus
2011-08-01
Full Text Available Schistosomiasis is a chronic and debilitating parasitic disease that has often been neglected because it is a disease of poverty, affecting poor rural communities in the developing world. This is not the case in the People's Republic of China (PRC, where the disease, caused by Schistosoma japonicum, has long captured the attention of the Chinese authorities who have, over the past 50-60 years, undertaken remarkably successful control programs that have substantially reduced the schistosomiasis disease burden. The Dongting Lake region in Hunan province is one of the major schistosome-endemic areas in the PRC due to its vast marshland habitats for the Oncomelania snail intermediate hosts of S. japonicum. Along with social, demographic, and other environmental factors, the recent completion and closure of the Three Gorges dam will most likely increase the range of these snail habitats, with the potential for re-emergence of schistosomiasis and increased transmission in Hunan and other schistosome-endemic provinces being a particular concern. In this paper, we review the history and the current status of schistosomiasis control in the Dongting Lake region. We explore the epidemiological factors contributing to S. japonicum transmission there, and summarise some of the key research findings from studies undertaken on schistosomiasis in Hunan province over the past 10 years. The impact of this research on current and future approaches for sustainable integrated control of schistosomiasis in this and other endemic areas in the PRC is emphasised.
Energy Technology Data Exchange (ETDEWEB)
Zhang, Wei, E-mail: zhangwei976@163.com [Department of Radiology, Tongji Hospital, Tongji University, No. 389, Xincun Road, Putuo District, Shanghai 200065 (China); Wang, Pei-Jun, E-mail: peijunwang_tongji@163.com [Department of Radiology, Tongji Hospital, Tongji University, No. 389, Xincun Road, Putuo District, Shanghai 200065 (China); Shen, Xing, E-mail: shenxing1997@163.com [Department of Radiology, Traditional Chinese Hospital, No. 189, Chaoyangxi Road, Kun Shan 215300, Jiangsu Province (China); Wang, Guo-liang, E-mail: glwang1960@163.com [Department of Radiology, Tongji Hospital, Tongji University, No. 389, Xincun Road, Putuo District, Shanghai 200065 (China); Zhao, Xiao-hu, E-mail: tiger1968@163.com [Department of Radiology, Tongji Hospital, Tongji University, No. 389, Xincun Road, Putuo District, Shanghai 200065 (China); Seema, S.F., E-mail: saaaamaaaa@163.com [Department of Radiology, Tongji Hospital, Tongji University, No. 389, Xincun Road, Putuo District, Shanghai 200065 (China); Zheng, Shao-qiang, E-mail: shaoqiangzh@163.com [Department of Radiology, Tongji Hospital, Tongji University, No. 389, Xincun Road, Putuo District, Shanghai 200065 (China); Li, Ming-hua, E-mail: minghuali@163.com [Department of Radiology, Tongji Hospital, Tongji University, No. 389, Xincun Road, Putuo District, Shanghai 200065 (China)
2012-08-15
Objective: To clarify pathological basis of computed tomography (CT) presentations of colorectal cancer (CRC) with schistosomiasis for the purpose of improving the accuracy of CT diagnosis and differential diagnosis of the condition. Materials and methods: 130 patients (87 male and 43 female; age range 49-86 years, mean 71.1) were selected whose diagnoses were pathologically confirmed as CRC with schistosomiasis. All the patients underwent abdominal plain CT and contrast enhanced scanning. The location, morphology, size, calcification features and enhancement modalities (patterns) were evaluated and compared with the pathological findings by two radiologists in a blind way. Results: CT showed that in 130 patients, the tumors occurred in the large intestine, among which 109 (83.9%) were solitary and 21 (16.1%) were multifocal. The intestinal wall was irregularly thickened in 123 patients, with soft tissue masses in 7 patients. Linear, spotty and small patchy calcifications were seen in 104 (80.0%) patients, with unclear margins in 96 patients. The tumors were markedly unevenly enhanced in 92 patients. Pathological examination revealed adenocarcinoma in 114 patients and in 104 patients, calcified Shistosoma japonicum (S. japonicum) ova inside the tumors, 15 patients were mucinous adenocarcinoma, and one patient was that of adenosquamous carcinoma. Conclusion: Irregular thickening of the intestinal wall, soft tissue masses, multiple S. japonicum ova calcifications inside the tumor with obscured margins and multiple intestinal masses in some patients are important CT features of CRC with schistosomiasis.
Evaluation of Anti-tumor and Chemoresistance-lowering Effects of ...
African Journals Online (AJOL)
Evaluation of Anti-tumor and Chemoresistance-lowering Effects of Pectolinarigenin from Cirsium japonicum Fisch ex DC in Breast Cancer. Mingqian Lu, Xinhua Xu, Hongda Lu, Zhongxin Lu, Bingqing Xu, Chao Tan, Kezhi Shi, Rong Guo, Qingzhi Kong ...
Directory of Open Access Journals (Sweden)
Terezinha Maria de PAIVA
2001-12-01
Full Text Available From June to July 1999 an outbreak of acute respiratory illness occurred in the town of Iporanga. Out of a total of 4,837 inhabitants, 324 cases were notified to the Regional Surveillance Service. Influenza virus was isolated from 57.1% of the collected samples and 100% seroconversion to influenza A (H1N1 was obtained in 20 paired sera tested. The isolates were related to the A/Bayern/07/95 strain (H1N1. The percentages of cases notified during the outbreak were 28.4%, 29.0%, 20.7%, 6.2% and 15.7% in the age groups of 0-4, 5-9, 10-14, 15-19 and older than 20 years, respectively. The highest proportion of positives was observed among children younger than 14 years and no cases were notified in people older than 65 years, none of whom had been recently vaccinated against influenza. These findings suggest a significant vaccine protection against A/Bayern/7/95, the H1 component included in the 1997-98 influenza vaccine for elderly people. This viral strain is antigenically and genetically related to A/Beijing/262/95, the H1 component of the 1999 vaccine. Vaccines containing A/Beijing/262/95 (H1N1 stimulated post-immunization hemagglutination inhibition antibodies equivalent in frequency and titre to both A/Beijing/262/95-like and A/Bayern/7/95-like viruses. Thus, this investigation demonstrates the effectiveness of vaccination against influenza virus in the elderly.Durante os meses de junho e julho de 1999, foram notificados 324 casos de doença respiratória aguda no Município de Iporanga-SP. O isolamento do vírus da influenza do tipo A/Bayern/07/95 (H1N1 e a conversão sorológica para a estirpe viral (H1N1 foram de 57,1% e 100%, respectivamente. A porcentagem de casos com diagnóstico clínico notificados durante a epidemia foi de 28,4%, 29,0%, 20,7%, 6,2% e 15,7%, nas faixas etárias de 0-4, 5-9, 10-14, 15-19 anos e indivíduos acima de 20 anos de idade, respectivamente. Observou-se maior incidência da doença entre os indivíduos menores de
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_004463 gi|27380945 >1tjlA 26 141 1 116 7e-32 ... ref|NP_772474.1| dnaK deletion su...ppressor protein [Bradyrhizobium japonicum USDA ... 110] dbj|BAC51099.1| dnaK deletion suppressor pro
You-Sheng, Liang; Yi-An, Wang; Xue-Hui, Shen; Wei, Wang; Guo-Li, Qu; Yun-Tian, Xing; Jian-Rong, Dai
2016-10-18
To quantitatively estimate the range and area of environmental contamination by the feces of Schistosoma japonicum -infected that were freely grazed, so as to provide the theoretical evidence for the scientific assessment of the role of the freely grazed goat in the transmission of schistosomiasis japonica and development of control strategy. All the fecal samples excreted by the infected goat at daytime (12 h) were collected by using a self-made goat fecal collector, weighed and counted. The quantity and dispersal of the feces excreted by the freely grazed goat at daytime under a natural condition were investigated, and the walking route and speed of the freely grazed goat at daytime were recorded with a multifunction GPS data logger. The maximum range and area of the environment contaminated by the feces of the freely grazed goat at daytime were estimated, and the maximum range and area of the Oncomelania hupensis snails that may be infected by the schistosome miracidium released from the eggs in the fecal samples of the freely graze goat at daytime were calculated. During the walking along the marshland at daytime (12 h), the quantity of the feces execrated by the freely grazed infected goat was (232.8 ± 39.8) g per goat, and the fecal samples were composed of (819.2 ± 152.1) pellets. The goat had a mean walking speed of (0.522 7 ± 0.099 7) km/h, and the longest distance, largest radius and largest range of walking activity were (6.272 4 ± 1.195 8) km, 3.136 2 km and (3 191.113 0 ± 1 189.709 4) hm 2 at daytime, respectively. The area of the snails that may be infected by the miracidium released from the eggs in the fecal samples of the freely graze goat (range of key regions for infected snails detection and control) at daytime was estimated to be (3 210.717 5 ± 1 190.907 3) hm 2 . The intensity of environmental contamination by the eggs in the fecal samples of the freely grazed goat is linked to the number of infected goat. The contamination range caused
Directory of Open Access Journals (Sweden)
Browman George P
2010-01-01
Full Text Available Abstract Background Cancer program delivery, like the rest of health care in Canada, faces two ongoing challenges: to coordinate a pan-Canadian approach across complex provincial jurisdictions, and to facilitate the rapid translation of knowledge into clinical practice. Communities of practice, or CoPs, which have been described by Etienne Wenger as a collaborative learning platform, represent a promising solution to these challenges because they rely on bottom-up rather than top-down social structures for integrating knowledge and practice across regions and agencies. The communities of practice model has been realized in the corporate (e.g., Royal Dutch Shell, Xerox, IBM, etc and development (e.g., World Bank sectors, but its application to health care is relatively new. The Canadian Partnership Against Cancer (CPAC is exploring the potential of Wenger's concept in the Canadian health care context. This paper provides an in-depth analysis of Wenger's concept with a focus on its applicability to the health care sector. Discussion Empirical studies and social science theory are used to examine the utility of Wenger's concept. Its value lies in emphasizing learning from peers and through practice in settings where innovation is valued. Yet the communities of practice concept lacks conceptual clarity because Wenger defines it so broadly and sidelines issues of decision making within CoPs. We consider the implications of his broad definition to establishing an informed nomenclature around this specific type of collaborative group. The CoP Project under CPAC and communities of practice in Canadian health care are discussed. Summary The use of communities of practice in Canadian health care has been shown in some instances to facilitate quality improvements, encourage buy in among participants, and generate high levels of satisfaction with clinical leadership and knowledge translation among participating physicians. Despite these individual success
Directory of Open Access Journals (Sweden)
Jorge Bejarano
1941-08-01
Full Text Available El ilustre varón, como todos los de su excelsa estirpe, que en hora trágica para la patria y para la medicina, acaba de perder la vida. Sólo elogios merece el proyecto de ley que sobre seguro social colectivo acaba de presentar a las cámaras el ministerio del trabajo. El brote epidémico del tifo exantemático, que con razón ha tenido tan alarmada a la ciudad nos sugiere dos enseñanzas.
Emilov Mentov, Teodor
2015-01-01
Los seres vivos son producto de la evolución por selección natural1. Durante este proceso han desarrollado adaptaciones que les permiten protegerse de la agresión. Los organismos pluricelulares complejos, tanto animales como plantas, disponen de un sistema de defensa contra patógenos que incluye dos tipos de sistema inmunitario: el sistema inmune innato y el sistema inmune adaptativo. La inmunidad innata incluye defensas de tipo barrera como piel y mucosas, y células de varias estirpes, mielo...
Lee, HyungJune; Kim, HyunSeok; Chang, Ik Joon
2014-01-01
We propose a technique to optimize the energy efficiency of data collection in sensor networks by exploiting a selective data compression. To achieve such an aim, we need to make optimal decisions regarding two aspects: (1) which sensor nodes should execute compression; and (2) which compression algorithm should be used by the selected sensor nodes. We formulate this problem into binary integer programs, which provide an energy-optimal solution under the given latency constraint. Our simulation results show that the optimization algorithm significantly reduces the overall network-wide energy consumption for data collection. In the environment having a stationary sink from stationary sensor nodes, the optimized data collection shows 47% energy savings compared to the state-of-the-art collection protocol (CTP). More importantly, we demonstrate that our optimized data collection provides the best performance in an intermittent network under high interference. In such networks, we found that the selective compression for frequent packet retransmissions saves up to 55% energy compared to the best known protocol. PMID:24721763
Directory of Open Access Journals (Sweden)
Octaviani Octaviani
2017-12-01
Full Text Available ABSTRAK Schistosomiasis merupakan penyakit parasitik yang disebabkan infeksi cacing Schistosoma japonicum, S. haematobium, S. mansoni, S. mekongi, dan S. intercalatum. Penyakit ini ditularkan melalui air tercemar cercaria ke hospes. Di Indonesia, schistosomiasis disebabkan oleh S. japonicum ditemukan endemis di dataran tinggi Lindu, dataran tinggi Napu, dan dataran tinggi Bada. Penyakit schistosomiasis bisa menyerang semua orang termasuk anak-anak. Apabila tidak diberikan pengobatan bisa menjadi kronis. Anak yang terinfeksi akan mengalami gangguan pertumbuhan, gangguan kognitif, bahkan dapat menimbulkan kematian. Secara epidemiologi penularan schistosomiasis tidak terpisahkan dari faktor perilaku atau kebiasaan manusia. Penelitian bertujuan mengidentifikasi hubungan perilaku anak sekolah dasar dengan kejadian schistosomiasis. Penelitian dilakukan di Kecamatan Lindu Kabupaten Sigi Provinsi Sulawesi Tengah, selama 8 bulan mulai bulan Maret sampai Oktober 2014. Penelitian observasional ini menggunakan desain cross sectional. Pengumpulan data dilakukan dengan pengambilan sampel tinja dan wawancara pada anak sekolah. Sampel tinja diperiksa dengan menggunakan metode Kato-Katz. Hasil uji chi-square menunjukkan bahwa tidak ada hubungan antara kebiasaan mandi, kebiasaan buang air besar, kebiasaan ke daerah fokus dan kebiasaan penggunaan sepatu boot dengan kejadian schistosomiasis. Kata kunci: schistosomiasis, perilaku, anak sekolah dasar ABSTRACT Schistosomiasis is a parasitic disease caused by infection of Schistosoma japonicum, S. haematobium, S. mansoni, S. mekongi, and S. intercalatum. It is transmitted to definitive host through cercaria contaminated water. In Indonesia, schistosomiasis was caused by S. japonicum which can be found in endemic areas at Lindu, Napu, and Bada highland. Schistosomiasis can infect all people regardless their age. If untreated, it leads to a chronic condition. Children who are infected will have a growth and cognitive
Murillo, Jesús; Villa, Ana; Chamber, Manuel; Ruiz-Argüeso, Tomás
1989-01-01
Fifty-four strains of Bradyrhizobium sp. (Lupinus) from worldwide collections were screened by a colony hybridization method for the presence of DNA sequences homologous to the structural genes of the Bradyrhizobium japonicum hydrogenase. Twelve strains exhibited strong colony hybridization signals, and subsequent Southern blot hybridization experiments showed that they fell into two different groups on the basis of the pattern of EcoRI fragments containing the homology to the hup probe. All strains in the first group (UPM860, UPM861, and 750) expressed uptake hydrogenase activity in symbiosis with Lupinus albus, Lupinus angustifolius, Lupinus luteus, and Ornithopus compressus, but both the rate of H2 uptake by bacteroids and the relative efficiency of N2 fixation (RE = 1 - [H2 evolved in air/acetylene reduced]) by nodules were markedly affected by the legume host. L. angustifolius was the less permissive host for hydrogenase expression in symbiosis with the three strains (average RE = 0.76), and O. compressus was the more permissive (average RE = 1.0). None of the strains in the second group expressed hydrogenase activity in lupine nodules, and only one exhibited low H2-uptake activity in symbiosis with O. compressus. The inability of these putative Hup+ strains to induce hydrogenase activity in lupine nodules is discussed on the basis of the legume host effect. Among the 42 strains showing no homology to the B. japonicum hup-specific probe in the colony hybridization assay, 10 were examined in symbiosis with L. angustifolius. The average RE for these strains was 0.51. However, one strain, IM43B, exhibited high RE values (higher than 0.80) and high levels of hydrogenase activity in symbiosis with L. angustifolius, L. albus, and L. luteus. In Southern blot hybridization experiments, no homology was detected between the B. japonicum hup-specific DNA probe and total DNA from vegetative cells or bacteroids from strain IM43B even under low stringency hybridization
The rust fungus Gymnosporangium in Korea including two new species, G. monticola and G. unicorne
A survey was conducted of species of the rust fungus Gymnosporangium in Korea. The previously known species were recollected, namely Gymnosporangium asiaticum, G. clavariiforme, G. globosum, G. japonicum, and G. yamadae. Although G. cornutum was reported from Korea, collections similar to that speci...
Directory of Open Access Journals (Sweden)
Sandra Elizabeth Pérez
2011-12-01
Full Text Available O herpesvírus bovino tipo 4 (BoHV-4 é um gama-herpesvírus que foi isolado de animais aparentemente saudáveis e de gado com uma variedade de sinais clínicos. O papel patogênico do BoHV-4 ainda não está claro e não se sabe se o vírus age como um patógeno primário ou se facilita infecções secundárias. Depois de infecções naturais ou experimentais, BoHV-4 pode estabelecer latência, principalmente nas células dos linhagens de monócitos/macrófagos. O vírus latente pode ser reativado após o uso de glicocorticóides ou por fatores de estresse. Em 2007, o BoHV-4 foi isolado pela primeira vez na Argentina, a partir de amostras de abortos bovinos. No presente estudo, utilizou-se o isolamento viral, nested PCR e análise com endonucleases de restrição (REA para investigar a presença de BoHV4 em leucócitos de bovinos provenientes de um único rebanho de gado leiteiro com problemas reprodutivos. Neste trabalho, demonstramos que o genoma do BoHV-4 está presente nos leucócitos em uma elevada proporção (63,4% dos animais, provavelmente em um estado latente ou persistente. BoHV-4 foi isolado de uma de cada onze amostras de leucócitos no sangue periférico (PBL. Por REA nós demonstramos a existência de variações genômicas entre as estirpes circulantes deste rebanho particular. Além disso, todas as amostras de PBL avaliados neste estudo diferiram da estirpe protótipo Americano, DN 599. Em geral, este estudo demonstrou que o BoHV-4 está presente na fração leucocitária do gado leiteiro e que as estirpes virais presentes neste rebanho são geneticamente divergentes. Embora que BoHV-4 foi detectado em um rebanho com história de distúrbios reprodutivos, não é possível concluir que o vírus é o principal responsável por estas condições.
Directory of Open Access Journals (Sweden)
Fábio Bueno dos Reis Junior
2006-03-01
Full Text Available O objetivo deste trabalho foi avaliar a diversidade intra-específica de isolados de Azospirillum amazonense e estabelecer a possível influência de diferentes espécies de Brachiaria ssp. e diferentes condições edafoclimáticas. A caracterização da diversidade desses isolados foi conduzida, utilizando-se a análise de restrição da região intergênica 16S-23S DNAr. As estirpes estudadas separaram-se em dois grupos, definidos a 56% de similaridade. As espécies de Brachiaria ssp. influenciaram a diversidade de estirpes. A maioria dos isolados oriundos de B. decumbens e B. brizantha está inserida no primeiro grupo, enquanto os oriundos de B. humidicola concentram-se no segundo grupo.The aim of this work was to study the intra-specific diversity of Azospirillum amazonense isolates and to establish possible influences of different Brachiaria spp. and edaphoclimatic conditions. The characterization of the diversity among the isolates of A. amazonense studied was conducted using restriction analysis of the 16S-23S rDNA intergenic spacer region. The evaluated strains were separated in two groups, defined at 56% of similarity. Brachiaria spp. showed effects on strain diversity. Most part of the isolates from B. decumbens and B. brizantha are inserted in the first group, while B. humidicola isolates concentrate in the second group.
40 CFR 725.239 - Use of specific microorganisms in activities conducted outside a structure.
2010-07-01
... Bradyrhizobium japonicum. (2) Modification of traits. (i) The introduced genetic material must meet the criteria for poorly mobilizable listed in § 725.421(c). (ii) The introduced genetic material must consist only... sequences needed to move genetic material, including linkers, homopolymers, adaptors, transposons, insertion...
Directory of Open Access Journals (Sweden)
Qiu Chunhui
2012-08-01
Full Text Available Abstract Background Thyroid hormones (TH modulate growth, development and differentiation and metabolic processes by interacting with thyroid hormone receptors (THRs. The purpose of this study was to identify a novel thyroid hormone receptor beta encoding gene of Schistosoma japonicum (SjTHRβ and to investigate its potential as a vaccine candidate antigen against schistosomiasis in BALB/c mice. Methods The full-length cDNA sequence of SjTHRβ, its gene organization, and its transcript levels were characterized, and the phylogenetic relationship between THR, RAR and RXR from other organisms were analysis, the ability of this protein binding to a conserved DNA core motif, and its potential as a vaccine candidate antigen against schistosomiasis in BALB/c mice were evaluated. Results The SjTHRβ cDNA was cloned, verified by 5’ and 3’ Rapid Amplification of cDNA Ends and shown to be polyadenylated at the 3’end, suggesting the transcript is full-length. SjTHRβ is homologous to THRs from other species and has a predicted conservative DNA binding domain and ligand binding domain that normally characterizes these receptors. A comparative quantitative PCR analysis showed that SjTHRβ was the highest expressed in 21d worms and the lowest in 7 d and 13 d schistosomula. The cDNA corresponding to DNA binding domain (SjTHRβ-DBD and ligand binding domain (SjTHRβ-LBD were cloned and subsequently expressed in E coli. The expressed proteins were used to immunize mice and generate specific serum against recombinant SjTHRβ (rSjTHRβ. Western blotting revealed that anti-rSjTHRβ-LBD serum recognized two protein bands in extracts from 21 d worm with molecular sizes of approximately 95 kDa and 72 kDa. Electrophoretic mobility shift assay (EMSA analysis showed that rSjTHRβ-DBD could bind to a conserved DNA core motif. Immunization of BALB/c mice with rSjTHRβ-LBD could induce partial protective efficacy(27.52% worm reduction and 29.50% liver eggs
Marques,Eder; Uesugi,Carlos Hidemi
2013-01-01
Atualmente, a árvore mais plantada no Brasil é o Eucalyptus spp., ocupando 81,6% das florestas plantadas. Sua produtividade em 2009 foi de 44,2 m³ de eucalipto com casca/ha, gerando aproximadamente 46.850 empregos diretos. Estudos de bactérias benéficas, como as Rizobactérias Promotoras de Crescimento de Plantas (RPCPs), vêm sendo desenvolvidos há mais de um século. Este trabalho objetivou avaliar estirpes de bactérias extremófilas facultativas que possuam potencial na promoção de crescimento...
Eder Marques; Carlos Hidemi Uesugi
2013-01-01
Atualmente, a árvore mais plantada no Brasil é o Eucalyptus spp., ocupando 81,6% das florestas plantadas. Sua produtividade em 2009 foi de 44,2 m3 de eucalipto com casca/ha, gerando aproximadamente 46.850 empregos diretos. Estudos de bactérias benéficas, como as Rizobactérias Promotoras de Crescimento de Plantas (RPCPs), vêm sendo desenvolvidos há mais de um século. Este trabalho objetivou avaliar estirpes de bactérias extremófilas facultativas que possuam potencial na promoção de crescimento...
Dos novelas colombianas olvidadas
Directory of Open Access Journals (Sweden)
Eduardo García Piedrahita
1980-06-01
Full Text Available Estas dos novelas olvidadas llevan por títulos Pax de don Lorenzo Marroquín (pr. edi. 1907, y Diana Cazadora de don Clímaco Soto Borda(pr. edi. 1917, ambos bogotanos aunque de disímiles estirpes literarias; y como tales en sus obras fluyen física y verbalmente, el ambiente de su ciudad natal; espíritu hecho de zumbona crítica, individualismo cáustico y solapada parodia de usos y costumbres. Y sobre tales bases sentimentales y estilísticas debe considerárselas.
Carrero Castillo, Yenddy Nayghit
2012-01-01
En nuestro trabajo de investigación sobre el patrón de infiltración leucocitaria de epitelio y estroma uterino y de la expresión tisular de quimioquinas, factor de crecimiento endotelial vascular y metabolitos oxidativos en pacientes con displasia epitelial, con cervicitis sin alteración displásica y controles sanos se concluye que: La progresión en el grado de displasia epitelial se asocia a una mayor y selectiva infiltración de linfocitos sin modificaciones en la estirpe monicitaria y la re...
Tumores del músculo liso del tracto digestivo
Tejada, Antonio; Capitan-Morales, Luis-Cristobal; Suelves, C.; Linares, E.; Rivera Hueto, F.; Fernández, F.; Méndez, J.; Jiménez-García, Antonio; Ortega, J.; Cantillana, J.
2000-01-01
Propósito: Los tumores de estirpe muscular son raros en el tracto esofágico y gastrointestinal. En este trabajo presentamos nuestra experiencia reciente en su manejo. Material y métodos: Hemos incluido en estudio los pacientes tratados de estas neoplasias en el Servicio de Cirugía General y Digestiva del Hospital Virgen Macarena de Sevilla (Prof. Cantillana Martínez) desde 1991 a 1996, analizando la clínica, los métodos diagnósticos empleados y la terapéutica utilizada. Resul...
Trillos Amaya, María
1992-01-01
En un principio fue Abukabusankua, la MADRE UNIVERSAL. Ella existe desde antes de la llegada de los hermanitos menores. Abukabusankua tuvo muchos hijos y pobló estas tierras. Sus hijos se fueron diseminando como la mata de ahuyama: su estirpe se regó sobre nuestro universo. Con el paso del tiempo fundaron muchos pueblos. Cada uno de ellos tenía una forma distinta de mirar el mundo y sus concepciones sobre la vida, el hombre, la mujer y la naturaleza eran diversas. Cada grupo fue libre para cr...
Potencialidad Celular Evolutiva y Medicina Regenerativa
Rojas, Mariana; Meruane, Manuel
2012-01-01
Las células derivadas del embrioblasto o macizo celular interno (MCI) del blastocisto corresponden a las células madres embrionarias, ellas son pluripotentes, debido a que tienen la capacidad de generar todas las estirpes celulares y al resto, se les conoce como células madres adultas porque tienen un potencial de diferenciación mucho más restringido. Dentro de las células adultas podemos reconocer las células madre hematopoyéticas de la médula ósea y las células madres mesenquimales presente...
Netto, Gabriel Gama
2012-01-01
Este trabalho objetivou avaliar o efeito da multiplicação de uma estirpe psicrotrófica proteolítica de Pseudomonas fluorescens nas temperaturas de 4, 7 e 10 ºC, estabelecidas pela Instrução Normativa 62 do MAPA, nas características físicoquímicas e proteólise do leite microfiltrado. Amostras leite desnatado e pasteurizado foram inoculadas com a cepa Pseudomonas fluorescens 041 em uma concentração de aproximadamente 104 UFC mL-1 e incubadas nas três temperaturas por 48 h e, posteriormente, ...
incidência em Portugal, métodos de diagnóstico e de controlo
Silva, Inês Madail Marques e
2016-01-01
As Infeções Nosocomiais são um grave problema de saúde a nível mundial, produzindo endemias e epidemias. O elevado consumo de antibióticos e a transmissão microbiana das resistências nos hospitais são as principais causas do seu aparecimento, sobretudo em Unidades de Cuidados Intensivos. A transmissão de resistências nos hospitais tem levado ao aparecimento de estirpes bacterianas multirresistentes cujo tratamento é dificultado pela falta de recursos terapêuticos, o que resulta em aumento dos...
Proximity effects of high voltage electric power transmission lines on ...
African Journals Online (AJOL)
The proximity effects of high voltage electric power transmission lines on Leyland Cypress (xCupressocyparis leylandii (Dallim. and A.B. Jacks.) Dallim) and Japanese Privet (Ligustrum japonicum Thunb.) growth were examined in a private nursery located in Sakarya, Turkey. Five transect were randomly chosen in both ...
CONDITIONING MICROBIAL PRODUCTS CONTAINING NITROGEN FIXING BACTERIA WITH DIFFERENT SOLID EXCIPIENTS
Directory of Open Access Journals (Sweden)
VINTILĂ T.
2007-01-01
Full Text Available The stability in real time of two strains of Rhizobium (Rhizobium meliloti andRhizobium japonicum mixed with different excipients was evaluated during a6-months period. The excipients studied were: peat, peat and calciumcarbonate, zeolite, and ceramic. Liquid cultures and excipients mixtures weredried (12-14% humidity, sealed in plastic bags and preserved at +4oC. Thecells were activated periodically by suspending aliquots from dry products in0.9% saline solution. The viability of Rhizobium cells was evaluated bycultivation of diluted suspensions in YMA plates. The number of viable cells isdecreasing during drying in all cases, increase in the first month of storage,and remains constant or decrease very slowly during storage for all obtaineddry products containing rhizobia mixed with solid dry excipients. The highestnumber of viable cells at the end of the experiment was obtained in ceramicwith Rhizobium japonicum (8x105 cells/gram, and the lowest number ofviable cells was obtained in zeolite with Rhizobium meliloti (1,1x103cells/gram.
Directory of Open Access Journals (Sweden)
M.R. Barros
2009-08-01
Full Text Available Inglúvios e cecos de reprodutoras comerciais de frangos de corte foram utilizados para o isolamento de Lactobacillus spp. As estirpes isoladas foram caracterizadas como Gram-positivo, catalase negativo, produtoras de gás em glicose, não produtoras de H2S em triple sugar iron e identificadas pela reação em cadeia da polimerase como Lactobacillus reuteri e Lactobacillus salivarius. A utilização da técnica spot-on-the-lawn para avaliação da inibição in vitro permitiu a análise de vários microrganismos simultaneamente. Todas as estirpes isoladas inibiram in vitro S. Enteritidis fagotipo 4, S. Enteritidis fagotipo 28, S. Typhimurium, S. Pullorum, S. Agona, S. Anatum, S. Dublin e S. Senftenberg.Crops and ceca of commercial broiler breeders were used for the isolation of Lactobacillus spp. The isolated samples were characterized by Gram positive staining, negative catalase test, production of gas from glucose, negative for H2S production from triple sugar iron, and were identified by the polymerase chain reaction as Lactobacillus reuteri and Lactobacillus salivarius. The use of the spot-on-the-lawn technique, with modifications, for the evaluation of the in vitro inhibition made it possible the simultaneous analysis of several microrganisms. All the crop and ceca isolated microorganisms presented an in vitro inhibitory effect against strains of Salmonella Enteritidis fagotype 4, S. Enteritidis fagotype 28, S. Typhimurium, S. Pullorum, S. Agona, S. Anatum, S. Dublin, and S. Senftenberg.
CPAC moisture study: Phase 1 report on the study of optical spectra calibration for moisture
International Nuclear Information System (INIS)
Veltkamp, D.
1993-01-01
This report discusses work done to investigate the feasibility of using optical spectroscopic methods, combined with multivariate Partial Least Squares (PLS) calibration modeling, to quantitatively predict the moisture content of the crust material in Hanford's waste tank materials. Experiments were conducted with BY-104 simulant material for the 400--1100 nm (VIS), 1100--2500 (NIR), and 400-4000 cm -1 (IR) optical regions. The test data indicated that the NIR optical region, with a single PLS calibration factor, provided the highest accuracy response (better than 0.5 wt %) over a 0--25 wt % moisture range. Issues relating to the preparation of moisture samples with the BY-104 materials and the potential implementation within hot cell and waste tanks are also discussed. The investigation of potential material interferences, including physical and chemical properties, and the scaled demonstration of fiber optic and camera types of applications with simulated waste tanks are outlined as future work tasks
Lifescience Database Archive (English)
Full Text Available s producing significant alignments: (bits) Value AF325215_2( AF325215 |pid:none) Lymphocytic choriomeningitis...5090 |pid:none) Schistosoma japonicum SJCHGC03255 ... 36 2.8 EU480452_2( EU480452 |pid:none) Lymphocytic choriomeningitis...325214_2( AF325214 |pid:none) Lymphocytic choriomeningitis virus... 35 8.2 BX2941
Juan, Xie; Li-Yong, Wen
2016-03-07
Oncomelania hupensis is the only intermediate host of Schistosoma japonicum , and the growth, reproduction and distribution of O.hupensis play an important role in schistosomiasis prevalence and transmission. This article reviews the influence of the new trend of ecological environment changes on the growth, reproduction and diffusion of the snails.
Gomes, Fábia Araújo
2011-01-01
As bactérias patogénicas presentes nos sistemas de processamento de alimentos podem ser potencialmente causadoras de doenças alimentares graves, quando sobrevivem à acção bactericida de desinfectantes. Esta acção depende da eficácia das substâncias activas que fazem parte da formulação do desinfectante e das condições ambientais onde se processa a interacção desinfectante – bactéria, sendo ainda específica para cada estirpe bacteriana. Este trabalho teve, como propósito, a implementação ...
Desenvolvimento de membranas compósitas à base de nanocelulose para pilhas de combustível
Martins, Ana Patrícia Carvalho
2016-01-01
A presente dissertação tem como objetivo o desenvolvimento de membranas polieletrólitas baseadas em celulose bacteriana (CB) para aplicação em pilhas de combustível de condução protónica, que se espera ser uma solução ambientalmente sustentável. A CB é um material celulósico, com uma estrutura nanofibrilar tridimensional, biossintetizada por algumas estirpes de bactérias não patogénicas como é o caso da Gluconacetobacter sacchari. Devido a algumas das suas propriedades, nomeadamente a sua ele...
Luiz Carlos Ribeiro Neduziak
2012-01-01
Esta dissertação tem por objetivo analisar o processo de integração e cooperação econômica no Mercado Comum do Sul (MERCOSUL). Constatando-se não haver no horizonte próximo uma perspectiva de reforma da arquitetura financeira internacional, será analisado o papel que as instituições internacionais podem desempenhar em empresas dessa estirpe. Para tanto, do ponto de vista da Teoria Econômica, será utilizada a Teoria das Áreas Monetárias Ótimas (TAMO) e seus corolários desenvolvidos posteriorme...
Bacterial Community Associated with Fish and Water from Congonhas River, Sertaneja, Paraná, Brazil
Directory of Open Access Journals (Sweden)
José Américo de Sousa
2001-12-01
Full Text Available A bacteriological study was conducted on fish and water from Congonhas River, Sertaneja (22º58’ S; 50º58’ W, Paraná State, Brazil. From 44% of the analysed fish, bacteria belonging to Pseudomonas, Acinetobacter, Aeromonas, Enterobacteriaceae, Micrococcus, Bacillus and Lactobacillus were isolated. The group most frequently isolated from fish was Aeromonas. In the water, the bacterial groups detected were Pseudomonas, Acinetobacter, Aeromonas, Enterobacteriaceae, Bacillus and Flavobacterium, from which Flavobacterium and Acinetobacter were the most abundant. The numbers of Colony Forming Units per millilitre of water varied from 3.1x10² to 1.0 x 10³. Although a clear pattern was not detected in the susceptibilities/resistances of the isolated strains to nine antimicrobial substances, Gram negative aerobic bacteria were more resistant than the other strains. A simultaneous resistance to furazolidone, oxolinic acid and norfloxacin, particularly in the bacteria isolated from fish, as well as in the aerobic strains isolated from water was observed. The antimicrobial substances to which less resistances were found were oxytetracycline in the strains isolated from water, and trimethoprim-sulphamethoxazole, oxytetracycline and chloramphenicol in those isolated from fish.Foi realizado um estudo da comunidade bacteriana de peixes e da água do rio Congonhas, próximo à sua foz no rio Tibagi, município de Sertaneja, Paraná, Brasil. De 44% dos peixes analisados, foram isoladas estirpes de Pseudomonas, Acinetobacter, Aeromonas, Enterobacteriaceae, Micrococcus, Bacillus e Lactobacillus. Destas, a mais abundante foi Aeromonas. Na água do rio Congonhas foram detectados os grupos Pseudomonas, Acinetobacter, Aeromonas, Enterobacteriaceae, Bacillus e Flavobacterium, dos quais os predominantes foram Flavobacterium e Acinetobacter. Os números de unidades formadoras de colônias por mililitro de água variaram entre 3,1x10² e 1,0x10³. Embora não tenha
Directory of Open Access Journals (Sweden)
Maria do Carmo S. S. Novo
1996-01-01
Full Text Available Durante 2 anos consecutivos, foi realizado um experimento na Estação Experimental de Ribeirão Preto, SP, do Instituto Agronômico, em um Latossolo roxo de textura argilosa, cultivado com soja [Glycine max (L. Merrill] cultivar IAC-11. O objetivo do trabalho foi estudar o efeito da inoculação de sementes e de doses de linuron (1,00 e 2,00 kg/ha e de oryzalin (1,875 e 3,75 kg/ha, aplicados em pré-emergência, no crescimento da planta, na fixação simbiótica do nitrogênio e na produtividade de grãos de soja. Além dos tratamentos com herbicidas, foram mantidos dois controles, sendo um não inoculado e outro inoculado com a estirpe de Bradyrhizobium japonicum SMS-463(=29W. Os tratamentos com herbicidas foram todos inoculados. O delineamento experimental empregado foi em parcelas subdivididas com quatro repetições dispostas em blocos ao acaso. Foram realizadas amostragens aos 28, 42, 56, 70, 84 e 98 dias após a semeadura (DAS no primeiro ano, e aos 28, 42, 56, 70, 84 e 105 DAS no segundo ano. Nos 2 anos avaliou-se o peso de matéria seca de raiz, parte aérea e nódulos, número de nódulos e produtividade de grãos; e no segundo, também a atividade da nitrogenase dos nódulos. De modo geral, não houve efeito benéfico da inoculação de sementes no crescimento e na nodulação de plantas de soja. Somente a atividade da nitrogenase foi beneficiada pela inoculação. Houve maior efeito na aplicação dos herbicidas no primeiro ano. O crescimento da planta foi favorecido pela aplicação de herbicidas. A atividade da nitrogenase foi reduzida pela aplicação dos herbicidas, sendo as doses maiores mais prejudiciais. Oryzalin afetou mais a atividade da nitrogenase que linuron. Apesar de ter havido efeito dos diferentes tratamentos nos parâmetros estudados estes não alteraram o rendimento de grãos.Field investigation was conducted in 1986 and 1987 at Ribeirão Preto, SP, Brazil, to determine the effect of linuron (1.00 and 2.00 kg/ha and
Directory of Open Access Journals (Sweden)
Darren J Gray
Full Text Available Schistosoma japonicum is a major public health concern in the Peoples' Republic of China (PRC, with about 800,000 people infected and another 50 million living in areas at risk of infection. Based on ecological, environmental, population genetic and molecular factors, schistosomiasis transmission in PRC can be categorised into four discrete ecosystems or transmission modes. It is predicted that, long-term, the Three Gorges Dam (TGD will impact upon the transmission of schistosomiasis in the PRC, with varying degree across the four transmission modes.We undertook longitudinal surveillance from 2002 to 2006 in sentinel villages of the three transmission modes below the TGD across four provinces (Hunan, Jiangxi, Hubei and Anhui to determine whether there was any immediate impact of the TGD on schistosomiasis transmission. Eight sentinel villages were selected to represent both province and transmission mode. The primary end point measured was human incidence. Here we present the results of this five-year longitudinal cohort study. Results showed that the incidence of human S. japonicum infection declined considerably within individual villages and overall mode over the course of the study. This is also reflected in the yearly odds ratios (adjusted for infection risk that showed significant (P<0.01 downward trends in all modes over the follow-up period.The decrease in human S. japonicum incidence observed across all transmission modes in this study can probably be attributed to the annual human and bovine PZQ chemotherapy. If an increase in schistosome transmission had occurred as a result of the TGD, it would be of negligible size compared to the treatment induced decline seen here. It appears therefore that there has been virtually no immediate impact of the TGD on schistosomiasis transmission downstream of the dam.
Soil microbes and successful invasions of an exotic weed Eupatorium adenophorum
International Nuclear Information System (INIS)
Zhou, P.; Tang, T.; Zhao, P.; Chen, J.
2016-01-01
The effects of soil microbes collected from the two invasive species Eupatorium adenophorum and E. odoratum and the two native species E. japonicum and E. chinense on the growth and biomass of E. adenophorum was examined to explore a possible link between soil microbes and successful invasions of the weed species E. adenophorum. In most cases, plant height, stem diameter, root number and root length were significantly enhanced when E. adenophorum was grown in sterilized soils compared with those when one was grown in non-sterilized soils collected from the rhizosphere of E. adenophorum, E. japonicum and E. chinense. In contrast, the growth and biomass of E. adenophorum were apparently inhibited when grown in soils collected from the rhizosphere of E. odoratum. Plant height, stem diameter, leaf area per plant and root length of E. adenophorum was greater when it was grown in soils collected from the rhizosphere of E. adenophorum compared with those when it was grown in soils collected from the rhizosphere of E. odoratum, but the enhancement considerably greater when it was grown in soils collected from the rhizosphere of E. japonicum and E. chinense compared with those when it was grown in soils collected from the rhizosphere of E. adenophorum. In addition, the biomass allocation of E. adenophorum was not significantly affected by soil microbes and soil sources. These Results suggest that although the competitive advantage of the invasive weed E. adenophorum is not achieved solely by soil microbes, successful invasions of E. adenophorum may result partly from its release from the harmful soil microbes in its native range and the positive feedbacks of soil microbes from itself and the native species in its invading range. (author)
History of wheat cultivars released by Embrapa in forty years of research
Directory of Open Access Journals (Sweden)
Eduardo Caierão
2014-11-01
Full Text Available In forty years of genetic breeding of wheat, Embrapa (Brazilian Agricultural Research Corporation has developed over a hundred new cultivars for different regions of Brazil. Information regarding identification of these cultivars is often requested from Embrapa breeders. Data on year of release, name of pre-commercial line, the cross made, and the company unit responsible for indication of the cultivar are not always easily accessible and are often scattered throughout different documents. The aim of this study was to conduct a historical survey of all the wheat cultivars released by Embrapa, aggregating the information in a single document. Since 1974, Embrapa has released 112 wheat cultivars, including 12 by Embrapa Soybean - CNPSo (Londrina, PR, 14 by Embrapa Cerrado - CPAC (Brasília, DF, 9 by Embrapa Agropecuária Oeste - CPAO (Dourados, MS, and 77 by Embrapa Wheat - CNPT (Passo Fundo, RS.
Shi, Yuanyuan; Qiu, Juan; Li, Rendong; Shen, Qiang; Huang, Duan
2017-08-30
Schistosomiasis japonica is an infectious disease caused by Schistosoma japonicum , and it remains endemic in China. Flooding is the main hazard factor, as it causes the spread of Oncomelania hupensis , the only intermediate host of Schistosoma japonicum , thereby triggering schistosomiasis outbreaks. Based on multi-source real-time remote sensing data, we used remote sensing (RS) technology, especially synthetic aperture radar (SAR), and geographic information system (GIS) techniques to carry out warning research on potential snail habitats within the snail dispersal range following flooding. Our research result demonstrated: (1) SAR data from Sentinel-1A before and during a flood were used to identify submerged areas rapidly and effectively; (2) the likelihood of snail survival was positively correlated with the clay proportion, core area standard deviation, and ditch length but negatively correlated with the wetness index, NDVI (normalized difference vegetation index), elevation, woodland area, and construction land area; (3) the snail habitats were most abundant near rivers and ditches in paddy fields; (4) the rivers and paddy irrigation ditches in the submerged areas must be the focused of mitigation efforts following future floods.
CONDITIONING MICROBIAL PRODUCTS CONTAINING NITROGEN FIXING BACTERIA WITH DIFFERENT SOLID EXCIPIENTS
Directory of Open Access Journals (Sweden)
DANIELA VINTILĂ
2007-05-01
Full Text Available The stability in real time of two strains of Rhizobium (Rhizobium meliloti and Rhizobium japonicum mixed with different excipients was evaluated during a 6- months period. The excipients studied were: peat, peat and calcium carbonate, zeolite, and ceramic. Liquid cultures and excipients mixtures were dried (12-14% humidity, sealed in plastic bags and preserved at +4oC. The cells were activated periodically by suspending aliquots from dry products in 0.9% saline solution. The viability of Rhizobium cells was evaluated by cultivation of diluted suspensions in YMA plates. The number of viable cells is decreasing during drying in all cases, increase in the first month of storage, and remains constant or decrease very slowly during storage for all obtained dry products containing rhizobia mixed with solid dry excipients. The highest number of viable cells at the end of the experiment was obtained in ceramic with Rhizobium japonicum (8x105 cells/gram, and the lowest number of viable cells was obtained in zeolite with Rhizobium meliloti (1,1x103 cells/gram.
Directory of Open Access Journals (Sweden)
Yi Hu
2015-11-01
Full Text Available Helminth infections are believed to be common in tropical and subtropical countries. A cross-sectional study was carried out in two villages located in Guichi District in Anhui Province, the People’s Republic of China, where multiparasitism was investigated using parasitological tests. The data collected were fitted to Bayesian multi-level models to profile risk factors for helminth infections. The prevalence of Schistosoma (S. japonicum, Ascaris (A. lumbricoides and Trichuris (T. trichiura were 0.43% (range: 0-0.87% at the village level, 2.28% (range: 1.69-2.88%, and 0.21% (range: 0-0.42%, respectively. No hookworm infection was found. With regard to multiparasitism, only a 33-year-old female was found to be co-infected with S. japonicum and A. lumbricoides. Multiparasitism was unexpectedly rare in the study area, which contrasts with results from other studies carried out elsewhere in the country. The long-term usage of albendazole for individuals serologically positive for schistosomiasis may be the main reason, but this needs to be confirmed by future studies.
Deng, Chen; Li-Yong, Wen
2017-10-24
As the only intermediate host of Schistosoma japonicum, Oncomelania hupensis in China is mainly distributed in the Yangtze River Basin. The origin of the O. hupensis and the spatio-temporal variations of its distribution and diffusion in the Yangtze River Basin and the influencing factors, as well as significances in schistosomiasis elimination in China are reviewed in this paper.
2009-09-11
Road construction and maintenance activities have introduced and spread cogon grass (Imperata cylindrical) and torpedo grass (Panicum repens) to...Chinese tallow, or popcorn tree (Triadica sebifera), cogon grass , Japanese climbing fern (Lygodium japonicum), Chinese privet/hedge (Ligustrum sinense...stormwater wetlands, wildlife habitat swales, grassed filter strips) Runoff pretreatment practices (e.g., catch basins, in-line storage, manufactured
Los señoríos de los Manrique en la Baja Edad Media
Directory of Open Access Journals (Sweden)
Rosa María Montero Tejada
1994-01-01
Full Text Available El presente trabajo pretende hacer una descripción de los principales señoríos de los Manrique en el siglo XV, aunque sin entrar en un análisis profundo, pues carecemos de la documentación adecuada para tal fin. Los Manrique, como es bien sabido, fueron uno de los linajes de más destacado protagonismo político y social del siglo XV castellano. Presumían de la antigüedad de su estirpe, hacían gala y ostentación pública de ello entre sus iguales —incluso parece que gozaron del reconocimiento de sus contemporáneos—, y fueron testigo y parte de los principales acontecimientos de su época. La lenta pero firme ascensión política que había iniciado el linaje desde mediados del siglo XIV le había permitido consolidar las antiguas posesiones solariegas de la familia, y al mismo tiempo adquirir nuevos señoríos gracias a las sustanciosas donaciones regias, especialmente de Enrique II y Juan I. La debilidad biológica del linaje, que a lo largo del siglo XIV fue víctima de la prematura mortalidad y de la escasa fertilidad de sus miembros, desapareció con el nacimiento de la nueva centuria, y la estirpe creció vertiginosamente dando lugar a la aparición de diversas ramas familiares que tuvieron primero como base económica primordial los bienes heredados de sus padres y antecesores, y después sus propias adquisiciones señoriales, como iremos viendo en las próximas páginas.
Directory of Open Access Journals (Sweden)
Antonio Carlos da Silva
2001-04-01
Full Text Available Estudou-se a competência vetorial de Lutzomyia intermedia (Diptera: Psychodidae do Vale do Ribeira (SP para estirpes de Leishmania (Viannia braziliensis (Kinetoplastida: Trypanosomatidae, mediante pesquisa de infectividade natural; exposições de fêmeas silvestres e colonizadas (F1 às lesões de hamsters experimentalmente infectados e testes de transmissão via picada. A infectividade natural e os testes de transmissão revelaram-se negativos e, nas exposições, foram obtidas positividades de 74% (123+/166 dissecados e 70% (115+/164 dissecados para fêmeas silvestres e colonizadas respectivamente, e o desenvolvimento das formas evolutivas compatíveis com o modelo Peripilaria. A suscetibilidade às estirpes testadas associada aos indicadores epidemiológicos concorrem para a suspeita do papel vetorial de Lutzomyia intermedia na região estudada.This paper investigated the vectorial competence of Lutzomyia intermedia (Diptera: Psychodidae in Vale do Ribeira (SP to strains of Leishmania (Viannia braziliensis (Kinetoplastida: Trypanosomatidae, by means of a search for natural infection; exposure of wild and colonized females (F1 to the lesions of experimentally infected hamsters and transmission tests by bite. The natural infection and the transmission tests were negative. In the exposures of Lu. intermedia to infected lesions we found rates of 74% (123+/166 dissected and 70% (115+/164 dissected for the wild and colonized females respectively. The development of the parasites was compatible with the development model of Peripilaria. The susceptibility of the tested strains associated with the epidemiological indicators contribute to the vectorial role suspicion of Lutzomyia intermedia in the studied region.
International Nuclear Information System (INIS)
Jones, P.L.
1994-01-01
This report discusses work done to investigate the feasibility of using non-contact optical absorption to remotely sense the surface moisture content of salt cake materials. Optical measurements were made in a dimensionally scaled setup to investigate this technique for in-situ waste tank applications. Moisture measurements were obtained from BY-104 simulant samples with 0 wt%, 10 wt%, and 20 wt% moisture content using the back-scattered light from a pulsed infrared optical parametric converter (OPC) laser source operating from 1.51 to 2.12 micron. An InGaAs detector, with 0.038 steradian solid angle (hemisphere = 6.28 steradians) collection angle was used to detect the back-scattered light. This work indicated that there was sufficient back-scatter from the BY-104 material to provide an indication of the surface moisture content
International Nuclear Information System (INIS)
Vojinovic, Z.; Milicic, B.; Radak, B.
1983-01-01
In the present work the first Yugoslav experiments on the application of gamma radiation for the sterilization of peat in the production of inoculants for soya bean production are summarised and briefly discussed. A radiation dose of 50 kGy was used. The growth and survival of the soya bean nodule bacteria, Rhizobium japonicum, in the sterilized peat is shown. (U.K.)
Schistosoma mansoni c-AMP-dependent Protein Kinase (PKA): A Potential New Drug Target
2009-12-07
subunits from other eukaryotic organisms (Aplysia californica, S. japonicum, Caenorhabditis 143 elegans Mus musculus, Onchocerca volvulus , and Homo...Caenorhabditis elegans PKA-R (J05220); OvR, Onchocerca volvulus PKA-R (AY159364). 156 157 Figure 19: RNAi of Sm04765 in...PKA cancer chemotherapeutics [12]. Interestingly, the PKA-R subunit homologue in Onchocerca volvulus , causative agent of river blindness, is being
Engineering Prototype for a Compact Medical Dielectric Wall Accelerator
Energy Technology Data Exchange (ETDEWEB)
Zografos, Anthony; Hening, Andy; Joshkin, Vladimir; Leung, Kevin; Pearson, Dave; Pearce-Percy, Henry; Rougieri, Mario; Parker, Yoko; Weir, John [CPAC, Livermore, CA (United States); Blackfield, Donald; Chen, Yu-Jiuan; Falabella, Steven; Guethlein, Gary; Poole, Brian [Lawrence Livermore National Laboratory, Livermore, CA (United States); Hamm, Robert W. [R and M Technical Enterprises, Pleasanton, CA (United States); Becker, Reinard [Scientific Software Service, Gelnhausen (Germany)
2011-12-13
A compact accelerator system architecture based on the dielectric wall accelerator (DWA) for medical proton beam therapy has been developed by the Compact Particle Acceleration Corporation (CPAC). The major subsystems are a Radio Frequency Quadrupole (RFQ) injector linac, a pulsed kicker to select the desired proton bunches, and a DWA linear accelerator incorporating a high gradient insulator (HGI) with stacked Blumleins to produce the required acceleration energy. The Blumleins are switched with solid state laser-driven optical switches integrated into the Blumlein assemblies. Other subsystems include a high power pulsed laser, fiber optic distribution system, electrical charging system, and beam diagnostics. An engineering prototype has been constructed and characterized, and these results will be used within the next three years to develop an extremely compact 150 MeV system capable of modulating energy, beam current, and spot size on a shot-to-shot basis. This paper presents the details the engineering prototype, experimental results, and commercialization plans.
Engineering Prototype for a Compact Medical Dielectric Wall Accelerator
International Nuclear Information System (INIS)
Zografos, Anthony; Hening, Andy; Joshkin, Vladimir; Leung, Kevin; Pearson, Dave; Pearce-Percy, Henry; Rougieri, Mario; Parker, Yoko; Weir, John; Blackfield, Donald; Chen, Yu-Jiuan; Falabella, Steven; Guethlein, Gary; Poole, Brian; Hamm, Robert W.; Becker, Reinard
2011-01-01
A compact accelerator system architecture based on the dielectric wall accelerator (DWA) for medical proton beam therapy has been developed by the Compact Particle Acceleration Corporation (CPAC). The major subsystems are a Radio Frequency Quadrupole (RFQ) injector linac, a pulsed kicker to select the desired proton bunches, and a DWA linear accelerator incorporating a high gradient insulator (HGI) with stacked Blumleins to produce the required acceleration energy. The Blumleins are switched with solid state laser-driven optical switches integrated into the Blumlein assemblies. Other subsystems include a high power pulsed laser, fiber optic distribution system, electrical charging system, and beam diagnostics. An engineering prototype has been constructed and characterized, and these results will be used within the next three years to develop an extremely compact 150 MeV system capable of modulating energy, beam current, and spot size on a shot-to-shot basis. This paper presents the details the engineering prototype, experimental results, and commercialization plans.
Directory of Open Access Journals (Sweden)
Dick Auld
2012-10-01
Full Text Available In this study, we developed a bioassay to quantify the ricin toxin content of castor bean seeds. Existing quantification methods do not always reflect actual toxicity of the seeds analyzed, which may present lower ricin content even though they are more toxic than seeds presenting a higher content of ricin. This is because these methods actually measure the addition of ricin RCA, which is a compound less toxic than pure ricin. We decided to use in this study, the nematode Caenorhabditis elegans, which has been widely used by the pharmaceutical industry. We tested two strains of C. elegans using different methods in 8 experiments. We examined 4 methods of extracting the ricin complex and 3 methods of exposing the nematodes. Among the nematode strains and ricin extraction methods tested, we concluded that the best strain for testing ricin toxicity was the strain called N2 and that the best method for ricin extraction was a rotating bath followed by centrifugation and exposing the nematodes in 24 well plates with a solution of nematodes extracted from the media with destilated waterexposing the nematodes in 24-well plates This method is inexpensive, quick and adequate for the selection of offspring with lower RIP content.Foi desenvolvido um bioensaio para quantificar o teor de ricina nas sementes de mamona. Os métodos de quantificação existentes não refletem a toxidez real das sementes analizadas, que pode mostrar um resultado de menor teor de ricina e ainda assim ser mais toxico do que as sementes que apresentaram teores maiores. Isto ocorre por que estes métodos medem alem da ricina a RCA, que é um composto menos tóxico que a ricina pura. Foi decidido utilizar neste estudo o nematoide Caenorhabditis elegans, que tem sido amplamente utilizado na industria farmacêutica. Foram testadas duas estirpes de C.elegans usadas em diferentes métodos contando com 8 experimentos distintos. nós examinamos 4 métodos de extração de ricina e 3 m
Directory of Open Access Journals (Sweden)
Márcia Tanajura Cavalcanti
2005-12-01
Full Text Available O objetivo deste estudo foi determinar o efeito da temperatura (0 a 45°C, pH (4 a 10 e concentração de NaCl (1 a 10% sobre o crescimento de Acidovorax avenae subsp. citrulli (Aac. Quatro estirpes de Aac foram cultivadas em meio de cultura líquido específico e o crescimento avaliado pela absorbância (580nm. Os dados obtidos foram submetidos à análise de regressão não linear. O crescimento das estirpes também foi avaliado em caldo base para fermentação contendo 1% dos carboidratos glicose, galactose, ramnose, sacarose, lactose, maltose, amido, inulina, manitol, dulcitol, sorbitol e salicina, indicada pela mudança da cor do meio. Com base nas análises de regressão, as temperaturas mínima, ótima e máxima para crescimento de Aac foram, respectivamente, 1, 32 e 41°C; o pH ótimo para crescimento dessa bactéria foi 7,4 com os extremos mínimo de 4,0 e máximo de 10,8 e; o crescimento de Aac decresceu com o aumento da concentração de NaCl, sendo o nível de 6,2% letal. Todos os carboidratos testados foram utilizados pelas estirpes de Aac como fonte de carbono, com pequena variação de crescimento observada pela velocidade e intensidade da utilização do substrato com produção de ácido.The objective of this study was to determine the effect of temperature (0 to 45°C, pH (4 to 10 and NaCl concentration (1 to 10% in the growth of Acidovorax avenae subsp. citrulli (Aac. Four Aac strains were grown in specific liquid medium, and their growth evaluated by absorbance (580nm. Data were submitted to nonlinear regression analysis. The bacterial growth was also studied in fermentation broth containing 1% of fermentable carbohydrates, glucose, galactose, rhamnose, sucrose, lactose, maltose, starch, inulin, mannitol, dulcitol, sorbitol and salicin, being evaluated by medium color change. Based upon regression analyses, the minimum, optimum and maximum temperatures for Aac growth were respectively 1, 32 and 41°C; the optimum pH for Aac
Directory of Open Access Journals (Sweden)
Rita Macedo
2009-05-01
, identificacao e testes de sensibilidade classicos, directamente a partir de amostras respiratorias. Estudamos 68 amostras, com baciloscopia positiva.O MTBDRplus® permitiu identificar, directamente a partir das amostras respiratorias, o complexo Mycobacterium tuberculosis em todos os casos em que o estudo cultural e a identificacao classica chegaram a esse mesmo resultado. Nas amostras em que culturalmente isolamos estirpes sensiveis, com o MTBDRplus® encontramos sempre perfis geneticos do tipo selvagem (63,2%. Relativamente as amostras em que culturalmente isolamos estirpes resistentes, com o MTBDRplus® encontramos sempre perfis geneticos com mutacoes ou com ausencia do perfil do tipo selvagem (36,8%.Este estudo permitiu concluir que o MTBDRplus® assegura a deteccao rapida de resistencias a farmacos em estirpes do complexo M. tuberculosis, com resultados totalmente sobreponiveis aos obtidos com os metodos bacteriologicos classicos. Key-words: Tuberculosis, Multi-drug resistance, Laboratory diagnosis, Palavras-chave: Tuberculose, Multirresistencia, Diagnostico laboratorial.
Directory of Open Access Journals (Sweden)
Salomão Lima Guimarães
2007-03-01
Full Text Available O objetivo deste trabalho foi avaliar o efeito da utilização de bactérias diazotróficas com ou sem molibdênio em duas cultivares de arroz com diferentes potenciais de fixação biológica de nitrogênio. Dois experimentos foram montados: o primeiro foi conduzido em condições gnotobióticas, com utilização das estirpes BR 11417 (ZAE94 - Herbaspirillum seropedicae e BR 11340 (M130 - Burkholderia sp., duas doses de molibdênio, 1,12 e 2,25 g, e duas fontes, molibdato de sódio e molibdato de amônio. As sementes foram peletizadas com inoculante turfoso com bactérias diazotróficas e o molibdênio. Em seguida as cultivares foram plantadas em tubos de ensaio com capacidade para 120 mL com 60 mL da solução de Hoagland sem nitrogênio por 30 dias. Foi avaliada a matéria seca das plantas. O segundo experimento foi conduzido em vasos em casa de vegetação, com as mesmas estirpes e dosagens de molibdênio. Foram avaliados a produção e o N total dos grãos. O delineamento estatístico foi inteiramente casualizado com quatro repetições e quatro plantas por vaso. Foram observados aumentos na produção de grãos nas cultivares IR42 e IAC4440 de 88 e 57%, respectivamente, com a adição ao inoculante turfoso, das estirpes ZAE94 e M130 com molibdênio.The objective of this work was to evaluate the effect of the inoculation of diazotrophic bacteria associated with the molybdenum in two rice cultivars. Two experiments were performed: the first one was lead under gnotobiotics conditions, using Herbaspirillum seropedicae, strain BR 11417 and Burkholderia sp., strain BR 11340, two doses of molybdenum (1.12 and 2.25 g and two different sources of Mo - sodium molybdate and ammonium molybdate. The seeds were pelleted with peat containing diazotrophic bacteria and molybdenum. After inoculations were seeds planted in to test tubes with capacity for 120 mL content 60 mL Hoagland solution without nitrogen. Seedlings were harvested after 30 days and plant
Directory of Open Access Journals (Sweden)
Vergara, G.
2009-09-01
Full Text Available The present study analyzed the effect of dietary fat and strain on the fatty acid and cholesterol contents of eggs over a 20 month-period. Hy-line and Warren hens received three consecutive 7% lipid diets in which the basal constituents of the diet supplied 3% of the fats while the remaining 4% was composed of fats, oils or oleins added to progressively increase polyunsaturated fatty acid (PUFA levels, while decreasing dietary levels of both saturated fatty acids (SFA and monounsaturated fatty acids (MUFA. In general, the percentages of most fatty acids in egg lipids were affected by changes in dietary lipids but not by the strain. Data suggest the existence of a dietary threshold for elaidic acid to appear in eggs. Mufa decreased and total PUFA increased throughout the study. The cholesterol egg content was higher at the animal fat plus soybean oil than at the animal fat or the olein plus soybean oil blend. Overall, results showed that changes in dietary lipids influenced fatty acid composition and hence atherogenic and thrombogenic indexes much more than the strain.El objetivo del presente estudio fue analizar los efectos de la grasa de la dieta de dos estirpes de ponedoras (Hy-line y Warren sobre el contenido de ácidos grasos y colesterol del huevo durante un periodo del ciclo de puesta de 20 meses. Ambas estirpes recibieron 3 dietas consecutivas que contenían 7% de lípidos de los cuales 3% provenía de los componentes basales de la dieta y 4% fue adicionado en forma de grasa, aceites u oleínas con objeto de aumentar progresivamente el contenido de ácidos grasos poliinsaturados y disminuir el contenido de los ácidos grasos saturados y monoinsaturados. El cambio de grasa en la dieta afectó al perfil de la mayoría de los ácidos grasos del huevo, sugiriéndose la existencia de un mínimo de ácido elaídico en la grasa añadida para su aparición en el huevo. El contenido de AGP se incrementó mientras que el de AGM disminuyó en el
Hua, Hai-Yong; Wang, Wei; Cao, Guo-Qun; Tang, Feng; Liang, You-Sheng
2013-09-11
Human Schistosoma haematobium infection that causes urinary schistosomiasis occurs in Africa and the eastern Mediterranean, and China is only endemic for S. japonicum. In this report, we reported an imported case with S. haematobium infection returning from Angola to Shaanxi Province, northwestern China, where S. japonicum is not endemic. The case was misdiagnosed as ureteral calculus, invasive urothelial carcinoma and eosinophilic cystitis in several hospitals, and was finally diagnosed by means of serological assay followed by microscopic examination of the urine sediment. The patient was then treated with praziquantel, and a satisfactory outcome was obtained. As S. haematobium is not indigenous to China, most Chinese doctors and medical technicians are unfamiliar with this introduced parasitic disease, therefore, they need to increase the awareness of its existence when they encounter persons who have visited or resided in endemic areas, and the techniques for detection of the parasite, so as to reduce the misdiagnosis. In addition, health education should be given to those who will go to the endemic areas to improve their knowledge and awareness on prevention and control of schistosomiasis haematobia, thereby reducing the risk of exposure to the infested freshwater.
Sur quelques aspects de la production du soja (Glycine max L. au Congo : essais préliminaires
Directory of Open Access Journals (Sweden)
Mandimba, GR.
1991-01-01
Full Text Available About some cropping systems of soybean (Glycine max. L. in Congo : first results. Field experiments were conducted to assess the response of soybean Glycine max cv. FN3 to N fertilization and inoculation respectively. In the first experiment, the effects of different levels of N fertilizer (0 ; 20 ; 40 and 80 kg N/ha with or without liming were studied. Soybean podyield were related to N fertilization only when liming was added to the soil In the second one, the effects of four Bradyrhizobium japonicum strains F A3 ; 3-40 ; SA 1 and G3S on nodulation and yields were also studied. Inoculation has significant effect on nodulation and plant top dry weight at full bloom, and seed yield at harvest when compared to the control. However, the Bradyrhizobium japonicum strains tested had various symbiotic effectiveness on Glycine max cv. FN3. In addition, soybean plants inoculated with G3S strain and those fertilized with 100 kg N/ha produced similar seed yield. Our study illustrated that G3S strain had the better adaptability in environmental conditions of Congo soil.
Compatibilidade entre a inoculação de rizóbios e fungicidas aplicados em sementes de feijoeiro-comum
Directory of Open Access Journals (Sweden)
Maurício Rocha Kintschev
2014-12-01
Full Text Available O objetivo do presente estudo foi avaliar os efeitos do tratamento de sementes de feijoeiro com diferentes fungicidas na sobrevivência de estirpe de Rhizobium tropici (SEMIA 4077 e Rhizobium freirei (SEMIA 4080, na nodulação das plantas e na produtividade da cultura. Foram conduzidos dois ensaios em substrato esterilizado, sob condições de casa de vegetação e um ensaio no campo experimental da Embrapa Agropecuária Oeste, em Dourados, MS, num Latossolo Vermelho distroférrico típico. Os fungicidas (princípios ativos utilizados nos ensaios foram: (1 carbendazim + tiram (Produto A; (2 carbendazim + tiram (Produto B; (3 carboxin + tiram; (4 fludioxonil + metalaxil-M; (5 fludioxonil + metalaxil-M + tiabendazol; (6 fluazinam + tiofanato metílico; (7 fipronil + tiofanato metílico + piraclostrobina; (8 clorotalonil + tiofanato metílico. A sobrevivência das estirpes de R. tropici inoculadas nas sementes de feijoeiro foi afetada pela aplicação dos fungicidas, principalmente por aqueles com modo de ação de contato. Observou-se ainda, com a aplicação dos fungicidas, redução na nodulação das plantas de feijoeiro, especialmente da massa nodular, tanto nos ensaios conduzidos em substrato esterilizado, em casa de vegetação, quanto no experimento a campo, onde também observou-se redução na produtividade do feijoeiro pela aplicação da maioria dos fungicidas avaliados. Os fungicidas que mais afetaram o rendimento de grãos foram carbendazim + tiram (Produto B e carboxin + tiram. Os produtos fipronil + tiofanato metílico + piraclostrobina, fludioxonil + metalaxil-M + tiabendazol e fludioxonil + metalaxil-M não afetaram a produtividade da cultura, embora a massa seca de nódulos tenha sido reduzida em todos os ensaios.
Directory of Open Access Journals (Sweden)
Erineudo de Lima Canuto
2003-11-01
Full Text Available The inoculation technique with endophytic diazotrophic bacteria in sugarcane has been shown as an alternative practice to plant growth promotion. The aim of this work was to evaluate the biological nitrogen fixation (BNF contribution by different strains of Herbaspirillum seropedicae and Gluconacetobacter diazotrophicus in sugarcane plant inoculated from seeds. The seeds were planted in pots filled with non-sterile soil, inoculated with the bacterial strains and grown 10 months outside of the greenhouse. The BNF contribution of the inoculated bacteria varied depending on the plant species used as a control. The highest BNF contribution as well as the highest populations of reisolated bacteria was observed with inoculation of H. seropedicae strains. The roots appeared to be the preferential tissues for the establishment of the inoculated species.A técnica de inoculação com bactérias diazotróficas endofíticas na cana-de-açúcar apresenta-se como uma prática alternativa para promover o crescimento vegetal menos dependente da adubação nitrogenada. Este trabalho teve como objetivo avaliar a contribuição da fixação biológica de nitrogênio (FBN por diferentes estirpes de Herbaspirillum seropedicae e Gluconacetobacter diazotrophicus inoculadas em plantas de cana-de-açúcar originadas de semente. As sementes foram plantadas em vasos com solo não estéril, inoculadas com as diferentes bactérias e mantidas por 10 meses ao ar livre. As maiores contribuições da FBN ocorreram com a inoculação de estirpes Herbaspirillum seropedicae, e dependeram da espécie vegetal utilizada como testemunha. As raízes apresentaram-se como o órgão vegetal preferencial para o estabelecimento das espécies inoculadas.
Directory of Open Access Journals (Sweden)
Nelson Inzulza Barrientos
2014-07-01
Full Text Available El meduloepitelioma es un tumor muy poco frecuente en adultos, encontrándose descritos en la literatura solo una decena de casos. Se presenta la historia de un paciente sometido a enucleación de su ojo derecho por sospecha de melanoma coroideo. La biopsia informó neoplasia de estirpe neural de comportamiento biológico incierto, y el estudio inmunohistoquímico informó neoplasia neuroendocrina de bajo grado. Se realizó estudio de extensión sistémica que resultó negativo. El paciente no se somete a controles durante 6 años, volviendo a consultar por una gran ocupación orbitaria derecha, manejada mediante exenteración orbitaria. La biopsia informó neoplasia maligna de estirpe neural, y la histoquímica concluyó meduloepitelioma pigmentado maligno ocular con extensión a la órbita. El paciente evolucionó con signos de remisión completa de la lesión, sin embargo un año y medio después comenzó con un aumento de volumen rápidamente progresivo, que compromete toda la región orbitaria derecha. Se presenta el caso a comité oncológico, indicando estudio de extensión sistémica mediante citología de LCR, TAC de tórax, abdomen y pelvis que resultaron normales; el cintigrama óseo evidenció actividad osteoblástica patológica en macizo facial, y la RMN de cerebro evidenció invasión intra y extracraneal, con ocupación de los senos paranasales. Con estos antecedentes se le ingresó en el programa de cuidados paliativos y alivio del dolor, realizándose radioterapia paliativa, con remisión parcial de tamaño tumoral y sintomatología.
Growing Season Definition and Use in Wetland Delineation: A Literature Review
2010-08-01
obvious bud set) unreliable indicators of the end of the growing season. For example, drought can induce premature leaf abscission, and woody plant...as well as privet (Ligustrum japonicum), loblolly pine ( Pinus taeda), and yellow poplar (Liriodendron tulipifera). The lack of water uptake was...the effects of four flooding/drying regimes on shortleaf pine ( Pinus echinata), loblolly pine, and pond pine ( Pinus serotina). The expected result
Dicty_cDB: Contig-U12039-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 9 |pid:none) Mougeotia scalaris neochrome gene,... 101 7e-20 AB206962_1( AB206962 |pid:none) Mougeotia scala...AB206961_1( AB206961 |pid:none) Mougeotia scalaris NEO1 mRNA for n... 97 2e-18 ( ...01 7e-20 AY813860_1( AY813860 |pid:none) Schistosoma japonicum SJCHGC06050 ... 101 7e-20 AY878549_1( AY87854
Directory of Open Access Journals (Sweden)
Wen-Bin Yu
2018-02-01
Full Text Available Phtheirospermum (Orobanchaceae, a hemiparasitic genus of Eastern Asia, is characterized by having long and viscous glandular hairs on stems and leaves. Despite this unifying character, previous phylogenetic analyses indicate that Phtheirospermum is polyphyletic, with Phtheirospermum japonicum allied with tribe Pedicularideae and members of the Ph. tenuisectum complex allied with members of tribe Rhinantheae. However, no analyses to date have included broad phylogenetic sampling necessary to test the monophyly of Phtheirospermum species, and to place these species into the existing subfamiliar taxonomic organization of Orobanchaceae. Two other genera of uncertain phylogenetic placement are Brandisia and Pterygiella, also both of Eastern Asia. In this study, broadly sampled phylogenetic analyses of nrITS and plastid DNA revealed hard incongruence between these datasets in the placement of Brandisia. However, both nrITS and the plastid datasets supported the placement of Ph. japonicum within tribe Pedicularideae, and a separate clade consisting of the Ph. tenuisectum complex and a monophyletic Pterygiella. Analyses were largely in agreement that Pterygiella, the Ptheirospermum complex, and Xizangia form a clade not nested within any of the monophyletic tribes of Orobanchaceae recognized to date. Ph. japonicum, a model species for parasitic plant research, is widely distributed in Eastern Asia. Despite this broad distribution, both nrITS and plastid DNA regions from a wide sampling of this species showed high genetic identity, suggesting that the wide species range is likely due to a recent population expansion. The Ph. tenuisectum complex is mainly distributed in the Hengduan Mountains region. Two cryptic species were identified by both phylogenetic analyses and morphological characters. Relationships among species of the Ph. tenuisectum complex and Pterygiella remain uncertain. Estimated divergence ages of the Ph. tenuisectum complex corresponding
DEFF Research Database (Denmark)
Guerreiro, L.; Couto, N.; Centeno, M.
O conhecimento existente sobre a presença e frequência de genes de Resistência às Quinolonas Mediada por Plasmídeos (RQMP) em estirpes comensais de E. coli de origem bovina é escasso a nível mundial. O presente trabalho teve como objectivos:i) avaliar a frequência de genes de RQMP, designadamente...... exista uma associação entre a presença de genes de RQMP e valores de CIMs, verifica-se um aumento da frequência destes genes ao longo do estudo longitudinal. Este é o primeiro estudo que descreve a existência de resistência às quinolonas por qQnrD em isolados de E. coli de bovinos....
Desenvolvimento de três cervejas : cerveja pelo método champanhês, cerveja de fruta e cerveja Gose
Vidal, Daniel Filipe Coelho
2017-01-01
A produção de cerveja é uma atividade milenar, sendo que ao longo da história tem sido pautada pela constante evolução e inovação. Existem diferentes estilos de cerveja e técnicas de produção, embora a base da produção consista em utilizar grão maltado (rico em amido que por ação de enzimas originará açúcares mais simples), lúpulo (apresenta grande teor de α-ácidos, que serão isomerisados e serão responsáveis pelo amargor), água e leveduras (diferentes estirpes podem ser usadas, produzindo et...
International Nuclear Information System (INIS)
Veltkamp, D.J.
1994-01-01
The impact of particle size and chemical composition variations on determination of tank simulant moisture from near infrared (NIR) optical spectra are presented. This work shows particle size and chemical variations will impact moisture predictions from NIR spectra. However, the prediction errors can be minimized if calibration models are built with samples containing these variations as interferents. Prior work showed the NIR spectral region (1100 to 2500 nm) could be used to predict moisture content of BY-104 tank simulant with a standard error less of approximately 0.5 wt%. Particle size will increase moisture prediction error if calibration-models do not include the same particle size ranges as unknown samples. A combined particle size model with 0-420 x10 -6 m, 420-841 x 10 -6 m, and 841 x 10 -6 m-2 mm diameter particles predicted 0.59, 0.34 nd 0.23 wt% errors respectively for samples containing only these size ranges and 0.80 wt% error for a samples with all particle size ranges. Chemical composition would also increase moisture prediction error if calibration model samples chemically differ from unknown samples. For a BY-104 simulant, increases in NaOH, NaAlO 2 , Na 2 SiO 3 , and Na 3 PO 4 produced moisture predictions that were lower than the actual moisture levels while increases in FE(NO 3 ) 3 , Ca(NO 3 ) 2 , and Mg (NO 3 ) 2 resulted in a higher than actual moisture prediction. Systematic changes in the NIR spectra could be observed for these families of materials. When all of the composition variations were included in a single model, the model had a moisture prediction error of 1.41 wt% as compared to a 2.96 wt% error without model changes. This work shows a calibration model based on a single set of tightly controlled experimental conditions will tend to have somewhat larger prediction errors when applied to samples collected with variations outside of such conditions
Dicty_cDB: Contig-U08887-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 1 FN317772_1( FN317772 |pid:none) Schistosoma japonicum isolate Anhu... 72 6e-11 X98769_1( X98769 |pid:none) Megaselia scala...ris mRNA for Sex-lethal... 71 1e-10 AJ000546_1( AJ000546 |pid:none) Megaselia scala...a cruzi RNA-binding prot... 67 2e-09 AF110846_1( AF110846 |pid:none) Megaselia scalaris sex-lethal homo... 6
Directory of Open Access Journals (Sweden)
H.C. Lamaita
2005-10-01
Full Text Available Analisaram-se 80 amostras de leite cru refrigerado a 4°C e estocado por 48 horas em tanques refrigeradores de propriedades rurais do estado de Minas Gerais quanto à contagem e identificação de Staphylococcus sp. e detecção de enterotoxinas estafilocócicas (SE e da toxina da síndrome do choque tóxico (TSST-1. Staphylococcus sp. foi detectado em 100% das amostras de leite de tanque refrigerador em contagens que variaram de 1,0 × 10(5 a 2,5 × 10(7 UFC/ml (média = 5,60 log UFC/ml; s = 0,53 e CV = 9,5%. Isolaram-se e identificaram-se 436 estirpes como: S. aureus, S hyicus, S. epidermidis, S. intermedius, S. cohnii, S. sciuri, S. schleirferi e S. delphini. As estirpes de mesmo perfil bioquímico, oriundas da mesma amostra, foram agrupadas (pools e induzidas a produzir SE e TSST-1. A detecção dessas enterotoxinas foi feita pelo método optimum sensitivity plate, usando-se técnica de celofane sobre ágar. Identificou-se a produção de SEA, SEB, SEC, SED e de TSST-1 em percentuais variados. Dos 138 pools preparados, 91 produziram, pelo menos, uma toxina isoladamente ou em associação a outras toxinas. Dos pools enterotoxigênicos, 24,6% eram coagulase positiva e 41,3%, coagulase negativa. A confirmação de estirpes enterotoxigênicas de Staphylococcus coagulase negativa isoladas de amostras de leite é importante em relação à saúde pública.In order to count and identify Staphylococcus sp., the detection of the Staphylococcal enterotoxins (SE and toxic shock toxin syndrome (TSST-1, 80 raw milk samples cooled at 4°C and stored in bulk tanks for 48 hours in different farms from Minas Gerais State were analyzed. Staphylococcus sp. was observed in all samples and the counts varied from 1.0 × 10(5 to 2.5 × 10(7 CFU/ml (mean = 5.60 log CFU/ml; sd = 0.53 and CV = 9.46 %. A total of 436 strains of Staphylococcus were isolated and identified as S. aureus, S hyicus, S. epidermidis, S. intermedius, S. cohnii, S. sciuri, S. schleirferi and S
Directory of Open Access Journals (Sweden)
Rodrigo Otávio Silveira Silva
2011-08-01
e três de leitões aparentemente saudáveis. Foi possível isolar C. difficile em 12 das 60 (20% amostras trabalhadas. Dessas, três estirpes eram não-toxigênicas (A-B- e nove eram toxigênicas, sendo quatro caracterizadas como A+B+ e cinco como A-B+. O gene responsável pela codificação da toxina binária foi encontrado em 50% das estirpes isoladas, proporção superior ao relatado em estudos anteriores. Todas as estirpes não toxigênicas foram isoladas de animais não diarreicos. Os resultados encontrados sugerem a ocorrência de diarreia por C. difficile em granjas no Brasil.
Directory of Open Access Journals (Sweden)
Watson Rogério de Azevedo
2002-08-01
Full Text Available O objetivo deste trabalho foi avaliar o efeito do boro na nodulação da ervilha (Pisum sativum L. cv. Torta de Flor Roxa, cultivada em solos de várzea em condições de casa de vegetação, entre maio e julho de 1998. Amostras de Neossolo Flúvico, Gleissolo Háplico, Gleissolo Melânico e Organossolo Mésico artificialmente drenado foram coletadas na camada de 0-20 cm. Essas amostras foram previamente cultivadas com rabanete, e receberam calcário, P, K, S, Cu e Zn e seis doses de B (0,0, 0,25, 0,5, 1,5, 3,0 e 6,0 mg dm-3. Por ocasião do cultivo da ervilha aplicou-se apenas K (100 mg dm-3. O delineamento experimental foi inteiramente casualizado, em esquema fatorial 4x6, com três repetições. Foram cultivadas três plantas por vaso, cujas sementes, na época da semeadura, foram submetidas à inoculação com estirpes de Rhizobium leguminosarum (BR 618 e BR 619. Para verificação da existência de estirpes nativas de rizóbio, cultivaram-se sem inoculação nas sementes, três vasos, de cada solo, que haviam recebido a mesma dose de calcário, a mesma adubação básica e 0,5 mg dm-3 de boro. Aos 45 dias após o plantio, em pleno florescimento, colheu-se o experimento. Não foram observadas estirpes nativas nos solos avaliados. Nos solos Gleissolo Háplico e Organossolo Mésico artificialmente drenado, as doses de B influenciaram a nodulação e a atividade da nitrogenase.The objective of this work was to evaluate the effect of boron on nodule development in pea Pisum sativum L. plants cultivated in lowland soils under greenhouse conditions from May to July, 1998. Samples of Alluvial Soil, Low Humic Gley, Humic Gley and artificially drained Bog Soil were collected from a layer 0-20 cm deep. The samples were previously cultivated with radish plants that received lime, P, K, S, Cu and Zn and doses of B (0, 0.25, 0.5, 1.5, 3.0 and 6.0 mg dm-3. Before pea cultivation only K was applied (100 mg dm-3. The experimental design was totally
Xie, Z. P.; Staehelin, C.; Vierheilig, H.; Wiemken, A.; Jabbouri, S.; Broughton, W. J.; Vogeli-Lange, R.; Boller, T.
1995-08-01
Legumes form tripartite symbiotic associations with noduleinducing rhizobia and vesicular-arbuscular mycorrhizal fungi. Co-inoculation of soybean (Glycine max [L.] Merr.) roots with Bradyrhizobium japonicum 61-A-101 considerably enhanced colonization by the mycorrhizal fungus Glomus mosseae. A similar stimulatory effect on mycorrhizal colonization was also observed in nonnodulating soybean mutants when inoculated with Bradyrhizobium japonicum and in wild-type soybean plants when inoculated with ineffective rhizobial strains, indicating that a functional rhizobial symbiosis is not necessary for enhanced mycorrhiza formation. Inoculation with the mutant Rhizobium sp. NGR[delta]nodABC, unable to produce nodulation (Nod) factors, did not show any effect on mycorrhiza. Highly purified Nod factors also increased the degree of mycorrhizal colonization. Nod factors from Rhizobium sp. NGR234 differed in their potential to promote fungal colonization. The acetylated factor NodNGR-V (MeFuc, Ac), added at concentrations as low as 10-9 M, was active, whereas the sulfated factor, NodNGR-V (MeFuc, S), was inactive. Several soybean flavonoids known to accumulate in response to the acetylated Nod factor showed a similar promoting effect on mycorrhiza. These results suggest that plant flavonoids mediate the Nod factor-induced stimulation of mycorrhizal colonization in soybean roots.
Discovery and molecular characterization of a Bcl-2–regulated cell death pathway in schistosomes
Lee, Erinna F.; Clarke, Oliver B.; Evangelista, Marco; Feng, Zhiping; Speed, Terence P.; Tchoubrieva, Elissaveta B.; Strasser, Andreas; Kalinna, Bernd H.; Colman, Peter M.; Fairlie, W. Douglas
2011-01-01
Schistosomiasis is an infectious disease caused by parasites of the phylum platyhelminthe. Here, we describe the identification and characterization of a Bcl-2–regulated apoptosis pathway in Schistosoma japonicum and S. mansoni. Genomic, biochemical, and cell-based mechanistic studies provide evidence for a tripartite pathway, similar to that in humans including BH3-only proteins that are inhibited by prosurvival Bcl-2–like molecules, and Bax/Bak-like proteins that facilitate mitochondrial ou...
Coccidiosis en pollos de engorde. Reporte de caso, Tunja, Boyacá
Directory of Open Access Journals (Sweden)
Sandra Rodriguez
2008-10-01
Full Text Available En el Laboratorio de Microbiología de la Facultadde Ciencias Agrarias de la Fundación UniversitariaJuan de Castellanos, se recibieron para necropsiados pollos machos de la estirpe Ross, de 4 semanasde edad; con reporte de diarrea sanguinolenta, bajacon versión alimenticia, poca ganancia de peso y altamortalidad en el lote. En los hallazgos se evidenciaron lesiones a lo largo del tubo digestivo, principalmenteen los ciegos, los cuales mostraron aumento de tamaño,con abundancia de sangre en la luz del órgano,mucosa hemorrágica, congestionada y aspecto aterciopelado con presencia de coágulos. Luego de la evaluación se diagnosticó una infestación por Eimeriadel género Tenella.
SUSCEPTIBILIDAD A LA HIPOXIA HIPOBÁRICA EN UNA ESTIRPE COMERCIAL DE POLLOS DE ENGORDE
Directory of Open Access Journals (Sweden)
L.C. Monroy
2013-01-01
Full Text Available La hipertensión arterial pulmonar (HAP inducida por la hipoxia hipobárica genera grandes pérdidas económicas en la industria de la carne de pollo. Los pollos Cobb 500 criados bajo condiciones de hipoxia hipobárica (2.638 m de altitud y temperatura controlada, tuvieron una disminución notable de peso corporal en comparación con los animales criados bajo normoxia relativa (310 m de altitud. Al día 42 de edad la mortalidad acumulada fue de 35,2% en machos y 53,8% en hembras, de la cual, 90,6% en machos y 96,4% en hembras se atribuyó a HAP. Al día 33 de edad, 64% de los pollos desarrollaron HAP (índice cardiaco > 25, 32% presentó ascitis y 82% hidropericardio solamente. Se encontró mayor mortalidad entre la tercera y quinta semanas. Se concluye que la ascitis puede o no estar presente en animales enfermos y que el hidropericardio por sí solo se asocia con la presencia de HAP. El tiempo de exposición a hipoxia hipo - bárica no influye en la forma de presentación, ni afecta la manifestación de la HAP, mientras que la susceptibilidad a la muerte por HAP se debe a un factor individual de adaptación. Por tanto, es factible que el grado de susceptibilidad individual determine los límites entre la compensación de la hipoxia, el desarrollo de la HAP (cuadro agudo o crónico y la muerte de los animales. El 36% de los pollos expuestos a hipoxia hipobárica tuvieron un buen desempeño productivo; estos pollos resistentes deberían ser objeto de programas de selección genética.
Directory of Open Access Journals (Sweden)
R. S. A. Nóbrega
2004-04-01
Full Text Available As gramíneas, usadas comumente para reabilitação de áreas degradadas, podem formar associações em suas raízes com bactérias fixadoras de nitrogênio e, assim, contribuir para a sustentabilidade do ecossistema. Por outro lado, a diversidade microbiana exerce papel relevante na resiliência dos processos biológicos do solo, que incluem a fixação biológica de N2. O presente estudo teve como objetivo a caracterização fenotípica de 72 isolados de bactérias diazotróficas associativas Gram-negativas, oriundos de áreas sob diferentes estratégias de reabilitação, após a mineração da bauxita em Poços de Caldas (MG, por meio da inoculação de amostras de solo nos meios de cultivo NFb, Fam e JNFb. Estirpes tipo e referência de espécies de Azospirillum, Herbaspirillum e Burkholderia foram usadas para comparação, uma vez que são capazes de crescer nestes meios. O dendrograma de similaridade baseado em sete características culturais dos isolados em meio de cultivo GNA revelou grande diversidade, sendo obtidos 50 grupos a 81 % de similaridade. A tolerância a NaCl em meio de cultivo batata/sacarose/ácido málico variou de 0 a 50 g L-1, permitindo separar os isolados e estirpes tipo em cinco grupos. O diâmetro celular variou de 0,61 a 1,21 µm, e 13 isolados diferiram das estirpes tipo e referência. Os padrões de proteína total, obtidos por eletroforese em gel de poliacrilamida (SDS-PAGE, foram bastante diversos, possibilitando a formação de 15 grupos com similaridade a 75 %. Não houve relação entre os grupos formados pelas várias características estudadas, tampouco destes com as áreas de origem dos isolados. Os meios de cultivo Fam e JNFb detectaram, além das espécies-alvo, outras não identificadas. A alta dissimilaridade da maioria dos isolados em relação a estirpes tipo, principalmente com relação aos padrões eletroforéticos de proteína total, admite a possibilidade da presença de novas espécies entre
Monincová, Marta; Prokop, Zbyněk; Vévodová, Jitka; Nagata, Yuji; Damborský, Jiří
2007-01-01
1,2,3-Trichloropropane (TCP) is a highly toxic and recalcitrant compound. Haloalkane dehalogenases are bacterial enzymes that catalyze the cleavage of a carbon-halogen bond in a wide range of organic halogenated compounds. Haloalkane dehalogenase LinB from Sphingobium japonicum UT26 has, for a long time, been considered inactive with TCP, since the reaction cannot be easily detected by conventional analytical methods. Here we demonstrate detection of the weak activity (kcat = 0.005 s−1) of Li...
Directory of Open Access Journals (Sweden)
Fabio Fernando de Araujo
2013-06-01
Full Text Available The biological nitrogen fixation provided by diazotrophic bacteria may represent an alternative to maize production in more sustainable agricultural systems or low use of technology. In order to evaluate the growth, content and accumulation of nitrogen in corn genotypes, depending on seed inoculation with Herbaspirillum seropedicae experiment was conducted in greenhouse evaluating 35 corn genotypes hybrid single, double, triple and varieties. For seed inoculation was used peat inoculant containing the bacterial strain of H. seropedicae (ZAE 94. Among the commercial corn genotypes studied, only nine hybrids show increase of growth or accumulation of N with the seed inoculation with Herbaspirillum seropedicae (ZAE 94. There is a distinction in response between maize cultivars in terms of biomass production and increase of N content in the shoots.A fixação biológica de nitrogênio proporcionada por bactérias diazotróficas pode representar alternativa para a produção de milho em sistemas agrícolas mais sustentáveis ou de baixa utilização de insumos. Objetivando-se avaliar o crescimento, teor e acúmulo de nitrogênio em genótipos de milho, em função da inoculação das sementes com Herbaspirillum seropedicae, foi conduzido experimento em casa de vegetação avaliando-se 35 genótipos de milho híbridos simples, duplo, triplo e variedades. Para inoculação das sementes foi utilizado inoculante turfoso contendo a estirpe bacteriana de H. seropedicae (ZAE 94. Entre os genótipos comerciais de milho estudados, apenas nove híbridos apresentam ganhos de crescimento ou acúmulo de N com a inoculação das sementes com a estirpe Herbaspirillum seropedicae (ZAE 94. Há distinção de resposta entre cultivares de milho em termos de produção de biomassa e incremento de teor de N na parte aérea das plantas.
Directory of Open Access Journals (Sweden)
Elvis Alexander Díaz López
2014-07-01
Full Text Available Las altas temperaturas ambientales propician susceptibilidad al estrés calórico en los pollos de engorde, lo que genera cambios metabólicos. Se buscó determinar los cambios en la bioquímica sanguínea y la concentración plasmática de corticosterona del pollo de engorde sometido a estrés calórico crónico y a las condiciones de temperatura ambiental del piedemonte amazónico colombiano, sobre las concentraciones plasmáticas de corticosterona, glucosa, proteínas totales, albumina, globulina, sodio, cloro, potasio, magnesio, fósforo y calcio. Se utilizaron pollos machos de 2 estirpes de 21 días de edad, distribuidos en un diseño experimental irrestrictamente al azar, en un esquema bifactorial, con 4 tratamientos. Se hicieron 5 repeticiones por tratamiento y 25 animales por unidad experimental. Las aves fueron alimentadas con una dieta básica de maíz y torta de soya con 3,100 Kcal de EM y 19,5 % de proteína hasta los 42 días de edad. El factor estirpe no tuvo efecto en las variables evaluadas (p ≥ 0,05. No obstante, existió diferencia estadística significativa (p ≤ 0,05 en todas las variables evaluadas al ser comparadas las concentraciones de los metabolitos de las aves en condiciones de estrés calórico crónico con las de las aves expuestas a las condiciones de temperatura del piedemonte amazónico colombiano. Se concluyó que la bioquímica sanguínea sufrió modificaciones significativas bajo las 2 temperaturas experimentales, con mayor detrimento fisiológico de las aves con estrés calórico crónico. La concentración de corticosterona se constituyó en el indicador más sensible y constante de la condición fisiológica de estrés crónico por calor.
Bio fertilization of soybean in sandy soils of egypt using N-15 tracer technique
Energy Technology Data Exchange (ETDEWEB)
Soliman, S; Galal, Y G.M.; Elghandour, I [Soil and Water Dept, Atomic Energy Authority, P.O.Box 13756 (Egypt)
1995-10-01
The effect of inoculation of soybeans with B. Japonicum and A. brasilense either solely or in mixture, and N fertilizer levels had been studied in pot experiment Nodulation of soybean grown in sandy soil was enhanced by inoculation. The highest values of nodules number and fresh weight were recorded at rate of 20 Kg N ha-1, and decreased with increasing N rate up to 40 kg N ha-1. In contrast, the dry weight of the above ground parts, as well as the N uptake was increased with increasing N fertilizer level. Similar effect was observed for inoculation as compared with the un inoculated treatment. Despite the nodulating and nonnodulating soybeans has almost the same dry weight, the nodulating isoline accumulated more N than the non-nodulating. Percentages of nitrogen derived from air (%Ndfa) was depressed with increasing N rates from 10 to 40 kg N ha-1 either estimated by isotope dilution (I D) or N difference method (D M). Dual inoculation resulted in high percent of N 2-fixed (42.5%) at rate of 10 kg N ha-1. Correlation between I D and D M methods was found to be dependent on inoculation treatments. However, nitrogen utilized by nodulating soybean (FUE%) was enhanced as a function of inoculation with B. Japonicum. 2 figs., 3 tabs.
bio fertilization of soybean in sandy soils of egypt using N-15 tracer technique
International Nuclear Information System (INIS)
Soliman, S.; Galal, Y.G.M.; Elghandour, I.
1995-01-01
The effect of inoculation of soybeans with B. Japonicum and A. brasilense either solely or in mixture, and N fertilizer levels had been studied in pot experiment Nodulation of soybean grown in sandy soil was enhanced by inoculation. The highest values of nodules number and fresh weight were recorded at rate of 20 Kg N ha-1, and decreased with increasing N rate up to 40 kg N ha-1. In contrast, the dry weight of the above ground parts, as well as the N uptake was increased with increasing N fertilizer level. Similar effect was observed for inoculation as compared with the un inoculated treatment. Despite the nodulating and nonnodulating soybeans has almost the same dry weight, the nodulating isoline accumulated more N than the non-nodulating. Percentages of nitrogen derived from air (%Ndfa) was depressed with increasing N rates from 10 to 40 kg N ha-1 either estimated by isotope dilution (I D) or N difference method (D M). Dual inoculation resulted in high percent of N 2-fixed (42.5%) at rate of 10 kg N ha-1. Correlation between I D and D M methods was found to be dependent on inoculation treatments. However, nitrogen utilized by nodulating soybean (FUE%) was enhanced as a function of inoculation with B. Japonicum. 2 figs., 3 tabs
Safronova, Vera I; Belimov, Andrey A; Sazanova, Anna L; Chirak, Elizaveta R; Verkhozina, Alla V; Kuznetsova, Irina G; Andronov, Evgeny E; Puhalsky, Jan V; Tikhonovich, Igor A
2018-06-20
Ten rhizobial strains were isolated from root nodules of a relict legume Oxytropis popoviana Peschkova. For identification of the isolates, sequencing of rrs, the internal transcribed spacer region, and housekeeping genes recA, glnII, and rpoB was used. Nine fast-growing isolates were Mesorhizobium-related; eight strains were identified as M. japonicum and one isolate belonged to M. kowhaii. The only slow-growing isolate was identified as a Bradyrhizobium sp. Two strains, M. japonicum Opo-242 and Bradyrhizobium sp. strain Opo-243, were isolated from the same nodule. Symbiotic genes of these isolates were searched throughout the whole-genome sequences. The common nodABC genes and other symbiotic genes required for plant nodulation and nitrogen fixation were present in the isolate Opo-242. Strain Opo-243 did not contain the principal nod, nif, and fix genes; however, five genes (nodP, nodQ, nifL, nolK, and noeL) affecting the specificity of plant-rhizobia interactions but absent in isolate Opo-242 were detected. Strain Opo-243 could not induce nodules but significantly accelerated the root nodule formation after coinoculation with isolate Opo-242. Thus, we demonstrated that taxonomically different strains of the archaic symbiotic system can be co-microsymbionts infecting the same nodule and promoting the nodulation process due to complementary sets of symbiotic genes.
International Nuclear Information System (INIS)
Rahalkar, G.W.
1982-03-01
Egg parasitism is the chief biotic factor regulating paddy stem borer populations. However, effective suppression of the borer through their natural enemies is not evident in practice. Studies were undertaken to evaluate the feasibility of releasing sterile yellow stem borer females into the field to increase host egg densities as these females would lay nonviable eggs. (a) Paddy fields were surveyed for the incidence of egg parasitism. (b) Attempts were made to rear yellow stem borer larvae on cut stem pieces of field grown rice plants. (c) Trichogramma japonicum, the natural egg parasite of the stem borer was reared in the laboratory using eggs of Corcyra cephalonica and Ephestia cautella as alternate host material. Mass rearing of yellow stem borer larvae on paddy plants grown under laboratory conditions does not appear practically feasible. Borer larvae reared on cut stem pieces with intact roots did not yield satisfactory adults as far as their reproductive behaviour was concerned. Though some of the dietary compositions contained natural host material, they failed to support the larval establishment. Probably some highly specific phagostimulants need to be incorporated in the diets. T. japonicum could be reared on radiation killed Ephestia eggs. The female parasite was unable to discriminate between eggs laid by radiation sterilized host females and those laid by normal ones
Qi, Xin-Shuai; Chen, Chen; Comes, Hans Peter; Sakaguchi, Shota; Liu, Yi-Hui; Tanaka, Nobuyuki; Sakio, Hitoshi; Qiu, Ying-Xiong
2012-10-01
East Asia's temperate deciduous forests served as sanctuary for Tertiary relict trees, but their ages and response to past climate change remain largely unknown. To address this issue, we elucidated the evolutionary and population demographic history of Cercdiphyllum, comprising species in China/Japan (Cercdiphyllum japonicum) and central Japan (Cercdiphyllum magnificum). Fifty-three populations were genotyped using chloroplast and ribosomal DNA sequences and microsatellite loci to assess molecular structure and diversity in relation to past (Last Glacial Maximum) and present distributions based on ecological niche modelling. Late Tertiary climate cooling was reflected in a relatively recent speciation event, dated at the Mio-/Pliocene boundary. During glacials, the warm-temperate C. japonicum experienced massive habitat losses in some areas (north-central China/north Japan) but increases in others (southwest/-east China, East China Sea landbridge, south Japan). In China, the Sichuan Basin and/or the middle-Yangtze were source areas of postglacial northward recolonization; in Japan, this may have been facilitated through introgressive hybridization with the cool-temperate C. magnificum. Our findings challenge the notion of relative evolutionary and demographic stability of Tertiary relict trees, and may serve as a guideline for assessing the impact of Neogene climate change on the evolution and distribution of East Asian temperate plants. © 2012 The Authors. New Phytologist © 2012 New Phytologist Trust.
Directory of Open Access Journals (Sweden)
D. Aranguibel
2012-04-01
Full Text Available El cáncer gástrico es una de las principales causas de muerte en el mundo. En Venezuela, las neoplasias gástricas representan 37% de todos los tumores malignos del sistema digestivo, pero el carcinoma tipo linfoepitelioma, sólo se presenta entre 1,6% y 3,1% de los casos. También es rara la presentación de lesiones tumorales sincrónicas. Al respecto se expone el caso clínico, el primero en este país, de un varón con 2 lesiones tumorales sincrónicas. Las lesiones lucían como incipientes, no obstante, el estudio histológico mostró 2 neoplasias malignas de estirpe epitelial: adenocarcinoma bien diferenciado y carcinoma tipo linfoepitelioma.
Pelasgos y Micénicos en Tesalia
Directory of Open Access Journals (Sweden)
J. L. GARCÍA RAMÓN
2009-10-01
Full Text Available Hay en las primeras etapas de la historia de Grecia una serie de problemas de todo tipo para cuya solución los testimonios de los autores antiguos no sólo no han sido de excesiva utilidad, sino que más bien han contribuido a complicar que a explicar las cosas. Baste recordar en este sentido el difuso significado que en la tradición antigua tiene el término «eolio», auténtico cajón de sastre en el que entraba toda estirpe o dialecto griego no clasificable como jonio, ático o dorio; la fidelidad a ultranza a tales fuentes ha alentado teorías como la del sustrato eolio cuya gratuidad hemos pretendido hacer ver en alguna ocasión.
Directory of Open Access Journals (Sweden)
Robson Cavalcante de Lima
2011-06-01
Full Text Available A utilização de inoculantes contendo microrganismos diazotróficos na cana-de-açúcar pode contribuir para a promoção do crescimento destas plantas e promover ganhos significativos na produtividade. Objetivou-se no presente trabalho caracterizar bactérias diazotróficas isoladas de colmos cana-de-açúcar. Foram utilizados os meios de cultivo semi-sólidos NFb e JNFb sem adição de nitrogênio. Foram isoladas cinco estirpes nativas de bactérias diazotróficas as quais foram avaliadas microscopicamente pela coloração de Gram e em relação à resistência intrínseca aos antibióticos; fungicida furadan (i.a. carbofuran e inseticida regente (i.a. fipronil, e à capacidade de fixar o nitrogênio em condições de casa-de-vegetação e campo. Os resultados obtidos permitiram observar que todos os isolados apresentaram características de bacilos Gram-negativos, e ampla resistência aos antibióticos. A estirpe nativa UCCBc5 apresentou resistência ao fungicida furadan e ao inseticida regente. As bactérias isoladas UCCBc1 e UCCBc5 apresentam capacidade e eficiência de fixar o nitrogênio atmosférico em condições de casa-de-vegetação. Verificou-se que a estirpe UCCBc5, resistente ao furadan e ao regente apresentou capacidade fixadora do nitrogênio atmosférico, em condições de campo. Na avaliação de doses de inoculante observou-se que existe relação dose de inoculante/ eficiência de fixação de nitrogênio. Estes resultados permitiram afirmar que as bactérias diazotróficas endofíticas podem ser utilizadas, em alguns casos, como substituto da adubação nitrogenada, na cultura de cana-de- açúcar.The use of inoculants containing diazotrophic microorganism in sugarcane can contribute to promoting the growth of these plants and tp promote significant gains in productivity. The objective of this study was to characterize diazotrophic bacteria isolated from stalks of sugarcane. We used the means of a semi-solid NFB and JNFb
Violencia, Racismo e Insalubridad en Colombia
Directory of Open Access Journals (Sweden)
Hugo A. Sotomayor Tribin
1995-08-01
Full Text Available
Las estirpes del actual pueblo colombiano nacieron en un mundo de violencia ofensiva española y violencia defensiva indígena; de un encuentro entre la persecución del oro profano por los europeos y la defensa del oro sagrado por los indios; del choque entre las creencias respectivas de superioridad del blanco e inferioridad del indio y del negro; de la prepotencia y fuerza misionera de los evangelizadores católicos contra los chamanes indígenas y las creencias animistas de los negros; de la espada y la alabarda contra la macana y la flecha; de la cruz de Cristo contra los bastones de moharbes y jaibanas; de manejos de conceptos de tiempo histórico, lineal, contra el de tiempos rituales, circulares; de la economía mercantil contra las economías de supervivencia; de las éticas de expoliación de la naturaleza y del ser humano para beneficio de sí mismo contra las éticas del aprovechamiento pausado y temeroso de la naturaleza y del otro ser humano; y de ideas científico-mágicas europeas contra ideas empírico-mágicas indígenas.
En ese mundo de violencia militar, racial, religiosa, económica y sexual nacieron las estirpes mestizas, mulatas, zambas, cuarteronas, “tente atrás”, “sostente en el aire” y “de todos los colores”; de la compulsión sexual del soldado y aventurero español, solitario y armado con sus metales, pólvora y racismo, sobre la sorprendida, deslumbrada y más frecuentemente salteada o violada india o negra nació aquella primera estirpe colombiana.
Padres violadores y madres violadas son los progenitores de la “Raza Cósmica”, del “Gran Mulato”, del “zambo” y del “mestizo” Colombianos.
Con los españoles se entronizó la búsqueda de “El Dorado”; primero el oro de las sepulturas del Sinú, luego la leyenda de Guatavita, después las minas de oro de Antioquia, Popayán y el Chocó; más tarde la Quina, la época de la guaquería, el ciclo genocida del caucho
Tratamento e prevenção das infecções e da colonização por Staphylococcus aureus
Directory of Open Access Journals (Sweden)
Isabel Ribeiro
2003-09-01
Full Text Available RESUMO: O número de infecções adquiridas na comunidade e nosocomiais por Staphylococcus aureus (S. aureus aumentou nos últimos 20 anos. Durante o perÃodo de 1990 a 1992, este microrganismo tornou-se a causa mais frequente de infecções nosocomiais1,2. Por outro lado, como resultado da pressão de selecção dos antibióticos, tem havido um aumento dramático na proporção de infecções por S. aureus meticilino-resistente (SAMR 3,4. Com a emergência recente de estirpes multirresistentes, incluindo a resistência aos glicopeptÃdeos, o tratamento destas infecções tornou-se ainda mais difÃcil2,4 â6.à importante prevenir a emergência de mais estirpes resistentes. Para que isso aconteça, deve ser optimizado o uso da antibioterapia, desenvolvidos métodos laboratoriais para a detecção de microrganismos resistentes e devem ser tomadas precauções estritas no seguimento da infecção ou colonização de doentes com estas estirpes 6 â10.Neste trabalho é feita uma uma revisão da história evolutiva dos anti-estafilocócicos e apresentadas as orientações actuais de tratamento e prevenção das infecções e da colonização pelo Staphylococcus aureus.REV PORT PNEUMOL 2003; IX (5: 395-409 ABSTRACT: The number of Staphylococcus aureus (S. aureus community and nosocomial acquired infections have increased in the last twenty years. Between 1990 and 1992, this pathogen has become the most frequent source of nosocomial infections 1,2. On the other hand, as result of antibiotherapy selection pressure, we observe a dramatic increase in the methicillin-resistant S. aureus (MRSA infections 3,4. With the recent emergence of multirresistant strains, including glycopeptides resistance, the treatment of these infections became still more difficult 2,4â6.Itâs important to prevent resistant strains emergence. To prevent further emergence of
Directory of Open Access Journals (Sweden)
Eli Sidney Lopes
1986-01-01
Full Text Available A adição de vinhaça na cultura canavieira tem sido praticada em áreas próximas às usinas de cana. Seria de interesse a avaliação do efeito da vinhaça no Rhizobium presente no solo (autóctone, uma vez que leguminosas têm sido indicadas para cultivo intercalar com a cana. Um experimento foi conduzido em casa de vegetação, com o objetivo de verificar a influência da aplicação contínua, durante três anos, de concentrações crescentes de vinhaça (0, 100 e 1.000 m³/ha/ano, com intervalos de seis meses entre aplicações, na população autóctone de Rhizobium que nodula amendoim, soja, feijão e crotalária. Em cada cultura, foram usados controle com solo sem adição da vinhaça e um tratamento inoculado com uma estirpe de Rhizobium de conhecida eficiência, recomendada para a cultura. Uma análise do efeito de uma dose adicional de 1,5 ppm do herbicida 2,4-D no tratamento com 100 m³/ha/ano foi também efetuada. Apesar de os resultados serem variados entre as culturas, ocorreram efeitos da vinhaça sobre a população de Rhizobium, causando aumentos de nodulação na crotalária e diminuição no amendoim. Não foram observados efeitos na nodulação do feijoeiro em nenhum dos tratamentos com a vinhaça, nem na soja, que nodulou somente com a dose mais elevada, sugerindo que o Rhizobium japonicum no solo estudado estava presente em baixo número. O tratamento com herbicida mostrou tendência de favorecer a nodulação e, conseqüentemente, a fixação biológica de N2, medida através do N na planta.The addition of vinasse on sugar cane plantations nearby alcohol fermentation plants is a common practice. Legumes are recommended to be intercropped with sugar cane. A greenhouse experiment was carried out with the objective of verifying the influence of continuous application of vinasse (0; 100 and 1000 m³/ha/year at six month interval during three years on soil rhizobia which nodulate peanuts, soybeans, dry-beans and crotalaria
Energy Technology Data Exchange (ETDEWEB)
Rinaldi, F.; Meza, A; Gulmarges, B
2009-01-01
Disulfide oxidoreductase DsbA catalyzes disulfide bond formation in proteins secreted to the periplasm and has been related to the folding process of virulence factors in many organisms. It is among the most oxidizing of the thioredoxin-like proteins, and DsbA redox power is understood in terms of the electrostatic interactions involving the active site motif CPHC. The plant pathogen Xylella fastidiosa has two chromosomal genes encoding two oxidoreductases belonging to the DsbA family, and in one of them, the canonical motif CPHC is replaced by CPAC. Biochemical assays showed that both X. fastidiosa homologues have similar redox properties and the determination of the crystal structure of XfDsbA revealed substitutions in the active site of X. fastidiosa enzymes, which are proposed to compensate for the lack of the conserved histidine in XfDsbA2. In addition, electron density maps showed a ligand bound to the XfDsbA active site, allowing the characterization of the enzyme interaction with an 8-mer peptide. Finally, surface analysis of XfDsbA and XfDsbA2 suggests that X. fastidiosa enzymes may have different substrate specificities.
Demystifying "oxi" cocaine: Chemical profiling analysis of a "new Brazilian drug" from Acre State.
da Silva Junior, Ronaldo C; Gomes, Cezar S; Goulart Júnior, Saulo S; Almeida, Fernanda V; Grobério, Tatiane S; Braga, Jez W B; Zacca, Jorge J; Vieira, Maurício L; Botelho, Elvio D; Maldaner, Adriano O
2012-09-10
Recent information from various sources suggests that a new illicit drug, called "oxi", is being spread across Brazil. It would be used in the smoked form and it would look like to crack cocaine: usually small yellowish or light brown stones. As fully released in the media, "oxi" would differ from crack cocaine in the sense that crack would contain carbonate or bicarbonate salts whereas "oxi" would include the addition of calcium oxide and kerosene (or gasoline). In this context, this work presents a chemical profiling comparative study between "oxi" street samples seized by the Civil Police of the State of Acre (CP/AC) and samples associated with both international and interstate drug trafficking seized by the Brazilian Federal Police in Acre (FP/AC). The outcome of this work assisted Brazilian authorities to stop inaccurate and alarmist releases on this issue. It may be of good use by the forensic community in order to better understand matters in their efforts to guide local law enforcement agencies in case such claims reach the international illicit market. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Adolfo de Francisco Zea
2008-06-01
“Su silueta alta, magra, elegante; sus rasgos bien modelados de pulcritud impecable expresan dignidad y decoro y revelan al patricio de noble estirpe, de alma pura, íntegra, de honradez inmaculada; en sus párpados se marcan las huellas de las meditaciones y desvelos del hombre de ciencia; su frente amplia surcada por arrugas que revelan el pensar profundo, está decorada por abundante cabellera en la que se ve la nieve de los años; su rostro enmarcado por barba poblada, casi blanca, expresa a la vez que energía de carácter, austeridad y altivez; pero para los que lo conocimos en la intimidad, ese aspecto a la vez austero y adusto se transformaba en el trato familiar en bondad, cultura y cordialidad que una espontánea y atrayente sonrisa solía matizar”...
Schistosome serine protease inhibitors: parasite defense or homeostasis?
Directory of Open Access Journals (Sweden)
Landys A. Lopez Quezada
2011-06-01
Full Text Available Serpins are a structurally conserved family of macromolecular inhibitors found in numerous biological systems. The completion and annotation of the genomes of Schistosoma mansoni and Schistosoma japonicum has enabled the identification by phylogenetic analysis of two major serpin clades. S. mansoni shows a greater multiplicity of serpin genes, perhaps reflecting adaptation to infection of a human host. Putative targets of schistosome serpins can be predicted from the sequence of the reactive center loop (RCL. Schistosome serpins may play important roles in both post-translational regulation of schistosome-derived proteases, as well as parasite defense mechanisms against the action of host proteases.Serpinas são uma família de inibidores macromoleculares estruturalmente conservados encontrados em inúmeros sistemas biológicos. O término e a anotação dos genomas de Schistosoma mansoni e de Schistosoma japonicum permitiram a identificação por análise filogenética de dois principais clados de serpinas. S. mansoni mostra uma multiplicidade maior de genes de serpinas, talvez refletindo uma adaptação à infecção de um hospedeiro humano. Alvos putativos das serpinas de esquistossomos podem ser preditos a partir da sequência do "loop" do centro reativo. Serpinas de esquistossomos podem ter importantes papeis tanto na regulação pós-traducional de proteases derivadas do esquistossoma, quanto nos mecanismos de defesa contra a ação de proteases do hospedeiro.
Directory of Open Access Journals (Sweden)
Guo-Jing Yang
2006-11-01
Full Text Available Political and health sector reforms, along with demographic, environmental and socio-economic transformations in the face of global warming, could cause the re-emergence of schistosomiasis in areas where transmission has been successfully interrupted and its emergence in previously non-endemic areas in China. In the present study, we used geographic information systems and remote sensing techniques to predict potential habitats of Oncomelania hupensis, the intermediate host snail of Schistosoma japonicum. Focussing on the Hongze, Baima and Gaoyou lakes in Jiangsu province in eastern China, we developed a model using the normalized difference vegetation index, a tasseled-cap transformed wetness index, and flooding areas to predict snail habitats at a small scale. Data were extracted from two Landsat images, one taken during a typical dry year and the other obtained three years later during a flooding event. An area of approximately 163.6 km2 was predicted as potential O. hupensis habitats around the three lakes, which accounts for 4.3% of the estimated snail habitats in China. In turn, these predicted snail habitats are risk areas for transmission of schistosomiasis, and hence illustrate the scale of the possible impact of climate change and other ecological transformations. The generated risk map can be used by health policy makers to guide mitigation policies targetting the possible spread of O. hupensis, and with the aim of containing the transmission of S. japonicum.
Dongbao, Y; Ross, A G; Musheng, X; Yuesheng, L; Yan, C
1999-12-01
A region-wide sampling survey was conducted in 1995 in order to evaluate the current epidemiological status of schistosomiasis japonica in Hunan Province, China. A total of 45,590 humans and 3,726 domestic animals, from 52 villages, were examined parasitologically and/or serologically for current Schistosoma japonicum infections. In uncontrolled endemic areas (43 villages) the overall human prevalence of S. japonicum was 7.81% across the different geographical subtypes. The geometric mean intensity of infection was 17.71 eggs per gram (epg) among infected individuals and only 1.25 epg in the general population. The bovine prevalence, as determined by the hatching test, was 9.63% in the uncontrolled endemic villages. Only one sero-positive (by indirect hemagglutination assay) child was found among 1,072 children tested aged 10-14 years in the 9 endemic villages under effective control. No infection was confirmed by the Kato-Katz thick smear stool examination. When the results of this survey were compared to those seen at baseline (1989) an overall reduction of 45.65% was seen in the human prevalence but no significant change was apparent in the lake-beach ecotype. Additionally, there was more than a 60% reduction in the prevalence among bovines over the same sampling period. The results demonstrate that the World Bank Loan Schistosomiasis Program was successful in achieving its most basic objectives for this province - to reduce human and bovine infections by 40%.
Subramaniam, Sarasvathy; Sabaratnam, Vikineswary; Kuppusamy, Umah Rani; Tan, Yee Shin
2014-01-01
Species of the genus Ganoderma are a cosmopolitan wood decaying white rot fungi, which has been used by the Asians for therapeutic purposes for centuries. In the present study, solid-substrate fermentation (SSF) of wheat grains (Triticum aestivum L.) was carried out with indigenous Ganoderma australe (KUM60813) and G. neo-japonicum (KUM61076) selected based on ethnomycological knowledge. G. lucidum (VITA GL) (a commercial strain) was also included in the study. Antioxidant activities of the crude ethanol and aqueous extracts of the fermented and unfermented wheat grains were investigated by ferric reducing antioxidant power (FRAP), Trolox equivalent antioxidant capacity (TEAC), diphenyl-1-picryl-hydrazyl (DPPH) free radical scavenging ability, and lipid peroxidation assay. Among the six mycelia extracts tested, the ethanol extract from wheat fermented with KUM61076 mycelia showed the most potent antioxidant activities, whereas the ethanol extract of wheat grains fermented with KUM60813 mycelia has a good potential in protecting frying oils against oxidation. Total phenolic content (TPC) in the ethanol extracts were higher than that in the aqueous extract. The wheat grains fermented with G. australe (KUM60813) and G. neo-japonicum KUM61076 have greater antioxidant potential compared to the commercially available G. lucidum (VITA GL). The antioxidant activities of the mycelia extracts had a positive correlation with their phenolic contents. Thus phenolic compounds may play a vital role in the antioxidant activities of the selected Ganoderma spp.
Informe científico de investigador: Balatti, Pedro Alberto (2013-2014)
Balatti, Pedro Alberto
2014-01-01
En lo que hace a los estudios de Bradyrhizobium japonicum se finalizaron los estudios de mapeo de SSR asociados a QTLs de nodulación en cultivares de soja. Se están analizando los resultados y el becario Darío Salvucci ha finalizado su manuscrito final lo ha entregado a los evaluadores y esta esperando le den fecha de defensa. . En este sentido se identificaron en una población de soja proveniente de un cruzamiento entre un cultivar de alta y otro de baja capacidad...
Xia, Q; Tan, P; Feng, X; Chen, M; Kajihara, N; Minai, M; Hosaka, Y
1992-04-01
Molluscicidal activities of Tribromosalan, Cartap and Chlorothalonil were evaluated in the laboratory and the field against Oncomelania hupensis, the intermediate host of Schistosoma japonicum in China. The three chemicals were very effective against O. hupensis in the laboratory. The molluscicidal activities found in the field trials suggest that Tribromosalan and Cartap may be used as practical molluscicides. Dosage of 10 g/m2 of Tribromosalan in spring only and 20 g/m2 of Cartap in both spring and autumn would be recommendable as practical mollusciciding doses for the control of O. hupensis.
Directory of Open Access Journals (Sweden)
Rita Macedo
2009-05-01
Full Text Available Resumo: Uma das principais problemáticas no controlo da tuberculose é o aparecimento de casos de tuberculose multirresistente (TB-MR e tuberculose extensiva-mente resistente (TB-XDR. A detecção precoce da resistência a fármacos, directamente a partir de amostras respiratórias, é essencial para que se assegure o tratamento atempado, adequado e eficaz da tuberculose, bem como para prevenir a disseminação destes casos de especial gravidade.O nosso objectivo foi avaliar a sensibilidade e comparar os resultados obtidos com um método de genética molecular disponÃvel comercialmente â MTBDRplus® â e o isolamento, identificação e testes de sensibilidade clássicos, directamente a partir de amostras respiratórias. Estudamos 68 amostras, com baciloscopia positiva.O MTBDRplus® permitiu identificar, directamente a partir das amostras respiratórias, o complexo Mycobacte-rium tuberculosis em todos os casos em que o estudo cultural e a identificação clássica chegaram a esse mesmo resultado. Nas amostras em que culturalmente iso-lámos estirpes sensÃveis, com o MTBDRplus® encontrá-mos sempre perfis genéticos do tipo selvagem (63,2%. Relativamente à s amostras em que culturalmente isolá-mos estirpes resistentes, com o MTBDRplus® encontrámos sempre perfis genéticos com mutações ou com au-sência do perfil do tipo selvagem (36,8%.Este estudo permitiu concluir que o MTBDRplus® assegura a detecção rápida de resistências a fármacos em estirpes do complexo M. tuberculosis, com resultados totalmente sobreponÃveis aos obtidos com os mé-todos bacteriológicos clássicos.Rev Port Pneumol 2009; XV (3: 353-366 Abstract: Nowadays, the greatest concern of tuberculosis control programmes is the appearance of multidrug-resistant tuberculosis and extensively drug-resistant tuberculosis. Rapid determination of drug resistance in clinical
Directory of Open Access Journals (Sweden)
Simone de Souza Prado
2008-01-01
Full Text Available Citrus variegated chlorosis (CVC and coffee stem atrophy (CSA are important diseases in Brazil associated with closely-related strains of Xylella fastidiosa, but little is know about host aoverlappingnd importance of citrus and coffee as inoculum sources of these strains. In this study, reciprocal-inoculation experiments were performed to determine if CVC and CSA isolates are biologically similar within citrus and coffee plants. These two hosts were mechanically inoculated with a CVC and a CSA isolate of X. fastidiosa at four concentrations ranging between10³ and 10(9 colony forming units CFU mL-1. At two, four and eight months after inoculation, the infection efficiency and bacterial populations of the isolates in each host were determined by culturing. The CVC isolate infected both citrus and coffee plants, but developed lower populations in coffee. The CSA isolate did not colonize citrus. Inoculation of coffee plants with the CVC isolate resulted in low rates of infection and required an inoculum concentration ten-fold higher than that necessary to obtain a similar (25% rate of infection in citrus. The relatively low infection rates and bacterial numbers of the CVC isolate in coffee plants compared with those observed in citrus suggest that coffee is not a suitable host to serve as a source of inoculum of the CVC strain for primary spread to citrus or within coffee plantations.Clorose variegada dos citros (CVC e atrofia dos ramos do cafeeiro (ARC são doenças importantes no Brasil, associadas a estirpes de Xylella fastidiosa que são geneticamente próximas. Entretanto, pouco se sabe a respeito de plantas hospedeiras em comum e da importância de citros e cafeeiro como fontes de inóculo dessas estirpes. Neste estudo, realizaram-se experimentos de inoculação recíproca para determinar se isolados de X. fastidiosa de CVC e de ARC são biologicamente semelhantes em plantas de citros e café. Estes dois hospedeiros foram mecanicamente
Directory of Open Access Journals (Sweden)
Fabiana Miraglia
2008-09-01
Full Text Available With the aim of isolating Leptospira spp., blood serum, kidney, liver and genital tract of 137 female swine (40 sows and 97 gilts and also urine samples from 22 sows were collected in a slaughterhouse in the State of São Paulo, from April 2003 to August 2004. Four isolates were obtained from animals that presented microagglutination test (MAT titers > 100 for the serovar Pomona and one was obtained from an animal negative by MAT in which Leptospira was isolated from the liver and reproductive tract. The presence of leptospiral DNA was investigated by PCR, and positive results were found in kidneys of 11 females, liver of two, genital tract of two and urine of one of them. Nephrosis, interstitial multifocal nephritis, moderate to severe changing, hyalines cylinders and hemorrhagic focuses, hepatic and uterine horns congestion were histological lesions observed in higher frequency in animals positive for leptospira. The silver impregnation (Warthin Starry confirmed the presence of spirochetes in renal tubules of four females with positive leptospira cultures from kidneys. The serogroup of the five isolates was identified as Pomona by cross agglutination with reference polyclonal antibodies. Molecular characterization of the isolates was carried out by variable-number tandem-repeats analysis. All the isolates revealed a pattern distinct from the L. interrogans Pomona type strain, but identical to a previously identified pattern from strains isolated in Argentina belonging to serovar Pomona.Amostras de soro sanguíneo, rim, fígado e trato genital de 137 fêmeas suínas (40 matrizes e 97 marrãs e de urina de 22 matrizes foram colhidas em abatedouro no Estado de São Paulo, no período de abril de 2003 a agosto de 2004 tendo como objetivo o isolamento de Leptospira spp. Quatro estirpes foram isoladas de animais que apresentaram títulos, no teste de soroaglutinação microscópica (SAM > 100, para o sorovar Pomona e de um animal, não reagente na
Directory of Open Access Journals (Sweden)
O.M. de Castro
1993-09-01
Full Text Available Para avaliar o efeito do manejo do solo e de culturas sobre a atividade de Bradyrhizobium japonicum e de outros microrganismos importantes na ciclagem de nutrientes do solo, montou-se um experimento em casa de vegetação utilizando solo de um ensaio de campo com sistemas de manejo de resíduos e preparo bem distintos, como plantio direto e preparo convencional com arado de discos e diferentes rotações de cultura. O solo é um latossolo roxo distrófico, A moderado, textura argilosa. As culturas utilizadas no ensaio de campo foram soja contínua e em rotação com milho, sempre após aveia preta e Crolalaria juncea no outono-inverno, perfazendo portanto oito sistemas de manejo. Como testemunha, utilizou-se o solo de uma mata localizada próxima do experimento de campo. Prepararam-se seis vasos com solo de cada tratamento, sendo que em três foi semeada soja com sementes inoculadas com B. japonicum e nos outros três soja sem inoculação. No início do florescimento fez-se a colheita das plantas para análise de N na parte aérea, determinação dos nódulos e micorrização. Em amostras de solo de todos os tratamentos, guardadas em geladeira, fez-se a quantificação de bactérias e fungos totais, bem como de microrganismos celulolíticos, amonifícadores, nitritadores e nitratadores. Os resultados obtidos revelaram que o solo do plantio direto e o sistema de rotação levaram a significativos aumentos da nodulação. O solo do plantio direto apresentou também maiores populações de celulolíticos, não havendo diferença para outros tipos de microrganismos. Não houve diferença entre tratamentos para a micorrização, que apresentou valores muito baixos, provavelmente devido ao alto nível de fósforo no solo.A greenhouse experiment was set up to evaluate the effect of different cultural practices on the activity of Bradyrhizobium japonicum and of other soil microorganisms involved in nutrient cycling. The soil used was from a field
Directory of Open Access Journals (Sweden)
Fábio Martins Mercante
2000-06-01
Full Text Available Muitos aspectos ecológicos envolvidos nas interações entre espécies leguminosas e estirpes de rizóbio têm sido facilmente entendidos com o emprego de técnicas que utilizam genes marcadores. A introdução de um gene marcador específico tem se mostrado altamente viável para análises dessas interações. Os genes marcadores são capazes de codificar para produtos que podem ser facilmente identificados ou medidos, especialmente, enzimas que podem atuar em diferentes substratos, fornecendo produtos coloridos ou fluorescentes facilmente detectáveis. De uma maneira geral, os genes marcadores têm sido utilizados em diferentes aspectos da ecologia microbiana, como nos estudos de competição entre estirpes de rizóbio, expressão de genes simbióticos, colonização da rizosfera e raízes, entre outros. Em todos esses estudos, os genes repórteres precisam ser introduzidos no genoma alvo através de um plasmídeo ou por inserção cromossomal. Nesta revisão, são enfatizados, principalmente, os diversos usos e aplicações de genes marcadores nos estudos de ecologia microbiana, com ênfase no sistema GUS (b-glucuronidase.Many of the ecological aspects involved with the interactions between legume species and rhizobia strains have been made easily to understood with the use of reporter gene techniques. The introduction of a specific reporter gene in an organism has shown to be highly efficient to analyze such interactions. These reporter genes generally code for products that can be easily identified or measured, mainly enzymes that can act on a variety of substrates, supplying colored or fluorescent detectable products. In general, the marker genes have been used in different aspects of microbial ecology, as in the competition studies among rhizobia strains, symbiotic gene expression, rhizosphere and root colonization, among others. In all studies, the marker genes need to be introduced into the genome by a plasmid or through a chromosomal
Directory of Open Access Journals (Sweden)
Otero Piñeyro Maseda, Pablo S.
2013-12-01
Full Text Available The identification and study of the lineages which made up the galician nobility pyramid in the Late Middle Ages must be based on a meticulous analysis of the sources, amoung which the most noteworthy are wills of testament due to there rich quantity of information. The objective of this work is to offer some preliminary ideas regarding this type of document. By examining diferent tendencies and describing methodologies, it is possible to make the best use of the information held within these documents in order to improve the study of the social history of the nobility. This work includes the publication and commentary of the wills of testament of three members of the Valladares lineage from the Late Middle Ages.La identificación y estudio de los linajes que conformaron la pirámide nobiliaria gallega en la Baja Edad Media deben fundamentarse en un cuidadoso análisis de las fuentes, entre las que destacan por su especial caudal informativo los testamentos. El objetivo de estas páginas es ofrecer unas primeras reflexiones sobre esta tipología documental: examinar algunas tendencias y anotar cuestiones metodológicas para el mejor aprovechamiento de sus posibilidades en el contexto de la historia social de la nobleza. El estudio se completa, o ilustra, con la edición y comentario de los testamentos de tres personajes de la estirpe de los Valladares, todos del final de la Edad Media. [gl] A identificación e estudo das liñaxes que conformaron a pirámide nobiliaria galega na Baixa Idade Media deben fundamentarse nunha coidadosa análise das fontes, entre as que destacan polo seu especial caudal informativo os testamentos. O obxectivo destas páxinas é ofrecer unhas primeiras reflexións sobre esta tipoloxía documental: examinar algunhas tendencias e anotar cuestións metodolóxicas para o mellor aproveitamento das súas posibilidades no contexto da historia social da nobreza. O estudo complétase, ou ilústrase, coa edición e comentario
Directory of Open Access Journals (Sweden)
Waldeídes Castro Sousa
2013-10-01
Full Text Available Avaliaram-se fontes de nitrogênio (N e proporções de caule decomposto de buritizeiro (Mauritia flexuosa L.f. na nodulação, crescimento e nos índices biométricos das mudas de tamboril [Enterolobium contortsiliquum (Vell. Morong] na região sudoeste do Piauí. O delineamento experimental foi inteiramente casualizado em esquema fatorial 3x5, com cinco repetições. Foram testadas três fontes de N (N-mineral, N do substrato e inoculação com a estirpe Bradyrhizobium elkanii BR 4406 e cinco proporções de caule decomposto de buritizeiro:solo (v/v, %: 0: 100; 10: 90; 20: 80; 40: 60; 80: 20. A emergência das plântulas foi avaliada diariamente até o décimo terceiro dia após a semeadura. Aos 80 dias, as mudas foram coletadas para as determinações da nodulação, do crescimento e dos índices biométricos. As mudas que foram cultivadas com os substratos contendo caule decomposto de buritizeiro apresentaram maior crescimento e nodulação, em relação às que foram cultivadas no substrato 0: 100 (caule decomposto de buritizeiro: solo. A obtenção de máximo Índice de Qualidade de Dickson foi com 48: 52 (caule decomposto de buritizeiro: solo, sendo, portanto, esta a proporção recomendada para a produção de mudas. Com relação às fontes de nitrogênio, a estirpe BR 4406 não foi eficiente em promover ganhos no teor de nitrogênio e matéria seca da parte aérea, em relação ao tratamento com N-mineral. As populações nativas de bactérias diazotróficas presentes no substrato que não recebeu N-mineral e nem inoculação foram capazes de nodular eficientemente o tamboril, uma vez que promoveram acréscimos no teor de nitrogênio e matéria seca da parte aérea equivalentes ao tratamento adubado com N-mineral.
Symbiotic Properties of Sinorhizobium Fredii, J-TGS50 an Indonesian Soybean Nodule Forming Bacteria
International Nuclear Information System (INIS)
Setiyo Hadi Waluyo
2004-01-01
Green House experiments were conducted to study symbiotic properties of Sinorhizobium Fredii, J-TGS50. Sinorhizobium Fredii USDA 192, USDA 201, USDA 205, USDA 206, USDA 217 and Bradyrhizobium japonicum USDA 110 were used as references. Yeast extract mannitol broth culture of the bacteria were made and used as inoculation for several local and imported soybean varieties used in this study. Plants were harvested at 20 days after inoculation. Number of nodules were counted, fresh weight of nodules and shoot were determined. S. Fredii J-TGS50 and S. Fredii USDA 192, USDA 201, USDA 205, USDA 206, USDA 217 were found different in their symbiotic properties. S. Fredii J-TGS50 formed nodules on same imported soybean. While there were no nodules obtained from the plant inoculated with S. Fredii USDA 192, USDA 201, USDA 205, USDA 206, USDA 217. S. Fredii J-TGS50 and recommended B. Japonicum USDA 110 formed nodule on several local soybean varieties. There was no differences between those two bacteria either in nodulation efficiency or in the effectiveness of the formed nodules. Results of this study can be concluded that S. Fredii, J-TGS50 is a native to Indonesian soil and it is a promising soybean nodule forming bacteria in Indonesia. Using indigenous bacteria is valuable. Since they are mostly more tolerant and adaptable than the introduced ones. An important aspect for the success of Biological Nitrogen Fixation (BNF) is insight in the structure of indigenous soybean rhizobia populations. Study on the biodiversity of soybean rhizobia was important conducted. (author)
Avula, Bharathi; Sagi, Satyanarayanaraju; Gafner, Stefan; Upton, Roy; Wang, Yan-Hong; Wang, Mei; Khan, Ikhlas A
2015-10-01
Ginkgo biloba is one of the most widely sold herbal supplements and medicines in the world. Its popularity stems from having a positive effect on memory and the circulatory system in clinical studies. As ginkgo popularity increased, non-proprietary extracts were introduced claiming to have a similar phytochemical profile as the clinically tested extracts. The standardized commercial extracts of G. biloba leaf used in ginkgo supplements contain not less than 6% sesquiterpene lactones and 24% flavonol glycosides. While sesquiterpene lactones are unique constituents of ginkgo leaf, the flavonol glycosides are found in many other botanical extracts. Being a high value botanical, low quality ginkgo extracts may be subjected to adulteration with flavonoids to meet the requirement of 24% flavonol glycosides. Chemical analysis by ultra high performance liquid chromatography-mass spectrometry revealed that adulteration of ginkgo leaf extracts in many of these products is common, the naturally flavonol glycoside-rich extract being spiked with pure flavonoids or extracts made from another flavonoid-rich material, such as the fruit/flower of Japanese sophora (Styphnolobium japonicum), which also contains the isoflavone genistein. Recently, genistein has been proposed as an analytical marker for the detection of adulteration of ginkgo extracts with S. japonicum. This study confirms that botanically authenticated G. biloba leaf and extracts made therefrom do not contain genistein, and the presence of which even in trace amounts is suggestive of adulteration. In addition to the mass spectrometric approach, a high performance thin layer chromatography method was developed as a fast and economic method for chemical fingerprint analysis of ginkgo samples.
Directory of Open Access Journals (Sweden)
Weisi Wang
2017-08-01
Full Text Available Malaria and schistosomiasis are two of the most socioeconomically devastating parasitic diseases in tropical and subtropical countries. Since current chemotherapeutic options are limited and defective, there is an urgent need to develop novel antiplasmodials and antischistosomals. Hemozoin is a disposal product formed from the hemoglobin digestion by some blood-feeding parasites. Hemozoin formation is an essential process for the parasites to detoxify free heme, which is a reliable therapeutic target for identifying novel antiparasitic agents. A series of novel carbazole aminoalcohols were designed and synthesized as potential antiplasmodial and antischistosomal agents, and several compounds showed potent in vitro activities against Plasmodium falciparum 3D7 and Dd2 strains and adult and juvenile Schistosoma japonicum. Investigations on the dual antiparasitic mechanisms showed the correlation between inhibitory activity of β-hematin formation and antiparasitic activity. Inhibiting hemozoin formation was identified as one of the mechanisms of action of carbazole aminoalcohols. Compound 7 displayed potent antiplasmodial (Pf3D7 IC50 = 0.248 μM, PfDd2 IC50 = 0.091 μM and antischistosomal activities (100% mortality of adult and juvenile schistosomes at 5 and 10 μg/mL, respectively and exhibited low cytotoxicity (CC50 = 7.931 μM, which could be considered as a promising lead for further investigation. Stoichiometry determination and molecular docking studies were also performed to explain the mode of action of compound 7. Keywords: Carbazole aminoalcohols, Plasmodium falciparum, Schistosoma japonicum, Antiplasmodials, Antischistosomals, Hematin
Paradiso, Roberta; Buonomo, Roberta; Dixon, Mike A.; Barbieri, Giancarlo; De Pascale, Stefania
2014-02-01
Soybean [Glycine max (L.) Merr.] is one of the plant species selected within the European Space Agency (ESA) Micro-Ecological Life Support System Alternative (MELiSSA) project for hydroponic cultivation in Biological Life Support Systems (BLSSs), because of the high nutritional value of seeds. Root symbiosis of soybean with Bradirhizobium japonicum contributes to plant nutrition in soil, providing ammonium through the bacterial fixation of atmospheric nitrogen. The aim of this study was to evaluate the effects of two hydroponic systems, Nutrient Film Technique (NFT) and cultivation on rockwool, and two nitrogen sources in the nutrient solution, nitrate (as Ca(NO3)2 and KNO3) and urea (CO(NH2)2), on root symbiosis, plant growth and seeds production of soybean. Plants of cultivar 'OT8914', inoculated with B. japonicum strain BUS-2, were grown in a growth chamber, under controlled environmental conditions. Cultivation on rockwool positively influenced root nodulation and plant growth and yield, without affecting the proximate composition of seeds, compared to NFT. Urea as the sole source of N drastically reduced the seed production and the harvest index of soybean plants, presumably because of ammonium toxicity, even though it enhanced root nodulation and increased the N content of seeds. In the view of large-scale cultivation for space colony on planetary surfaces, the possibility to use porous media, prepared using in situ resources, should be investigated. Urea can be included in the nutrient formulation for soybean in order to promote bacterial activity, however a proper ammonium/nitrate ratio should be maintained.
Dicty_cDB: Contig-U15443-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available lic Acid Glyc... 42 7e-04 2 ( EL475659 ) CHUL3619.b1_F17.ab1 CHU(LMS) puzzle sunf...Schistosoma japonicum cDNA similar ... 42 0.12 2 ( EL482406 ) CHUM4387.b1_F17.ab1 CHU(LMS) puzzle sunflower ...200.b1_O04.ab1 CHU(LMS) puzzle sunflower Hel... 42 5e-04 3 ( CD414213 ) Gm_ck46258 Soybean induced by Salicy.... 58 2e-04 2 ( EH303465 ) UAHYP_14C_F_G04 UaHyphae_ARS Uromyces appendicula... 46 3e-04 2 ( EL483290 ) CHUM5
Pollos cuello desnudo alimentados con harina de Morus alba y Cajanus cajan
Directory of Open Access Journals (Sweden)
Tito Solís-Barros
2017-12-01
Full Text Available El objetivo de la investigación fue estudiar el comportamiento productivo de pollos cuello desnudo heterocigotos que se alimentaron con harina de hojas de Morus alba y granos de Cajanus cajan tostados a 120 ºC por 12 min, se utilizaron 144 pollos sexados de la estirpe T451N de 1 a 90 d de edad. Se distribuyeron según diseño de bloques al azar, en tres tratamientos, 48 pollos por tratamiento repartidos en ocho réplicas. Fueron criados en piso, en instalaciones rústicas. Se evaluaron indicadores productivos como el consumo de alimento, ganancia de peso promedio diario, conversión alimentaria y la eficiencia en el uso de los nutrientes. Los tratamientos fueron: T1=Control, T2=5% Cajanus cajan y 3% Morus alba y T3=3% C. cajan y 5% M. alba. El control consumió maíz y soya, como dieta base. La mayor ingestión de alimento (p
Energy Technology Data Exchange (ETDEWEB)
Caribe, Rebeka Alves; Colaco, Waldeciro [Pernambuco Univ., Recife, PE (Brazil). Dept. de Energia Nuclear
2002-07-01
Native Rhizobium sp. and Bradyrhizobium sp. isolates from the root nodules of bean and cowpea were selected. Six isolates, and the SEMIA 4077 (R. leguminosarum bv. phaseolus) and SEMIA 6145 (Bradyrhizobium sp) strains used as references, were irradiated with ultraviolet light (R-uv) and gamma rays (R-{gamma}). The D{sub 37} values for the rhizobial strain SEMIA 4077 were 43 J.m{sup -2} (UV) and 32 Gy (R-{gamma}) and for the SEMIA 6145 were 45 J.m{sup -2} (UV) and 35 Gy (R-gamma). Through a greenhouse experiment the irradiated isolates were inoculated on bean (P. vulgaris L., cv. Princesa) and on cowpea [Vigna unguiculata, (L.) Walp, cv. IPA-206] seedlings, in an attempt to evaluate the sensitivity of the host plants, and possible effects on their nodulation. Differences in responses to nodulation due to the effect of irradiation were observed for the isolates tested. Significantly differences were observed only for nodules dry matter yield of the IPA-206 cultivar. Gamma irradiated treatment were statistically superior to treatments with ultraviolet light in relation. (author)
Biophysical investigation of type A PutAs reveals a conserved core oligomeric structure
Energy Technology Data Exchange (ETDEWEB)
Korasick, David A. [Department of Biochemistry, University of Missouri, Columbia MO USA; Singh, Harkewal [Department of Chemistry, University of Missouri, Columbia MO USA; Pemberton, Travis A. [Department of Chemistry, University of Missouri, Columbia MO USA; Luo, Min [Department of Chemistry, University of Missouri, Columbia MO USA; Dhatwalia, Richa [Department of Chemistry, University of Missouri, Columbia MO USA; Tanner, John J. [Department of Biochemistry, University of Missouri, Columbia MO USA; Department of Chemistry, University of Missouri, Columbia MO USA
2017-08-01
Many enzymes form homooligomers, yet the functional significance of self-association is seldom obvious. Herein, we examine the connection between oligomerization and catalytic function for proline utilization A (PutA) enzymes. PutAs are bifunctional enzymes that catalyze both reactions of proline catabolism. Type A PutAs are the smallest members of the family, possessing a minimal domain architecture consisting of N-terminal proline dehydrogenase and C-terminal l-glutamate-γ-semialdehyde dehydrogenase modules. Type A PutAs form domain-swapped dimers, and in one case (Bradyrhizobium japonicum PutA), two of the dimers assemble into a ring-shaped tetramer. Whereas the dimer has a clear role in substrate channeling, the functional significance of the tetramer is unknown. To address this question, we performed structural studies of four-type A PutAs from two clades of the PutA tree. The crystal structure of Bdellovibrio bacteriovorus PutA covalently inactivated by N-propargylglycine revealed a fold and substrate-channeling tunnel similar to other PutAs. Small-angle X-ray scattering (SAXS) and analytical ultracentrifugation indicated that Bdellovibrio PutA is dimeric in solution, in contrast to the prediction from crystal packing of a stable tetrameric assembly. SAXS studies of two other type A PutAs from separate clades also suggested that the dimer predominates in solution. To assess whether the tetramer of B. japonicum PutA is necessary for catalytic function, a hot spot disruption mutant that cleanly produces dimeric protein was generated. The dimeric variant exhibited kinetic parameters similar to the wild-type enzyme. These results implicate the domain-swapped dimer as the core structural and functional unit of type A PutAs.
Osińska-Jaroszuk, Monika; Jaszek, Magdalena; Starosielec, Magdalena; Sulej, Justyna; Matuszewska, Anna; Janczarek, Monika; Bancerz, Renata; Wydrych, Jerzy; Wiater, Adrian; Jarosz-Wilkołazka, Anna
2018-03-26
Four bacterial EPSs extracted from Rhizobium leguminosarum bv. trifolii Rt24.2, Sinorhizobium meliloti Rm1021, Bradyrhizobium japonicum USDA110, and Bradyrhizobium elkanii USDA76 were determined towards their metal ion adsorption properties and possible modification of Cerrena unicolor laccase properties. The highest magnesium and iron ion-sorption capacity (~ 42 and ~ 14.5%, respectively) was observed for EPS isolated from B. japonicum USDA110. An evident influence of EPSs on the stability of laccase compared to the control values (without EPSs) was shown after 30-day incubation at 25 °C. The residual activity of laccases was obtained in the presence of Rh76EPS and Rh1021EPS, i.e., 49.5 and 41.5% of the initial catalytic activity, respectively. This result was confirmed by native PAGE electrophoresis. The EPS effect on laccase stability at different pH (from 3.8 to 7.0) was also estimated. The most significant changes at the optimum pH value (pH 5.8) was observed in samples of laccase stabilized by Rh76EPS and Rh1021EPS. Cyclic voltamperometry was used for analysis of electrochemical parameters of laccase stabilized by bacterial EPS and immobilized on single-walled carbon nanotubes (SWCNTs) with aryl residues. Laccases with Rh76EPS and Rh1021EPS had an evident shift of the value of the redox potential compared to the control without EPS addition. In conclusion, the results obtained in this work present a new potential use of bacterial EPSs as a metal-binding component and a modulator of laccase properties especially stability of enzyme activity, which can be a very effective tool in biotechnology and industrial applications.
An economic evaluation of the national schistosomiasis control programme in China from 1992 to 2000.
Zhou, Xiao-Nong; Wang, Li-Ying; Chen, Ming-Gang; Wang, Tian-Ping; Guo, Jia-Gang; Wu, Xiao-Hua; Jiang, Qing-Wu; Zheng, Jiang; Chen, Xian-Yi
2005-01-01
The World Bank Loan Project, by far the largest effort in China for schistosomiasis control since control activities were initiated in the mid 1950s, was carried out for a 9-year period commencing in 1992 in the 8 provinces where Schistosoma japonicum remained endemic when the project started. To evaluate its impact, a retrospective economic evaluation was done in 2001. Six representative counties, i.e. Huarong in Hunan province, Qianjiang in Hubei province, Yugan in Jiangxi province, Tongling in Anhui province, Xichang in Sichuan province and Dali in Yunnan province, were selected for the study. The total financial input in these counties from 1992 to 2000 was RMB Yuan 90.334 million with the World Bank loan accounting for 40.9%. Control efforts resulted in reduction of human prevalence rates in the six counties from 0.7-9.0% in 1992 to 0.1-2.7% in 2000. With regard to S. japonicum infection in bovines, a high reduction was observed in Qianjiang, and smaller decreases were noted in four counties, while there was an increase in Dali. In general, the areas infested by the intermediate host snail fluctuated around the initial level. The net benefit-cost ratio was 6.20, which means that this project gained US$ 6.20 for every dollar spent. The correlation coefficients of the net benefit-cost ratio to the human and bovine infection rates at the beginning of the project were 0.55 and 0.66, respectively. It is conceivable that further progress in schistosomiasis control is an important feature for sustained growth of the local economy, particularly in areas where control of the disease has been most challenging.
Effect of neem cake/fertilizers on symbiotic and non-symbiotic N2 fixing bacteria
International Nuclear Information System (INIS)
Akhtar, S.; Solangi, A.H.; Gilani, G.; Pirzada, M.H.
2002-01-01
Neem cake amendment in soil at 1.3% no adverse effect on the population of four symbiotic Rhizobium species viz., japonicum, R. leguminosarum, R. Phaseoli and R. Fredii and three non-symbiotic free living nitrogen fixers bacteria viz., Pseudomonas diazotrophicus, Klebsiella planticola and Enterobacter cloacae. Neem cake extracted with n-hexane stimulated the growth of Rhizobium species in vitro, whereas Neem cake expeller extracted neither inhibited nor stimulated the growth of Rhizobium species except for R. Fredii, whose was slightly retarded. The fertilizers (urea, NPK and DAP) had no adverse effect on these bacteria even at the dosage ten times higher the recommended dose. (author)
Directory of Open Access Journals (Sweden)
Tharwat El-Sayed El-Desouk Radwan
2005-10-01
Full Text Available Foi analisada a produção de compostos indólicos por Azospirillum brasilense Cd, A. lipoferum Br 17, Herbaspirillum seropedicae Z 67, H. rubrisubalbicans M4 e a estirpe 34 isolada de arroz, que não se enquadra em nenhuma das espécies de Herbaspirillum já descritas, em relação a diferentes condições de aeração e concentrações de sais. A maior aeração do meio propiciou aumento na produção de compostos indólicos pelas bactérias testadas. Foi verificado aumento desses compostos, em culturas estáticas, em meio sem nitrogênio no caso de Azospirillum, e na presença de N para as estirpes de Herbaspirillum. O aumento da concentração de sais no meio de cultivo inibiu a produção de compostos indólicos, embora tenha sido observado um pequeno aumento quando a concentração de CaCl2 foi de 1 g L-1. O efeito mais deletério da salinidade foi observado com a presença de NaHCO3, seguido de NaCl e Na2SO4. Azospirillum produziu mais compostos indólicos em meio semi-sólido e Herbaspirillum em meio líquido, mas em menor nível.The production of indolic compounds by Azospirillum brasilense Cd, A. lipoferum Br 17, Herbaspirillum seropedicae Z 67, H. rubrisubalbicans M4, and strain 34 isolated from rice, which does not fit into the described Herbaspirillum species, was measured under aeration ratio and salt concentrations. Aeration of the medium increased growth and production of indole compounds by these bacteria. Under static condition, the production was higher both in nitrogen-free medium for Azospirillum, and in amended N medium for the Herbaspirillum strains. Increasing salt concentration into the medium inhibited the production of indole compounds, although a small increase in production was observed, when CaCl2 concentration was raised above 1 g L-1. Deleterious effect of salinity was more pronounced in the presence of NaHCO3, followed by NaCl and Na2SO4. Azospirillum produced more indolic compounds in semi-solid cultures, and
Directory of Open Access Journals (Sweden)
Ana Dolores Santiago de Freitas
2007-01-01
Full Text Available Pesquisas sobre a biodiversidade microbiológica de solos salinos envolvem a busca por genótipos tolerantes a esse tipo de estresse ambiental. Dados genotípicos correlacionados às características morfológicas, fisiológicas e bioquímicas de bactérias fornecem informações importantes para sua identificação e agrupamento. Este trabalho objetivou caracterizar rizóbios provenientes de solos salinos, do Agreste e Sertão de Pernambuco, utilizando jacatupé (Pachyrhizus erosus L. Urban como planta-isca. Os testes foram efetuados em meio YMA e as características culturais observadas em 24 isolados foram as seguintes: mudança de pH, tempo de crescimento, transparência, forma, borda, produção de exopolissacarídeo das colônias e resistência à salinidade. Os testes moleculares utilizando análise por PCR (reação em cadeia da polimerase por meio de seqüências repetitivas de DNA amplificadas com o primer BOX envolveram 13 isolados. Os resultados revelaram alta diversidade fenotípica e genotípica entre os isolados nativos. As características culturais e genéticas desses isolados foram comparados com 19 estirpes de referência. Os isolados NFB746 e NFB747 tiveram alta semelhança entre si e também com as estirpes Rhizobium sp. NGR234 (BR2406 e Mesorhizobium ciceri USDA3383 (BR521. O isolado NFB742, possivelmente, era da mesma espécie de M. ciceri (BR521. Com relação ao isolado NFB741, a semelhança com as bactérias Rhizobium tropici IIA CFN299T (BR10016 e Sinorhizobium terangue USDA4894 (BR527 foi de 87%. Os demais isolados, praticamente, formaram grupos independentes quando comparados com as estirpes de referência. Os resultados foram de grande relevância para diagnosticar novas espécies de rizóbios nativos altamente tolerantes a estresses ambientais.Investigation on microbiological biodiversity in the saline soils involves searching for tolerant genotypes to this type of emvironmental stress. Genotypic data associated to
Du, Xin; Patel, Anushka; Li, Xian; Wu, Yangfeng; Turnbull, Fiona; Gao, Runlin
2017-08-15
Variations in care and outcomes by sex in patients with acute coronary syndrome (ACS) have been reported worldwide. The aims of this study are to describe ACS management according to sex in China and the effects of a quality improvement program in Chinese male and female ACS patients. Clinical Pathways for Acute Coronary Syndromes - Phase 2 (CPACS-2) was a cluster randomized trial to test whether a clinical pathways-based intervention would improve ACS management in China. The study enrolled 15,141 hospitalized patients [4631 (30.6%) were women] from 75 hospitals throughout China between October 2007 and August 2010. The intervention included clinical pathway implementation and performance measurement using standardized indicators with 6 monthly audit-feedback cycles. Eight key performance indicators reflecting in hospital management of ACS were measured. After adjustment for differences in patient characteristics and comorbidities at presentation, women were significantly less likely to undergo coronary angiography when indicated (RR 0.88 [0.85 to 0.92], Pquality improvement initiative by sex. Sex disparities were apparent in some key quality of care indicators for patients with suspected with ACS presenting to hospitals in China. The beneficial effect of the quality improvement program was consistent in women and men. http://www.anzctr.org.au/default.aspx. Unique identifier: ACTRN12609000491268. Copyright © 2017. Published by Elsevier B.V.
MacIntyre, Olathe; Stasiak, Michael; Cottenie, Karl; Trevors, Jack; Dixon, Mike
An assembled microbial community in the hydroponics solution of an advanced life support system may improve plant performance and productivity in three ways: (1) exclusion of plant pathogens from the initial community, (2) resistance to infection, and (3) plant-growth promotion. However, the plant production area is likely to have a hypobaric (low pressure) and hypoxic (low oxygen) atmosphere to reduce structural mass and atmosphere leakage, and these conditions may alter plant-microbe interactions. Plant performance and productivity of radish (Raphanus sativus L. cv. Cherry Bomb II) grown under hypobaric and hypoxic conditions were investigated at the University of Guelph's Controlled Environment Systems Research Facility. Changes in the microbial communities that routinely colonized the re-circulated nutrient solution, roots, and leaves of radishes in these experiments were quantified in terms of similarity in community composition, abundance of bacteria, and community diversity before and after exposure to hypobaric and hypoxic conditions relative to communities maintained at ambient growth conditions. The microbial succession was affected by extreme hypoxia (2 kPa oxygen partial pressure) while hypobaria as low as 10 kPa total pressure had little effect on microbial ecology. There were no correlations found between the physiological profile of these unintentional microbial communities and radish growth. The effects of hypobaric and hypoxic conditions on specific plant-microbe interactions need to be determined before beneficial gnotobiotic communities can be developed for use in space. The bacterial strains Tal 629 of Bradyrhizobium japonicum and WCS417 of Pseudomonas fluorescens, and the plant pathogen Fusarium oxysporum f. sp. raphani will be used in future experiments. B. japonicum Tal 629 promotes radish growth in hydroponics systems and P. fluorescens WCS417 induces systemic resistance to fusarium wilt (F. oxysporum f. sp. raphani) in radish under ambient
Xu, Jun-Fang; Xu, Jing; Li, Shi-Zhu; Jia, Tia-Wu; Huang, Xi-Bao; Zhang, Hua-Ming; Chen, Mei; Yang, Guo-Jing; Gao, Shu-Jing; Wang, Qing-Yun; Zhou, Xiao-Nong
2013-01-01
Background The transmission of schistosomiasis japonica in a local setting is still poorly understood in the lake regions of the People's Republic of China (P. R. China), and its transmission patterns are closely related to human, social and economic factors. Methodology/Principal Findings We aimed to apply the integrated approach of artificial neural network (ANN) and logistic regression model in assessment of transmission risks of Schistosoma japonicum with epidemiological data collected from 2339 villagers from 1247 households in six villages of Jiangling County, P.R. China. By using the back-propagation (BP) of the ANN model, 16 factors out of 27 factors were screened, and the top five factors ranked by the absolute value of mean impact value (MIV) were mainly related to human behavior, i.e. integration of water contact history and infection history, family with past infection, history of water contact, infection history, and infection times. The top five factors screened by the logistic regression model were mainly related to the social economics, i.e. village level, economic conditions of family, age group, education level, and infection times. The risk of human infection with S. japonicum is higher in the population who are at age 15 or younger, or with lower education, or with the higher infection rate of the village, or with poor family, and in the population with more than one time to be infected. Conclusion/Significance Both BP artificial neural network and logistic regression model established in a small scale suggested that individual behavior and socioeconomic status are the most important risk factors in the transmission of schistosomiasis japonica. It was reviewed that the young population (≤15) in higher-risk areas was the main target to be intervened for the disease transmission control. PMID:23556015
Lim, Un Taek
2018-01-01
A strain (ARP14) of the entomopathogenic fungus Beauveria bassiana (Balsamo) Vuillemin was isolated from field-collected Riptortus pedestris (Fabricius) (Hemiptera: Alydidae). The lethal median concentration of the ARP14 strain was compared with that of a commercialized strain (GHA) of the same fungus against R. pedestris and its two egg parasitoids, Ooencyrtus nezarae Ishii (Hymenoptera: Encyrtidae) and Gryon japonicum (Ashmead) (Hymenoptera: Platygastridae). Mortality and mycosis rates were evaluated after exposure to five concentrations of the fungus, i.e., 1×109, 1×108, 1×107, 1×106, and 1×105 conidia/mL, using a glass scintillation vial as an exposure arena in 25.0 ± 0.5°C and 93.7 ± 2.9% RH. The lethal median concentrations (LC50) for 2nd and 4th instar nymphs, and adults of R. pedestris were not significantly different between the two strains of B. bassiana. However, the mycosis rate of ARP14 was 1.3 and 1.8 times higher than that of the GHA strain in 4th instar nymphs and adult females of R. pedestris, respectively, at the 1×108 conidia/mL concentration. More interestingly, the mycosis rates at 1×108 conidia/mL concentration in the parasitoids G. japonicum and O. nezarae were much lower in the ARP14 strain (15.0 and 0%) than in the GHA strain (73.3 and 66.0%), respectively, suggesting that the B. bassiana strain ARP14 is less virulent to these parasitoids than the commercially available strain. Our results suggest that B. bassiana ARP14 may be a potential new biopesticide against R. pedestris with fewer negative effects on beneficial parasitoids than currently available options. PMID:29664929
Directory of Open Access Journals (Sweden)
Ignacio A Ciampitti
2005-12-01
Full Text Available El óxido nitroso absorbe radiación infrarroja contribuyendo al efecto invernadero; este gas es producido principalmente en el suelo, mediante los procesos de nitrificación y denitrificación. En un estudio a campo, sobre un suelo Argiudol típico, se evaluó el efecto de la fertilización y la inoculación con Bradyrhizobium japonicum en un cultivo de soja [Glycine max (L. Merrill], sobre las emisiones de óxido nitroso. Los gases se extrajeron de cilindros de PVC y la lectura se realizó con cromatografía gaseosa. Las emisiones presentaron valores crecientes desde la siembra hacia madurez fisiológica del cultivo, para todos los tratamientos; este comportamiento fue concomitante con la evolución presentada por la humedad edáfica. La fertilización nitrogenada aumentó significativamente (PNitrous oxide gas absorbs infrared radiation contributing to the greenhouse effect; this gas is produced mainly in soil, by means of the processes of nitrification and denitrification. In a field study at the FAUBA on a typic Argiudol, we evaluated the effect of fertilization and inoculation with Bradyrhizobium japonicum during a soybean culture [Glycine max (L. Merrill], on nitrous oxide emisión. Gases were sampled with PVC cylinders and were read with gaseous chromatography. Emissions presented increasing values from seeding towards physiological maturity for all treatments; this behavior was similar to the evolution presented by nitrate level and soil moisture. Nitrogen fertilization significantly increased (P<0.05 nitrous oxide emissions and inoculation only had a significant effect with the highest level of fertilization (P=0.09. Plots fertilized at highest dose and inoculated gave the greatest nitrous oxide emissions. The variable that better explains the emissions is the nitrate level (r² = 0.1899; P=0.0231.
Saeki, Yuichi; Nakamura, Misato; Mason, Maria Luisa T; Yano, Tsubasa; Shiro, Sokichi; Sameshima-Saito, Reiko; Itakura, Manabu; Minamisawa, Kiwamu; Yamamoto, Akihiro
2017-06-24
We investigated the effects of the water status (flooded or non-flooded) and presence of the nosZ gene in bradyrhizobia on the bradyrhizobial community structure in a factorial experiment that examined three temperature levels (20°C, 25°C, and 30°C) and two soil types (andosol and gray lowland soil) using microcosm incubations. All microcosms were inoculated with Bradyrhizobium japonicum USDA6 T , B. japonicum USDA123, and B. elkanii USDA76 T , which do not possess the nosZ gene, and then half received B. diazoefficiens USDA110 T wt (wt for the wild-type) and the other half received B. diazoefficiens USDA110ΔnosZ. USDA110 T wt possesses the nosZ gene, which encodes N 2 O reductase; 110ΔnosZ, a mutant variant, does not. Changes in the community structure after 30- and 60-d incubations were investigated by denaturing-gradient gel electrophoresis and an image analysis. USDA6 T and 76 T strains slightly increased in non-flooded soil regardless of which USDA110 T strain was present. In flooded microcosms with the USDA110 T wt strain, USDA110 T wt became dominant, whereas in microcosms with the USDA110ΔnosZ, a similar change in the community structure occurred to that in non-flooded microcosms. These results suggest that possession of the nosZ gene confers a competitive advantage to B. diazoefficiens USDA110 T in flooded soil. We herein demonstrated that the dominance of B. diazoefficiens USDA110 T wt within the soil bradyrhizobial population may be enhanced by periods of flooding or waterlogging systems such as paddy-soybean rotations because it appears to have the ability to thrive in moderately anaerobic soil.
Vinuesa, Pablo; Rademaker, Jan L. W.; de Bruijn, Frans J.; Werner, Dietrich
1998-01-01
We present a phylogenetic analysis of nine strains of symbiotic nitrogen-fixing bacteria isolated from nodules of tagasaste (Chamaecytisus proliferus) and other endemic woody legumes of the Canary Islands, Spain. These and several reference strains were characterized genotypically at different levels of taxonomic resolution by computer-assisted analysis of 16S ribosomal DNA (rDNA) PCR-restriction fragment length polymorphisms (PCR-RFLPs), 16S-23S rDNA intergenic spacer (IGS) RFLPs, and repetitive extragenic palindromic PCR (rep-PCR) genomic fingerprints with BOX, ERIC, and REP primers. Cluster analysis of 16S rDNA restriction patterns with four tetrameric endonucleases grouped the Canarian isolates with the two reference strains, Bradyrhizobium japonicum USDA 110spc4 and Bradyrhizobium sp. strain (Centrosema) CIAT 3101, resolving three genotypes within these bradyrhizobia. In the analysis of IGS RFLPs with three enzymes, six groups were found, whereas rep-PCR fingerprinting revealed an even greater genotypic diversity, with only two of the Canarian strains having similar fingerprints. Furthermore, we show that IGS RFLPs and even very dissimilar rep-PCR fingerprints can be clustered into phylogenetically sound groupings by combining them with 16S rDNA RFLPs in computer-assisted cluster analysis of electrophoretic patterns. The DNA sequence analysis of a highly variable 264-bp segment of the 16S rRNA genes of these strains was found to be consistent with the fingerprint-based classification. Three different DNA sequences were obtained, one of which was not previously described, and all belonged to the B. japonicum/Rhodopseudomonas rDNA cluster. Nodulation assays revealed that none of the Canarian isolates nodulated Glycine max or Leucaena leucocephala, but all nodulated Acacia pendula, C. proliferus, Macroptilium atropurpureum, and Vigna unguiculata. PMID:9603820
Directory of Open Access Journals (Sweden)
Maria Izabel Merino de Medeiros
2013-03-01
Full Text Available We studied the molecular epidemiology of Staphylococcus aureus strains potentially toxigenic, isolated from the production process of Minas frescal cheese in a small dairy plant in the state of São Paulo. For this, samples were taken during the period from June 2008 to July 2009. Samples were collected from the surface of the receiving and storage tanks of raw milk, the surface of the balance tank of pasteurized milk, the water supply system, the pipes and equipments, the hands of the handler and from the packaged cheese, totaling 140 samples. The colonies isolated on Baird-Parker Agar confirmed as Gram positive and positive for catalase, coagulase and acetoin production, were submitted to extraction of bacterial DNA using the Invitek - Uniscience® kit. Confirmation of the isolated species and enterotoxins SEA, SEB, SEC, SED and TSST-1 toxin was carried out through the amplification of specific fragments of chromosomal DNA. Among the 74 strains of isolated coagulase-positive staphylococci, only 41 (55.4% strains were confirmed as Staphylococcus aureus, of which 25 (61.0% were positive to the presence of staphylococcal toxins. The most frequently identified enterotoxin was SEA. The toxigenic strains of Staphylococcus aureus were more frequently isolated from hands of the handler (16.0%, raw milk receiving tank (12.0%, pasteurized milk for cheese making (12.0% and fresh white cheese ready for consumption (12.0%.
International Nuclear Information System (INIS)
Yuan Hongli; Wang Huixian; You Chongbiao
1990-01-01
All of the tested species (strains) in this work can reduce TTC, suggesting that they contain hydrogen uptake hydrogenase. Hybridization with Rhizobium japonicum hup gene indicated that there was homology between restricted DNA and the probe for Alcaligenes faecalis A15, Enterobacter cloacae EnSs, Klebsiella planticola DWUL2 and Pseudomonas saccharophila. Negative results were obtained for E. cloacae E26 and K. oxytoca NG13. Hup genes of A. faecalis A15 were located on chromosomal DNA, however, it was located on the larger plasmid for E. cloacae EnSs. Nif gene and hup gene are located on the same replicon. Hup gene from different hup + microorganisms was not homology inevitably
Garcia, Rolando G.
1972-01-01
Ecological investigations were made of habitats containing natural populations of the snail Oncomelania hupensis quadrasi and of habitats free from the snail in the island of Leyte, Philippines. This species of snail is a vector of Schistosoma japonicum in the Philippines. Snail-infested habitats had dissolved oxygen levels of 3.8-9.85 ppm but snail-free habitats had levels of only 0.08-3.6 ppm. Snail-infested habitats were less polluted by organic matter than habitats that were snail-free. Larger numbers of chlorophyll-bearing algae were present in both the water and the soil of snail-infested habitats. Other factors, including temperature, pH, hydrogen carbonate alkalinity, and relative humidity, were also investigated. PMID:4538906
Actuación de enfermería en la leucemia mieloide aguda.
Directory of Open Access Journals (Sweden)
Melchor Pino, Pilar
2012-08-01
Full Text Available La leucemia mieloide aguda (LMA es una proliferación neoplásica de células inmaduras de estirpe mieloide que se produce por una alteración en el crecimiento y diferenciación de las células hematopoyéticas.En este trabajo se presenta un caso clínico sobre un paciente de 37 años diagnosticado de LMA. Se hace una valoración de las necesidades básicas siguiendo el modelo de Virginia Henderson al ingreso del paciente, mediante una entrevista dirigida y la obtención de datos mediante la observación.El objetivo general es elaborar un plan individualizado de cuidados a dicho paciente, mediante la aplicación del Proceso Enfermero y la utilización de la taxonomía NANDA-NOC-NIC que nos permitirá aplicar unos cuidados de calidad a este paciente.Cuando el paciente abandone el hospital, la enfermera le entregará un informe de alta, que asegurará la continuidad de sus cuidados.
Presentación del Libro “Tres Médicos Árabes” Rhases, Averroes, Avicena
Directory of Open Access Journals (Sweden)
Efraim Otero Ruiz
2007-12-01
Pero esa misma migratoriedad, especialmente de las del norte, hizo que gradualmente se extendieran por Siria, Mesopotamia y por todo el antiguo imperio Persa hasta la India, por el oriente; y por Egipto y la costa norte del Africa hasta Gibraltar, por el occidente. Unidos por lenguajes ancestrales derivados del sumerio, el babilonio, el sánscrito y el urdu, que dieron origen al idioma árabe, en esas regiones había enclaves de muchas tribus y muchas religiones, mono y politeístas. El genio de Mahoma y su Corán fue el unificarlos monoteísticamente y darles un sentido de trascendencia, en esta vida y en la otra. Por eso, en el milenio que nos ocupa, se cumplió lo que después describiría maravillosamente Carlyle, el pensador inglés: Aquella estirpe, polvo inflamable por mucho tiempo aislado en el desierto, de golpe prendió fuego y sus llamas formidables se elevaron al cielo desde Dehli, en la India, hasta Granada en España...
Análise genotÃpica de isolados de Mycobacterium tuberculosis de um hospital em Lisboa, Portugal
Directory of Open Access Journals (Sweden)
João Perdigão
2009-09-01
Full Text Available Resumo: Portugal apresenta uma das taxas de incidência de tuberculose mais altas da União Europeia, tendo a Região de Saúde de Lisboa uma taxa de incidência muito acima da média nacional. O presente estudo analisa a transmissão, susceptibilidade aos antibacilares e caracterÃsticas de uma população de estudo de um hospital central de Lisboa. Cento e trinta e dois isolados clÃnicos de Mycobacterium tuberculosis foram pre-viamente testados quanto à susceptibilidade aos antibacilares de primeira linha. A taxa de multirresistência encontrada foi de 3,0%, enquanto 13,6% dos isolados eram resistentes a um ou mais antibacilares de primeira linha. A serologia para o VIH estava disponÃvel para 98 doentes, 26 (26,5% eram positivos. Os isolados foram genotipados por MIRU-VNTR e 53 (40,2% dos 132 isolados encontravam-se distribuÃdos por 17 clusters MIRU-VNTR diferentes de dois ou mais isolados. De todos os isolados analisados, 25,8% perten-ciam à famÃlia Lisboa. ConcluÃmos que a transmissão de estirpes de Mycobacterium tuberculosis, resistentes e susceptÃveis, está a ocorrer, com especial preocupação para as estirpes Lisboa.Rev Port Pneumol 2009; XV (5: 761-769 Abstract: Portugal has one of the highest tuberculosis notification rates of the European Union with Lisbon Health Region having an incidence rate well above the national average. The present study analyses the transmission, drug susceptibility and characteristics of a study population from a Central Lisbonâs Hospital. One hundred and thirty-two Mycobacterium tuberculosis clinical isolates were previously tested for drug susceptibility to first-line drugs. The multidrug (MDR resistance rate was found to be 3.0%, while 13.6% of the isolates were resistant to one or more first-line drugs. HIV serology was available for 98 patients, 26 (26.5% were positive. Genotyping was performed by MIRU-VNTR and 53 (40,2% out of the 132 isolates
Directory of Open Access Journals (Sweden)
Suzana David
2005-11-01
Full Text Available Resumo: O presente estudo populacional, que decorreu entre 1999 e 2003, foi baseado na utilização do Spoligotyping na genotipagem de 452 isolados do complexo Mycobacterium tuberculosis de doentes com tuberculose internados no Hospital Fernando Fonseca. Spoligotypes foram identificados como shared types (ST recorrendo a uma base de dados internacional. Onze ST raros, não identificados na base de dados, acomodaram 8,4% dos isolados. Aliás, particular a Portugal poderá ser a predominância de ST identificados na base de dados mas não previamente classificados como famÃlias genotÃpicas, tais como o ST244, ST150 e ST389, representando 13,3 % do total. A identificação de isolados clÃnicos de M. africanum de genótipo Afri1 e de M. tuberculosis de genótipo CAS1 poderá confirmar a importação de isolados de origem africana e asiática. M. tuberculosis da famÃlia Beijing foi pela primeira vez por nós assinalado a partir de 1999. Desde então, o número de isolados provenientes do hospital passou de um para cinco, anualmente, representando actualmente 2,2%, o que a coloca em décimo lugar em prevalência. M. tuberculosis Beijing poderá corresponder a um problema emergente em Portugal devido à recente imigração proveniente da Europa Oriental e da Ãsia. Outros genótipos, ST150 e ST389, mostraram um incremento, cujo significado não é claro. No entanto, as frequências relativas das famÃlias predominantes LAM, T1 e Haarlem mantiveram-se relativamente estáveis. O presente estudo confirma a variabilidade genética em Portugal dos isolados do complexo M. tuberculosis. Estes estudos poderão contribuir para a definição de prioridades nos programas nacionais de luta contra a tuberculose.Rev Port Pneumol 2005; XI (6: 513-531 Abstract: The present population study, from 1999 to 2003, has been based on the use of Spoligotyping in the genotyping of 452 isolates of the Mycobacterium tuberculosis complex from tuberculosis patients of the Fernando Fonseca Hospital. Spoligotypes were identified as âshared typesâ (STs with the aid of an international database. Eleven rarely found STs, not identified in the database, grouped 8.4% of the isolates. Moreover, particular to Portugal, may be the predominance of STs identified in the database but not previously classified as genotypic families, such as ST244, ST150 and ST389, representing 13.3% of the total. The identification of clinical isolates of M. africanum genotype Afri1 and of M. tuberculosis genotype CAS1 may confirm import of isolates of African and Asian origin. M. tuberculosis of the Beijing family was first reported by us as of 1999. Since then, the number of isolates at the Hospital has passed from one to five annually, representing 2.2% of the total and the tenth most predominant family in the present study. M. tuberculosis Beijing may correspond to an emerging problem in Portugal due to recent immigration from Eastern Europe and Asia. Other genotypes, ST150 and ST389, have shown increase, the significance of which is not clear. However, the relative frequencies of the predominant families LAM, T1 and Haarlem remained relatively stable. The present study confirms the genetic variability in Portugal of M. tuberculosis complex isolates. These studies may contribute to the definition of priorities in the national tuberculosis control programs.Rev Port Pneumol 2005; XI (6: 513-531 Palavras-chave: Complexo Mycobacterium tuberculosis, Spoligotyping, Portugal, Key-words: Mycobacterium tuberculosis complex, Spoligotyping, Portugal
Dicty_cDB: Contig-U03730-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available us... 38 0.002 3 ( DC237378 ) Hodotermopsis sjoestedti cDNA clone: MY0684BHsMg_... 38 0.002 2 ( FD625418 ) s... 40 0.007 2 ( EJ329051 ) 1092963417437 Global-Ocean-Sampling_GS-28-01-01-1... 42 0.007 2 ( DA728805 ) Homo sapie... AGENCOURT_13629201 NIH_MGC_148 Homo sapiens cDNA ... 40 0.007 2 ( EK209959 ) 1095460095251 Global-Ocean-Sampli...8746 ) ox66e02.s1 Soares_NhHMPu_S1 Homo sapiens cDNA clo... 40 0.007 2 ( EJ828039 ) 1093017568475 Global-Ocean-Sampli...136358 ) 1092343604888 Global-Ocean-Sampling_GS-27-01-01-1... 54 0.008 1 ( BU801459 ) SJF2DDD09 SJF Schistosoma japonicum cDNA sim
Oi, M; Araki, J; Matsumoto, J; Nogami, S
2012-10-01
The red-eared slider turtle (Trachemys scripta elegans) was intentionally introduced from the United States to Japan as a pet in the 1950s and has become established throughout much of the country. We examined red-eared slider turtles from two localities in Japan for foreign parasitic helminths. Consequently, a total of seven species of helminths were found: two monogeneans (Neopolystoma exhamatum and Polystomoides japonicum), three digeneans (Spirorchisartericola, Spi.elegans and Telorchis clemmydis) and two nematodes (Serpinema microcephalum and Falcaustra wardi). Of these, three helminths are alien to Japan-Spi.artericola, Spi. elegans and F. wardi-which represent the first report of their presence in the red-eared slider turtle from Japan. Copyright © 2011 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Neal Shahidi
2016-01-01
Full Text Available Background and Aims. The Canadian Partnership Against Cancer (CPAC recommends a fecal immunochemical test- (FIT- positive predictive value (PPV for all adenomas of ≥50%. We sought to assess FIT performance among average-risk participants of the British Columbia Colon Screening Program (BCCSP. Methods. From Nov-2013 to Dec-2014 consecutive participants of the BCCSP were assessed. Data was obtained from a prospectively collected database. A single quantitative FIT (NS-Plus, Alfresa Pharma Corporation, Japan with a cut-off of ≥10 μg/g (≥50 ng/mL was used. Results. 20,322 FIT-positive participants underwent CSPY. At a FIT cut-off of ≥10 μg/g (≥50 ng/mL the PPV for all adenomas was 52.0%. Increasing the FIT cut-off to ≥20 μg/g (≥100 ng/mL would increase the PPV for colorectal cancer (CRC by 1.5% and for high-risk adenomas (HRAs by 6.5% at a cost of missing 13.6% of CRCs and 32.4% of HRAs. Conclusions. As the NS-Plus FIT cut-off rises, the PPV for CRC and HRAs increases but at the cost of missed lesions. A cut-off of ≥10 μg/g (≥50 ng/mL produces a PPV for all adenomas exceeding national recommendations. Health authorities need to take into consideration endoscopic resources when selecting a FIT positivity threshold.
Differences in crystallization of two LinB variants from Sphingobium japonicum UT26
Czech Academy of Sciences Publication Activity Database
Degtjarik, O.; Chaloupková, R.; Řezáčová, Pavlína; Kutý, M.; Damborský, J.; Smatanová, I.K.
2013-01-01
Roč. 69, č. 3 (2013), s. 284-287 ISSN 1744-3091 Institutional support: RVO:68378050 Keywords : protein crystallization * dehalogenase Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.568, year: 2013
A Study on Photosynthetic Physiological Characteristics of Six Rare and Endangered Species
Institute of Scientific and Technical Information of China (English)
Tailin ZHONG; Guangwu ZHAO; Jiamiao CHU; Xiaomin GUO; Genyou LI
2014-01-01
The parameters of gas exchange and chlorophyl fluorescence in leaves of six rare and endangered species Neolitsea sericea, Cinnamomum japonicum var. cheni , Sinojackia microcarpa, Discocleidion glabrum var. trichocarpum, Parrotia sub-aequalis, Cercidiphyl um japonicum were measured in fields. The results showed that there were significant differences in photosynthetic capacity, intrinsic water use effi-ciency (WUEi ), the efficiency of primary conversion of light energy of PSⅡ and its potential activity, the quantum yield of PSⅡ electron transport, and the potential ca-pacity of heat dissipation among the six species. However, there was no significant difference in WUE. The highest values of net photosynthetic rate (Pn), transpiration rate (Tr) and stomatal conductance (gs) occurred in D. glabrum var. trichocarpum and the lowest in S. microcarpa. On the contrary, D. glabrum var. trichocarpum had the lowest WUE, intrinsic water use efficiency (WUEi ) and S. microcarpa had the highest. The results indicated that D. glabrum var. trichocarpum had higher photo-synthetic capacity and poorer WUE, while S. microcarpa had lower photosynthetic capacity and greater WUE. Furthermore, the mean values of maximal fluorescence (Fm), potential efficiency of primary conversion of light energy of PSⅡ (Fv/Fm),ΦPSⅡ, actual efficiency of primary conversion of light energy of PSⅡ (F′v/F′m) and non-photochemical quenching coefficient (NPQ) were the highest in S. micro-carpa, indicating that its PSⅡ had higher capacity of heat dissipation and could prevent photosynthetic apparatus from damage by excessive light energy. Correlation analysis showed that there were significant correlations among photosynthetic physi-ological parameters. However, the initial fluorescence (Fo) was not significantly cor-related with any other parameters. This study also revealed the extremely significant positive correlations between Pn and Tr, gs, apparent quantum yield (AQY), be-tween Tr and
Directory of Open Access Journals (Sweden)
Julien Zwang
Full Text Available Extensive use of praziquantel for treatment and control of schistosomiasis requires a comprehensive understanding of efficacy and safety of various doses for different Schistosoma species.A systematic review and meta-analysis of comparative and non-comparative trials of praziquantel at any dose for any Schistosoma species assessed within two months post-treatment. Of 273 studies identified, 55 were eligible (19,499 subjects treated with praziquantel, control treatment or placebo. Most studied were in school-aged children (64%, S. mansoni (58%, and the 40 mg/kg dose (56%; 68% of subjects were in Africa. Efficacy was assessed as cure rate (CR, n=17,017 and egg reduction rate (ERR, n=13,007; safety as adverse events (AE incidence. The WHO-recommended dose of praziquantel 40 mg/kg achieved CRs of 94.7% (95%CI 92.2-98.0 for S. japonicum, 77.1% (68.4-85.1 for S. haematobium, 76.7% (95%CI 71.9-81.2 for S. mansoni, and 63.5% (95%CI 48.2-77.0 for mixed S. haematobium/S. mansoni infections. Using a random-effect meta-analysis regression model, a dose-effect for CR was found up to 40 mg/kg for S. mansoni and 30 mg/kg for S. haematobium. The mean ERR was 95% for S. japonicum, 94.1% for S. haematobium, and 86.3% for S. mansoni. No significant relationship between dose and ERR was detected. Tolerability was assessed in 40 studies (12,435 subjects. On average, 56.9% (95%CI 47.4-67.9 of the subjects receiving praziquantel 40 mg/kg experienced an AE. The incidence of AEs ranged from 2.3% for urticaria to 31.1% for abdominal pain.The large number of subjects allows generalizable conclusions despite the inherent limitations of aggregated-data meta-analyses. The choice of praziquantel dose of 40 mg/kg is justified as a reasonable compromise for all species and ages, although in a proportion of sites efficacy may be lower than expected and age effects could not be fully explored.
Directory of Open Access Journals (Sweden)
Danilo Dufech Castilhos
2001-12-01
Full Text Available Foram avaliados os efeitos de doses crescentes de Cr6+ sobre a produção de matéria seca, absorção de nutrientes e fixação biológica de nitrogênio em plantas de soja. Antes da semeadura, as sementes foram tratadas com inóculo turfoso contendo Bradyrhizobium japonicum. As plantas foram cultivadas durante 40 dias em vasos "Leonard" que continha areia na parte superior e solução nutritiva sem nitrogênio na parte inferior. Os tratamentos constaram das seguintes doses de Cr6+ (K2Cr2O7 na solução nutritiva: 0, 5, 10, 20 e 40mg -1. Foi constatado que concentrações de Cr6+ maiores que 5mg -1 diminuíram a produção de matéria seca da parte aérea e radicular da soja, o número e peso de nódulos secos de Bradyrhizobium, como também a fixação biológica de nitrogênio e a absorção de P, K, Ca e Mg. Teores de Cr na parte aérea de plantas de soja superiores a 3,4mg Kg-1 podem ser considerados fitotóxicos.This study was carried out to evaluate the effect of hexavalent chromium on dry matter production, nutrient uptake and nitrogen fixation in soybeans (Glycine max The seeds were inoculated with comercial strains of Bradyrhizobium japonicum (SEMIA 587 and 5019 and the plants were grown in "Leonard Jars" containing washed sand in the upper portion and nutrient solution (without N in the lower. Five Cr6+ concentrations were used: 0, 5, 10, 20 e 40mg -1 in the nutrient solution. Concentrations of Cr6+ above 5mg -1 decreased plants and nodules dry matter production, number of nodules, nitrogen fixation and P, K, Ca e Mg uptake. Chromium concentrations in soybean tops above 3,4mg kg-1 were considered phytotoxic.
DEFF Research Database (Denmark)
Quaiser, Achim; Ochsenreiter, Torsten; Lanz, Christa
2003-01-01
fragments differed between 2.3% and 19.9% and were placed into two different subgroups of Acidobacteria (groups III and V). Although partial co-linearity was found between genomic fragments, the gene content around the rRNA operons was generally not conserved. Phylogenetic reconstructions with orthologues......Acidobacteria have been established as a novel phylum of Bacteria that is consistently detected in many different habitats around the globe by 16S rDNA-based molecular surveys. The phylogenetic diversity, ubiquity and abundance of this group, particularly in soil habitats, suggest an important...... palustris and Bradyrhizobium japonicum, including a conserved two-component system. Phylogenetic analysis of the putative response regulator confirmed that this similarity between Rhizobiales and Acidobacteria might be due to a horizontal gene transfer. In total, our data give first insight into the genome...
Innate scavenger receptor-A regulates adaptive T helper cell responses to pathogen infection
Xu, Zhipeng; Xu, Lei; Li, Wei; Jin, Xin; Song, Xian; Chen, Xiaojun; Zhu, Jifeng; Zhou, Sha; Li, Yong; Zhang, Weiwei; Dong, Xiaoxiao; Yang, Xiaowei; Liu, Feng; Bai, Hui; Chen, Qi; Su, Chuan
2017-01-01
The pattern recognition receptor (PRR) scavenger receptor class A (SR-A) has an important function in the pathogenesis of non-infectious diseases and in innate immune responses to pathogen infections. However, little is known about the role of SR-A in the host adaptive immune responses to pathogen infection. Here we show with mouse models of helminth Schistosoma japonicum infection and heat-inactivated Mycobacterium tuberculosis stimulation that SR-A is regulated by pathogens and suppresses IRF5 nuclear translocation by direct interaction. Reduced abundance of nuclear IRF5 shifts macrophage polarization from M1 towards M2, which subsequently switches T-helper responses from type 1 to type 2. Our study identifies a role for SR-A as an innate PRR in regulating adaptive immune responses. PMID:28695899
The use of ionizing radiation in the control of Oncomelania quadrasi snails
International Nuclear Information System (INIS)
Cruz, B. de la; Asis, A.V.; Pagulayan, P.; Payongayong, A.; Pineda, R.
1983-01-01
Schistosomiasis is still an endemic disease affecting mostly farmers. One way of checking the spread of the disease is to eradicate the intermediate host of parasite. Previous reports indicate that application of nuclear techniques could be a viable tool in the control of parasites of medical importance. To determine whether ionizing radiation could be a useful tool in the control of Oncomelania quadrasi, which is the vector host of Schistosoma japonicum. Attempts have been made to determine whether genetic effects on irradiated male snails can be transmitted to their progenies. These deleterious effects could be either short life span or defective reproductive capacity of the progenies. Attemps were also made to determine whether introduction of irradiated male snails in a given population could reduce the snail density. (author)
Directory of Open Access Journals (Sweden)
Amanda Keller Siqueira
2017-05-01
Full Text Available A emergência de estafilococos multirresistentes e resistentes à meticilina, isolados de animais, alimentos e humanos é uma preocupação em saúde pública. Esses micro-organismos produzem diferentes toxinas relacionadas à intoxicação alimentar em humanos. Este estudo caracterizou Staphylococcus spp. isolados em duas fazendas orgânicas no Brasil. Foram coletadas 259 amostras de leite em duas propriedades leiteiras orgânicas, nas quais 58 (22,4% estirpes de Staphylococcus spp. foram isoladas. A maior sensibilidade dos isolados foi observada para ceftiofur e sulfametoxazol/trimetoprim em 96,6%. Em contraste, acima de 89% de resistência dos estafilicocos foi encontrada para penicilina G. O gene mecA foi identificado em 13,8% dos isolados. SEA e SEC foram as enterotoxinas mais comumente detectadas. PFGE revelou heterogeneidade genética entre S. intermedius e S. warneri, enquanto S. aureus demonstraram perfis semelhantes entre isolados dos dois rebanhos estudados. Relata-se pela primeira vez no Brasil a detecção de enterotoxinas, o gene mecA e diversidade genética em estafilococos isolados de vacas em produção orgânica.
Directory of Open Access Journals (Sweden)
Ágatha Cristina de Pinho Carão
2014-09-01
Full Text Available As aflatoxicoses são micotoxicoses causadas por toxinas produzidas por estirpes de fungos do gênero Aspergillus. Causam prejuízos importantes à produção animal, em especial àquelas que têm nos grãos sua matéria-prima base para preparação de ração, como a avicultura de corte. Atualmente, diversas técnicas, tais como uso de substâncias químicas, métodos físicos, estratégias de colheita, armazenagem e processamento de alimentos, estão sendo estudadas para que se diminua e, se bem aplicadas, evite os efeitos deletérios causados por essas substâncias à saúde animal. O objetivo desta revisão é descrever os principais efeitos das aflatoxinas sobre o desempenho zootécnico na produção de frangos de corte, as alterações nas matérias-primas de ração e os avanços científicos em metodologias de detoxificação biológica e de boas práticas agrícolas.
De hechicera a santa: la piedad heroica de Juana de Arco
Directory of Open Access Journals (Sweden)
Isabel Balza
2011-01-01
Full Text Available En este artículo se discute la figura de Juana de Arco en tanto que héroe. Para ello examinamos los procesos judiciales que la condenan a muerte. Se trata de precisar si el sexo determina su modo de encarnar la heroicidad. Defendemos que su travestismo es una de las causas fundamentales de su condena, por la transgresión que supone de los límites de las normas de la Iglesia y de las rígidas regulaciones del binarismo de género. Juana de Arco ocupa un lugar de excepción simbólico y social al no haber en ese momento histórico un espacio conceptual que simbolice la posición masculina para las mujeres. Utilizamos los análisis de María Zambrano sobre Antígona para señalar la posición que ocupa Juana de Arco dentro de la estirpe de las «doncellas muertas». Por último, proponemos que Juana de Arco muestra una ética de la piedad desde ese lugar de excepción en la ciudadanía.
VARIAÇÕES NA MICROBIOTA LEVEDURIFORME DO FERMENTO ENDÓGENO UTILIZADO NA PRODUÇÃO DO QUEIJO CANASTRA
Directory of Open Access Journals (Sweden)
Juliana E. Nóbrega
2008-10-01
Full Text Available Variações na microbiota leveduriforme presente no fermento endógeno utilizado para fabricação do queijo Canastra foram avaliadas no período das águas (PA e no período da seca (PS. O queijo Canastra é produzido na região da Serra da Canastra, Minas Gerais, de forma artesanal a partir de leite cru de vaca e utiliza como cultura iniciadora um fermento endógeno obtido após prensagem e salga do queijo. Um total de 115 estirpes foram isoladas de 16 amostras do fermento endógeno coletadas em 8 unidades produtoras nos dois períodos amostrados e identificadas pela metodologia tradicional e pelo sistema API C 20 AUX. As espécies de leveduras predominantes no PA foram Debaryomyces hansenii, Torulaspora delbruekii e Kluyveromyces lactis. No PS, predominaram as espécies Kluyveromyces lactis, Torulaspora delbruekii e Kluyveromyces marxianus. Os resultados demonstram que as espécies leveduriformes presentes no fermento endógeno da Serra da Canastra, nos dois períodos avaliados, são basicamente as mesmas, variando a freqüência com as quais ocorrem.
DEFF Research Database (Denmark)
Chacon, Tony; De Basilio, Vasco; Zerpa, Hector
2015-01-01
Genetic selection in poultry has been based on fast growth characters and not on stress adaptability. This investigation assessed cardiovascular variables in two lineages of Gallus gallus domesticus of different domestication levels, subjected to acute heat stress. To carry out the assay, broiler...
Directory of Open Access Journals (Sweden)
Francielle Gibson da Silva
2005-03-01
contra o sorovar Hardjo (Hardjoprajitno e contra a estirpe Londrina (LO14, do sorovar Canicola, isolada no norte do Paraná, Brasil, utilizados como anticorpo primário. O exame direto detectou leptospiras na urina de quatro animais. Todas as tentativas de isolamento das urinas e fragmentos de rim, fígado e útero foram negativas após 16 semanas de incubação. No exame histopatológico foi observado infiltrado focal de células mononucleares no interstício renal da maioria dos animais. Na prova de imunoperoxidase indireta com o soro hiperimune contra a estirpe LO14, o rim de um animal foi o único a apresentar resultado positivo. Todos os fragmentos de rim, fígado e útero testados com o soro hiperimune contra o sorovar Hardjo foram negativos.
Directory of Open Access Journals (Sweden)
Maria Luiza Ribeiro Bastos da Silva
2007-09-01
Full Text Available
The evaluation of native rhizobia strains potential as related to efficiency, competitiveness, and adaptation in regions subjected to high temperature is important to the study of nitrogen symbiotic fixation. The objective of this research was the morphologic characterization of rhizobia isolated from samples of a red yellow argisol of Serra Talhada municipality, Pernambuco State, Brazil, and selection for high temperature and kanamicina and nalidixic acid antibiotics resistance. The study was carried out at Institute of Agricultural Research of Pernambuco (IPA. The isolates were cultivated in YMA media to evaluate colonie characteristics as acidity or alkalinity production, growing velocity, color, shape and transparency, elevation, and mucus production. All isolates were compared to the standard strain Bradyrhizobium sp. 6145, recommended for cowpea. The morphological and physiological diversity of the isolates enabled the identification of distinct groups. The isolates 1, 2 and 4 presented higher resistance to high temperature and adaptation to survive in regions subjected to thermal stress periods. The isolate 1 showed the highest resistance to tested antibiotics.
KEY-WORDS: Rhizobia; morphologic characteristics; high temperature.
A avaliação do potencial de estirpes nativas de rizóbio em relação à eficiência, competitividade e adaptação às regiões sujeitas à alta temperatura é importante no estudo da fixação simbiótica de nitrogênio. O objetivo do trabalho foi efetuar a caracterização morfológica de isolados de rizóbios a partir de amostras de um argissolo vermelho amarelo do Município de Serra Talhada (PE, e selecioná-los quanto a resistente a alta temperatura e aos antibióticos kanamicina e ácido nalidíxico. O estudo foi conduzido na Empresa Pernambucana de
Directory of Open Access Journals (Sweden)
Alexandre Matsuda
2002-03-01
Full Text Available Sessenta estirpes/isolados dos gêneros Bradyrhizobium, Rhizobium, Sinorhizobium, Mesorhizobium e Azorhizobium, procedentes de diferentes locais (Mata Atlântica, Amazônia, culturas agrícolas e experimentos com metais pesados e de espécies hospedeiras pertencentes às subfamílias Papilionoideae, Mimosoideae e Caesalpinoideae, foram avaliadas quanto à tolerância a Zn, Cu e Cd em meio YMA modificado pela adição de tampões biológicos (HEPES e MES e suplementados com Cu (0 a 60 mg L-1, Cd (0 a 60 mg L-1 e Zn (0 a 1.000 mg L-1. Mediante padrões de crescimento atribuídos às culturas nas diferentes concentrações dos metais, avaliaram-se as concentrações máximas toleradas e as doses tóxicas destes metais para redução de crescimento em 25% (DT25 e 50% (DT50. Não houve influência da procedência na concentração máxima de metal tolerada. A ordem de sensibilidade aos metais, considerando-se as concentrações máximas toleradas, foi Azorhizobium > Rhizobium = Mesorhizobium = Sinorhizobium > Bradyrhizobium. A DT25 e a DT50 foram úteis para diferenciarem estirpes/isolados de um mesmo gênero, que atingiram a mesma concentração máxima tolerada a Zn, Cu e Cd. A ordem de toxicidade dos metais estudados foi Cu > Cd > Zn.Sixty strains/isolates of the genera Bradyrhizobium, Rhizobium, Sinorhizobium, Mesorhizobium and Azorhizobium, isolated from different hosts (legume subfamilies: Papilionoideae, Mimosoideae and Caesalpinoideae and location (Atlantic Forest, Amazon region, crop plantings and heavy metal experiments, were evaluated for Zn, Cu and Cd tolerance in YMA medium modified by the addition of biological buffers (HEPES and MES and supplemented with Cu (0 to 60 mg L-1, Cd (0 to 60 mg L-1, and Zn (0 to 1,000 mg L-1sulphates. Growth standards were applied to evaluate rhizobia cultures growth at different metal concentrations, allowing evaluation of highest tolerated concentrations of Zn, Cu, and Cd and the toxic doses
Tatiana Barrionuevo Gotti
2007-01-01
Considerando-se que a leptospirose pode ser transmitida pela inseminação artificial e a existência de possíveis falhas na Instrução Normativa vigente do Ministério da Agricultura, Pecuária e Abastecimento-MAPA, quanto ao controle desta enfermidade em touros em serviço reprodutivo em Centrais de lnseminação Artificial -CIA, e ainda pelas baixas taxas na FIV em vista da presença de microbiota autóctone no sêmen industrializado, o presente trabalho propôs avaliar: l-a microbiota autóctone presen...
Zhou, Huan; He, Yongkang; Ohtsuka, Ryutaro
2005-01-01
Based on nutritional and parasitological examinations of 389 children aged 10-13 years in five primary schools in the schistosomiasis endemic Dongting Lake region of China, the causal factors of their retarded growth, represented by height, weight, mid-upper arm circumference and body mass index, were investigated. Among the four parasites, schistosomiasis infection due to Schistosoma japonicum played a significant role, with higher rates in girls than in boys. Praziquantel treatment of schistosomiasis decreased the infection rate and improved the children's growth. For dietary intake factors, the contribution of protein to total energy intake, which was lower in girls than in boys, had the greatest effect on the growth patterns. The sex difference in growth retardation is judged to be attributable to the traditional norms, such as girls spending more time in infested environments and gender discrimination in food distribution.
Energy Technology Data Exchange (ETDEWEB)
Elhottova, D.; Kristufek, V.; Maly, S.; Frouz, J. [Academy of Sciences of the Czech Republic, Ceske Budejovice (Czech Republic). Inst. for Soil Biology
2009-07-01
The impact of pioneer plant species Tussilago farfara on structural, functional, and growth characterization of microbial community colonizing the spoil colliery substrate was studied in a laboratory microcosm experiment. Microcosms consisting of spoil substrate (0.7 dm{sup 3} of tertiary alkaline clay sediment from Sokolov brown-coal mine area) from a pioneer site (without vegetation, 5 years after heaping) were cultivated in a greenhouse with one plant of this species. Plant roots substantially increased microbial diversity and biomass after one season (7 months) of cultivation. Roots influenced the microbial community and had nearly twice the size, higher growth, and metabolic potential in comparison to the control. The development of microbial specialists improves the plant nutrient status. Bacterial nitrogen (N{sub 2}) fixators (Bradyrhizobium japonicum, Rhizobium radiobacter) and arbuscular mycorrhizal fungi were confirmed in the rhizosphere of Tussilago farfara.
Dicty_cDB: Contig-U02520-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available ) KBrH001K21F KBrH, Brassica rapa HindIII BAC libra... 46 3.3 1 ( CT538104 ) A BAC library has been constructed from culti...1 ( DR026249 ) Osmo00116 F. cylindrus osmotic stress library Fra... 46 3.3 1 ( DN805411 ) 76947238 Sea Urchi...( CV793140 ) c-030216-1w_E04.abd cDNA library of Tamarix andro... 46 3.3 1 ( CV672849 ) RET7SJ_07D06.T7 Schistosoma japonicum re...012 2 ( CK416159 ) AUF_IpPit_34_o05 Pituitary cDNA library Ictalurus... 54 0.013 1 ( FE840166 ) CCAG48972.g1...99 ) NF075H11EC1F1095 Elicited cell culture Medicago t... 48 0.20 2 ( BF647354 ) NF075A06EC1F1040 Elicited cell culture Medic
Evaluation of Lethal Giant Larvae as a Schistosomiasis Vaccine Candidate
Directory of Open Access Journals (Sweden)
Yufan Cao
2016-01-01
Full Text Available Schistosomiasis is a neglected tropical disease of humans, and it is considered to be the second most devastating parasitic disease after malaria. Eggs produced by normally developed female worms are important in the transmission of the parasite, and they responsible for the pathogenesis of schistosomiasis. The tumor suppressor gene lethal giant larvae (lgl has an essential function in establishing apical-basal cell polarity, cell proliferation, differentiation, and tissue organization. In our earlier study, downregulation of the lgl gene induced a significant reduction in the egg hatching rate of Schistosoma japonicum (Sj eggs. In this study, the Sjlgl gene was used as a vaccine candidate against schistosomiasis, and vaccination achieved and maintained a stable reduction of the egg hatching rate, which is consistent with previous studies, in addition to reducing the worm burden and liver egg burden in some trials.
Schistosoma japonicum transmission risk maps at present and under climate change in mainland China.
Zhu, Gengping; Fan, Jingyu; Peterson, A Townsend
2017-10-01
The South-to-North Water Diversion (SNWD) project is designed to channel fresh water from the Yangtze River north to more industrialized parts of China. An important question is whether future climate change and dispersal via the SNWD may synergistically favor a northward expansion of species involved in hosting and transmitting schistosomiasis in China, specifically the intermediate host, Oncomelania hupensis. In this study, climate spaces occupied by the four subspecies of O. hupensis (O. h. hupensis, O. h. robertsoni, O. h. guangxiensis and O. h. tangi) were estimated, and niche conservatism tested among each pair of subspecies. Fine-tuned Maxent (fMaxent) and ensemble models were used to anticipate potential distributions of O. hupensis under future climate change scenarios. We were largely unable to reject the null hypothesis that climatic niches are conserved among the four subspecies, so factors other than climate appear to account for the divergence of O. hupensis populations across mainland China. Both model approaches indicated increased suitability and range expansion in O. h. hupensis in the future; an eastward and northward shift in O. h. robertsioni and O. h. guangxiensis, respectively; and relative distributional stability in O. h. gangi. The southern parts of the Central Route of SNWD will coincide with suitable areas for O. h. hupensis in 2050-2060; its suitable areas will also expand northward along the southern parts of the Eastern Route by 2080-2090. Our results call for rigorous monitoring and surveillance of schistosomiasis along the southern Central Route and Eastern Route of the SNWD in a future, warmer China.
Directory of Open Access Journals (Sweden)
Manuel Alberto Restrepo-Medina
2010-03-01
Full Text Available Una de las características distintivas del sistema constitucional adoptado en 1991 es el desarrollo de mecanismos de control al ejercicio de la autoridad, uno de los cuales es el control fiscal, que bajo un tratamiento normativo diferente del vigente hasta entonces, se orienta a la preservación de los recursos públicos y a su aplicación a los fines esenciales del Estado. Dentro del nuevo esquema constitucional del control fiscal, su objeto de vigilancia lo constituye la gestión fiscal, cuyo ejercicio inadecuado, lesivo del erario, da lugar a la deducción de la consecuente responsabilidad patrimonial por parte de las contralorías. Ante la ausencia de desarrollo legal dada la precariedad de la regulación procesal contenida en la Ley 42 de 1993, la evolución conceptual al respecto fue asumida por las altas cortes hasta la expedición de la Ley 610 de 2000. Sin embargo, la demora en la expedición del estatuto legal que desarrollara integralmente el ejercicio de esta atribución de las contralorías, impide efectuar un juicio sobre las bondades o las fallas de la existencia y aplicación de esta institución jurídica de estirpe constitucional.
Estudos preliminares com bromoacetamida, um novo moluscicida
Directory of Open Access Journals (Sweden)
Naftale Katz
1985-09-01
Full Text Available A bromoacetamida tem sido testada como moluscicida na República Popular da China, para tratamento de criadouros de Oncomelania, hospedeiro do Schistosoma japonicum, com bons resultados. O produto é solúvel em água, o que simplifica seu uso. Foram feitos ensaios biológicos preliminares deste produto em caramujos adultos (Biomphalaria glabrata, B. tenagophila e B. straminea, recém-eclodidos e desovas. Paralelamente foram feitos ensaios com o pentaclorofenol para avaliar a suscetibilidade dos caramujos. O produto foi testado também sobre peixes, Lebistes reticulatus. Os moluscos testados mediam 8-10 mm de diâmetro; os recém-eclodidos tinham 1-3 dias de idade e as desovas 0-1 dia de idade. A temperatura da água durante os experimentos variou de 24,3 a 27,0°C. O produto foi ativo para caramujos adultos, recém-eclodidos e desovas, em concentrações em tomo de 1 a 4 ppm. Para os peixes o produto foi menos tóxico do que para os caramujos (CLço 7,5 ppm. Estes resultados indicam que a bromoacetamida apresenta propriedades moluscicidas promissoras para o controle da Biomphalaria spp.Bromocetamide has been tested as molluscicide, with good results, in the People's Republic of China, on Oncomelania, host of Schistosoma japonicum. We have conducted preliminary assays with bromoacetamide on adult snails (B. glabrata, B. tenagophila and B. straminea, newly hatched smails and egg-masses. This product has been also tested on fishes (Lebistes reticulatus. Comparative assays have been made with pentaclorophenol to evaluate the suceptibility of the snails. Snails tested had a diameter of 8-10 mm; the newly hatched were 1-3 days old and the eggs-masses. 0-1 day old. The temperature of the water varied from 24.3 to 27.5° C. Bromoacetamide was active on adult and newly hatched snails and egg-masses, in concentrations from 1-4ppm. The product was less toxic for jish (LC90 = 7,5 ppm. These results indicate that bromoacetamide has promising molluscicide
A Rapid Monitoring and Evaluation Method of Schistosomiasis Based on Spatial Information Technology.
Wang, Yong; Zhuang, Dafang
2015-12-12
Thanks to Spatial Information Technologies (SITs) such as Remote Sensing (RS) and Geographical Information System (GIS) that are being quickly developed and updated, SITs are being used more widely in the public health field. The use of SITs to study the characteristics of the temporal and spatial distribution of Schistosoma japonicum and to assess the risk of infection provides methods for the control and prevention of schistosomiasis japonica has gradually become a hot topic in the field. The purpose of the present paper was to use RS and GIS technology to develop an efficient method of prediction and assessment of the risk of schistosomiasis japonica. We choose the Yueyang region, close to the east DongTing Lake (Hunan Province, China), as the study area, where a recent serious outbreak of schistosomiasis japonica took place. We monitored and evaluated the transmission risk of schistosomiasis japonica in the region using SITs. Water distribution data were extracted from RS images. The ground temperature, ground humidity and vegetation index were calculated based on RS images. Additionally, the density of oncomelania snails, which are the Schistosoma japonicum intermediate host, was calculated on the base of RS data and field measurements. The spatial distribution of oncomelania snails was explored using SITs in order to estimate the area surrounding the residents with transmission risk of schistosomiasis japonica. Our research result demonstrated: (1) the risk factors for the transmission of schistosomiasis japonica were closely related to the living environment of oncomelania snails. Key factors such as water distribution, ground temperature, ground humidity and vegetation index can be quickly obtained and calculated from RS images; (2) using GIS technology and a RS deduction technique along with statistical regression models, the density distribution model of oncomelania snails could be quickly built; (3) using SITs and analysis with overlaying population
Jang, Su Hee; Kim, Dong Il; Choi, Min-Sun
2014-01-10
During their reproductive years about 10% of women experience some kind of symptoms before menstruation (PMS) in a degree that affects their quality of life (QOL). Acupuncture and herbal medicine has been a recent favorable therapeutic approach. Thus we aimed to review the effects of acupuncture and herbal medicine in the past decade as a preceding research in order to further investigate the most effective Korean Medicine treatment for PMS/PMDD. A systematic literature search was conducted using electronic databases on studies published between 2002 and 2012. Our review included randomized controlled clinical trials (RCTs) of acupuncture and herbal medicine for PMS/PMDD. Interventions include acupuncture or herbal medicine. Clinical information including statistical tests was extracted from the articles and summarized in tabular form or in the text. Study outcomes were presented as the rate of improvement (%) and/or end-of-treatment scores. The search yielded 19 studies. In screening the RCTs, 8 studies in acupuncture and 11 studies in herbal medicine that matched the criteria were identified. Different acupuncture techniques including traditional acupuncture, hand acupuncture and moxibustion, and traditional acupuncture technique with auricular points, have been selected for analysis. In herbal medicine, studies on Vitex Agnus castus, Hypericum perforatum, Xiao yao san, Elsholtzia splendens, Cirsium japonicum, and Gingko biloba L. were identified. Experimental groups with Acupuncture and herbal medicine treatment (all herbal medicine except Cirsium japonicum) had significantly improved results regarding PMS/PMDD. Limited evidence supports the efficacy of alternative medicinal interventions such as acupuncture and herbal medicine in controlling premenstrual syndrome and premenstrual dysphoric disorder. Acupuncture and herbal medicine treatments for premenstrual syndrome and premenstrual dysphoric disorder showed a 50% or better reduction of symptoms compared to
2014-01-01
Background During their reproductive years about 10% of women experience some kind of symptoms before menstruation (PMS) in a degree that affects their quality of life (QOL). Acupuncture and herbal medicine has been a recent favorable therapeutic approach. Thus we aimed to review the effects of acupuncture and herbal medicine in the past decade as a preceding research in order to further investigate the most effective Korean Medicine treatment for PMS/PMDD. Methods A systematic literature search was conducted using electronic databases on studies published between 2002 and 2012. Our review included randomized controlled clinical trials (RCTs) of acupuncture and herbal medicine for PMS/PMDD. Interventions include acupuncture or herbal medicine. Clinical information including statistical tests was extracted from the articles and summarized in tabular form or in the text. Study outcomes were presented as the rate of improvement (%) and/or end-of-treatment scores. Results The search yielded 19 studies. In screening the RCTs, 8 studies in acupuncture and 11 studies in herbal medicine that matched the criteria were identified. Different acupuncture techniques including traditional acupuncture, hand acupuncture and moxibustion, and traditional acupuncture technique with auricular points, have been selected for analysis. In herbal medicine, studies on Vitex Agnus castus, Hypericum perforatum, Xiao yao san, Elsholtzia splendens, Cirsium japonicum, and Gingko biloba L. were identified. Experimental groups with Acupuncture and herbal medicine treatment (all herbal medicine except Cirsium japonicum) had significantly improved results regarding PMS/PMDD. Conclusions Limited evidence supports the efficacy of alternative medicinal interventions such as acupuncture and herbal medicine in controlling premenstrual syndrome and premenstrual dysphoric disorder. Acupuncture and herbal medicine treatments for premenstrual syndrome and premenstrual dysphoric disorder showed a 50% or
Directory of Open Access Journals (Sweden)
Martín Díaz-Zorita
2010-12-01
Full Text Available La simbiosis entre rizobios y soja [Glycine max (L. Merril] provee parte de los requerimientos de N del cultivo en un proceso que depende de la disponibilidad de nutrientes tales como el P. El objetivo de este estudio fue determinar los aportes de la fertilización con P (0,18 y 36 kg ha-1 y de la inoculación con Bradyrhizobium japonicum sobre la nodulación y los rendimientos de soja en Vertisoles potencialmente deficientes en P. En sitios sin antecedentes de soja, la inoculación incrementó la nodulación, la biomasa aérea y el rendimiento en grano por sobre los cultivos sin inocular. Al aumentar el P disponible (Psuelo + Pfertilización hasta 12,4 mg kg-1 la nodulación y la biomasa aérea aumentaron. En los sitios con antecedentes de soja en rotación, los rendimientos fueron superiores al inocular y sólo con este tratamiento la biomasa aérea y los rendimientos mejoraron al aumentar la oferta de P. En general, los cultivos inoculados y fertilizados mostraron los mayores rendimientos sugiriendo la conveniencia del manejo combinado de la nutrición del cultivo.The symbiosis between rhizobia and soybean [Glycine max (L. Merril] provides most of the nitrogen requirements of the crop through a process that also depends on the availability of nutrients, for example phosphorous. The objective of this study was to determine the contribution of P fertilization (0, 18 y 36 kg ha-1 and Bradyrhizobium japonicum inoculation on the nodulation and grain yield of soybean crops in Vertisols with low soil P availability. In the sites without previous soybean crops, the inoculation promoted a greater nodulation, and shoot dry matter and grain yields above the non-inoculated crops. Nodulation and shoot growth increased with increasing available P (Psoil + Pfertilization levels up to 12.4 mg kg-1. In the sites rotated with soybean, yields were greater in the inoculated crops. Shoot dry matter and grain yields increased with increasing available P levels
Directory of Open Access Journals (Sweden)
Gabriel Salles Góes
2015-12-01
Full Text Available Inga laurina é uma espécie arbórea com ampla distribuição na América do Sul, útil para sistemas agroflorestais, restauração florestal e arborização urbana. Este estudo teve como objetivo avaliar os efeitos da inoculação com bactérias fixadoras de nitrogênio (N e da adubação nitrogenada no crescimento e qualidade de mudas de I. laurina. O experimento teve duração de 170 dias, e as mudas foram cultivadas em tubetes plásticos com 115 cm3 de capacidade, contendo uma mistura 9: 1 em volume de HS Florestal® e pó de fibra de coco como substrato. Foram analisados seis tratamentos, sendo quatro inoculações (Bradyrhizobium japonicum 1 - BJ1, Rhizobium miluonense - RM, Bradyrhizobium japonicum 2- BJ2 e Burkholderia cepacia - BC, o controle positivo - C+ (sem inoculação e com adubação nitrogenada semanal, 60 mg dm3 de N, na forma de ureia e o controle negativo - C- (sem inoculação e sem adubação nitrogenada. Os tratamentos com inoculação foram pouco efetivos em relação ao crescimento das mudas, visto que as médias das variáveis de crescimento, da massa foliar específica (MFE e do índice de qualidade de Dixon (IQD foram significativamente superiores no C+, em comparação com os demais tratamentos. No entanto, os isolados RM e BJ2 foram efetivos na produção de nódulos, pois apresentaram os maiores valores médios da massa de matéria seca de nódulos (MSN. Além disso, os valores médios do índice de clorofila Falker (ICF foram significativamente superiores nos tratamentos com inoculação em relação ao C-. Os melhores resultados entre os tratamentos com inoculação foram obtidos para RM, seguido de BJ2.
Leong, L. E.-C.; Walker, P. A.; Porter, A. G.
1992-08-01
The protease (3C pro) from human rhinovirus serotype-14 (HRV-14) has been cloned and efficiently expressed in E. coli. A straightforward single-step purification of the recombinant 3C pro has been achieved by fusing the protein to the car☐y-terminus of the glutathione-S-transferase from Schistosoma japonicum. Modifications made to the 5' end of the PCR fragment coding for the 3C pro have allowed the specific cleavage of the fusion protein using thrombin to yield mature 3C pro with the correct amino-terminal amino acid. This protease has been shown to be active when assayed using synthetic peptides corresponding to the natural cleavage recognition sequences within the polyprotein. Other substrates are being developed for this protease for possible use in the screening of inhibitors of 3C pro. Sufficient protease 3C pro has been purified for initial attempts at crystallization.
Monincová, Marta; Prokop, Zbynek; Vévodová, Jitka; Nagata, Yuji; Damborsky, Jirí
2007-03-01
1,2,3-Trichloropropane (TCP) is a highly toxic and recalcitrant compound. Haloalkane dehalogenases are bacterial enzymes that catalyze the cleavage of a carbon-halogen bond in a wide range of organic halogenated compounds. Haloalkane dehalogenase LinB from Sphingobium japonicum UT26 has, for a long time, been considered inactive with TCP, since the reaction cannot be easily detected by conventional analytical methods. Here we demonstrate detection of the weak activity (k(cat) = 0.005 s(-1)) of LinB with TCP using X-ray crystallography and microcalorimetry. This observation makes LinB a useful starting material for the development of a new biocatalyst toward TCP by protein engineering. Microcalorimetry is proposed to be a universal method for the detection of weak enzymatic activities. Detection of these activities is becoming increasingly important for engineering novel biocatalysts using the scaffolds of proteins with promiscuous activities.
Monincová, Marta; Prokop, Zbyněk; Vévodová, Jitka; Nagata, Yuji; Damborský, Jiří
2007-01-01
1,2,3-Trichloropropane (TCP) is a highly toxic and recalcitrant compound. Haloalkane dehalogenases are bacterial enzymes that catalyze the cleavage of a carbon-halogen bond in a wide range of organic halogenated compounds. Haloalkane dehalogenase LinB from Sphingobium japonicum UT26 has, for a long time, been considered inactive with TCP, since the reaction cannot be easily detected by conventional analytical methods. Here we demonstrate detection of the weak activity (kcat = 0.005 s−1) of LinB with TCP using X-ray crystallography and microcalorimetry. This observation makes LinB a useful starting material for the development of a new biocatalyst toward TCP by protein engineering. Microcalorimetry is proposed to be a universal method for the detection of weak enzymatic activities. Detection of these activities is becoming increasingly important for engineering novel biocatalysts using the scaffolds of proteins with promiscuous activities. PMID:17259360
SCHISTOSOMIASIS: GEOSPATIAL SURVEILLANCE AND RESPONSE SYSTEMS IN SOUTHEAST ASIA
Directory of Open Access Journals (Sweden)
J. Malone
2016-10-01
Full Text Available Geographic information system (GIS and remote sensing (RS from Earth-observing satellites offer opportunities for rapid assessment of areas endemic for vector-borne diseases including estimates of populations at risk and guidance to intervention strategies. This presentation deals with GIS and RS applications for the control of schistosomiasis in China and the Philippines. It includes large-scale risk mapping including identification of suitable habitats for Oncomelania hupensis, the intermediate host snail of Schistosoma japonicum. Predictions of infection risk are discussed with reference to ecological transformations and the potential impact of climate change and the potential for long-term temperature increases in the North as well as the impact on rivers, lakes and water resource developments. Potential integration of geospatial mapping and modeling in schistosomiasis surveillance and response systems in Asia within Global Earth Observation System of Systems (GEOSS guidelines in the health societal benefit area is discussed.
Hemodynamic effects of a novel pharmacologic stress agent, Higemine
International Nuclear Information System (INIS)
Zhang, X.L.; Liu, X.J.; Tao, Z.H.; Shi, R.F.
2002-01-01
Objective: Higenamine (dl-demethylcodaurine) (HG), which was isolated from aconitum japonicum. This study was to evaluate the hemodynamic effects of HG in animal study. Methods: We compared the hemodynamic effects of HG (0.5-4μg/min/kg) with Dobutamine (Dob) (5-30μg/min/kg) in 6 dogs: heart rate (HR), blood pressure (BP), coronary blood flow (CBF), myocardial oxygen consumption (MOC) were measured. Tolerability and safety of HG (1-500μg/mg/min) were evaluated in 8 dogs. Results: Comparison of hemodynamic effects between Dob an HG was presented. SBP: systolic blood pressure; DP: diastolic blood pressure; P<0.01; P<0.05. Diastolic BP slightly decreased, but systolic BP did not change significantly during HG infusion. There was no significant ECG abnormalities and side effects during HG infusion. Conclusion: HG might be a safe and useful pharmacologic stress agent, especially for patients with severe hypertension
Gross, Johannes; Prokop, Zbyněk; Janssen, Dick; Faber, Kurt; Hall, Mélanie
2016-08-03
The hydrolytic dehalogenation of rac-1,3-dibromobutane catalyzed by the haloalkane dehalogenase LinB from Sphingobium japonicum UT26 proceeds in a sequential fashion: initial formation of intermediate haloalcohols followed by a second hydrolytic step to produce the final diol. Detailed investigation of the course of the reaction revealed favored nucleophilic displacement of the sec-halogen in the first hydrolytic event with pronounced R enantioselectivity. The second hydrolysis step proceeded with a regioselectivity switch at the primary position, with preference for the S enantiomer. Because of complex competition between all eight possible reactions, intermediate haloalcohols formed with moderate to good ee ((S)-4-bromobutan-2-ol: up to 87 %). Similarly, (S)-butane-1,3-diol was formed at a maximum ee of 35 % before full hydrolysis furnished the racemic diol product. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Ding, Xia; Lv, Zhen-Mei; Zhao, Yang; Min, Hang; Yang, Wei-Jun
2008-01-01
MTH1745 is a putative protein disulfide isomerase characterized with 151 amino acid residues and a CPAC active-site from the anaerobic archaea Methanothermobacter thermoautotrophicum. The potential functions of MTH1745 are not clear. In the present study, we show a crucial role of MTH1745 in protecting cells against stress which may be related to its functions as a disulfide isomerase and its chaperone properties. Using real-time polymerase chain reaction analyses, the level of MTH1745 messenger RNA (mRNA) in the thermophilic archaea M. thermoautotrophicum was found to be stress-induced in that it was significantly higher under low (50 degrees C) and high (70 degrees C) growth temperatures than under the optimal growth temperature for the organism (65 degrees C). Additionally, the expression of MTH1745 mRNA was up-regulated by cold shock (4 degrees C). Furthermore, the survival of MTH1745 expressing Escherichia coli cells was markedly higher than that of control cells in response to heat shock (51.0 degrees C). These results indicated that MTH1745 plays an important role in the resistance of stress. By assay of enzyme activities in vitro, MTH1745 also exhibited a chaperone function by promoting the functional folding of citrate synthase after thermodenaturation. On the other hand, MTH1745 was also shown to function as a disulfide isomerase on the refolding of denatured and reduced ribonuclease A. On the basis of its single thioredoxin domain, function as a disulfide isomerase, and its chaperone activity, we suggest that MTH1745 may be an ancient protein disulfide isomerase. These studies may provide clues to the understanding of the function of protein disulfide isomerase in archaea.
Animal caliciviruses / Calicivírus animal
Directory of Open Access Journals (Sweden)
Amauri Alcindo Alfieri
2008-08-01
-like virus, são considerados os mais importantes causadores de gastroenterite não-bacteriana em seres humanos adultos e crianças em países da Europa, nos Estados Unidos e Japão. Os hospedeiros naturais dos norovírus são os seres humanos, bovinos, suínos e ratos. Os sapovírus são descritos em seres humanos e suínos, e principalmente os indivíduos jovens são acometidos. Em seres humanos a infecção pelos sapovírus se manifesta como uma diarréia moderada e em suínos já foi verificada atrofia das vilosidades intestinais e diarréia em leitões experimentalmente infectados com a estirpe padrão Cowden. Apesar da grande variabilidade genética descrita nos sapovírus, já foram descritas recombinações entre estirpes de genogrupos e genotipos diferentes, existindo a possibilidade do potencial zoonótico da doença.
Directory of Open Access Journals (Sweden)
Luciano Kayser Vargas
2007-08-01
Full Text Available A acácia-negra é a terceira espécie florestal mais cultivada no Brasil. Além de sua importância econômica, é utilizada na recuperação de áreas degradadas, nas quais o solo geralmente apresenta pH baixo e altos teores de Al. O presente trabalho objetivou avaliar a diversidade genética de rizóbios naturais de solos do Rio Grande do Sul e selecionar isolados eficientes na fixação de N2 em condições de pH baixo. Um total de 50 isolados de Bradyrhizobium sp. foi obtido, os quais, juntamente com as estirpes recomendadas BR 3067 e BR 3068, foram caracterizados com o marcador BOX A 1-R. O padrão de bandas dos isolados foi utilizado na construção de um dendrograma, a partir do qual se calculou o índice de diversidade de Shannon. Dez isolados foram testados quanto à tolerância a pH baixo e à presença de Al, selecionando-se oito para o teste de eficiência simbiótica em casa de vegetação. Observou-se diversidade genética elevada entre os isolados, com a formação de 10 grupos, a partir do ponto de corte de 70 % de similaridade e com o índice de diversidade de 4,30. A presença de Al não afetou os isolados avaliados, que tiveram seu crescimento reduzido em pH 4,5. Quanto à eficiência simbiótica, os isolados T6-16 e V-7 foram os mais eficientes, assemelhando-se à estirpe recomendada BR 3068.Black wattle is the third most cultivated forest species in Brazil. Besides its economic importance, black wattle is also used to restore degraded areas, where soils are generally acid and Al levels high. This study intended to investigate the genetic diversity of indigenous rhizobia in soils in Rio Grande do Sul and to select isolates that fix N2 efficiently at low pH. Fifty Bradyrhizobium sp. isolates were obtained, which, along with the recommended strains BR 3067 and BR 3068, were molecularly characterized by PCR with primer BOX A 1-R. DNA band patterns of the isolates were used to construct a dendrogram by which the Shannon
International Nuclear Information System (INIS)
Wongwicharn, A.; Piadang, S.
1994-01-01
The study on the growth of Rhizobium japonicum THA-7 in carriers: Peat Sludge, Filter press cake from sugar industry and the mixer compone nts of Sludge and Filter press cake. These carriers were sterilized by Gamm a radiation at 55 Kilograys. Then rhizobium suspension which grew to late log phase in Mannitol Yeast Extract broth were transfer to carriers. The initial rhizobial cells were 10 7 cfu at 50 percent moisture content. The maximum growth (10 9 cfu) was found after incubation at 30 o C for 17 days in all carriers. The rhizobial cells were stored in carriers at 4 o - 5 o C for 120 days. The amount of cells in all carriers were detected at 10 8 cfu. Maximum survival rate was in the mixture of sludge and filter press cake at the ratio of 1 : 3. Therefore, It should be used as biological fertilizer better than other carriers
Characterization of indigenous rhizobia from Caatinga
Directory of Open Access Journals (Sweden)
Fernanda Cíntia Pires e Teixeira
2010-03-01
Full Text Available The aim of this study was to characterize rhizobial isolates from Cratylia mollis Mart. ex Benth, Calliandra depauperata Benth. and Mimosa tenuiflora (Willd. Poir. by means of rhizobial colonies morphology and restriction analysis of the 16S ribosomal gene (16S rDNA-ARDRA. Nodules were collected in the field and from plants cultivated in a greenhouse experiment using Caatinga soil samples. Sixty seven isolates were described by morphological analysis. Forty seven representative isolates were used for ARDRA analysis using seven restriction enzymes. We observed high diversity of both slow and fast-growing rhizobia that formed three morpho-physiological clusters. A few fast-growing isolates formed a group of strains of the Bradyrhizobium type; however, most of them diverged from the B. japonicum and B. elkanii species. Cratylia mollis nodule isolates were the most diverse, while all Mimosa tenuiflora isolates displayed fast growth with no pH change and were clustered into groups bearing 100% similarity, according to ARDRA results.
Zhang, L-J; Li, S-Z; Wen, L-Y; Lin, D-D; Abe, E M; Zhu, R; Du, Y; Lv, S; Xu, J; Webster, B L; Rollinson, D; Zhou, X-N
2016-01-01
Schistosoma japonicum is the main schistosome species in The People's Republic of China, causing intestinal schistosomiasis, a debilitating disease of public health importance. The People's Republic of China used to be heavily endemic with schistosomiasis, but great progress has been made through the vigorous efforts of the national control programmes in the last six decades. Presently, efforts are geared towards eliminating schistosomiasis from The People's Republic of China by the end of 2025 through effective schistosomiasis surveillance, an important component in the drive towards schistosomiasis elimination. Therefore, this article explicitly outlines the development and progress made in schistosomiasis surveillance since 1990 with a special focus on the new surveillance system in use. Although the surveillance system has steadily improved over the years, it is faced with many challenges. Hence, more efforts are needed to establish an effective and sensitive evaluation system for the national schistosomiasis elimination programme in The People's Republic of China. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
F.V. Silva
2012-06-01
Full Text Available The aim of this work was to characterize rhizobia isolated from the root nodules of cowpea (Vigna unguiculata plants cultivated in Amazon soils samples by means of ARDRA (Amplified rDNA Restriction Analysis and sequencing analysis, to know their phylogenetic relationships. The 16S rRNA gene of rhizobia was amplified by PCR (polymerase chain reaction using universal primers Y1 and Y3. The amplification products were analyzed by the restriction enzymes HinfI, MspI and DdeI and also sequenced with Y1, Y3 and six intermediate primers. The clustering analysis based on ARDRA profiles separated the Amazon isolates in three subgroups, which formed a group apart from the reference isolates of Bradyrhizobium japonicum and Bradyrhizobium elkanii. The clustering analysis of 16S rRNA gene sequences showed that the fast-growing isolates had similarity with Enterobacter, Rhizobium, Klebsiella and Bradyrhizobium and all the slow-growing clustered close to Bradyrhizobium.
Directory of Open Access Journals (Sweden)
Arlem Nascimento de Oliveira
2009-12-01
Full Text Available Few are the details concerning the molecular characterization of native rhizobia isolates from Amazonas soils. The aim of the present study was the genetic characterization of rhizobia isolated from nodules of cowpea using the method PCR-RFLP of the ribosome genes 16S rRNA and the restriction enzymes HinfI, MspI, and MboI. The analysis included 20 native isolates and ten reference strains from different origins. The results indicated a great genetic variability with the formation of eight groups in one dendrogram with a varied level of similarity.Poucas são as informações referentes à caracterização molecular de rizóbios nativos isolados de solos no Amazonas. Assim, o objetivo deste trabalho foi a caracterização genética de rizóbios isolados de nódulos de caupi usando o método PCR-RFLP dos genes ribossomais 16S rRNA e as enzimas de restrição HinfI, MspI, e MboI. A análise incluiu 20 isolados nativos e dez estirpes-referência de diferentes origens. Os resultados indicaram uma grande variabilidade genética com a formação de oito grupos em um dendrograma com um nível de similaridade variado.
Factor de crecimiento transformante beta-1: estructura, función y mecanismos de regulación en cáncer
Directory of Open Access Journals (Sweden)
Peralta-Zaragoza Oscar
2001-01-01
Full Text Available El factor de crecimiento transformante beta-1 (TGF-beta1 es sintetizado por muchas estirpes celulares como linfocitos, macrófagos y células dendríticas, y su expresión regula de manera autócrina o parácrina la diferenciación, proliferación y el estado de activación de éstas y muchas otras células. En general, el TGF-beta1 tiene propiedades pleiotrópicas en el contexto de la respuesta inmune durante el desarrollo de infecciones y procesos neoplásicos; sin embargo, los mecanismos de acción y regulación de la expresión de esta citocina aún no se comprenden del todo. En la presente revisión se describen las propiedades biológicas y los procesos moleculares que regulan la expresión del TGF-beta1, para entender los efectos de esta citocina durante la proliferación y la diferenciación celular. El conocimiento de los mecanismos moleculares de la regulación del TGF-beta1 puede representar una importante estrategia de tratamiento del cáncer. El texto completo en inglés de este artículo está disponible en: http://www.insp.mx/salud/index.html
Directory of Open Access Journals (Sweden)
Francisco Mercado Montañez
2017-07-01
Full Text Available Los tumores de la región facial en niños son poco frecuentes pero el daño que ocasionan en los tejidos modifica el desarrollo y crecimiento de la cara, ocasionando alteraciones físicas, estéticas y psicológicas. El origen histopatológico de las lesiones es variable, pero la conducta local de las mismas suele ser agresiva, no correspondiendo en muchas ocasiones a su «benigna» apariencia histológica. Para llegar a un diagnóstico correcto es importante conocer características clínicas y de imagen que presenta cada lesión, realizar una adecuada toma de biopsia, además de contar con histopatólogos de experiencia en el reconocimiento de estos tumores, ya que de ello depende el correcto tratamiento a realizar. El objetivo del tratamiento es la resección de la lesión, restaurando función y estética facial y de ser posible, favorecer el crecimiento de las estructuras anatómicas afectadas. En este artículo se reportan 3 casos de tumores en pacientes pediátricos, de diferente estirpe histopatológica y de poca frecuencia, pero con la misma agresividad local, tratados en el Hospital de Alta Especialidad (UMAE 134, del Instituto Mexicano del Seguro Social, Torreón, Coahuila, México.
Alves, Artur Jorge da Costa Peixoto
2001-01-01
O síndroma da esca é uma das doenças mais destrutivas da videira (Vitis vinifera L.), estando disseminado pela grande maioria dos países onde tradicionalmente se cultiva a vinha, tendo sido já identificada em diversas regiões vitivinícolas de Portugal. Pensa-se que esta doença resulta da acção de diversos fungos actuando conjuntamente ou em sucessão. De entre estes, os mais frequentes são fungos mitospóricos do género Phaeoacremonium. Neste trabalho foram analisadas 14 estir...
Directory of Open Access Journals (Sweden)
Justin Remais
Full Text Available Cooking and heating remain the most energy intensive activities among the world's poor, and thus improved access to clean energies for these tasks has been highlighted as a key requirement of attaining the major objectives of the UN Millennium Development Goals. A move towards clean energy technologies such as biogas systems (which produce methane from human and animal waste has the potential to provide immediate benefits for the control of neglected tropical diseases. Here, an assessment of the parasitic disease and energy benefits of biogas systems in Sichuan Province, China, is presented, highlighting how the public health sector can leverage the proliferation of rural energy projects for infectious disease control.First, the effectiveness of biogas systems at inactivating and removing ova of the human parasite Schistosoma japonicum is experimentally evaluated. Second, the impact of biogas infrastructure on energy use and environmental quality as reported by surveyed village populations is assessed, as is the community acceptance of the technology. No viable eggs were recovered in the effluent collected weekly from biogas systems for two months following seeding with infected stool. Less than 1% of ova were recovered viable from a series of nylon bags seeded with ova, a 2-log removal attributable to biochemical inactivation. More than 90% of Ascaris lumbricoides ova (used as a proxy for S. japonicum ova counted at the influent of two biogas systems were removed in the systems when adjusted for system residence time, an approximate 1-log removal attributable to sedimentation. Combined, these inactivation/removal processes underscore the promise of biogas infrastructure for reducing parasite contamination resulting from nightsoil use. When interviewed an average of 4 years after construction, villagers attributed large changes in fuel usage to the installation of biogas systems. Household coal usage decreased by 68%, wood by 74%, and crop waste
[Investigation of some virulence factors in Trichosporon spp. strains].
Demir, Feyza; Kuştimur, Semra
2014-10-01
The frequency of fungal infections have increased recently in parallel to prolonged survival of patients with chronical infections, common use of the broad-spectrum antibiotics and cytotoxic drugs and surgical interventions. Fungi such as Trichosporon, Fusarium and Geotrichum that were previously evaluated as contaminant/colonization, become important causes of morbidity and mortality especially in neutropenic patients. The aim of this study was to investigate the presence of virulence factors such as acid proteinase, phospholipase, esterase, coagulase and hemolytic activity among Trichosporon species. A total of 40 Trichosporon strains, of them 24 (60%) were T.asahii, 6 (15%) were T.inkin and 10 (25%) were the other species (one of each of T.aquatile, T.asteroides, T.coremiiforme, T.cutaneum, T.dermatis, T.faecale, T.japonicum, T.montevideense, T.mucoides, T.ovoides) were included in the study. Identification of the isolates was performed according to microscopic morphology (blastospores, arthrospores, pseudohyphae and true hyphae) on corn meal agar media, and carbohydrate assimilation patterns (API ID32C; bioMérieux, France). Secretory acid proteinase, phospholipase and esterase activities of the strains were evaluated by 1% bovine serum albumin containing agar, by egg yolk containing solid medium, and by Tween 80 containing solid medium, respectively. Hemolytic activity of the isolates were evaluated by 5-10% sheep blood Sabouraud dextrose agar. Coagulase enzyme activity was determined by using human and rabbit plasma. In our study, all of the 40 Trichosporon spp. strains were found negative in terms of acid proteinase and phospholipase enzyme activity, however all were positive for esterase enzyme activity. Hemolytic enzyme activity were identified in a total of 15 (37.5%) strains, being "+++" in three strains (2 T.asahii, 1 T.japonicum), and "++" in 12 isolates (9 T.asahii, 1 T.inkin, 1 T.asteroides, 1 T.mentevideense). Although 11 of those 15 positive
Performance evaluation of the BSRC multi-purpose bio-climatic roof
Energy Technology Data Exchange (ETDEWEB)
Waewsak, J.; Hirunlabh, J.; Khedari, J. [Mongkut' s University of Technology, Bangkok (Thailand). Building Scientific Research Center; Shin, U.C. [Taejon University (Korea). College of Engineering
2003-11-01
This paper reports on experimental investigation of the performance of a new multi-purpose bio-climatic roof (BCR) developed by our teamwork (The Building Scientific Research Center, BSRC). The innovative functions of this BSRC-BCR are to decrease daily heat gain through the roof fabrics, to induce significant air ventilation rate, which improves the thermal comfort of residents, to ensure appropriate daylighting without any overheating and to act as a roof radiator during nighttime. The BSRC-BCR is composed of a combination of CPAC Monier concrete and transparent acrylic tiles on the outer side, air gap and another combination of gypsum with an aluminum foil board and translucent sheets on the room side. The thermal and visual performances of BCR were investigated experimentally and compared to the conventional roof solar collector (RSC) based on the following three important parameters: the temperature difference index (TD) defined as the temperature difference between the outdoor and indoor, the air change number (ACH) induced by the BSRC-BCR and the amount of indoor illumination. To this end, two units (BCR and RSC) each of 1 x l.5 m{sup 2} surface area were integrated into the south-facing roof of the center single-room solar house of 25 m{sup 3} volume. The experimental results show that the BSRC-BCR is extremely interesting as it can reduce roof heat gain significantly, provide sufficient natural lighting for housing and induce high air change that improve indoor thermal comfort. The TD index of BCR was always lower or close to neutral than that of RSC during the hottest period of the day. The indoor illuminance delivered by the BSRC-BCR was about 300 and 140 lx in summer and winter, respectively. The ACH was about 13-14 and 5-7 in summer and winter, respectively, two times that induced by the RSC. (author)
Directory of Open Access Journals (Sweden)
Diógenes da Cruz Batista
2012-09-01
Full Text Available A mangicultura praticada no Submédio do Vale do São Francisco é considerada um dos principais destaques no comércio externo do País. Dentre as diversas variedades cultivadas, a Tommy Atkins é a que representa a maior parte das exportações. Entretanto, a magnitude das perdas por podridões pós-colheita, causadas por fungos Botryosphaeriaceae, é sempre uma grande preocupação para exportadores e importadores da fruta. A busca por métodos de controle mais eficazes e limpos é uma tendência mundial. Nesse sentido, o objetivo deste trabalho foi avaliar a reação de frutos, de 47 acessos de mangueiras, quanto à resistência aos fungos Fusicoccum aesculis e Neofusicoccum parvum. As inoculações foram realizadas mediante deposição de disco do meio de cultura batata-dextrose-ágar (BDA, contendo estruturas do patógeno sobre duas posições opostas na região equatorial da manga, mantido, posteriormente, por 24 horas em câmara úmida. Foram realizadas medições das lesões até o sétimo dia, com uma régua milimetrada. Com os registros dos crescimentos das lesões, foram calculadas as taxas diárias de crescimento da lesão (TDCL's para cada acesso. As maiores TDCLs foram observadas nos acessos 'Roxa' e 'Lita', quando inoculados com F. aesculis, e nos acessos 'Roxa', 'Ruby', 'Papo de peru', 'CPAC 22/93', 'Pingo-de-ouro', 'Pêssego' e 'M13269', quando inoculados com N. parvum. Os acessos 'Nego-não-chupa', 'Manga-d'água', 'Juazeiro VI', 'Juazeiro VII' e 'Favo-de-mel' foram os que apresentaram, concomitantemente, as menores TDCLs para ambos os patógenos e diferenças significativas em relação aos demais acessos.
Manzano, Susana; Aguado, Encarnación; Martínez, Cecilia; Megías, Zoraida; García, Alicia; Jamilena, Manuel
2016-01-01
Monoecious and andromonoecious cultivars of watermelon are characterised by the production of male and female flower or male and hermaphrodite flowers, respectively. The segregation analysis in the offspring of crosses between monoecious and andromonoecious lines has demonstrated that this trait is controlled by a single gene pair, being the monoecious allele M semi-dominant to the andromonoecious allele A. The two studied F1 hybrids (MA) had a predominantly monoecious phenotype since both produced not only female flowers, but also bisexual flowers with incomplete stamens, and hermaphrodite flowers with pollen. Given that in other cucurbit species andromonoecy is conferred by mutations in the ethylene biosynthesis genes CmACS7, CsACS2 and CpACS27A we have cloned and characterised CitACS4, the watermelon gene showing the highest similarity with the formers. CitACS4 encoded for a type ACS type III enzyme that is predominantly expressed in pistillate flowers of watermelon. In the andromonoecious line we have detected a missense mutation in a very conserved residue of CitACS4 (C364W) that cosegregates with the andromonoecious phenotype in two independent F2 populations, concomitantly with a reduction in ethylene production in the floral buds that will develop as hermaphrodite flowers. The gene does not however co-segregates with other sex expression traits regulated by ethylene in this species, including pistillate flowering transition and the number of pistillate flowers per plant. These data indicate that CitAC4 is likely to be involved in the biosynthesis of the ethylene required for stamen arrest during the development of female flowers. The C364W mutation would reduce the production of ethylene in pistillate floral buds, promoting the conversion of female into hermaphrodite flowers, and therefore of monoecy into andromonoecy.
Directory of Open Access Journals (Sweden)
Bang-xing Han
2010-11-01
Full Text Available In a search for natural products that could be used to control schistosomiasis, nineteen extracts of eleven medicinal plants from eastern China have been tested for molluscicidal activity against snail Oncomelania hupensis. The n-butanol fraction of the fresh leaf from Buddleja lindleyana Fortune, Buddlejaceae, showed significant activity against the snails. Statistical analysis revealed that the LC50 and LC90 values for the n-butanol fraction were 39.91 mg L-1 and 59.28 mg L-1 for 48 h, respectively. Otherwise, the LC50 values for the n-butanol fraction to zebrafish was 403.24 mg L-1 for 48 h. Therefore, the n-butanol fraction of the fresh leaf from B. lindleyana may be a potent and safe molluscicides.Na busca por produtos naturais que podem ser utilizados para controle da esquistossomose, dezenove extratos de onze plantas medicinais do leste da China foram testados para atividade moluscicida contra o caramujo Oncomelania hupensis. A fração n-butanol das folhas frescas de Buddleja lindleyana Fortune, Buddlejaceae, mostrou atividade significativa contra os caracóis. A análise estatística revelou que os valores de CL50 e CL90 para a fração n-butanol foram 39,91 mg L-1 e 59,28 mg L-1 por 48 h, respectivamente. Por outro lado, a CL50 para a fração n-butanol para peixe-zebra foi 403,24 mg L-1 por 48 h. Portanto, a fração n-butanol das folhas frescas de B. lindleyana poderá vir a ser um moluscicidas potente e seguro.
High prevalence of enteroparasites in children from Ribeirão Preto, São Paulo, Brazil
Directory of Open Access Journals (Sweden)
Renata Elizabete Pagotti da Fonseca
Full Text Available ABSTRACT Objective: To determine the prevalence of intestinal parasites and possible associated factors. Method: Cross-sectional epidemiological study of 962 children (3-12-years from an area within the scope of a basic health unit in Ribeirão Preto, São Paulo, Brazil. Data were collected by home interviews and three-sample stool analysis and evaluated with the chi-square and Fisher's exact tests (p<0.05. Results: The prevalence of intestinal parasites was significantly high (57.5%. Giardia lamblia was the most prevalent (50.8%, followed by Ascaris lumbricoides (17.8%, Entamoeba histolytica, Hymenolepis nana, Entamoeba coli and Enterobius vermiculares (5.6-7.3% and other parasites of lower prevalence, such as Schistosoma japonicum (1% and Schistosoma mansoni (0.5%. No statistically significant associations were detected between prevalence and the risk factors analyzed. Conclusion: Since the area presents good conditions of environmental sanitation, health education programs should be implemented that emphasize hygiene procedures for the hands and for food and water to be consumed by the population.
A revision of the Chinese Gasteruptiidae (Hymenoptera, Evanioidea
Directory of Open Access Journals (Sweden)
Zhao Kexin
2012-11-01
Full Text Available The Chinese fauna of the family Gasteruptiidae is revised, keyed and fully illustrated for the first time. Only one genus of this family, Gasteruption Latreille, 1796, is recorded from China. In total 28 valid species of the genus Gasteruption are recognized. Six species are new to science (Gasteruption angulatum sp. n., G. assectoides sp. n., G. coloratum sp. n., G. latitibia sp. n., G. sinepunctatum sp. n. and G. strigosum sp. n. and eight species are reported new for China (G. bimaculatum Pasteels, 1958, G. birmanense Pasteels, 1958, G. dimidiatum Semenov, 1892, G. formilis Alekseev, 1995, G. subhamatum Pasteels, 1958, G. tonkinense Pasteels, 1958, G. tournieri Schletterer, 1885, G. transversiceps Pasteels, 1958. Three new synonyms are proposed: G. curiosum Pasteels, 1958, of G. amoyense Pasteels, 1958; G. sinense var. minus Kieffer, 1924, with G. japonicum Cameron, 1888, and G. sinense Kieffer, 1924, of G. sinarum Kieffer, 1911. Lectotypes are designated for Gasteruption corniculigerum Enderlein, 1913, G. sinense Kieffer, 1924, and G. transversiceps Pasteels, 1958. Gasteruption bihamatum Kieffer, 1911, previously reported from South China, is a South American species.
Discovery and molecular characterization of a Bcl-2-regulated cell death pathway in schistosomes.
Lee, Erinna F; Clarke, Oliver B; Evangelista, Marco; Feng, Zhiping; Speed, Terence P; Tchoubrieva, Elissaveta B; Strasser, Andreas; Kalinna, Bernd H; Colman, Peter M; Fairlie, W Douglas
2011-04-26
Schistosomiasis is an infectious disease caused by parasites of the phylum platyhelminthe. Here, we describe the identification and characterization of a Bcl-2-regulated apoptosis pathway in Schistosoma japonicum and S. mansoni. Genomic, biochemical, and cell-based mechanistic studies provide evidence for a tripartite pathway, similar to that in humans including BH3-only proteins that are inhibited by prosurvival Bcl-2-like molecules, and Bax/Bak-like proteins that facilitate mitochondrial outer-membrane permeabilization. Because Bcl-2 proteins have been successfully targeted with "BH3 mimetic" drugs, particularly in the treatment of cancer, we investigated whether schistosome apoptosis pathways could provide targets for future antischistosomal drug discovery efforts. Accordingly, we showed that a schistosome prosurvival protein, sjA, binds ABT-737, a well-characterized BH3 mimetic. A crystal structure of sjA bound to a BH3 peptide provides direct evidence for the feasibility of developing BH3 mimetics to target Bcl-2 prosurvival proteins in schistosomes, suggesting an alternative application for this class of drugs beyond cancer treatment.
Discovery and molecular characterization of a Bcl-2–regulated cell death pathway in schistosomes
Lee, Erinna F.; Clarke, Oliver B.; Evangelista, Marco; Feng, Zhiping; Speed, Terence P.; Tchoubrieva, Elissaveta B.; Strasser, Andreas; Kalinna, Bernd H.; Colman, Peter M.; Fairlie, W. Douglas
2011-01-01
Schistosomiasis is an infectious disease caused by parasites of the phylum platyhelminthe. Here, we describe the identification and characterization of a Bcl-2–regulated apoptosis pathway in Schistosoma japonicum and S. mansoni. Genomic, biochemical, and cell-based mechanistic studies provide evidence for a tripartite pathway, similar to that in humans including BH3-only proteins that are inhibited by prosurvival Bcl-2–like molecules, and Bax/Bak-like proteins that facilitate mitochondrial outer-membrane permeabilization. Because Bcl-2 proteins have been successfully targeted with “BH3 mimetic” drugs, particularly in the treatment of cancer, we investigated whether schistosome apoptosis pathways could provide targets for future antischistosomal drug discovery efforts. Accordingly, we showed that a schistosome prosurvival protein, sjA, binds ABT-737, a well-characterized BH3 mimetic. A crystal structure of sjA bound to a BH3 peptide provides direct evidence for the feasibility of developing BH3 mimetics to target Bcl-2 prosurvival proteins in schistosomes, suggesting an alternative application for this class of drugs beyond cancer treatment. PMID:21444803
Rapid synthesis and metabolism of glutamate in N2-fixing bacteroids
International Nuclear Information System (INIS)
Salminen, S.O.; Streeter, J.G.
1987-01-01
Symbiotic nodule bacteroids are thought to support N 2 fixation mainly by metabolizing dicarboxylic acids to CO 2 , generating reductant and ATP required by nitrogenase. Bradyrhizobium japonicum bacteroids were isolated anaerobically and incubated at 2% O 2 with 14 C-labeled succinate, malate, glutamate, or aspartate. 14 CO 2 was collected, and the bacteroid contents separated into neutral, organic acid, and amino acid fractions. The respiration of substrates, relative to their uptake, was malate > glutamate > succinate > aspartate. Analysis of the fractions revealed that will all substrates the radioactivity was found mostly in the amino acid fraction. The labeling of the neutral fraction was negligible and only a small amount of label was found in the organic acid fraction indicating a small pool size. TLC of the amino acid fraction showed the label to be principally in glutamate. Glutamate contained 67, 80, 97, and 88% of the 14 C in the amino acid fraction in bacteroids fed with succinate, malate, glutamate and aspartate, respectively. The data suggest that glutamate may play an important role in the bacteroid function
Deng, Wangping; Xu, Bin; Hu, Haiyan; Li, Jianyong; Hu, Wei; Song, Shiping; Feng, Zheng; Fan, Chunhai
2013-05-01
Schistosomiasis control remains to be an important and challenging task in the world. However, lack of quick, simple, sensitive and specific sero-diagnostic test is still a hurdle in the control practice. The commonly employed enzyme-linked immuno-sorbent assay (ELISA) relies on the native soluble egg antigen (SEA) that is limited in supply. Here we developed an electrochemical immunosensor array (ECISA) assay with an interfacial co-assembly strategy. A recombinant Schistosoma japonicum (Sj) calcium-binding protein (SjE16) was used as a principal antigen, while the SEA as a minor, co-assembling agent, with a ratio of 8:1 (SjE16: SEA, Sj16EA), which was co-immobilized on a disposable 16-channel screen-printed carbon electrode array. A portable electrochemical detector was employed to detect antibodies in serum samples. The sensitivity of ECISA reached 100% with minimal cross-reactions. Therefore, we have demonstrated that this rapid, sensitive and specific ECISA technique has the potential to perform large-scale on-site screening of Sj infection.
Helminth Genomics: The Implications for Human Health
Brindley, Paul J.; Mitreva, Makedonka; Ghedin, Elodie; Lustigman, Sara
2009-01-01
More than two billion people (one-third of humanity) are infected with parasitic roundworms or flatworms, collectively known as helminth parasites. These infections cause diseases that are responsible for enormous levels of morbidity and mortality, delays in the physical development of children, loss of productivity among the workforce, and maintenance of poverty. Genomes of the major helminth species that affect humans, and many others of agricultural and veterinary significance, are now the subject of intensive genome sequencing and annotation. Draft genome sequences of the filarial worm Brugia malayi and two of the human schistosomes, Schistosoma japonicum and S. mansoni, are now available, among others. These genome data will provide the basis for a comprehensive understanding of the molecular mechanisms involved in helminth nutrition and metabolism, host-dependent development and maturation, immune evasion, and evolution. They are likely also to predict new potential vaccine candidates and drug targets. In this review, we present an overview of these efforts and emphasize the potential impact and importance of these new findings. PMID:19855829
International Nuclear Information System (INIS)
Janat, M.; Kurdali, F.
2008-01-01
Soybean in naturally N 2 -fixing legume, but it needs artificial inoculation with appropriate strains of rhizobia when introduced to land not previously cultivated to the crop. As soybean is being introduced to Syria, inoculation with Bradyrhizobium japonicum is essential to ensure effective biological nitrogen fixation by the crop. The question is: what is the most effective mean of inoculation?. As Syria is a water-short country, we examined the possibility of applying the rhizobial inoculant in irrigation system (Biofertigation) in contrast with the conventional seed pelleting application. In a 2 year experiment at a research station near Damascus, we compared seed pelleting of the inoculant under furrow and drip irrigation, with repeated inoculation by injection of a liquid culture rhizobial inoculum through the drip system. Drip irrigation enhanced N 2 fixation by soybean regardless of inoculation technique ad repeated inoculation. Injection of the liquid rhizobial inoculum through drip irrigation system was shown to enhances the acquisition of atmospheric N 2 and improve N 2 fixation by soybean.(author)
International Nuclear Information System (INIS)
Bickle, Q.D.; Andrews, B.J.; Doenhoff, M.J.; Ford, M.J.; Taylor, M.G.
1985-01-01
Significant levels of resistance against Schistosoma mansoni challenge were developed by mice exposed to highly irradiated (20 krad.) cercariae of the homologous species (53-67%), whereas vaccination with S. bovis, S. haematobium or S. japonicum failed to confer significant levels of resistance (-5-12%), thus confirming the specificity of the immunizing procedure. Attempts to transfer resistance to naive recipients by injection of serum and of spleen or lymph node cells from donor mice vaccinated with highly irradiated cercariae were largely unsuccessful. However, significant levels of resistance could be transferred to mice by injection of serum from rabbits exposed to irradiated cercariae. Comparable levels of resistance were conferred by injection of serum at the time of challenge (34-69%) or 5-6 days later (31-56%). In contrast, sera from rabbits injected with soluble egg antigen or homogenized cercariae failed to confer protection upon recipient mice. Sera from vaccinated mice, vaccinated rabbits and antigen-injected rabbits all caused cell adherence to skin-transformed schistosomula but neither the level of adherence nor the serum titre correlated with the ability to confer protection to mice. (author)
A coproantigen diagnostic test for Strongyloides infection.
Directory of Open Access Journals (Sweden)
Alex M Sykes
Full Text Available Accurate diagnosis of infection with the parasite Strongyloides stercoralis is hampered by the low concentration of larvae in stool, rendering parasitological diagnosis insensitive. Even if the more sensitive agar plate culture method is used repeated stool sampling is necessary to achieve satisfactory sensitivity. In this manuscript we describe the development of a coproantigen ELISA for diagnosis of infection. Polyclonal rabbit antiserum was raised against Strongyloides ratti excretory/secretory (E/S antigen and utilized to develop an antigen capture ELISA. The assay enabled detection of subpatent rodent S. ratti and human S. stercoralis infection. No cross-reactivity was observed with purified E/S from Schistosoma japonicum, the hookworms Ancylostoma caninum, A. ceylanicum, nor with fecal samples collected from rodents harboring Trichuris muris or S. mansoni infection. Strongyloides coproantigens that appear stable when frozen as formalin-extracted fecal supernatants stored at -20 °C remained positive up to 270 days of storage, whereas supernatants stored at 4 °C tested negative. These results indicate that diagnosis of human strongyloidiasis by detection of coproantigen is an approach worthy of further development.
Guo, J; Booth, M; Jenkins, J; Wang, H; Tanner, M
1998-12-01
The World Bank Loan Project for schistosomiasis in China commenced field activities in 1992. In this paper, we describe disease control strategies for levels of different endemicity, and estimate unit costs and total expenditure of screening, treatment (cattle and humans) and snail control for 8 provinces where Schistosoma japonicum infection is endemic. Overall, we estimate that more than 21 million US dollars were spent on field activities during the first three years of the project. Mollusciciding (43% of the total expenditure) and screening (28% of the total) are estimated to have the most expensive field activities. However, despite the expense of screening, a simple model predicts that selective chemotherapy could have been cheaper than mass chemotherapy in areas where infection prevalence was higher than 15%, which was the threshold for mass chemotherapy intervention. It is concluded that considerable cost savings could be made in the future by narrowing the scope of snail control activities, redefining the threshold infection prevalence for mass chemotherapy, defining smaller administrative units, and developing rapid assessment tools.
Analysis of molecular responses in plants under the conditions of excess-aluminum stress
International Nuclear Information System (INIS)
Masaoka, Yoshikuni; Arakawa, Yusuke; Asanuma, Shuichi
1998-01-01
Development of a measuring method for the amount of 26 aluminum (Al) incorporated into the root of Brachiaria ruziziensis which is a highly Al-resistant gramineous grass was attempted. After incubation of the root in 10 mM AlCl 3 solution for 5 hrs, mitochondrial fraction was prepared by an ordinary method and applied to tandem-accelerator mass spectrometry (t-AMS). Thus, super-sensitive Al-detection method which allows to detect 10 7 -10 8 atoms of Al was established. Using this method it was found that 26 Al incorporated from the root is transferred into the leaves and mitochondria at first and it was accumulated in mitochondria up to 70 ng/mg protein. Aiming to construct new Al-resistant leguminous cells utilizing a lot of genetic sources, a screening of Al-resistant leguminous bacteria was conducted to investigate the resistance mechanism. Thus, 5 resistant strains of B. japonicum, 3 of R. huakuii and 2 of R. meliloti were obtained. Then, the effects of Al, phosphorous and pH on the growth were compared among these bacteria. (M.N.)
International Nuclear Information System (INIS)
Gresshoff, P.
1998-01-01
To understand chemically-induced genomic differences in soybean mutants differing in their ability to enter the nitrogen-fixing symbiosis involving Bradyrhizobium japonicum, molecular techniques were developed to aid the map-based, or positional, cloning. DNA marker technology involving single arbitrary primers was used to enrich regional RFLP linkage data. Molecular techniques, including two-dimensional pulse field gel electrophoresis, were developed to ascertain the first physical mapping in soybean, leading to the conclusion that in the region of marker pA-36 on linkage group H, 1 cM equals about 500 cM. High molecular weight DNA was isolated and cloned into yeast or bacterial artificial chromosomes (YACs/ BACs). YACs were used to analyze soybean genome structure, revealing that over half of the genome contains repetitive DNA. Genetic and molecular tools are now available to facilitate the isolation of plant genes directly involved in symbiosis. The further characterization of these genes, along with the determination of the mechanisms that lead to the mutation, will be of value to other plants and induced mutation research. (author)
Involvement of central nervous system in the schistosomiasis
Directory of Open Access Journals (Sweden)
Teresa Cristina de Abreu Ferrari
2004-08-01
Full Text Available The involvement of the central nervous system (CNS by schistosomes may or may not determine clinical manifestations. When symptomatic, neuroschistosomiasis (NS is one of the most severe presentations of schistosomal infection. Considering the symptomatic form, cerebral involvement is almost always due to Schistosoma japonicum and the spinal cord disease, caused by S. mansoni or S. haematobium. Available evidence suggests that NS depends basically on the presence of parasite eggs in the nervous tissue and on the host immune response. The patients with cerebral NS usually have the clinical manifestations of increased intracranial pressure associated with focal neurological signs; and those with schistosomal myeloradiculopathy (SMR present rapidly progressing symptoms of myelitis involving the lower cord, usually in association with the involvement of the cauda esquina roots. The diagnosis of cerebral NS is established by biopsy of the nervous tissue and SMR is usually diagnosed according to a clinical criterion. Antischistosomal drugs, corticosteroids and surgery are the resourses available for treating NS. The outcome is variable and is better in cerebral disease.
Heme-based sensors in biological systems.
Rodgers, K R
1999-04-01
The past several years have been witness to a staggering rate of advancement in the understanding of how organisms respond to changes in the availability of diatomic molecules that are toxic and/or crucial to survival. Heme-based sensors presently constitute the majority of the proteins known to sense NO, O2 and CO and to initiate the chemistry required to adapt to changes in their availabilities. Knowledge of the three characterized members of this class, soluble guanylate cyclase, FixL and CooA, has grown substantially during the past year. The major advances have resulted from a broad range of approaches to elucidation of both function and mechanism. They include growth in the understanding of the interplay between the heme and protein in soluble guanylate cyclase, as well as alternate means for its stimulation. Insight into the O2-induced structural changes in FixL has been supplied by the single crystal structure of the heme domain of Bradyrhizobium japonicum. Finally, the ligation environment and ligand interchange that facilitates CO sensing by CooA has been established by spectroscopic and mutagenesis techniques.
Directory of Open Access Journals (Sweden)
José Leon Bernardo
1998-05-01
Full Text Available RESUMO: Os autores descrevem um caso clinic de tuberculose multi-resistente num doente recluse, toxicodependente e com SIDA que se encontrava sob terapêutiea antibacilar em virtude de anterior episodin de tuberculose âsendivelâ.Comentam alguns aspectos relacionadus com o diagnostic, tratamento e evoução exógena por estirpe multi-resistente.Em conclusão, us autores salientam o interesse do DNA âfingerprintingâ no diagnostic e epidemiologia da tuberculose multi-resistente e a necessidade de implementação de um efectivo programa de luta contra a tuberculose multi-resistente na comunidade prisional.REV PORT PNEUMOL 1998; IV (3: 319-325 ARSTRACT: A case of multidrug-resistant tuberculosis in a drug-addicted and jailed patient with AIDS is reported. The patient was in anti-tuberculosis therapy, because a question of ongoing âsensitiveâ tuberculosis.The authors comment some aspects of the clinical management of the patient. Exogenous reinfection with a multidrug-resistant strain was convincelly demonstrated with DNA fingerprinting.The relevance of DNA fingerprinting in the diagnosis and epidemiology of multidrug-resistant tuberculosis is emphasized and the reformulation of the anti-tuberculosis programme in the prisional setting is warranted, in the face of ongoing transmissionREV PORT PNEUMOL 1998; IV (3: 319-325 Palavras-chave: Tuberculose multirresistente, RFLP, Key-words: Multidrug-resistant tuberculosis (MDR-TB, RELP
Tratamiento quirúrgico de las lesiones intradurales extramedulares mediante hemilaminectomía
Villalonga, Juan F.; Cervio, Andrés
2017-01-01
Resumen Objetivo: Evaluar la utilidad de la hemilaminectomía como abordaje quirúrgico en pacientes con tumores intradurales-extramedulares. Material y métodos: Estudio descriptivo retrospectivo que incluye a 53 pacientes en los que se utilizó la hemilaminectomía como abordaje a tumores intradurales-extramedulares durante el periodo junio de 2006 a diciembre de 2015. Se analizaron datos demográficos, signo-sintomatología preoperatoria, características imagenológicas, hallazgos intraoperatorios, estirpe histológico y complicaciones post-quirúrgicas. El periodo de seguimiento promedio fue de 48.9 meses (6-120 meses). Resultados: Cincuenta y tres pacientes con tumores intradurales-extramedulares fueron intervenidos mediante hemilaminectomía. La serie incluyó 5 tumores cervicales, 24 dorsales y 24 lumbares. El análisis histológico reveló 28 neurinomas, 11 meningiomas, 7 ependimomas y 7 “lesiones varias”. En el 96% de los casos se efectuó una exéresis total sin causar déficit neurológico agregado. No se evidenció recidiva en ninguno de los casos durante el periodo de seguimiento. Conclusión: La hemilaminectomía constituye una vía efectiva para la resección de tumores intradurales-extramedulares lateralizados a nivel cervicodorsal. Mientras que a nivel lumbar esta técnica puede ser también útil en lesiones de línea media. PMID:29142776
Directory of Open Access Journals (Sweden)
Bang-xing Han
2010-09-01
Full Text Available In a search for natural products that could be used to control schistosomiasis, nineteen extracts of eleven medicinal plants from eastern China have been tested for molluscicidal activity against snail Oncomelania hupensis. The n-butanol fraction of the fresh leaf from Buddleja lindleyana Fortune, Buddlejaceae, showed significant activity against the snails. Statistical analysis revealed that the LC50 and LC90 values for the n-butanol fraction were 39.91 mg L-1 and 59.28 mg L-1 for 48 h, respectively. Otherwise, the LC50 values for the n-butanol fraction to zebrafish was 403.24 mg L-1 for 48 h. Therefore, the n-butanol fraction of the fresh leaf from B. lindleyana may be a potent and safe molluscicides.
Associative diazotrophic bacteria in grass roots and soils from heavy metal contaminated sites
Directory of Open Access Journals (Sweden)
Fátima M.S. Moreira
2008-12-01
Full Text Available This work aimed to evaluate density of associative diazotrophic bacteria populations in soil and grass root samples from heavy metal contaminated sites, and to characterize isolates from these populations, both, phenotypically (Zinc, Cadmium and NaCl tolerance in vitro, and protein profiles and genotypically (16S rDNA sequencing, as compared to type strains of known diazotrophic species. Densities were evaluated by using NFb, Fam and JNFb media, commonly used for enrichment cultures of diazotrophic bacteria. Bacterial densities found in soil and grass root samples from contaminated sites were similar to those reported for agricultural soils. Azospirillum spp. isolates from contaminated sites and type strains from non-contaminated sites varied substantially in their in vitro tolerance to Zn+2 and Cd+2, being Cd+2 more toxic than Zn+2. Among the most tolerant isolates (UFLA 1S, 1R, S181, S34 and S22, some (1R, S34 and S22 were more tolerant to heavy metals than rhizobia from tropical and temperate soils. The majority of the isolates tolerant to heavy metals were also tolerant to salt stress as indicated by their ability to grow in solid medium supplemented with 30 g L-1 NaCl. Five isolates exhibited high dissimilarity in protein profiles, and the 16S rDNA sequence analysis of two of them revealed new sequences for Azospirillum.Objetivou-se avaliar a densidade de populações de bactérias diazotróficas associativas em amostras de solos e de raízes de gramíneas oriundas de sítios contaminados com metais pesados, e caracterizar isolados destas populações através da análise fenotípica (tolerância aos metais pesados zinco e cádmio e à NaCl in vitro, perfis protéicos, e genotípica (seqüenciamento de 16S rDNA, comparados às estirpes tipo das mesmas espécies. As densidades foram avaliadas nos meios NFb, Fam e LGI, comumente utilizados para culturas de enriquecimento de populações de bactérias diazotróficas associativas. As densidades
Directory of Open Access Journals (Sweden)
Keize Pereira Junqueira
2010-09-01
Full Text Available A espécie de pitaya mais cultivada atualmente é Hylocereus undatus, a pitaya-vermelha-de-polpa-branca. Colômbia e México são os principais produtores mundiais e, devido à sua rusticidade, a pitaya é considerada uma alternativa potencialmente viável também para o aproveitamento de solos pedregosos, arenosos e maciços rochosos. Apesar da crescente demanda, ainda não há uma cultivar lançada no mercado que atenda às necessidades climáticas de produção e às exigências do consumidor brasileiro. O presente trabalho é parte do programa de seleção e melhoramento da pitaya CPAC PY-01 da Embrapa Cerrados. Objetivou-se realizar o estudo da variabilidade genética de 16 acessos de pitayas mantidos na coleção de germoplasma da Embrapa Cerrados, apresentando diferentes características fenotípicas relacionadas especialmente à produção, por meio de marcadores moleculares RAPD (Random Amplified Polymorphic DNA. O DNA genômico de cada acesso foi extraído, e onze iniciadores decâmeros foram utilizados para a obtenção de marcadores moleculares RAPD, que foram convertidos em matriz de dados binários, a partir da qual foram estimadas as distâncias genéticas entre os acessos e realizadas análises de agrupamento e de dispersão gráfica. Foram obtidos 111 marcadores RAPD, perfazendo uma média de 10,1 marcadores por primer, dos quais 45 (40,54% foram polimórficos. As distâncias genéticas entre os 16 acessos variaram entre 0,006 e 0,148. As maiores distâncias genéticas foram obtidas entre os acessos "52" e "61", sendo que, em 2007, o primeiro produziu mais de 25 frutos, e o segundo, nenhum. Assim, deduz-se que, nesse caso, a próvável causa da variação seja genotípica. As menores distâncias genéticas foram constatadas entre os acessos "63"e "55" e entre "19"e "59". Os dois grupos apresentaram valores de produção próximos. Os marcadores moleculares RAPD mostraram que, mesmo dentro da mesma espécie, há variabilidade gen
Directory of Open Access Journals (Sweden)
A. S. Costa
1957-01-01
Full Text Available Entre cêrca de 200 variedades de feijoeiro ensaiadas, a Manteiga foi mais sensitiva aos vírus de vira-cabeça e da necrose branca, formando, nas fôlhas primárias, lesões locais adequadas para contagens. Com o vírus de vira-cabeça as lesões locais apareceram de 3 -6 dias após as inoculações, sob a forma de manchas cloróticas, às vezes com anéis necróticos; com o vírus da necrose branca as lesões se manifestaram em 1 - 4 dias, sob a forma de pontuações necróticas, pequenos anéis necróticos ou, em casos de certas estirpes do vírus, como pintas cloróticas. Feijoeiros com as fôlhas primárias tendo 2/3 de sua expansão ou mais desenvolvidas deram melhores resultados para o vírus de vira-cabeça; para o vírus da necrose branca os melhores resultados foram obtidos com fôlhas que tinham 2/3 ou ligeiramente menos de sua expansão total. O vírus de vira-cabeça não se tornou sistêmico em plantas inoculadas mecanicamente. A maioria das estirpes do vírus da necrose branca também não se tornou sistêmica em feijoeiros inoculados mecanicamente. Uma estirpe amarela deste tem a capacidade de se tornar sistêmica em feijoeiros sob determinadas condições. O sulfito de sódio em solução 0,0125 M, usado na extração do inóculo, aumentou ligeiramente o número de lesões formadas nas fôlhas do feijoeiro Manteiga pelo vírus de vira-cabeça; aumento consideravelmente maior foi obtido com a extração em presença de búfer de fosfato 0,1 M com pH 7, sendo êsse efeito atribuído a um aumento da sensitividade da planta-teste. A mistura de ambos causou aumento igual ou ligeiramente menor que o búfer só. Para o vírus da necrose branca a presença de sulfito de sódio 0,0125 M durante a extração aumentou consideravelmente o número de lesões, sendo esse efeito atribuído à diminuição na perda de atividade do vírus, devida à oxidação; o búfer sozinho ocasionou pequeno aumento em comparação com a testemunha, mas a
Directory of Open Access Journals (Sweden)
F. G. Carvalho
1999-06-01
Full Text Available Com a finalidade de avaliar a tolerância de rhizobium loti em Leucaena leucocephala cv K8, submetida a níveis crescentes de salinidade, realizou-se um experimento em casa de vegetação, usando-se um Podzólico Vermelho-Amarelo textura franco-arenosa, coletado em Serra Talhada (PE. O experimento obedeceu ao arranjo fatorial 5 x 4, no delineamento em blocos ao acaso, com 3 repetições. Foram usados 5 níveis de salinidade do solo (C.E. = 1,5; 6,6; 10,1; 12,8 e 14,4 dS m-1 e 2 tratamentos inoculados (NFB 494 e SEMIA 6069, fertilização nitrogenada com 200 mg kg-1 de N (NH4NO3, e o controle sem inoculação e sem adubação nitrogenada. O incremento dos níveis crescentes de salinidade reduziu a nodulação (número e massa de nódulos, o rendimento de matéria seca e a acumulação de N na parte aérea. O tratamento com fertilização nitrogenada inibiu totalmente a nodulação em leucena, em todos os níveis de salinidade; contudo, promoveu melhores rendimentos na acumulação de N e na produção de matéria seca. Observou-se resposta significativa das plantas inoculadas com a estirpe SEMIA 6069, em todas as características avaliadas, superando os resultados obtidos com o isolado NFB 494.
Sarcoma sinovial en adolescente. Presentación de un caso y revisión de la literatura
Directory of Open Access Journals (Sweden)
Maria Faviola Corti Hart
2012-09-01
Full Text Available El sarcoma sinovial (SS es un una neoplasia maligna de estirpe mesenquimal, constituida por células fusiformes y un componente de diferenciación epitelial con grados variables de displasia, siendo menos frecuente que el rabdomiosarcoma en adolescentes y adultos jóvenes. El SS afecta principalmente las extremidades, con predominio de las inferiores. De acuerdo al estadiaje quirúrgico, el estadío III/IVA, ha sido relacionado con un pronóstico mucho más precario. Para los pacientes con enfermedad irresecable al momento del diagnóstico (estadío III, la supervivencia se ha reportado entre el 50 y el 70%. El objetivo es presentar un caso clínico inusual y conocer el comportamiento de la neoplasia. Se trata de paciente femenina de 16 años, con tumoración en cara medial de tercio distal de brazo izquierdo, no móvil y dolorosa a la palpación. El ultrasonido reportó: lesión ocupante de espacio heterogénea de partes blandas, adyacente a 1/3 distal de húmero izquierdo. La biopsia reportó: Sarcoma Sinovial fibroso monofásico grado I Estadio III Primario. Se indicó quimioterapia más radioterapia, con evolución satisfactoria. Actualmente asintomática, sin evidencia de actividad tumoral. El SS es un tumor poco frecuente, su patogénesis es todavía desconocida y no están bien establecidos los factores de riesgo. El tratamiento es multidisciplinario.
SARCOMA SINOVIAL EN ADOLESCENTE. PRESENTACIÓN DE UN CASO Y REVISIÓN DE LA LITERATURA
Directory of Open Access Journals (Sweden)
María Faviola Corti Hart
2011-01-01
Full Text Available El sarcoma sinovial (SS es un una neoplasia maligna de estirpe mesenquimal, constituida por células fusiformes y un componente de diferenciación epitelial con grados variables de displasia, siendo menos frecuente que el rabdomiosarcoma en adolescentes y adultos jóvenes. El SS afecta principalmente las extremidades, con predominio de las inferiores. De acuerdo al estadiaje quirúrgico, el estadío III/IVA, ha sido relacionado con un pronóstico mucho más precario. Para los pacientes con enfermedad irresecable al momento del diagnóstico (estadío III, la supervivencia se ha reportado entre el 50 y el 70%. El objetivo es presentar un caso clínico inusual y conocer el comportamiento de la neoplasia. Se trata de paciente femenina de 16 años, con tumoración en cara medial de tercio distal de brazo izquierdo, no móvil y dolorosa a la palpación. El ultrasonido reportó: lesión ocupante de espacio heterogénea de partes blandas, adyacente a 1/3 distal de húmero izquierdo. La biopsia reportó: Sarcoma Sinovial fibroso monofásico grado I Estadio III Primario. Se indicó quimioterapia más radioterapia, con evolución satisfactoria. Actualmente asintomática, sin evidencia de actividad tumoral. El SS es un tumor poco frecuente, su patogénesis es todavía desconocida y no están bien establecidos los factores de riesgo. El tratamiento es multidisciplinario.
Pearson, Mark S; Becker, Luke; Driguez, Patrick; Young, Neil D; Gaze, Soraya; Mendes, Tiago; Li, Xiao-Hong; Doolan, Denise L; Midzi, Nicholas; Mduluza, Takafira; McManus, Donald P; Wilson, R Alan; Bethony, Jeffrey M; Nausch, Norman; Mutapi, Francisca; Felgner, Philip L; Loukas, Alex
2015-01-01
Schistosoma haematobium affects more than 100 million people throughout Africa and is the causative agent of urogenital schistosomiasis. The parasite is strongly associated with urothelial cancer in infected individuals and as such is designated a group I carcinogen by the International Agency for Research on Cancer. Using a protein microarray containing schistosome proteins, we sought to identify antigens that were the targets of protective IgG1 immune responses in S. haematobium-exposed individuals that acquire drug-induced resistance (DIR) to schistosomiasis after praziquantel treatment. Numerous antigens with known vaccine potential were identified, including calpain (Smp80), tetraspanins, glutathione-S-transferases, and glucose transporters (SGTP1), as well as previously uncharacterized proteins. Reactive IgG1 responses were not elevated in exposed individuals who did not acquire DIR. To complement our human subjects study, we screened for antigen targets of rhesus macaques rendered resistant to S. japonicum by experimental infection followed by self-cure, and discovered a number of new and known vaccine targets, including major targets recognized by our human subjects. This study has further validated the immunomics-based approach to schistosomiasis vaccine antigen discovery and identified numerous novel potential vaccine antigens.
Ai, L; Li, C; Elsheikha, H M; Hong, S J; Chen, J X; Chen, S H; Li, X; Cai, X Q; Chen, M X; Zhu, X Q
2010-12-15
The present study developed and validated a species-specific loop-mediated isothermal amplification (LAMP) assay for the rapid detection and discrimination of Fasciola hepatica and Fasciola gigantica. The LAMP assay is inexpensive, easy to perform and shows rapid reaction, wherein the amplification can be obtained in 45 min under isothermal conditions of 61 °C or 62 °C by employing a set of four species-specific primer mixtures and results can be checked through naked-eye visualization. The optimal assay conditions with no cross-reaction with other closely related trematodes (Clonorchis sinensis, Opisthorchis viverrini, Orientobilharzia turkestanicum and Schistosoma japonicum) as well as within the two Fasciola species were established. The assay was validated by examining F. gigantica DNA in the intermediate host snails and in faecal samples. The results indicated that the LAMP assay is approximately 10(4) times more sensitive than the conventional specific PCR assays. These findings indicate that this Fasciola species-specific LAMP assay may have a potential clinical application for detection and differentiation of Fasciola species, especially in endemic countries. Copyright © 2010 Elsevier B.V. All rights reserved.
Estudos preliminares com bromoacetamida, um novo moluscicida
Directory of Open Access Journals (Sweden)
Naftale Katz
1985-09-01
Full Text Available A bromoacetamida tem sido testada como moluscicida na República Popular da China, para tratamento de criadouros de Oncomelania, hospedeiro do Schistosoma japonicum, com bons resultados. O produto é solúvel em água, o que simplifica seu uso. Foram feitos ensaios biológicos preliminares deste produto em caramujos adultos (Biomphalaria glabrata, B. tenagophila e B. straminea, recém-eclodidos e desovas. Paralelamente foram feitos ensaios com o pentaclorofenol para avaliar a suscetibilidade dos caramujos. O produto foi testado também sobre peixes, Lebistes reticulatus. Os moluscos testados mediam 8-10 mm de diâmetro; os recém-eclodidos tinham 1-3 dias de idade e as desovas 0-1 dia de idade. A temperatura da água durante os experimentos variou de 24,3 a 27,0°C. O produto foi ativo para caramujos adultos, recém-eclodidos e desovas, em concentrações em tomo de 1 a 4 ppm. Para os peixes o produto foi menos tóxico do que para os caramujos (CLço 7,5 ppm. Estes resultados indicam que a bromoacetamida apresenta propriedades moluscicidas promissoras para o controle da Biomphalaria spp.