12 CFR 263.102 - Prevailing party.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Prevailing party. 263.102 Section 263.102 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM RULES... Prevailing party. Only an eligible applicant that prevailed on the merits of an adversary proceeding may...
Movements in Parties: OccupyPD
Directory of Open Access Journals (Sweden)
Donatella della Porta
2015-03-01
Full Text Available When the United States activists called for people to Occupy#everywhere, it is unlikely they were thinking of the headquarters of the Italian centre-left party. Parties and movements are often considered to be worlds apart. In reality, parties have been relevant players in movement politics, and movements have influenced parties, often through the double militancy of many of their members. OccupyPD testifies to a continuous fluidity at the movement-party border, but also to a blockage in the party’s interactions with society that started long before the economic crisis but drastically accelerated with it. In this paper we present the OccupyPD Movement as a case of interaction between party politics and social movement politics, and in particular between the base membership of a centre-left party and the broader anti-austerity movement that diffused from the US to Europe adopting similar forms of actions and claims. Second, by locating it within the context of the economic and democratic crisis that erupted in 2007, we understand its emergence as a reaction towards politics in times of crisis of responsibility, by which we mean a drastic drop in the capacity of the government to respond to citizens’ requests. To fulfil this double aim, we bridge social movement studies with research on party change, institutional trust and democratic theory, looking at some political effects of the economic crisis in terms of a specific form of legitimacy crisis, as well as citizens’ responses to it, with a particular focus on the political meaning of recent anti-austerity protests. In this analysis, we refer to both quantitative and qualitative data from secondary liter-ature and original in-depth interviews carried out with a sample of OccupyPD activists.
Electromagnetic properties of low-spin states in 102,104Pd
International Nuclear Information System (INIS)
Luontama, M.; Julin, R.; Kantele, J.; Passoja, A.; Trzaska, W.; Baecklin, A.; Jonsson, N.G.; Westerberg, L.
1985-12-01
Electromagnetic transitions from low-lying 0 + , 2 + , 4 + and 3 - states in 102 , 104 Pd have been studied with (p,2n) and (p,p) reactions and with Coulomb excitation. The E2 transition probabilities from the 0 3 + state in 102 Pd (13 W.u.) and from the 0 2 + state in 104 Pd (14 W.u.) are somewhat low for two-phonon states. Generally, the E2 transition rates are reasonably well reproduced by the IBA-2 and by the boson-expansion description. The intruding 0 2 + state (tsub(1/2) = 14.3 ns) in 102 Pd is connected to the 2 2 + and 2 3 + states via strong E2 transitions: B(E2;0 2 + →2 2 + )=96+-40 W.u.; B(E2;2 3 + →0 2 + )=17+-8 W.u
MEASUREMENTS OF ^102Pd(n,γ) REACTIONS USING DANCE(funded via DOE)
Hatarik, R.; Alpizar-Vicente, A. M.; Greife, U.; Bredeweg, T. A.; Esch, E.-I.; Haight, R. C.; O'Donnell, J. M.; Reifarth, R.; Rundberg, R. S.; Ullmann, J. L.; Vieira, D. J.; Wouters, J. M.
2004-10-01
The so called p-nuclei (proton rich, Z > 34) cannot be produced by s or r process, therefore other processes are required in order to produce them. There are two ways to produce p-nuclei: rapid proton capture (rp process) and photo disintegration of neutron rich elements (p process). In the termination range of the rp process are three stable even-even p-nuclei: ^102Pd, ^106Cd and ^112Sn. The exact knowledge of all three (n,γ)-rates are potentially important for disentangling the p- and rp-contributions. ^102Pd(n,γ) was measured with the Detector for Advanced Neutron Capture Experiments (DANCE) at the Los Alamos Neutron Science Center to complete the experimental data set in this range. The target was a sheet of 2 mg ^102Pd (78% enriched) held in a bag of 0.9 μm mylar, which was selected after testing of different plastic support materials. Preliminary results will be presented.
Half-life and intensities of photons of 103Pd isotope
International Nuclear Information System (INIS)
Popov, Yu.S.; Zakharova, L.V.; Kupriyanov, V.N.; Andreev, O.I.; Pakhomov, A.N.; Vakhetov, F.Z.
2001-01-01
Half-life and intensities of photons forming during 103 Pd isotope decay are determined by the methods of semiconductor x-ray and γ-spectrometry. 103 Pd is applied in nuclear medicine for preparation of 103m Rh isomer (T 1/2 =56 min) being used in irradiation of prostate neoplasms. Half-life of 103 Pd isotope is 16±0.6 days, relative intensities of x-ray and γ-photons are: K α /Kβ=5.1±0.4; 358 keV - 100 rel.units; 295 keV - 12.3±0.4 rel.units; 497 keV - 17.6±0.6 rel.units. Errors are represented for confidence probability 95 % [ru
Studies of isotopic defined hydrogen beams scattering from Pd single-crystal surfaces
International Nuclear Information System (INIS)
Varlam, Mihai; Steflea, Dumitru
2001-01-01
An experimental investigation of hydrogen isotopes interaction with Pd single-crystal surface has been carried out using molecular beam technique. The energy dependence of the sticking probability and its relation with the trapping probability into the precursor state is studied by integrating the scattered angular distribution of hydrogen Isotopic defined beams from Pd (111) surface in the 40-400 K surface temperature range. The dependence has been evaluated by defining hydrogen molecular beams with different isotopic concentration - from the natural one to the 5% D/(D+H) ratio - and for different incident energies. The beam was directed onto a single-crystal Pd (111) surface. In the paper, we report the experimental results and some considerations related to it. (authors)
Studies of isotopic defined hydrogen beams scattering from Pd single-crystal surfaces
International Nuclear Information System (INIS)
Varlam, Mihai; Steflea, Dumitru
1999-01-01
An experimental investigation of hydrogen isotopes interaction with Pd single-crystal surfaces has been carried out using molecular beam technique. The energy dependence of the sticking probability and its relation with the trapping probability into the precursor state is studied by integrating the scattered angular distribution of hydrogen isotopic defined beams from Pd (111) surfaces in the 40 - 400 K surface temperature range. The dependence has been evaluated by defining hydrogen molecular beams with different isotopic concentration - from the natural one until 5% D/(D + H) and different incident energies and directed onto a single - crystal Pd (111) surface. In the paper, we report the experimental results and some considerations related to them. (authors)
2010-07-01
..., or by registered mail, certified mail, regular mail, electronic mail (if the document was filed... proceeding, the other party shall be served by electronic mail (e-mail), if possible. If the other party does...; manner and proof of filing or service; electronic filings. 102.114 Section 102.114 Labor Regulations...
Design study of fuel circulating system using Pd-alloy membrane isotope separation method
International Nuclear Information System (INIS)
Naito, T.; Yamada, T.; Yamanaka, T.; Aizawa, T.; Kasahara, T.; Nishikawa, M.; Asami, N.
1980-01-01
Design study on the fuel circulating system (FCS) for a tokamak experimental fusion reactor (JXFR) has been carried out to establish the system concept, to plan the development program, and to evaluate the feasibility of diffusion system. The FCS consists of main vacuum system, fuel gas refiners, isotope separators, fuel feeders, and auxiliary systems. In the system design, Pd-alloy membrane permeation method is adopted for fuel refining and isotope separating. All impurities are effectively removed and hydrogen isotopes are sufficiently separated by Pd-alloy membrane. The isotope separation system consists of 1st (47 separators) and 2nd (46 separators) cascades for removing protium and separating deuterium, respectively. In the FCS, while cryogenic distillation method appears to be practicable, Pd-alloy membrane diffusion method is attractive for isotope separation and refining of fuel gas. The choice will have to be based on reliability, economic, and safety analyses
Design study of fuel circulating system using Pd alloy membrane isotope separation method
International Nuclear Information System (INIS)
Naito, T.; Yamada, T.; Aizawa, T.; Kasahara, T.; Yamanaka, T.
1981-01-01
It is expected that the method of permeating through Pd-alloy membrances is effective for isotope separation and the refining of fuel gas. In this paper, the design study of the Fuel Circulating System (FCS) using Pb-alloy membranes is described. The study is mainly focused on the main vacuum, fuel gas refining, isotope separating, and tritium containment systems. In the fuel gas refining system, impurities are effectively removed by using Pd-alloy membranes. For the isotope separation system, the diffusion method through Pd-alloy membranes was adopted. From the standpoint of the safety and economy, a three-stage tritium containment system was adopted to control tritium release to the environment as low as possible. The principal conclusion drawn from the design study was as follows. In the FCS, while cryogenic distillation method appears to be practicable, Pd-alloy membrane method is attractive for isotope separation and the refining of fuel gas. For a large amount of tritium inventory, handling and control technologies should be completed by the experimental evaluation and development of the components and materials used for the FCS. A three-stage containment system was adopted to control tritium release to environment as low as possible. Consideration to prevent tritium escape will be necessary for fuel gas refiners and isotope separators. (Kato, T.)
Permeability of hydrogen isotopes through Pd-Ag membrane
International Nuclear Information System (INIS)
Yoshida, Hiroshi
1981-01-01
This paper represents the permeabilities, diffusion coefficients and isotope effects for hydrogen and deuterium through Pd-25 wt.% Ag alloy tubes The feed gas H 2 or D 2 flowing into the permeation cell was preheated before it reached to the outer surface of the permeation tube made of palladium-silver alloy. Permeation time lag method could be successfully carried out with the present apparatus to measure both permeability and diffusion coefficient. The square-root pressure dependence for the permeation of hydrogen isotopes was observed. The observed systematic temperature dependence indicates that the approximation of the Arrhenius' relation was effective within this experimental conditions. Some tendency of permeation fluxes in relation to the reciprocal temperature, 1/T, was seen. The permeability ratio was larger than the square root of isotopic mass ratio, and it decreased with temperature rise. On the contrary, the diffusion coefficient ratio was much smaller than the square root of isotopic mass ratio. (Kato, T.)
Contribution to the structure study of mercury isotopes with the (p,d) reaction
International Nuclear Information System (INIS)
Grafeuille, S.
1985-10-01
The mercury isotopes were studied by means of the two pick-up reactions (p,d) and (p,t). Enriched targets of 204 Hg, 202 Hg, 201 Hg, 200 Hg, 199 Hg, 198 Hg and 196 Hg were bombarded by a 25 MeV proton beam from the Orsay MP tandem accelerator. Emitted particles were analyzed by a split-pole magnetic spectrometer. We present all the results (nearly 150 states) of the analysis of the (p,d) reactions. Our (p,d) and (p,t) study show new discontinuities around 200 Hg in systematics of mercury isotopes. Part of the results are compared to the U(5) limits of Interacting Bosons (and Fermions) Models. The light nuclei can be considered reasonably described but this could be somewhat fortuitous. (71 refs) [fr
Gamma-ray linear polarization measurements following heavy-ion bombardment of odd isotopes of Pd
International Nuclear Information System (INIS)
Kim, J.S.; Lee, Y.K.; Hardy, K.A.; Simms, P.C.; Grau, J.A.; Smith, G.J.; Rickey, F.A.
1975-01-01
γ-ray linear polarization measurements have been used to locate negative parity states in the even-odd isotopes 99 , 101 , 103 Pd. A Compton polarimeter based on two Ge(Li) coaxial detectors was used. Collective bands (I=11 - /2, 15 - /2, 19 - /2, . . .) bulit on 11 - /2 states were observed in 101 Pd and 103 Pd. Many negative parity states were also observed in 99 Pd, but they do not appear to be part of a similar collective band. These polarization measurements also confirm many angular momentum assignments which previously had been made using systematic arguments
Righter, K.; Schonbachler, M.
2018-01-01
Decay of (sup 107) Pd to (sup 107) Ag has a half-life of 6.5 times 10 (sup 6) mega-annums. Because these elements are siderophile but also volatile, they offer potential constraints on the timing of core formation as well as volatile addition. Initial modelling has shown that the Ag isotopic composition of the bulk silicate Earth (BSE) can be explained if accretion occurs with late volatile addition. These arguments were tested for sensitivity for pre-cursor Pd/Ag contents, and for a fixed Pd/Ag ratio of the BSE of 0.1. New Ag and Pd partitioning data has allowed a better understanding of the partitioning behavior of Pd and Ag during core formation. The effects of S, C and Si, and the effect of high temperature and pressure has been evaluated. We can now calculate D(Ag) and D(Pd) over the wide range of PT conditions and variable metallic liquid compositions that are known during accretion. We then use this new partitioning information to revisit the Ag isotopic composition of the BSE during accretion.
Production of stable isotopes utilizing the plasma separation process
Bigelow, T. S.; Tarallo, F. J.; Stevenson, N. R.
2005-12-01
A plasma separation process (PSP) is being operated at Theragenics Corporation's®, Oak Ridge, TN, facility for the enrichment of stable isotopes. The PSP utilizes ion cyclotron mass discrimination to separate isotopes on a relatively large scale. With a few exceptions, nearly any metallic element could be processed with PSP. Output isotope enrichment factor depends on natural abundance and mass separation and can be fairly high in some cases. The Theragenics™ PSP facility is believed to be the only such process currently in operation. This system was developed and formerly operated under the US Department of Energy Advanced Isotope Separation program. Theragenics™ also has a laboratory at the PSP site capable of harvesting the isotopes from the process and a mass spectrometer system for analyzing enrichment and product purity. Since becoming operational in 2002, Theragenics™ has utilized the PSP to separate isotopes of several elements including: dysprosium, erbium, gadolinium, molybdenum and nickel. Currently, Theragenics™ is using the PSP for the separation of 102Pd, which is used as precursor for the production of 103Pd. The 103Pd radioisotope is the active ingredient in TheraSeed®, which is used in the treatment of early stage prostate cancer and being investigated for other medical applications. New industrial, medical and research applications are being investigated for isotopes that can be enriched on the PSP. Pre-enrichment of accelerator or reactor targets offers improved radioisotope production. Theragenics operates 14 cyclotrons for proton activation and has access to HFIR at ORNL for neutron activation of radioisotopes.
Study of the structure of yrast bands of neutron-rich 114-124Pd isotopes
Chaudhary, Ritu; Devi, Rani; Khosa, S. K.
2018-02-01
The projected shell model calculations have been carried out in the neutron-rich 114-124Pd isotopic mass chain. The results have been obtained for the deformation systematics of E(2+1) and E(4+1)/E({2}+1) values, BCS subshell occupation numbers, yrast spectra, backbending phenomena, B( E2) transition probabilities and g-factors in these nuclei. The observed systematics of E(2+1) values and R_{42} ratios in the 114-124Pd isotopic mass chain indicate that there is a decrease of collectivity as the neutron number increases from 68 to 78. The occurrence of backbending in these nuclei as well as the changes in the calculated B( E2) transition probabilities and g -factors predict that there are changes in the structure of yrast bands in these nuclei. These changes occur at the spin where there is crossing of g-band by 2-qp bands. The predicted backbendings and predicted values of B( E2)s and g-factors in some of the isotopes need to be confirmed experimentally.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Discovery. 509.102 Section 509.102 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE IN ADJUDICATORY PROCEEDINGS Local Rules § 509.102 Discovery. (a) In general. A party may take the deposition of an...
Energy Technology Data Exchange (ETDEWEB)
Fukada, Yoshiki, E-mail: yoshiki_fukada@mail.toyota.co.jp [Toyota Motor Corporation, 1200 Mishuku, Susono-shi, Shizuoka-ken, 410-1193 (Japan); Hioki, Tatsumi; Motohiro, Tomoyoshi [Toyota Central R& D Labs.,Inc, 41-1, Yokomichi, Nagakute, Aichi, 480-1192 (Japan); Green Mobility Collaborative Research Center & Graduate School of Engineering Nagoya University, Furo-cho, Chikusa-ku, Nagoya, 464-8603 (Japan); Ohshima, Shigeki [Toyota Central R& D Labs.,Inc, 41-1, Yokomichi, Nagakute, Aichi, 480-1192 (Japan)
2015-10-25
Hydrogen isotopes and metal interaction with respect to Pd under high hydrogen isotope potential at moderate temperature region around 300 °C was studied. A dry electrolysis technique using BaZr{sub 1−x} Y{sub x}O{sub 3} solid state electrolyte was developed to generate high hydrogen isotope potential. Hydrogen or deuterium was loaded into a 200 nm thick Pd cathode. The cathode is deposited on SiO{sub 2} substrate and covered with the solid state electrolyte and a Pd anode layer. Time resolved in situ monochromatic x-ray diffraction measurement was performed during the electrolysis. Two phase states of the Pd cathodes with large and small lattice parameters were observed during the electrolysis. Numerous sub-micron scale voids in the Pd cathode and dendrite-like Pd precipitates in the solid state electrolyte were found from the recovered samples. Hydrogen induced super-abundant-vacancy may take role in those phenomena. The observed two phase states may be attributed to phase separation into vacancy-rich and vacancy-poor states. The voids formed in the Pd cathodes seem to be products of vacancy coalescence. Isotope effects were also observed. The deuterium loaded samples showed more rapid phase changes and more formation of voids than the hydrogen doped samples. - Highlights: • High amount hydrogen loading into Pd by all solid-state electrolysis was performed. • Two phase states with large and small lattice parameters were observed. • Lattice contractions were observed suggesting formations of super-abundant-vacancy. • The absence of mechanical pressure might stimulate the formation of the vacancy. • Sub-micron void formations were found in the Pd from recovered samples.
International Nuclear Information System (INIS)
Fukada, Yoshiki; Hioki, Tatsumi; Motohiro, Tomoyoshi; Ohshima, Shigeki
2015-01-01
Hydrogen isotopes and metal interaction with respect to Pd under high hydrogen isotope potential at moderate temperature region around 300 °C was studied. A dry electrolysis technique using BaZr 1−x Y x O 3 solid state electrolyte was developed to generate high hydrogen isotope potential. Hydrogen or deuterium was loaded into a 200 nm thick Pd cathode. The cathode is deposited on SiO 2 substrate and covered with the solid state electrolyte and a Pd anode layer. Time resolved in situ monochromatic x-ray diffraction measurement was performed during the electrolysis. Two phase states of the Pd cathodes with large and small lattice parameters were observed during the electrolysis. Numerous sub-micron scale voids in the Pd cathode and dendrite-like Pd precipitates in the solid state electrolyte were found from the recovered samples. Hydrogen induced super-abundant-vacancy may take role in those phenomena. The observed two phase states may be attributed to phase separation into vacancy-rich and vacancy-poor states. The voids formed in the Pd cathodes seem to be products of vacancy coalescence. Isotope effects were also observed. The deuterium loaded samples showed more rapid phase changes and more formation of voids than the hydrogen doped samples. - Highlights: • High amount hydrogen loading into Pd by all solid-state electrolysis was performed. • Two phase states with large and small lattice parameters were observed. • Lattice contractions were observed suggesting formations of super-abundant-vacancy. • The absence of mechanical pressure might stimulate the formation of the vacancy. • Sub-micron void formations were found in the Pd from recovered samples
Electrophysical properties of silicon doped by palladium-103 isotope
International Nuclear Information System (INIS)
Makhkamov, Sh.; Tursunov, N.A.; Sattiev, A.R.; Normurodov, A.B.
2007-01-01
The work is devoted to study of radiation physical processes taking place in Si under nuclear transmutation, Identification and determination of defects microstructure and homogeneities and their distribution, study of interactions of nuclear-transformed phosphorus isotopes with palladium atoms, and its effect on crystal properties. For examination monocrystalline silicon of n- and p-type conductivity with specific resistance from 1 to 40 Ω·cm, dislocation density ∼10 4 cm -2 and oxygen content ∼10 17 cm -3 has been applied. Doping of silicon plates by examined admixture has been carried out by thermal diffusion method within temperature range 1000-1250 deg. C for 0.5- 5 h. Irradiation of doped silicon was conducted by reactor neutron fluences 5·10 18 - 5·10 19 cm -2 with subsequent annealing at 1000 deg. C for 30 min. Efficiency of mixture centers formation in silicon, effect of concentration of formed mixture-defect centers on electro-physical, photoelectric and recombination parameters of doped silicon and revealing of type and state of generated defects have been controlled by electric, volume and X-ray fluorescent methods. On the base of spectroscopic researches it is shown, that in silicon forbidden zone after Pd diffusion in DLTS spectra peaks related with acceptor (E c -0.18 and E v +0.34 eV) levels, and peak responsible for level E v +0.32 eV of donor character caused by palladium impurity. It is shown, that irradiation of doped silicon samples by neutrons lead to nuclear transmutation of 102 Pd, 104 Pd in 103 Pd isotopes in the crystal volume with following electron capture in stable isotope 103m Rh
Ground-State Band and Deformation of the Z = 102 Isotope N 254
International Nuclear Information System (INIS)
Reiter, P.; Khoo, T.L.; Lister, C.J.; Seweryniak, D.; Ahmad, I.; Alcorta, M.; Carpenter, M.P.; Cizewski, J.A.; Davids, C.N.; Gervais, G.; Greene, J.P.; Henning, W.F.; Janssens, R.V.; Lauritsen, T.; Siem, S.; Sonzogni, A.A.; Sullivan, D.; Uusitalo, J.; Wiedenhoever, I.; Amzal, N.; Butler, P.A.; Chewter, A.J.; Greenlees, P.T.; Herzberg, R.; Jones, G.D.; Cizewski, J.A.; Ding, K.Y.; Fotiades, N.; Fox, J.D.; Korten, W.; Leino, M.; Vetter, K.; Siem, S.
1999-01-01
The ground-state band of the Z=102 isotope 254 No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadrupole deformation, β=0.27 , is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of 254 No up to spin 14 means that its fission barrier persists at least up to that spin. copyright 1999 The American Physical Society
Microscopic calculation of parameters of the sdg interacting boson model for 104-110Pd isotopes
International Nuclear Information System (INIS)
Liu Yong
1995-01-01
The parameters of the sdg interacting boson model Hamiltonian are calculated for the 104-110 Pd isotopes. The calculations utilize the microscopic procedure based on the Dyson boson mapping proposed by Yang-Liu-Qi and extended to include the g boson effects. The calculated parameters reproduce those values from the phenomenological fits. The resulting spectra are compared with the experimental spectra
Biomedical research applications of electromagnetically separated enriched stable isotopes
International Nuclear Information System (INIS)
Lambrecht, R.M.
1982-01-01
The current and projected annual requirements through 1985 for stable isotopes enriched by electromagnetic separation methods were reviewed for applications in various types of biomedical research: (1) medical radiosotope production, labeled compounds, and potential radiopharmaceuticals; (2) nutrition, food science, and pharmacology; (3) metallobiochemistry and environmental toxicology; (4) nuclear magnetic resonance, electron paramagnetic resonance, and Moessbauer spectroscopy in biochemical, biophysical, and biomedical research; and (5) miscellaneous advances in radioactive and non-radioactive tracer technology. Radioisotopes available from commercial sources or routinely used in clinical nuclear medicine were excluded. Priorities and summaries are based on statements in the references and from answers to a survey conducted in the fall of 1981. Current requirements for enriched stable isotopes in biomedical research are not being satisfied. Severe shortages exist for 26 Mg, 43 Ca, 70 Zn, 76 Se, 78 Se, 102 Pd, 111 Cd, 113 Cd, and 190 Os. Many interesting and potentially important investigations in biomedical research require small quantities of specific elements at high isotopic enrichments
International Nuclear Information System (INIS)
Cabot, C.; Della Negra, S.; Deprun, C.; Gauvin, H.; Le Beyec, Y.
1978-01-01
By 63 Cu induced reactions on 110 Cd, 108 Cd, 106 Cd, 109 Ag, 107 Ag and 110 Pd targets, new isotopes were searched in the Ir, Os, Re region. Cross bombardments and excitation function measurements were used to identify new α emitting isotopes. The α-decay measurements are compared to the Qα values obtained from different mass predictions
Energy Technology Data Exchange (ETDEWEB)
Kloeckl, Ingo
2008-06-15
The present work describes the measuring of Q{sub {beta}} values of {beta}-instable isotopes of Tc, Ru, Rh and Pd. The mass range A=110 to 117 comprises neutron-rich, short-living isotopes. Due to their small (fission) abundances, few data are known, especially regarding level schemes or gamma radiation. The proton-induced fission and a fast online mass separation was used to produce these nuclides in the IGISOL facility located in Jyvaeskylaein Finland. The {beta},{gamma},X coincidence apparatus used during the experiments allows measuring Q{sub {beta}} values as well as {gamma},X coincidences. The latter represent the basic input data for a calculation of Q{sub {beta}} values out of {beta},{gamma} coincidences. It is so possible to examine nuclides with incomplete level schemes; similarly, these level schemes can be extended using beta,gamma coincidence data. Twelve Q{sub {beta}} values of neutron-rich Tc to Pd isotopes could be determined, yielding nuclear masses, mass defects and neutron separation energies. Eight of them were determined for the first time; another one could be confirmed. For three more, the error of earlier values could be decreased by a factor of nearly ten. The resulting data are of interest for the review of nuclear mass models, they represent also input in astrophysical network calculations. (orig.)
Isotope selection for patients undergoing prostate brachytherapy
International Nuclear Information System (INIS)
Cha, Christine M.; Potters, Louis; Ashley, Richard; Freeman, Katherine; Wang Xiaohong; Waldbaum, Robert; Leibel, Steven
1999-01-01
Purpose: Ultrasound-guided trans perineal interstitial permanent prostate brachytherapy (TIPPB) is generally performed with either 103 Pd or 125 I. The use of 125 I for low Gleason score tumors and 103 Pd for higher Gleason scores has been suggested based on isotope dose rate and cell doubling time observed in in vitro studies. While many centers follow these isotope selection criteria, other centers have elected to use only a single isotope, regardless of Gleason score. No clinical data have been published comparing these isotopes. This study was undertaken to compare outcomes between 125 I and 103 Pd in a matched pair analysis for patients undergoing prostate brachytherapy. Methods and Materials: Six hundred forty-eight consecutively treated patients with clinically confined prostate cancer underwent TIPPB between June 1992 and February 1997. Five hundred thirty-two patients underwent TIPPB alone, whereas 116 received pelvic external beam irradiation and TIPPB. Ninety-three patients received androgen deprivation therapy prior to TIPPB. The prescribed doses for TIPPB were 160 Gy for 125 I (pre-TG43) and 120 Gy for 103 Pd. Patients treated with combination therapy received 41.4 or 45 Gy (1.8 Gy/fraction) external beam irradiation followed by a 3- to 5-week break and then received either a 120-Gy 125 I or a 90-Gy 103 Pd implant. Until November 1994, all patients underwent an 125 I implant after which the isotope selection was based on either Gleason score (Gleason score 2-5: 125 I; Gleason 5-8: 103 Pd) or isotope availability. A matched pair analysis was performed to assess any difference between isotopes. Two hundred twenty-two patients were matched according to Gleason score, prostate-specific antigen (PSA), and stage. PSA relapse-free survival (PSA-RFS) was calculated based on the American Society for Therapeutic Radiology and Oncology (ASTRO) Consensus Group definition of failure. Kaplan-Meier actuarial survival curves were compared to assess differences in
International Nuclear Information System (INIS)
Mernagh, T.
1992-01-01
The fluid inclusion and isotope data have been used to constrain the ore genesis models for the Au-Pt-Pd-U mineralization at Coronation Hill. The fluid inclusions demonstrate that the ore fluid was strongly saline with an unusually high CaCl 2 content, and that the mineralisation was probably formed from a boiling fluid at around 140 deg C. Furthermore, the fluids were highly oxidised and the replacement of earlier chlorite by hematite is common throughout the deposit. It is concluded that both U-rich and U-poor Au-Pt-Pd mineralisation were formed by descending, low-temperature, highly oxidised, very saline, meteoric fluids. The segregation of U was controlled by fluid-rock interaction in the feldspathic or carbonate rocks. Interaction with carbonaceous or chloritic rocks resulted in a reduction in fO 2 , and consequent precipitation of U, Au, Pt and Pd. The other two types of metal associations can be explained by further reaction of the mineralizing fluids. 3 figs
International Nuclear Information System (INIS)
Dudu, D.; Popa, V.; Racolta, P.M.; Tetcu, N.; Voiculescu, Dana
2001-01-01
Historically, 103 Pb, a short-lived isotope for permanent implant treatment of early stage prostate cancer, was generated via the 102 Pd(n,γ) 103 Pd reaction which relied on the availability of 1% naturally abundant 102 Pd in an enriched form and its moderately high neutron capture cross section. For the last 12 years, the accelerator production method for 103 Pd has been based on the irradiation of the rhodium metal with rather low energy protons via the reaction 103 Rh(p,n) 103 Pd. Big corporations from USA operate more than 10 dedicated accelerators to produce this nuclide. The prostate cancer market with 180,000 new cases reported annually justifies the effort for this radionuclide production. Recently, a manufacture in Europe also brought the USA patented type of 103 Pd seed implants on the world market. Our interest for this radioisotope production was started in 2000, as a result of the demand of two big hospitals from Bucharest and the opportunity to participate in a research programme (333-F2-RC 832) co-ordinated by the IAEA in Vienna. The U-120 Cyclotron, made in 1956 and brought from Russia, was quite a reliable machine. The accelerator is a classical cyclotron with adjustable energy. Now at the level of our technology, we can maintain it by ourselves and operate it quite independently. The experiments for the first year were focused on obtaining homemade data on cross-section, thick target yields and possible contaminants for the nuclear reaction 103 Rh (p,n) 103 Pb in the proton energy region 5-14 MeV. The experiments were performed at our Van de Graaff HV Tandem FN 15 accelerator (8 MV on terminal) by using proton beams up to 14 MeV with a current intensity of 100 nA. Design and adaptation of a dedicated beam line at IFIN-HH Cyclotron for the 103 production was a priority in our work planning for the first year
Study on (d,t) reaction in the 100, 102 and 104 ruthenium isotopes
International Nuclear Information System (INIS)
Duarte, J.L.M.
1990-01-01
Neutron-hole components in 99, 101, 103 Ru isotopes were investigated by (d,t) reactions at incident deuteron energies of 15.5 MeV and 16 MeV on, respectively, 100 Ru and 102 , 104 Ru. Outgoing triton groups were momentum analyzed by a magnetic spectrograph and detected in nuclear emulsion plates with an energy resolution better than 8 KeV. A total of 14,36 and 46 levels up to 1.4, 2.1 2.5 MeV excitation energy were identified, respectively, in 99 , 101 , 103 Ru. The transferred orbital angular momenta, l, and the spectroscopic strengths were obtained by comparing experimental angular distributions, measured at carefully chosen scattering angles between 8 0 C and 46 0 C, with Distorted Wave Born Approximation predictions. The analysis of the spectroscopic strength distributions corresponding to each l-value reveals a similar pattern among the three isotopes, although there is a shift of the highest strengths towards low energy, for increasing neutron number, indicating increasing deformation. Special attention is drawn to transitions to low-lying states with l=3 and l=1 character, associated with the next major shell, whose description is discussed in terms of a quasiparticle-prolate non-rigid rotor model with the Coriolis effect fully treated, and the Interacting Boson-Fermion Model. (author)
A 20MeV (p,d) study of nuclear structure in the even and odd tin isotopes
International Nuclear Information System (INIS)
Fleming, D.G.; Paris-11 Univ., 91 - Orsay
1978-01-01
The even and odd tin isotopes have been studied by 20 MeV (p,d) reactions. States strongly populated in the odd isotopes are due to the valence neutron shells and extend up to only 2 MeV of excitation energy; 'deep hole' states were not identified. The occupation probabilities extracted from finite-range distorted-wave-Born-approximation calculations generally agree well with the predictions of the BCS theory of superconducting nuclei, particularly with the calculations of Clement and Baranger. In the even tin isotopes, strongly populated states are characterized predominantly by L=2 transfers extending up to 4 MeV excitation energy. The experimental spectroscopic factors are compared with the BCS calculated values of Clement and Baranger, Alzetta and Sawicki, and Van Gunsteren; relatively good agreement is obtained for L=2 transitions, but not for L=0 transitions. A considerable fraction of the sum rule L=2 strength in 118 Sn is missing in the 119 Sn(p,d) 118 Sn experimental spectrum; in like manner, no 4 + strength could be identified in either 114 Sn or 118 Sn
Creech, J. B.; Moynier, F.; Bizzarro, M.
2017-11-01
Stable isotope studies of highly siderophile elements (HSE) have the potential to yield valuable insights into a range of geological processes. In particular, the strong partitioning of these elements into metal over silicates may lead to stable isotope fractionation during metal-silicate segregation, making them sensitive tracers of planetary differentiation processes. We present the first techniques for the precise determination of palladium stable isotopes by MC-ICPMS using a 106Pd-110Pd double-spike to correct for instrumental mass fractionation. Results are expressed as the per mil (‰) difference in the 106Pd/105Pd ratio (δ106Pd) relative to an in-house solution standard (Pd_IPGP) in the absence of a certified Pd isotopic standard. Repeated analyses of the Pd isotopic composition of the chondrite Allende demonstrate the external reproducibility of the technique of ±0.032‰ on δ106Pd. Using these techniques, we have analysed Pd stable isotopes from a range of terrestrial and extraterrestrial samples. We find that chondrites define a mean δ106Pdchondrite = -0.19 ± 0.05‰. Ureilites reveal a weak trend towards heavier δ106Pd with decreasing Pd content, similar to recent findings based on Pt stable isotopes (Creech et al., 2017), although fractionation of Pd isotopes is significantly less than for Pt, possibly related to its weaker metal-silicate partitioning behaviour and the limited field shift effect. Terrestrial mantle samples have a mean δ106Pdmantle = -0.182 ± 0.130‰, which is consistent with a late-veneer of chondritic material after core formation.
Electron scattering off palladium isotopes
International Nuclear Information System (INIS)
Laan, J.B. van der.
1986-01-01
The low-lying states of the even Pd isotopes are characterized by vibrator-like properties. In this thesis the results of an electron scattering experiment on the Pd isotopes, designed to study the description of such nuclei in the Anharmonic Vibrator Model (AVM) and the Interacting Boson Approximation (IBA), are presented and discussed. Data have been taken at the high-resolution electron scattering facility of NIKHEF-K and covered a momentum-transfer range of 0.4 to 2.5 fm -1 . (Auth.)
Study of band terminating in the A ≅ 100 by EUROGAM
International Nuclear Information System (INIS)
Gizon, J.; Gizon, A.; Genevey, J.; Santos, D.; Nyako, B.M.; Timar, J.; Zolnai, L.; Boston, A.J.; Zoss, D.T.; Paul, E.S.; Semple, A.T.; O'Brien, N.J.; Parry, C.M.; Cata-Danil, Gh.; Bucurescu, D.; Afanasjev, A.V.; Ragnarsson, I.
1997-01-01
Terminating bands in nuclei in the A≅ 100 region have been investigated using the EUROGAM2 array. Results have been obtained for Pd (Z 46) and Rh (Z = 45) isotopes. In the nucleus 102 Pd, eight terminating configurations are identified. It is the first nucleus where terminating bands built on the valence space configurations and on core excited configurations are observed. Terminating bands have been also found in 103 Pd and 102 Rh. For 102 Rh it is the first case of band terminations identified in a doubly-odd nucleus below the Z = 50 shell closure. (authors)
DEFF Research Database (Denmark)
Creech, J. B.; Moynier, F.; Bizzarro, Martin
2017-01-01
Stable isotope studies of highly siderophile elements (HSE) have the potential to yield valuable insights into a range of geological processes. In particular, the strong partitioning of these elements into metal over silicates may lead to stable isotope fractionation during metal......–silicate segregation, making them sensitive tracers of planetary differentiation processes. We present the first techniques for the precise determination of palladium stable isotopes by MC-ICPMS using a 106Pd–110Pd double-spike to correct for instrumental mass fractionation. Results are expressed as the per mil...... (‰) difference in the 106Pd/105Pd ratio (δ106Pd) relative to an in-house solution standard (Pd_IPGP) in the absence of a certified Pd isotopic standard. Repeated analyses of the Pd isotopic composition of the chondrite Allende demonstrate the external reproducibility of the technique of ±0.032‰ on δ106Pd. Using...
29 CFR 102.100 - Notice of petition; service of petition.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Notice of petition; service of petition. 102.100 Section... petition; service of petition. Upon the filing of a petition the petitioner shall immediately serve in the manner provided by § 102.114(a) of these rules a copy of the petition on all parties to the proceeding...
Preparation of Pd/γ- Al2O3 catalyst utilized in chemisorption of hydrogen isotopes
International Nuclear Information System (INIS)
David, Elena; Stefanescu, Doina; Stanciu, V.
1997-01-01
Separation and hydrogen isotope determination require packings with special properties, utilizable in separation columns. Consequently, such packings as catalysts using γ-aluminia and metallic palladium active component as holder were obtained. The γ-aluminia used as holder has been prepared starting from λ salts, easy soluble in water, such as Al 2 (NO 3 ) 3 ·9H 2 O, at a preset (6.2-6.4) controlled pH. At a first stage the Al(OH) 3 results which by calcination at controlled temperature transforms in γ-Al 2O3 . On this holder, in which the specific surface and porosity has been determined, metallic palladium has been deposed, using for impregnation a 2% PdCl 2 solution. The content of deposed palladium was determined as the difference between the content in the initial solution and solution remaining after holder impregnation. This content has been determined by atomic absorption and is within 0.5 - 1.2% Pd. After impregnation the catalyst has been dried, then granulated at the 0.16 mm size and activated by hydrogen at a flow rate of 300 vol H 2 /volume
Energy Technology Data Exchange (ETDEWEB)
Gizon, J.; Gizon, A.; Genevey, J.; Santos, D. [Inst. des Sciences Nucleaires, Grenoble-1 Univ., 38 (France); Nyako, B.M.; Timar, J.; Zolnai, L. [Institute of Nuclear Research, Debrecen (Hungary); Boston, A.J.; Zoss, D.T.; Paul, E.S.; Semple, A.T. [Oliver Lodge Laboratory, University of Liverpool, Liverpool (United Kingdom); O`Brien, N.J.; Parry, C.M. [Department of Physics, University of York, Heslington, York (United Kingdom); Cata-Danil, Gh.; Bucurescu, D. [Horia Hulubei Institute of Physics and Nuclear Engineering, Bucharest (Romania); Afanasjev, A.V.; Ragnarsson, I. [Department of Mathematical Physics, University of Lund, Lund (Sweden)
1997-12-31
Terminating bands in nuclei in the A{approx_equal} 100 region have been investigated using the EUROGAM2 array. Results have been obtained for Pd (Z 46) and Rh (Z = 45) isotopes. In the nucleus {sup 102}Pd, eight terminating configurations are identified. It is the first nucleus where terminating bands built on the valence space configurations and on core excited configurations are observed. Terminating bands have been also found in {sup 103}Pd and {sup 102}Rh. For {sup 102}Rh it is the first case of band terminations identified in a doubly-odd nucleus below the Z = 50 shell closure. (authors) 9 refs., 2 figs.
Müller, M; Heumann, K G
2000-09-01
An isotope dilution inductively coupled plasma quadrupole mass spectrometric (ID-ICP-QMS) method was developed for the simultaneous determination of the platinum group elements Pt, Pd, Ru, and Ir in environmental samples. Spike solutions, enriched with the isotopes 194Pt, 108Pd, 99Ru, and 191Ir, were used for the isotope dilution step. Interfering elements were eliminated by chromatographic separation using an anion-exchange resin. Samples were dissolved with aqua regia in a high pressure asher. Additional dissolution of possible silicate portions by hydrofluoric acid was usually not necessary. Detection limits of 0.15 ng x g(-1), 0.075 ng x g(-1), and 0.015 ng x g(-1) were achieved for Pt, Pd, Ru, and Ir, respectively, using sample weights of only 0.2 g. The reliability of the ID-ICP-QMS method was demonstrated by analyzing a Canadian geological reference material and by participating in an interlaboratory study for the determination of platinum and palladium in a homogenized road dust sample. Surface soil, sampled at different distances from a highway, showed concentrations in the range of 0.1-87 ng x g(-1). An exponential decrease of the platinum and palladium concentration with increasing distance and a small anthropogenic contribution to the natural background concentration of ruthenium and iridium was found in these samples.
Charge-exchange neutral hydrogen measurements in TFTR using Pd-MOS microsensors
International Nuclear Information System (INIS)
Bastasz, R.; Kilpatrick, S.J.; Ruzic, D.N.
1991-06-01
An array of Pd-metal-oxide semiconductor (Pd-MOS) diodes has been used to monitor the fluence and energy of charge-exchange neutral hydrogen isotopes striking the wall of the Tokamak Fusion Test Reactor (TFTR). The array was positioned 4 cm behind the graphite-tiled wall at the toroidal midplane and exposed to several hundred plasma discharges. Hydrogen isotopes striking the Pd-MOS diodes were detected by measuring the leakage current, which is affected by the presence of these species at the Pd/SiO 2 interface. It was found that the midplane flux strongly increased for neutral-beam heated plasmas and correlated with co-injected neutral beam power. The majority of the neutral flux was <50 eV in energy but its energy distribution extended to above 500 eV. 20 refs., 4 figs
The Democratic Party of Córdoba before the November 1931 elections
Directory of Open Access Journals (Sweden)
Desiree del Valle Osella
2015-04-01
Full Text Available The paper analyzes the Cordoba Democratic leaders's actions for orchestrating an electoral solution to the uriburista dictatorship, considering the results of the elections; strategy to integrate a national electoral antiyrigoyenista coalition (The National Democratic Party and the reaction that it brought about within the group. How ever the Democrats triumphed comfortably in the provincial and municipal elections; the PDN victory was not very pronounced. Integrating meant to PD coalition the defection of the leaders who saw in it the loss of the progressivism that characterized the Cordoba party
Co-deposition of palladium with hydrogen isotopes
International Nuclear Information System (INIS)
Dash, J.; Ambadkar, A.
2006-01-01
Palladium was co-deposited with hydrogen isotopes on a Pd cathode. This resulted in enhanced production of excess thermal power. After electrolysis the Pd Lβ/ Lα ratio was found to be increased in characteristic X-ray spectra from localized, microscopic areas on the surface of the Pd cathode. This suggests the possibility that appreciable amounts of silver are present in these areas. (authors)
Laser assisted aerodynamic isotope separation
International Nuclear Information System (INIS)
Berg, H. van den
1985-01-01
It is shown that the efficiency of conventional aerodynamic isotope seperation can be improved by two orders of magnitude with the aid of a relatively weak cw infrared laser which is used to induce isotopically selective condensation. Overall isotope enrichment factors in excess of 2 are obtained as compared to about 1.02 in the conventional seperation. Sulphur isotopes in SF 6 as well as Silicon isotopes in SiF 4 and Bromine isotopes in CF 3 Br are seperated on a laboratory scale. Infrared vibrational predissociation by itself and in combination with isotopically selective condensation are also shown to be effective new ways of isotope separation. (orig.) [de
42 CFR 102.2 - Summary of available benefits.
2010-10-01
... Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX... benefits paid under § 102.82(c) are secondary to death and disability benefits under the PSOB Program. The... potential third-party payor makes a determination on the availability of similar benefits and has the right...
Development of Separation Materials Containing Palladium for Hydrogen Isotopes Separation
International Nuclear Information System (INIS)
Deng Xiaojun; Luo Deli; Qian Xiaojing
2010-01-01
Displacement chromatography (DC) is a ascendant technique for hydrogen isotopes separation. The performance of separation materials is a key factor to determine the separation effect of DC. At present,kinds of materials are researched, including palladium materials and non-palladium materials. It is hardly replaceable because of its excellent separation performance, although palladium is expensive. The theory of hydrogen isotopes separation using DC was introduced at a brief manner, while several palladium separation materials were expatiated in detail(Pd/K, Pd-Al 2 O 3 , Pd-Pt alloy). Development direction of separation materials for DC was forecasted elementarily. (authors)
2010-01-01
...: Accounts and accounting. 102.5 Section 102.5 Federal Elections FEDERAL ELECTION COMMISSION GENERAL... connection with non-Federal elections. Administrative expenses for State, district, and local party... 11 Federal Elections 1 2010-01-01 2010-01-01 false Organizations financing political activity in...
Tank characterization report for double-shell tank 241-AW-102
International Nuclear Information System (INIS)
Bell, K.E.
1997-01-01
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AW-102. This report supports the requirements of the Tri-Party Agreement Milestone M-44-05
Tank characterization report for double-shell tank 241-AW-102
Energy Technology Data Exchange (ETDEWEB)
Bell, K.E.
1997-05-29
This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in Tank 241-AW-102. This report supports the requirements of the Tri-Party Agreement Milestone M-44-05.
Preparation of a Pd-Pt alloy on alumina and its application for a gas chromatography
Energy Technology Data Exchange (ETDEWEB)
Lee, Minsoo [Korea Atomic Energy Research Institute, 150 Deokjin-dong, Yuseong, Daejeon 305-353 (Korea, Republic of)]. E-mail: minm@kaeri.re.kr; Paek, Seungwoo [Korea Atomic Energy Research Institute, 150 Deokjin-dong, Yuseong, Daejeon 305-353 (Korea, Republic of); Ahn, Do-Hee [Korea Atomic Energy Research Institute, 150 Deokjin-dong, Yuseong, Daejeon 305-353 (Korea, Republic of); Kim, Kwang-Rag [Korea Atomic Energy Research Institute, 150 Deokjin-dong, Yuseong, Daejeon 305-353 (Korea, Republic of); Yim, Sung-Paal [Korea Atomic Energy Research Institute, 150 Deokjin-dong, Yuseong, Daejeon 305-353 (Korea, Republic of); Chung, Hongsuk [Korea Atomic Energy Research Institute, 150 Deokjin-dong, Yuseong, Daejeon 305-353 (Korea, Republic of)
2007-08-30
In this study we attempted to obtain a Pd-Pt alloy on alumina (PPA) by using an impregnation and alcohol reduction method for the purpose of a hydrogen isotopes separation, in which {alpha}-alumina powder was impregnated into an ethanol water (1/1, w/w) solution containing PdCl{sub 2}, PtCl{sub 2}, and polyvinylpyrrolidone (PVP, MW = 10,000). The sample was dried, reduced by hydrogen, and thermally treated at 1073 K. Thus, two kinds of PPA (Pd content 17 and 29 wt%) were achieved. The produced PPA showed a good crystallinity from the XRD analysis and it exhibited an adequate hydrogen desorption isotherm as a packing material for the separation of hydrogen isotopes. GC columns packed with PPA and Cu powder were used for the separation of a 29.2% D{sub 2}-H{sub 2} gas mixture at 303 and 343 K. The experimental result showed a good separation efficiency of the hydrogen isotopes for the GC process. Consequently, the suggested technique for the production of a Pd-Pt alloy on alumina was proven to be successful.
International Nuclear Information System (INIS)
Li, I-H.; Huang, W.-S.; Yeh, C.-B.; Liao, M.-H.; Chen, C.-C.; Shen, L.-H.; Liu, J.-C.; Ma, K.-H.
2009-01-01
Introduction: Parkinson's disease (PD) affects both dopaminergic and serotonergic systems. In this study, we simultaneously evaluated dopamine and serotonin transporters in primates using dual-isotope single-photon emission computed tomography (SPECT) imaging and compared the results with traditional single-isotope imaging. Methods: Four healthy and one 6-OHDA-induced PD monkeys were used for this study. SPECT was performed over 4 h after individual or simultaneous injection of [ 99m Tc]TRODAT-1 (a dopamine transporter imaging agent) and [ 123 I]ADAM (a serotonin transporter imaging agent). Results: The results showed that the image quality and uptake ratios in different brain regions were comparable between single- and dual-isotope studies. The striatal [ 99m Tc]TRODAT-1 uptake in the PD monkey was markedly lower than that in normal monkeys. The uptake of [ 123 I]ADAM in the midbrain of the PD monkey was comparable to that in the normal monkeys, but there were decreased uptakes in the thalamus and striatum of the PD monkey. Conclusions: Our results suggest that dual-isotope SPECT using [ 99m Tc]TRODAT-1 and [ 123 I]ADAM can simultaneously evaluate changes in dopaminergic and serotonergic systems in a PD model.
2010-07-01
... responsible party with respect to the hazardous substance activity? 102-75.345 Section 102-75.345 Public... Relating to Hazardous Substance Activity § 102-75.345 What is different about the statements in the offer... the hazardous substance activity? In the case where the purchaser or grantee is a potentially...
Hydrogen isotope effect through Pd in hydrogen transport pipe
International Nuclear Information System (INIS)
Tamaki, Masayoshi
1992-01-01
This investigation concerns hydrogen system with hydrogen transport pipes for transportation, purification, isotope separation and storage of hydrogen and its isotopes. A principle of the hydrogen transport pipe (heat pipe having hydrogen transport function) was proposed. It is comprised of the heat pipe and palladium alloy tubes as inlet, outlet, and the separation membrane of hydrogen. The operation was as follows: (1) gas was introduced into the heat pipe through the membrane in the evaporator; (2) the introduced gas was transported toward the condenser by the vapor flow; (3) the transported gas was swept and compressed to the end of the condenser by the vapor pressure; and (4) the compressed gas was exhausted from the heat pipe through the membrane in the condenser. The characteristics of the hydrogen transport pipe were examined for various working conditions. Basic performance concerning transportation, evacuation and compression was experimentally verified. Isotopic dihydrogen gases (H 2 and D 2 ) were used as feed gas for examining the intrinsic performance of the isotope separation by the hydrogen transport pipe. A simulated experiment for hydrogen isotope separation was carried out using a hydrogen-helium gas mixture. The hydrogen transport pipe has a potential for isotope separation and purification of hydrogen, deuterium and tritium in fusion reactor technology. (author)
International Nuclear Information System (INIS)
Yuldashev, B.S.; Khudajbergenov, U.; Gulamov, I.R.; Mirzarva, M.A.; Rylov, A.A.
2003-01-01
A procedure for preparation of 103 Pd isotope of 99.9 % purity from a thin rhodium wire irradiated by 21 MeV proton beam in a cyclotron was developed. The desired product was prepared by electrolytic dissolution of the irradiated target in 6 M HCl with subsequent extraction of 103 Pd isotope without carrier by dimethylglyoxime in chloroform [ru
Electric quadrupole moments of the 2$_{1}^{+}$ states in $^{100,102,104}$Cd
Ekström, A; DiJulio, D D; Fahlander, C; Hjorth-Jensen, M; Blazhev, A; Bruyneel, B; Butler, P A; Davinson, T; Eberth, J; Fransen, C; Geibel, K; Hess, H; Ivanov, O; Iwanicki, J; Kester, O; Kownacki, J; Köster, U; Marsh, B A; Reiter, P; Scheck, M; Siebeck, B; Siem, S; Stefanescu, I; Toft, H K; Tveten, G M; van de Walle, J; Voulot, D; Warr, N; Weisshaar, D; Wenander, F; Wrzosek, K; Zielińska, M
2009-01-01
Using the REX-ISOLDE facility at CERN the Coulomb excitation cross sections for the 0gs+→21+ transition in the β-unstable isotopes 100,102,104Cd have been measured for the first time. Two different targets were used, which allows for the first extraction of the static electric quadrupole moments Q(21+) in 102,104Cd. In addition to the B(E2) values in 102,104Cd, a first experimental limit for the B(E2) value in 100Cd is presented. The data was analyzed using the maximum likelihood method. The provided probability distributions impose a test for theoretical predictions of the static and dynamic moments. The data are interpreted within the shell-model using realistic matrix elements obtained from a G-matrix renormalized CD-Bonn interaction. In view of recent results for the light Sn isotopes the data are discussed in the context of a renormalization of the neutron effective charge. This study is the first to use the reorientation effect for post-accelerated short-lived radioactive isotopes to simultaneously d...
Effect of anharmonicity and Debye-Waller factor on the superconductivity of PdHsub(x) and PdDsub(x)
International Nuclear Information System (INIS)
Griessen, R.; Groot, D.G. de
1983-01-01
On the basis of existing superconducting tunnelling, neutron scattering, electrical resistivity and Raman scattering data and new thermal expansion, elastic moduli and point-contact spectroscopy data it is concluded that the anharmonicity of the proton (deuteron)-palladium potential is such that Msub(H)#betta#sub(H) 2 /(Msub(D)#betta#sub(D) 2 ) = 1.12 +- 0.05 Msub(H(D)) is the mass and #betta#sub(H(D)) the frequency of the vibration of hydrogen (deuterium). This anharmonicity is approximately 2 times too weak to reproduce the observed inverse isotope effect in the superconducting transition temperature of concentrated PdHsub(x) and PdDsub(x) alloys. Within a pseudopotential formalism it is shown that the Debye-Waller factor arising from the large zero-point amplitude of the interstitial hydrogen (deuterium) leads to a contribution to the inverse isotope effect in Tsub(c) which is as large as that of anharmonicity alone. (Auth.)
Thermodynamic assessment of the Pd-H-D-T system
Energy Technology Data Exchange (ETDEWEB)
Joubert, J.-M., E-mail: jean-marc.joubert@icmpe.cnrs.f [Chimie Metallurgique des Terres Rares, Institut de Chimie et des Materiaux Paris-Est, CNRS, Universite de Paris XII, UMR 7182, 2-8 rue Henri Dunant, F-94320 Thiais (France); Thiebaut, S. [CEA/DAM/Valduc, F-21120 Is sur Tille (France)
2009-12-15
The three binary systems H-Pd, D-Pd and Pd-T have been modelled in the frame of the Calphad approach. A complete literature search has been undertaken and the most significant experimental data have been selected for a thermodynamic assessment of these systems. To complement the available data, pressure-composition curves have been measured for the three systems in the present work. The three systems are characterized by a strong isotope effect which is well taken into account in the modelling. They have been combined to perform calculations in the quaternary H-D-Pd-T system. It is shown that a reasonable extrapolation can be made without the use of ternary parameters if it is calculated with the so-called Toop model.
Energy Technology Data Exchange (ETDEWEB)
Li, I-H. [Graduate Institute of Medical Sciences, National Defense Medical Center, Taipei 114, Taiwan (China); Huang, W.-S. [Department of Nuclear Medicine, Tri-Service General Hospital, Taipei, 114, Taiwan (China); Yeh, C.-B. [Department of Psychiatry, Tri-Service General Hospital, Taipei, 114, Taiwan (China); Liao, M.-H.; Chen, C.-C.; Shen, L.-H. [Division of Isotope Application, Institute of Nuclear Energy Research, Taoyaun, 325 Taiwan (China); Liu, J.-C. [Department of Biology and Anatomy, National Defense Medical Center, Taipei 114, Taiwan (China); Ma, K.-H. [Department of Biology and Anatomy, National Defense Medical Center, Taipei 114, Taiwan (China)], E-mail: kuohsing91@yahoo.com.tw
2009-08-15
Introduction: Parkinson's disease (PD) affects both dopaminergic and serotonergic systems. In this study, we simultaneously evaluated dopamine and serotonin transporters in primates using dual-isotope single-photon emission computed tomography (SPECT) imaging and compared the results with traditional single-isotope imaging. Methods: Four healthy and one 6-OHDA-induced PD monkeys were used for this study. SPECT was performed over 4 h after individual or simultaneous injection of [{sup 99m}Tc]TRODAT-1 (a dopamine transporter imaging agent) and [{sup 123}I]ADAM (a serotonin transporter imaging agent). Results: The results showed that the image quality and uptake ratios in different brain regions were comparable between single- and dual-isotope studies. The striatal [{sup 99m}Tc]TRODAT-1 uptake in the PD monkey was markedly lower than that in normal monkeys. The uptake of [{sup 123}I]ADAM in the midbrain of the PD monkey was comparable to that in the normal monkeys, but there were decreased uptakes in the thalamus and striatum of the PD monkey. Conclusions: Our results suggest that dual-isotope SPECT using [{sup 99m}Tc]TRODAT-1 and [{sup 123}I]ADAM can simultaneously evaluate changes in dopaminergic and serotonergic systems in a PD model.
Feasibility test for production and separation of 103Pd
International Nuclear Information System (INIS)
Szuecs, Z.; Takacs, S.; Hunyadi, M.; Gacsi, Z.; Zeevaart, J.R.
2011-01-01
Complete text of publication follows. 103 Pd as a well-known Auger-emitter is commonly employed in brachytherapy, but the ultra-short range stopping of Auger-electrons can be more potentially exploited in applications of targeted radionuclide therapy in the future. The no-carrier-added production of 103 Pd is practically possible through charged particle induced reactions. However, separation techniques of 103 Pd from the target material (typically Rh), as well as its recovery by wet chemistry are expensive, and yields high amounts of radioactive waste. An alternative and more efficient procedure, called drydistillation method (DDM), is based on differences between the isothermal vapor pressures of the radionuclide element and the target element. In an appropriately selected temperature region the diffusion and out-gassing rates of radionuclides from the solid matrix of the target material are enhanced. Optimal irradiation parameters were determined in previous experiments at ATOMKI. Separation of 103 Pd was demonstrated at the Isotope Separator Laboratory with an evaporating-condensing system (Fig. 1). Figure 1. Evaporation-condensation system at the Isotope Separator Laboratory of ATOMKI. The irradiated Rh foil was kept above 1800?C in vacuum for several hours. The evaluation of γ-spectra of the Rh foil and the 103 Pd condensed on a low-temperature substrate (Fig. 2). The analysis resulted in a radiochemical yield of about 99.5% for 103 Pd and a radionuclidic purity of better than 99% with respect to the level of 101 Rh in the end product. Acknowledgement. The work was partly supported by the Hungarian TeT Bilateral Cooperation (OMFB- 00138/2009) and by the South African NRF (UID 68768).
Separation and sampling technique of light element isotopes by chemical exchange process
International Nuclear Information System (INIS)
Kato, Shunsaku; Oi, Kenta; Takagi, Norio; Hirotsu, Takafumi; Kano, Hirofumi; Sonoda, Akinari; Makita, Yoji
2000-01-01
Lithium and boron isotope separation technique were studied. Granulation of lithium isotope separation agent was carried out by cure covering in solution. Separation of lithium isotope was stepped up by ammonium carbonate used as elusion agent. Styrene and ester resin derived three kinds of agents such as 2-amino-1, 3-propanediol (1, 3-PD), 2-amino-2-methyl-1, 3-propanediol (Me-1,3-PD) and tris(2-hydroxyethyl)amine (Tris) were used as absorbent.The ester resin with Tris showed larger amount of adsorption (1.4 mmol/g) than other resins. However, all resins with agent indicated more large adsorption volume of boron than the objective value (0.5 mmol/g). Large isotope shift was shown by the unsymmetrical vibration mode of lithium ion on the basis of quantum chemical calculation of isotope effect on dehydration of hydrated lithium ion. (S.Y.)
Party Control, Party Competition and Public Service Performance
Boyne, George Alexander; James, O.; John, P.; Petrovsky, Nicolai
2012-01-01
This article assesses party effects on the performance of public services. A policy-seeking model, hypothesizing that left and right party control affects performance, and an instrumental model, where all parties strive to raise performance, are presented. The framework also suggests a mixed model in which party effects are contingent on party competition, with parties raising performance as increasing party competition places their control of government at increasing risk. These models are t...
Quasimolecular states in a reaction with carbon isotopes
Czech Academy of Sciences Publication Activity Database
Torilov, S. Yu.; Maltsev, N. A.; Goldberg, V. Z.; Gridnev, K. A.; Zherebchevsky, V. I.; Lönnroth, T.; Novatskii, B. G.; Slotte, J. M. K.; Sobolev, Yuri, G.; Trzaska, W. H.; Tyurin, G. P.; Khlebnikov, S. V.
2015-01-01
Roč. 102, č. 2 (2015), s. 69-72 ISSN 0021-3640 R&D Projects: GA MŠk LG14004 Institutional support: RVO:61389005 Keywords : rich Be isotope * C isotope * C-14+C-12 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.172, year: 2015
Party member recruitment and the representativeness of party membership
DEFF Research Database (Denmark)
Kosiara-Pedersen, Karina
Party membership figures are in decline. However, parties are still recruiting party members. Are there any differences in the social and political characteristics of old and new party members? If there is a difference, are new party members more or less representative for party voters than old...
DEVELOPMENT OF POLITICAL PARTIES AND PARTY FUNDING: MODELS AND CHARACTERISTICS
Directory of Open Access Journals (Sweden)
Hrvoje MATAKOVIC
2015-03-01
Full Text Available The first modern political parties were formed at the end of the 18th century and have, from those times up to now, undergone 4 developing phases; each of the phases is bound to ideal-type political party model: cadre parties, mass parties, catch-all parties and cartel parties. Each of these party models differentiates in various characteristics: party foundation, number of members, and way of leading the election campaigns, but also in ways of financing. This paper describes the above mentioned 4 phases of political parties’ development and 4 phases of parties' finances development; it will be analysed in detail positive and negative sides of each of the models of party financing.
Tank 241-AZ-102 tank characterization plan
International Nuclear Information System (INIS)
Schreiber, R.D.
1995-01-01
The Defense Nuclear Facilities Safety Board has advised the DOE to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The Data Quality Objective (DQO) process was chosen as a tool to be used in the resolution of safety issues. As a result, a revision in the Federal Facilities Agreement and Consent Order (Tri-Party Agreement) milestone M-44 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process ... Development of TCPs by the DQO process is intended to allow users to ensure their needs will be met and that resources are devoted to gaining only necessary information''. This document satisfies that requirement for tank 241-AZ-102 (AZ-102) sampling activities. Tank AZ-102 is currently a non-Watch List tank, so the only DQOs applicable to this tank are the safety screening DQO and the compatibility DQO, as described below. The current contents of Tank AZ-102, as of October 31, 1994, consisted of 3,600 kL (950 kgal) of dilute non-complexed waste and aging waste from PUREX (NCAW, neutralized current acid waste). Tank AZ-102 is expected to have two primary layers. The bottom layer is composed of 360 kL of sludge, and the top layer is composed of 3,240 kL of supernatant, with a total tank waste depth of approximately 8.9 meters
International Nuclear Information System (INIS)
Dmitriyeva, O.; Cantwell, R.; McConnell, M.; Moddel, G.
2012-01-01
Highlights: ► We studied heat produced by hydrogen and deuterium in Pd-impregnated alumina powder. ► Samples were fabricated using light and heavy water isotopes and varied the gas used for loading. ► Incorporation of hydrogen and deuterium influenced the amount of heat released or consumed. ► Pd nanoparticles appear to catalyze hydrogen/deuterium (H/D) exchange chemical reactions. ► Anomalous heating can be accounted for by chemical rather than nuclear reactions. - Abstract: We studied heat production in Pd-impregnated alumina powder in the presence of hydrogen and deuterium gases, investigating claims of anomalous heat generated as a result of nuclear fusion, usually referred to as a low energy nuclear reaction (LENR). By selecting the water isotope used to fabricate the material and then varying the gas used for loading, we were able to influence the amount of heat released or consumed. We suggest that Pd in its nanoparticle form catalyzes hydrogen/deuterium (H/D) exchange reactions in the material. This hypothesis is supported by heat measurements, residual gas analysis (RGA) data, and calculations of energy available from H/D exchange reactions. Based on the results we conclude that the origin of the anomalous heat generated during deuterium loading of Pd-enriched alumina powder is chemical rather than nuclear.
Separation of 103Pd from metal Rhodium by dry distillation
International Nuclear Information System (INIS)
Szuecs, Z.; Takacs, S.
2009-01-01
background also exist. This cyclotron facility is able to do routine irradiation with the necessary energy range (38-25 MeV) and beam intensity (at least 50 μA). Experimental and results. Irradiation of a stack of thin Rh foils was performed to determine the optimal irradiation parameters to avoid side nuclear reactions taking place simultaneously producing contaminating 101,101m,102,102m Rh. radionuclides. After evaluating the gamma-spectra optimal parameters were determined during the second irradiation, producing pure 103 Pd. Two activated Rh foils were transferred to Necsa for further investigation of the separation process of 103 Pd. A series of experiments were carried out using high temperature and high vacuum condition. Separation of 103 Pd was demonstrated after keeping the irradiated Rh foil for 45 hours at 1190 degC and 2x10 -6 torr pressure. Acknowledgements. The work was partly supported by the Hungarian TeT Bilateral Cooperation (OMFB- 00138/2009) and by the South African NRF (UID 68768 )
Oxygen isotope exchange on palladium catalysts
International Nuclear Information System (INIS)
Kravchuk, L.S.; Beschetvertnaya, T.I.; Novorodskij, V.G.; Novikova, M.G.; Zaretskij, M.V.; Valieva, S.V.
1983-01-01
Oxygen heteromolecular isotope exchange on unreduced palladium catalysts, distingushing by metal content is studied. Content of 18 O in gaseous phase is eoual to 46%. Calculations of heteroexchange rates are conducted with decrease of the 18 O in the gaseous phase over solid sample. Method of oxygen thermodesorption has been used to establish that palladium, deposited on γ-Al 2 O 3 during exchange process is in oxidized state; in this case strength of Pd-O bond is determined by content dispersity) of the metal. It is shown that significant increase of exchange rate on the samples with Pd >> 0.5 mass.% content can be induced as by side decomposition reaction of its oxide and corresponding dilution of gaseous mixture by ''light'' oxygen so by possibility of exchange with oxygen of PdO phase
Theory of the isotope effect in superconducting compounds
International Nuclear Information System (INIS)
Culetto, F.J.; Rainer, D.
1978-05-01
We present a theoretical analysis of the isotope effect on the superconducting transition temperature. Our method is to calculate via formal perturbation theory the response of the transition temperature to small changes of the masses of the various constituents of the compound. We discuss the relation between the isotope effect and various more fundamental parameters in strong coupling superconductors. As illustrative examples, we consider the systems Pd-H(D) alloys and the binary Chevrel phase superconductor Mo 6 Se 8 , and show that analysis of the isotope effect can yield useful information concerning interaction mechanisms in these compounds. (orig.)
Development of an inter-atomic potential for the Pd-H binary system.
Energy Technology Data Exchange (ETDEWEB)
Zimmerman, Jonathan A.; Hoyt, Jeffrey John (McMaster University, Hamilton, Ontario, Canada); Leonard, Francois Leonard; Griffin, Joshua D.; Zhou, Xiao Wang
2007-09-01
Ongoing research at Sandia National Laboratories has been in the area of developing models and simulation methods that can be used to uncover and illuminate the material defects created during He bubble growth in aging bulk metal tritides. Previous efforts have used molecular dynamics calculations to examine the physical mechanisms by which growing He bubbles in a Pd metal lattice create material defects. However, these efforts focused only on the growth of He bubbles in pure Pd and not on bubble growth in the material of interest, palladium tritide (PdT), or its non-radioactive isotope palladium hydride (PdH). The reason for this is that existing inter-atomic potentials do not adequately describe the thermodynamics of the Pd-H system, which includes a miscibility gap that leads to phase separation of the dilute (alpha) and concentrated (beta) alloys of H in Pd at room temperature. This document will report the results of research to either find or develop inter-atomic potentials for the Pd-H and Pd-T systems, including our efforts to use experimental data and density functional theory calculations to create an inter-atomic potential for this unique metal alloy system.
An automated system for selective fission product separations; decays of 113-115Pd
International Nuclear Information System (INIS)
Meikrantz, D.H.; Gehrke, R.J.; McIsaac, L.D.; Baker, J.D.; Greenwood, R.C.
1981-01-01
A microcomputer controlled radiochemical separation system has been developed for the isolation and study of fission products with half-lives of approx. >= 10 s. The system is based upon solvent extraction with three centrifugal contactors coupled in series, which provides both rapid and highly efficient separations with large decontamination factors. This automated system was utilized to study the radioactive decays of 113-115 Pd via solvent extraction of the Pd-dimethylglyoxime complex from 252 Cf fission products. As a result of this effort, γ-rays associated with the decay of approx. equal to 90-s sup(113,113m)Pd, 149-s 114 Pd and 47-s 115 Pd have been identified. The isotopic assignments to each of these Pd radioactivities have been confirmed from observation of the growth and decay curves of their respective Ag daughters. In addition, previously unreported Ag γ-rays have been assigned; one to the decay of 69-s 113 Ag, and two to the decay of 19-s 115 Ag. (orig.)
Guzman, R
2000-03-01
Circuit parties are extended celebrations, lasting from a day to a week, primarily attended by gay and bisexual men in their thirties and forties. These large-scale dance parties move from city to city and draw thousands of participants. The risks for contracting HIV during these parties include recreational drug use and unsafe sex. Limited data exists on the level of risk at these parties, and participants are skeptical of outside help because of past criticism of these events. Health care and HIV advocates can promote risk-reduction strategies with the cooperation of party planners and can counsel individuals to personally reduce their own risk. To convey the message, HIV prevention workers should emphasize positive and community-centered aspects of the parties, such as taking care of friends and avoiding overdose.
de Roubin, Antoine
An extension of the atomic mass surface in the region $A \\approx 100$ is performed via mass measurements of the $^{100−102}$Sr and $^{100−102}$Rb isotopes with the ion-trap mass spectrometer ISOLTRAP at CERN-ISOLDE. The first direct mass measurements of $^{102}$Sr and $^{101,102}$Rb are reported here. These measurements confirm the continuation of the region of nuclear deformation with the increase of neutron number, at least as far as $N = 65$. In order to interpret the deformation in the strontium isotopic chain and to determine whether an onset of deformation is present in heavier krypton isotopes, a comparison is made between experimental values and theoretical calculations available in the literature. To complete this comparison, Hartree-Fock-Bogoliubov calculations for even and odd isotopes are also presented, illustrating the competition of nuclear shapes in the region. The development of an electrospray ionization ion source is presented. This source can deliver a large range of isobaric masses ...
DEFF Research Database (Denmark)
Kosiara-Pedersen, Karina
Political parties have as their main assignment the creation of linkage between citizens and government. They provide one of several channels of participation in modern democracies. Yet, the general trend across the Western world is that party membership figures decline. The purpose of this article...... is to report on the state of Danish party membership; the numbers and participation. The claim of the article is that total membership figures hide evidence of membership renewal and increases, and that mere party membership figures are insufficient when evaluating political parties as channels...... of participation. Instead, membership figures at party level as well as the participation of party members need to be taken into account in order to assess parties as channels of participation. This is supported by the analyses reported here which show that even though membership figures are declining, parties...
Energy Technology Data Exchange (ETDEWEB)
Dmitriyeva, O., E-mail: olga.dmitriyeva@colorado.edu [Department of Electrical, Computer, and Energy Engineering, University of Colorado, Boulder, CO 80309-0425 (United States); Coolescence LLC, 2450 Central Ave Ste F, Boulder, CO 80301 (United States); Cantwell, R.; McConnell, M. [Coolescence LLC, 2450 Central Ave Ste F, Boulder, CO 80301 (United States); Moddel, G. [Department of Electrical, Computer, and Energy Engineering, University of Colorado, Boulder, CO 80309-0425 (United States)
2012-09-10
Highlights: Black-Right-Pointing-Pointer We studied heat produced by hydrogen and deuterium in Pd-impregnated alumina powder. Black-Right-Pointing-Pointer Samples were fabricated using light and heavy water isotopes and varied the gas used for loading. Black-Right-Pointing-Pointer Incorporation of hydrogen and deuterium influenced the amount of heat released or consumed. Black-Right-Pointing-Pointer Pd nanoparticles appear to catalyze hydrogen/deuterium (H/D) exchange chemical reactions. Black-Right-Pointing-Pointer Anomalous heating can be accounted for by chemical rather than nuclear reactions. - Abstract: We studied heat production in Pd-impregnated alumina powder in the presence of hydrogen and deuterium gases, investigating claims of anomalous heat generated as a result of nuclear fusion, usually referred to as a low energy nuclear reaction (LENR). By selecting the water isotope used to fabricate the material and then varying the gas used for loading, we were able to influence the amount of heat released or consumed. We suggest that Pd in its nanoparticle form catalyzes hydrogen/deuterium (H/D) exchange reactions in the material. This hypothesis is supported by heat measurements, residual gas analysis (RGA) data, and calculations of energy available from H/D exchange reactions. Based on the results we conclude that the origin of the anomalous heat generated during deuterium loading of Pd-enriched alumina powder is chemical rather than nuclear.
Study on rotational bands in odd-odd nuclei 102,l04Nb by using PSM
International Nuclear Information System (INIS)
Dong Yongsheng; Hu Wentao; Feng Youliang; Wang Jinbao; Yu Shaoying; Shen Caiwan
2012-01-01
The Projected Shell Model (PSM) is used to study the low energy scheme of the neutron-rich normal-deformed isotopes of odd-odd nuclei 102,104 Nb. The quasiparticle configuration is assigned. The theoretical calculations of the energy band of 102,104 Nb could well reproduce the experimental data. It is shown that PSM is a valid method for studying the low energy scheme of heavy nuclei. (authors)
International Nuclear Information System (INIS)
Manenti, Simone; Alí Santoro, María del Carmen; Cotogno, Giulio; Duchemin, Charlotte; Haddad, Ferid; Holzwarth, Uwe; Groppi, Flavia
2017-01-01
Deuteron-induced nuclear reactions for the generation of 103 Pd were investigated using the stacked-foil activation technique on rhodium targets at deuteron energies up to E d = 33 MeV. The excitation functions of the reactions 103 Rh(d,xn) 101,103 Pd, 103 Rh(d,x) 100g,cum,101m,g,102m,g Rh and 103 Rh(d,2p) 103 Ru have been measured, and the Thick-Target Yield for 103 Pd has been calculated.
Studies of rotational structures in the neutron-rich niobium isotopes 101-103
International Nuclear Information System (INIS)
Paffrath, U.
1989-08-01
The aim of this thesis was to study rotational structures in the low-lying levels of the niobium isotopes 101, 102, and 103. This was performed at the recoil separator JOSEF of the Nuclear Research Facility Juelich by studies of the β-decays of the zirconium isotopes 101-103 into their niobium daughters. By γ-γ respectively X-γ coincidence measurements the already existing term schemes of the niobium isotopes should be verified respectively extended and by γ-γ angular-correlation measurements the rotational structures should be studied. The term schemes of the niobium isotopes 101 and 102 could be confirmed in the framework of the performed experiments while the level scheme of the 103 Nb could be essentially extended. From the X-γ coincidence measurement for a plurality of γ transitions the conversion coefficients and by this the dominant multipolarities could be determined. With these conversion coefficients then also the mixing parameters were calculated. These data together with the results from the γ-γ angular-correlation experiments led to a fixing concerning the spins and parities at a series of levels in all three niobium isotopes. (orig./HSI) [de
Authentication method for authenticating a first party to a second party
2014-01-01
An authentication system and method is presented for authenticating a first party to a second party, where an operation is performed on condition that the authentication succeeds. The authentication method verifies whether the first party is authenticated. If the first party is not authenticated,
International Nuclear Information System (INIS)
Stuchbery, A.E.; Ryan, G.C.; Bolotin, H.H.; Sie, S.H.
1980-01-01
The velocity-dependence of the magnitude of the enchanced dynamic hyperfine magnetic field (EDF) manifest at nuclei of 108 Pd ions swiftly recoiling through thin magnetized Fe has been investigated at ion velocities higher than have heretofore been examined for the heavier nuclides (i.e., at initial recoil velocities (v/Zv 0 )=0.090 and 0.160, v 0 =c/137). These results for 108 Pd, when taken in conjunction with those of prior similar measurements for 106 Pd at lower velocities, and fitted to a velocity dependence for the EDF, give for the Pd isotopes over the extended velocity range 1.74 0 )<=7.02, p=0.41+-0.15; a result incompatible with previous attributions of a linear velocity dependence for the field
A thermodynamic description of the system Pd-Rh-H-D-T
Energy Technology Data Exchange (ETDEWEB)
Joubert, J.-M., E-mail: jean-marc.joubert@icmpe.cnrs.fr [Chimie Metallurgique des Terres Rares, Institut de Chimie et des Materiaux Paris-Est, CNRS, Universite Paris-Est, UMR 7182, 2-8 Rue Henri Dunant, F-94320 Thiais (France); Thiebaut, S. [CEA/DAM/Valduc, F-21120 Is sur Tille (France)
2011-02-15
The quinary system D-H-Pd-Rh-T has been described thermodynamically by the CALPHAD approach. Previous descriptions of the binary subsystems have been used. To model the high pressure data an equation of state for the gases D{sub 2} and T{sub 2} compatible with the CALPHAD approach has been obtained similar to that previously used for H{sub 2}. A complete literature search has been undertaken for the three ternary systems H-Pd-Rh, D-Pd-Rh and Pd-Rh-T and the most significant experimental data have been selected for a thermodynamic assessment of these systems. In order to complement the available data, pressure-composition curves have been measured at different temperatures for the two last systems in the present work. Calculations and optimization of the system under para-equilibrium conditions, i.e. in pseudo-binary systems (Pd,Rh)-H, (Pd,Rh)-D or (Pd,Rh)-T, have been achieved using a pseudo-atom describing the Pd-Rh solid solution. This special method allows the presence of a miscibility gap in the binary metallic system to be dealt with. We show that a simple combination of the binary systems alone is unable to properly describe these ternary systems and that ternary interaction parameters have to be introduced. The binary and ternary systems may then be combined to perform calculations in the quinary D-H-Pd-Rh-T system. It is believed that extrapolation in systems containing different isotopes are fairly accurate provided that the so-called Toop model is used.
New data on some short-lived isotopes of ruthenium and rhodium
International Nuclear Information System (INIS)
Baumgartner, F.; Plata Bedmar, A.
1961-01-01
Ru and Rd isotopes with mass numbers 107 and 108 and 1 09Rh, has been obtained from fission products. 1 07 Ru has also been prepared by the nuclear process 1 10Pd (n,α) 1 07 Ru. Beta and gamma energies of these nuclides have been studied spectropolarimetry and the gamma lines found for 1 07 Ru and 1 08Ru ( and daughter) have been very useful for the precise determination of their half-lives. 1 09Rh has been identified through its daughter 1 09Pd in the mixture of rhodium isotopes from fission products. Irradiation of natural palladium with fast neutrons has lead to an activity that may only be attributed to 1 10rh. Neither its half life nor its decay energy have been possible to determine accurately. (Author) 1 refs
Mechanistic evidence for a ring-opening pathway in the Pd-catalyzed direct arylation of benzoxazoles
DEFF Research Database (Denmark)
Sanchez, R.S.; Zhuravlev, Fedor
2007-01-01
The direct Pd-catalyzed arylation of 5-substituted benzoxazoles, used as a mechanistic model for 1,3-azoles, was investigated experimentally and computationally. The results of the primary deuterium kinetic isotope effect, Hammett studies, and H/D exchange were shown to be inconsistent with the r......The direct Pd-catalyzed arylation of 5-substituted benzoxazoles, used as a mechanistic model for 1,3-azoles, was investigated experimentally and computationally. The results of the primary deuterium kinetic isotope effect, Hammett studies, and H/D exchange were shown to be inconsistent...... with the rate-limiting electrophilic or concerted palladation. A mechanism, proposed on the basis of kinetic and computational studies, includes generation of isocyanophenolate as the key step. The DFT calculations suggest that the overall catalytic cycle is facile and is largely controlled by the C-H acidity...
Party rules, party resources and the politics of parliamentary democracies
DEFF Research Database (Denmark)
Poguntke, Thomas; Scarrow, Susan; Webb, Paul
2016-01-01
, then investigate what it tells us about contemporary party organization in these countries, focusing on parties’ resources, structures and internal decision-making. We examine organizational patterns by country and party family, and where possible we make temporal comparisons with older data sets. Our analyses...... suggest a remarkable coexistence of uniformity and diversity. In terms of the major organizational resources on which parties can draw, such as members, staff and finance, the new evidence largely confirms the continuation of trends identified in previous research: that is, declining membership......, but enhanced financial resources and more paid staff. We also find remarkable uniformity regarding the core architecture of party organizations. At the same time, however, we find substantial variation between countries and party families in terms of their internal processes, with particular regard to how...
Campaigning on behalf of the party? Party constraints on candidate campaign personalisation
DEFF Research Database (Denmark)
Bøggild, Troels; Pedersen, Helene Helboe
2017-01-01
This article analyses what makes political candidates run a party-focused or personalised election campaign. Prior work shows that candidates face incentives from voters and the media to personalise their campaign rhetoric and promises at the expense of party policy. This has raised concerns about...... that party control over the candidate nomination process and campaign financing constrains most political candidates in following electoral incentives for campaign personalisation. Using candidate survey data from the 2009 EP election campaign in 27 countries, we show how candidates from parties in which...... party officials exerted greater control over the nomination process and campaign finances were less likely to engage in personalised campaigning at the expense of the party programme. The findings imply that most parties, as central gatekeepers and resource suppliers, hold important control mechanisms...
Institute of party leadership system of the party creation of modern Ukraine
Directory of Open Access Journals (Sweden)
I. O. Lavrenyuk
2015-06-01
Full Text Available This article based on the study of the theory and practice of partybuilding in Ukraine examines the role of party leader in the political process and the establishment of parties, implementation of the political power, the development of political consciousness and the formation of modern political elite of our country. It is alleged that party leader – a reputable, recognized in its political environment, the person chosen to lead the party and the ability of citizens to consolidate around a common goal, most effectively represent the interests of a particular social group. It is stated that the defining feature of the phenomenon of party leadership is that under conditions of constant political development and irreversibility of democratic transformations in Ukraine part of leaders of political parties in fact is a powerful talent pool for senior government officials, local government agencies and other administrative institutions. The process of creating games as an integral part of the political process is characterized by a certain way, the mechanism of action of consciousness and culture in the public sphere, which deals with political parties. Regularities component of modern political elite of the party elite acts governing the range of persons in the political party headed by its leader that are directly involved in strategic decisionmaking, policy formulation of this power, as well as its participation in the political process. We study the classification model of national political parties and the institutions of the party leadership. It is proposed to assess the level of correlation of the party leaders and the general dynamics of the civil society in Ukraine. It is stated that at this time a fundamental change in Ukrainian Party elite has not happened yet. However, there is a long evolution of the institute of the party leadership – a rather difficult process of internal and external, objective and subjective, economic
International Nuclear Information System (INIS)
Gomez Jaen, Juan Pedro
1973-01-01
The study of diffusion in concentrated alloys presents two main aspects: 1) The search for an adequate theoretical framework; 2) The carrying out of experiments with a view towards verification of the theory. From the theoretical standpoint it is shown that the atomic theory of diffusion, as formulated by MANNING, can be linked to the phenomenological theory of HOWARD and LIDIARD. Thus it is seen that the vacancy flow effect is really a cross correlation effect and, that the phenomenological ONSAGER coefficients can be expressed as functions of the correlation factors. From the experimental side, a number of experiments were performed on the Fe - Pd System, including experiments on interdiffusion, the KIRKENDALL effect, diffusion of Fe 59 and Pd 103 isotopes in homogeneous Fe - Pd alloys, and the diffusion of these isotopes in the concentration gradient. We introduce a perfected method for taking account of the changes in the molar volume of the alloy expressed as a function of the concentration, throughout the diffusion process. The experiments enabled us to obtain the different diffusion coefficients, correlation factors, and partial mobilities, thus allowing a precise knowledge of the Fe - Pd solid state diffusion system.(author) [fr
DEFF Research Database (Denmark)
Pedersen, Helene Helboe
2012-01-01
What parties want – policy, office or votes - is important to how they represent their voters, how they make strategic decisions and how they respond to external changes in society. What parties strive to accomplish is simply important to what they do. Moreover, our knowledge of what parties want...... is important to what we expect them to do. For instance, coalition theory assumes that parties have homogeneous goals, and hence are equally likely to join coalitions given the same circumstances. However, this article investigates this basic assumption of party goal homogeneity and finds that party goals do...
Low Membership in Czech Political Parties: Party Strategy or Structural Determinants?
Czech Academy of Sciences Publication Activity Database
Linek, Lukáš; Pecháček, Š.
2007-01-01
Roč. 23, č. 2 (2007), s. 259-275 ISSN 1352-3279 R&D Projects: GA MPS 1J004/04-DP1 Institutional research plan: CEZ:AV0Z70280505 Keywords : political parties * party membership * antiparty sentiments * party organization Subject RIV: AD - Politology ; Political Sciences
International Nuclear Information System (INIS)
Arzumanov, A.; Berger, V.; Borissenko, A.; Gorodisskaya, N.; Ilmatov, I.; Knyazev, A.; Koptev, V.; Lyssukhin, S.; Platov, A.; Sychikov, G.; Zheltov, D.
2004-01-01
The objectives of the present work are to increase thermal stability of cyclotron targets for production of Tl-201 isotope, increase Tl-203 regeneration rate at radiochemical reprocessing of the targets and develop production technology for radiochemical sources based on Rd-103 isotope. Electrochemical coating of copper substrate with Tl increased the beam current at target irradiation from 100 μA to 125 μA. Further increase of the beam current results in sharp decrease of target stability time at irradiation to 15 min at beam current 150 μA. Thermal calculations and tests at the electron-beam stand predict satisfactory stability at such currents. The discrepancy with the irradiation results has not been explained. More accurate specification of regimes for Tl-203 electrochemical recovery from irradiated targets and better matching of the electrolyte composition made it possible to increase the recovery rate up to 99.5%. Before the present Project, the INP had no experience in production of radioactive sources based on Pd-103. Thermo-diffusion extraction of Pd-103 from irradiated rhodium foil has been chosen as a technology-defining method. The process assures good extraction rate and high purity of extracted isotope. Production of Pd-103 sources based on this technology is much simpler compared to the same based on electrochemical processes. (author)
Gholamreza Raisali; Mahdi Sadeghi; Vahideh Ataeinia; Arjang Shahvar; Maryam Ghasemi Ghonchehnazi
2008-01-01
Introduction: The use of low energy isotopes such as 103 Pd in brachytherapy for the treatment of cancers such as prostate, eye, head, neck, breast and cervix is increasing. In this regard, different models of Pd- 103 seeds have been designed and manufactured at the Agricultural, Medical and Industrial Research School (AMIRS) of Atomic Energy Organization of Iran. In this research, the dosimetric parameters of the second model of Pd-103 seed manufactured at AMIRS have been ca...
International Nuclear Information System (INIS)
Heinze, S.
2000-01-01
The objective of the study is to enrich waters of poor tritium concentration, by electrolysis in the same time of an hydrogen emission of low activity. In this framework the hydrogen electrochemical permeation threw Pd-Ag alloy membranes has been used. The first part of the study concerns the hydrogen and the deuterium diffusion threw these membranes. The activation and the thermal treatments influence have been studied. A relation between the membrane microstructure and the diffusion mechanism has been proposed. The second part of the study is devoted to the hydrogen gate mechanism determination in the membrane by impedance spectroscopy. The last part concerns the determination of the isotopic separation factor hydrogen-deuterium. Experimental results agree the calculated theoretical data. The operation of an operational membrane cell has been simulated and the process feasibility has been proved. (A.L.B.)
Parties heed (with caution): Public knowledge of and attitudes towards party finance in Britain.
vanHeerde-Hudson, Jennifer; Fisher, Justin
2013-01-01
Despite comprehensive reform ( Political Parties, Elections and Referendums Act ) and recent review (Phillips Review in 2007) of party finance in Britain, public opinion of party finance remains plagued by perceptions of corruption, undue influence from wealthy donors, carefree and wasteful spending and, more generally, from the perception that there is just 'too much money' in politics. In this article we argue that knowledge of and attitudes to party finance matter, not least because advocates of reform have cited public opinion as evidence for reform. However, because attitudes to party finance are part of a broader attitudinal structure, opinion-led reforms are unlikely to succeed in increasing public confidence. Using data generated from YouGov's online panel (N=2,008), we demonstrate that the public know little of the key provisions regulating party finance and attitudes to party finance can be explained along two underlying dimensions - Anti-Party Finance and Reformers . As such, we consider whether parties and politicians should be freed from the constraints of public opinion in reforming party finance.
International Nuclear Information System (INIS)
Morawek, W.
1991-07-01
In the framework of this thesis the excitation functions of the systems 110 Pd + 110 Pd and 110 Pd + 104 Ru could be measured. The evaporation-residual-nucleus cross sections is deviating from lighter systems dominated by channels, which arise from evaporation of α particles. In the reaction 110 Pd + 110 Pd no xn channels were observed. In comparison to other reactions qualitatively a strong fusion hindrance of this system is shown. (orig./HSI) [de
Julien, Maxime; Nun, Pierrick; Höhener, Patrick; Parinet, Julien; Robins, Richard J; Remaud, Gérald S
2016-01-15
In forensic environmental investigations the main issue concerns the inference of the original source of the pollutant for determining the liable party. Isotope measurements in geochemistry, combined with complimentary techniques for contaminant identification, have contributed significantly to source determination at polluted sites. In this work we have determined the intramolecular (13)C profiles of several molecules well-known as pollutants. By giving additional analytical parameters, position-specific isotope analysis performed by isotope ratio monitoring by (13)C nuclear magnetic resonance (irm-(13)C NMR) spectrometry gives new information to help in answering the major question: what is the origin of the detected contaminant? We have shown that isotope profiling of the core of a molecule reveals both the raw materials and the process used in its manufacture. It also can reveal processes occurring between the contamination site 'source' and the sampling site. Thus, irm-(13)C NMR is shown to be a very good complement to compound-specific isotope analysis currently performed by mass spectrometry for assessing polluted sites involving substantial spills of pollutant. Copyright © 2015 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Akulov, G.P.; Snetkova, E.V.; Kayumov, V.G.; Kaminskij, Yu.L.
1990-01-01
Reaction rate constants of catalytic (PdO/BaSO 4 (Al 2 O 3 ) catalyst) heterogeneous protium - tritium isotopic exchange D - [1- 3 H] of carbohydrates and gaseous oxygen have been measured. It is ascertained that the rate of isotopic exchange depends on the nature of carbohydrate, catalyst, buffer and medium acidity. The value of concentration of carbohydrate acyclic forms plays the determining role in the process
International Nuclear Information System (INIS)
Clark, S.
1997-01-01
The importance of Canada's natural gas industry to remain competitive on a global level was discussed. Third party processing is a tool that the Canadian gas industry can use to overcome the relative disadvantage of smaller, and therefore more expensive, gas processing plants in Canada, and to maintain, and even improve, its competitive position vis-a-vis its US counterparts. The principal role of a third party processor is to provide midstream services such as raw gas gathering, field compression, gas processing, sales gas transmission, and natural gas liquids fractionation. Some third party processors also provide marketing services. Third party processors add value to the gas producer by reducing risk, reducing cost, improving reliability, and improving netbacks. The many variables involved in determining the economic viability of third party processing, including the quantity and deliverability of the raw resource, facility capacity, capital investment, operating costs, technology, fee structures, operational reliability, and speed, among others, were examined and the significance of each variable was explained
Morgenstern, Matthis; Li, Zhongze; Li, Zhigang; Sargent, James D
2017-01-01
To test whether exposure to party-related alcohol advertising is associated with drinking behavior in a national US sample of adolescents and young adults, independently of exposure to other alcohol advertising. Longitudinal telephone- and web-based surveys conducted in 2011 and 2013. All regions of the United States, participants selected via mixed-mode random-digit-dial landline and cellphone frames. A sample of 705 respondents who never had a whole drink of alcohol at baseline (mean age 16.9 years, 53.3% female) and a sample of 1036 who never had six or more drinks during one drinking occasion (mean age 17.4 years, 55.8% female). Outcome measures were onset of alcohol use and binge drinking during the study interval. Primary predictor was exposure to television alcohol advertising, operationalized as contact frequency and brand recall for 20 randomly selected alcohol advertisements. Independent post-hoc analyses classified all advertisements as 'party' or 'non-party' advertisements. Socio-demographics, sensation-seeking, alcohol expectancies and alcohol use of friends and family were assessed as covariates. Onset rates for having the first whole drink of alcohol and for first binge drinking were 49.2% and 29.5%, respectively. On average, approximately half (median = 10.2) of the 20 alcohol advertisements in each individual survey were 'party' advertisements. If both types of exposures ('party' and 'non-party') were included in the regression model, only 'party' exposure remained a significant predictor of alcohol use onset [adjusted odds ratio (AOR) = 19.17; 95% confidence interval (CI) = 3.72-98.79] and binge drinking onset (AOR = 3.87; 95% CI = 1.07-13.99) after covariate control. Adolescents and young adults in the United States appear to have higher rates of alcohol use and binge drinking onset if they have higher exposure to alcohol advertisements using a partying theme, independently of the amount of exposure to alcohol advertisements with non-party
Directory of Open Access Journals (Sweden)
Orlović Slobodan P.
2015-01-01
Full Text Available In this work the author refers to some legal and political questions in connection with green political parties. Those questions cover: the ideology of green political parties, their number and influence, both in general and in Serbia. The first part of work is generally speaking about political parties - their definition, ideology, role and action. Main thesis in this work is that green political parties, by their appearance, were something new on the political scene. But quickly, because of objective and subjective reasons, they were changing original ideas and were beginning to resemble to all other political parties. In this way, they lost their vanguard and political alternativeness.
International Nuclear Information System (INIS)
Chinfang Chai; Yongzhong Liu; Xueying Mao
1996-01-01
The isotopic abundance ratios of 190 Os/ 184 Os and 96 Ru/ 102 Ru for the metal phases of the Jilin and Taonan stone meteorites were determined by pretreatment and radiochemical neutron activation analysis. All experimental factors affecting Os and Ru isotopic ratios were discussed, including sampling, standard, irradiation, separation and counting. The statistical errors of measurements for the 199 Os/ 184 Os ratio can be controlled within 1%. The experimental results indicate that the statistically significant anomalies of the 190 Os/ 184 Os and 96 Ru/ 102 Ru ratios have not been found relative to the terrestrial Os and Ru standards. (author). 6 refs., 1 fig., 5 tabs
Political Parties and Innovation
DEFF Research Database (Denmark)
Bischoff, Carina Saxlund; Christiansen, Flemming Juul
2017-01-01
parties themselves as well their impact on potentially innovative public decisions. One major expectation is that hierarchical parties with centralized leadership make more efficient decisions but that sustainable innovation outcomes promoted by collaborative efforts are easier to obtain for decentralized...... political parties with participatory internal democratic processes....
Political Market Orientation and Strategic Party Postures in Danish Political Parties
DEFF Research Database (Denmark)
Ormrod, Robert P.; Henneberg, Stephan
2011-01-01
Purpose – This paper investigates the relationship between the strategic postures and political market orientation profile of two Danish parties. Profile stability at the organisational level is used as a control variable. Design/methodology/approach – The strategic political postures of two Danish...... parties are derived using a self-typing study. Based on configuration theory, ideal organisational profiles to implement these studies are juxtaposed with the actual political market orientation profile for each party, gained from two datasets analysed using Partial Least Squares. Member activity levels...... Ideologist. Thus, Party A exhibits a mismatch between strategic orientation and implemented organisational profile, based on configuration theory. The results were generally stable across political activity levels. Originality/value – The study contributes to understanding the concept of market orientation...
Intra-party democracy beyond aggregation
DEFF Research Database (Denmark)
Wolkenstein, Fabio
2016-01-01
, discussing several functions intra-party deliberation is said to serve in the democratic theory literature. It then goes on to explore the deliberative credentials of political discussion between party members, drawing on group interviews with party members in two Social Democratic parties in Germany...
Separation of boron isotopes using NMG type anion exchange resin
International Nuclear Information System (INIS)
Itagaki, Takaharu; Kosuge, Masao; Fukuda, Junji; Fujii, Yasuhiko.
1992-01-01
Ion exchange separation of boron isotopes (B-10 and B-11) has been studied by using a special boron selective ion exchange resin; NMG (n-methyl glucamine)-type anion exchange resin. The resin has shown a large isotope separation coefficient of 1.02 at the experimental conditions of temperature, 80degC, and boric acid concentration, 0.2 M (mole/dm 3 ). Enriched B-10 (92%) was obtained after the migration of 1149 m by a recyclic operation of ion exchange columns in a merry-go-round method. (author)
CO-induced Pd segregation and the effect of subsurface Pd on CO adsorption on CuPd surfaces
International Nuclear Information System (INIS)
Padama, A A B; Villaos, R A B; Albia, J R; Diño, W A; Nakanishi, H; Kasai, H
2017-01-01
We report results of our study on the adsorption of CO on CuPd surfaces with bulk stoichiometric and nonstoichiometric layers using density functional theory (DFT). We found that the presence of Pd atoms in the subsurface layer promotes the adsorption of CO. We also observed CO-induced Pd segregation on the CuPd surface and we attribute this to the strong CO–Pd interaction. Lastly, we showed that the adsorption of CO promotes Pd–Pd interaction as compared to the pristine surface which promotes strong Cu–Pd interaction. These results indicate that CO adsorption on CuPd surfaces can be tuned by taking advantage of the CO-induced segregation and by considering the role of subsurface Pd atoms. (paper)
Basal cell carcinoma: PD-L1/PD-1 checkpoint expression and tumor regression after PD-1 blockade.
Lipson, Evan J; Lilo, Mohammed T; Ogurtsova, Aleksandra; Esandrio, Jessica; Xu, Haiying; Brothers, Patricia; Schollenberger, Megan; Sharfman, William H; Taube, Janis M
2017-01-01
Monoclonal antibodies that block immune regulatory proteins such as programmed death-1 (PD-1) have demonstrated remarkable efficacy in controlling the growth of multiple tumor types. Unresectable or metastatic basal cell carcinoma, however, has largely gone untested. Because PD-Ligand-1 (PD-L1) expression in other tumor types has been associated with response to anti-PD-1, we investigated the expression of PD-L1 and its association with PD-1 expression in the basal cell carcinoma tumor microenvironment. Among 40 basal cell carcinoma specimens, 9/40 (22%) demonstrated PD-L1 expression on tumor cells, and 33/40 (82%) demonstrated PD-L1 expression on tumor-infiltrating lymphocytes and associated macrophages. PD-L1 was observed in close geographic association to PD-1+ tumor infiltrating lymphocytes. Additionally, we present, here, the first report of an objective anti-tumor response to pembrolizumab (anti-PD-1) in a patient with metastatic PD-L1 (+) basal cell carcinoma, whose disease had previously progressed through hedgehog pathway-directed therapy. The patient remains in a partial response 14 months after initiation of therapy. Taken together, our findings provide a rationale for testing anti-PD-1 therapy in patients with advanced basal cell carcinoma, either as initial treatment or after acquired resistance to hedgehog pathway inhibition.
Political Market Orientation and Strategic Party Postures in Danish Political Parties
DEFF Research Database (Denmark)
Ormrod, Robert P.; Henneberg, Stephan
2011-01-01
Purpose – This paper investigates the relationship between the strategic postures and political market orientation profile of two Danish parties. Profile stability at the organisational level is used as a control variable. Design/methodology/approach – The strategic political postures of two Danish...... are used to control for organisational stability. Findings – The self-typing study revealed that Party A was perceived to follow a Relationship Builder posture, and Party B a Convinced Ideologist posture. However, both market orientation profiles resembled the organisational structures of a Convinced...... in the political sphere. More specifically it empirically links political market orientation as an issue of political marketing implementation on the one hand, and strategic postures of parties as a strategic issue on the other, following a configuration theory logic. Research limitations...
Book Review: Training the Party: Party Adaptation and Elite Training in Reform-era China
DEFF Research Database (Denmark)
Brødsgaard, Kjeld Erik
2016-01-01
Review of: Training the Party: Party Adaptation and Elite Training in Reform-era China. Charlotte P. Lee . Cambridge: Cambridge University Press, 2015. xii + 251 pp. $99.99. ISBN 978-1-107-09063-7......Review of: Training the Party: Party Adaptation and Elite Training in Reform-era China. Charlotte P. Lee . Cambridge: Cambridge University Press, 2015. xii + 251 pp. $99.99. ISBN 978-1-107-09063-7...
Isotope and Patient Age Predict for PSA Spikes After Permanent Prostate Brachytherapy
International Nuclear Information System (INIS)
Bostancic, Chelsea; Merrick, Gregory S.; Butler, Wayne M.; Wallner, Kent E.; Allen, Zachariah; Galbreath, Robert; Lief, Jonathan; Gutman, Sarah E.
2007-01-01
Purpose: To evaluate prostate-specific antigen (PSA) spikes after permanent prostate brachytherapy in low-risk patients. Methods and Materials: The study population consisted of 164 prostate cancer patients who were part of a prospective randomized trial comparing 103 Pd and 125 I for low-risk disease. Of the 164 patients, 61 (37.2%) received short-course androgen deprivation therapy. The median follow-up was 5.4 years. On average, 11.1 post-treatment PSA measurements were obtained per patient. Biochemical disease-free survival was defined as a PSA level of ≤0.40 ng/mL after nadir. A PSA spike was defined as an increase of ≥0.2 ng/mL, followed by a durable decline to prespike levels. Multiple parameters were evaluated as predictors for a PSA spike. Results: Of the 164 patients, 44 (26.9%) developed a PSA spike. Of the 46 hormone-naive 125 I patients and 57 hormone-naive 103 Pd patients, 21 (45.7%) and 8 (14.0%) developed a PSA spike. In the hormone-naive patients, the mean time between implantation and the spike was 22.6 months and 18.7 months for 125 I and 103 Pd, respectively. In patients receiving neoadjuvant androgen deprivation therapy, the incidence of spikes was comparable between isotopes ( 125 I 28.1% and 103 Pd 20.7%). The incidence of spikes was substantially different in patients 125 I and/or <65 years of age. Differences in isotope-related spikes are most pronounced in hormone-naive patients
Molecular mechanism of PD-1/PD-L1 blockade via anti-PD-L1 antibodies atezolizumab and durvalumab.
Lee, Hyun Tae; Lee, Ju Yeon; Lim, Heejin; Lee, Sang Hyung; Moon, Yu Jeong; Pyo, Hyo Jeong; Ryu, Seong Eon; Shin, Woori; Heo, Yong-Seok
2017-07-17
In 2016 and 2017, monoclonal antibodies targeting PD-L1, including atezolizumab, durvalumab, and avelumab, were approved by the FDA for the treatment of multiple advanced cancers. And many other anti-PD-L1 antibodies are under clinical trials. Recently, the crystal structures of PD-L1 in complex with BMS-936559 and avelumab have been determined, revealing details of the antigen-antibody interactions. However, it is still unknown how atezolizumab and durvalumab specifically recognize PD-L1, although this is important for investigating novel binding sites on PD-L1 targeted by other therapeutic antibodies for the design and improvement of anti-PD-L1 agents. Here, we report the crystal structures of PD-L1 in complex with atezolizumab and durvalumab to elucidate the precise epitopes involved and the structural basis for PD-1/PD-L1 blockade by these antibodies. A comprehensive comparison of PD-L1 interactions with anti-PD-L1 antibodies provides a better understanding of the mechanism of PD-L1 blockade as well as new insights into the rational design of improved anti-PD-L1 therapeutics.
Gendering transnational party politics
DEFF Research Database (Denmark)
Kantola, Johanna; Rolandsen-Agustín, Lise
2016-01-01
research traditions, we build toward an analytical framework to study gender and transnational party politics. Our empirical analysis focuses on two policy issues, the economic crisis and the sexual and reproductive health and rights, analyzing European Parliament reports, debates and voting on the issues...... from 2009 to 2014. By focusing on gender equality constructions and the way in which consensus and contestation are built around them within and between party groups, we argue that shared constructions about gender equality are issue specific and change over time. Consensus breaks down along the left......In this article, we analyze transnational party politics in the European Union from a gender perspective. This is a subject that has been neglected both by mainstream European studies on party politics and by gender scholars who work on political parties. Drawing on the insights of these two...
Introduction to isotopic shifts and transmutations observed in LENR experiments
International Nuclear Information System (INIS)
Srinivasan, Mahadeva
2015-01-01
This article presents a brief introduction to the topic of transmutation reactions which occur in a variety of LENR configurations wherein the 'host metal' nuclei (Pd, Ni, Ti, etc.) interact with the loaded deuterium or hydrogen nuclei, resulting in the formation of new stable elements or isotopes not present in the system prior to the experimental run. (author)
16 CFR 1507.11 - Party poppers.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Party poppers. 1507.11 Section 1507.11... FIREWORKS DEVICES § 1507.11 Party poppers. Party poppers (also known by other names such as “Champagne Party Poppers,” and “Party Surprise Poppers,”) shall not contain more than 0.25 grains of pyrotechnic...
Todor, Dorin A; Barani, Igor J; Lin, Peck-Sun; Anscher, Mitchell S
2011-09-01
To compare the ability of single- and dual-isotope prostate seed implants to escalate biologically effective dose (BED) to foci of disease while reducing prescription dose to the prostate. Nine plans, using 125I, 103Pd, and 131Cs alone and in combination were created retrospectively for 2 patients. Ultrasound and MRI/MRS datasets were used for treatment planning. Voxel-by-voxel BED was calculated for single- and dual-isotope plans. Equivalent uniform BED (EUBED) was used to compare plans. The MRS-positive planning target volumes (PTVi) were delineated along with PTV (prostate+5 mm), rectum, and urethra. Single-isotope implants, prescribed to conventional doses, were generated to achieve good PTV coverage. The PTVi were prospectively used to generate implants using mixtures of isotopes. For mixed-radioisotope implants, we also explored the impact on EUBED of lowering prescription doses by 15%. The EUBED of PTVi in the setting of primary 125I implant increased 20-66% when 103Pd and 131Cs were used compared with 125I boost. Decreasing prescription dose by 15% in mixed-isotope implants results in a potential 10% reduction in urethral EUBED with preservation of PTV coverage while still boosting PTVi (up to 80%). When radiobiologic parameters corresponding to more-aggressive disease are assigned to foci, faster-decaying isotopes used in mixed implants have the potential to preserve the equivalent biological effect of mono-isotope implants considering less-aggressive disease distributed in the entire prostate. This is a hypothesis-generating study proposing a treatment paradigm that could be the middle ground between whole-gland irradiation and focal-only treatment. The use of two isotopes concurrent with decreasing the minimal peripheral dose is shown to increase EUBED of selected subvolumes while preserving the therapeutic effect at the level of the gland. Copyright © 2011 Elsevier Inc. All rights reserved.
Cho, Jong Ho; Zhou, Wei; Choi, Yoon-La; Sun, Jong-Mu; Choi, Hyejoo; Kim, Tae-Eun; Dolled-Filhart, Marisa; Emancipator, Kenneth; Rutkowski, Mary Anne; Kim, Jhingook
2018-01-01
Data are limited on programmed death ligand 1 (PD-L1) expression in epidermal growth factor receptor ( EGFR )-mutant non-small cell lung cancer (NSCLC). We retrospectively evaluated the relationship between PD-L1 expression and recurrence-free survival (RFS) and overall survival in 319 patients with EGFR -mutant NSCLC who were treated at Samsung Medical Center from 2006 to 2014. Membranous PD-L1 expression on tumor cells was measured using the PD-L1 IHC 22C3 pharmDx antibody and reported as tumor proportion score (TPS). Kaplan-Meier methods, log-rank test, and Cox proportional hazards models were used for survival analysis. All patients had ≥1 EGFR mutation-54% in exon 19 and 39% in exon 21. Overall, 51% of patients had PD-L1-positive tumors. The prevalence of PD-L1 positivity was higher among patients with stages II-IV versus stage I disease (64% vs. 44%) and among patients with other EGFR mutations (75%) than with L858R mutation (39%) or exon 19 deletion (52%). PD-L1 positivity was associated with shorter RFS, with an adjusted hazard ratio of 1.52 (95% confidence interval [CI], 0.81 to 2.84; median, 18 months) for the PD-L1 TPS ≥ 50% group, 1.51 (95% CI, 1.02 to 2.21; median, 31 months) for the PD-L1 TPS 1%-49% group, and 1.51 (95% CI, 1.05 to 2.18) for the combined PD-L1-positive groups (TPS ≥ 1%) compared with the PD-L1-negative group (median, 35 months). PD-L1 expression is associated with disease stage and type of EGFR mutation. PD-L1 positivity might be associated with worse RFS among patients with surgically treated EGFR -mutant NSCLC.
Multi-party semi-quantum key distribution-convertible multi-party semi-quantum secret sharing
Yu, Kun-Fei; Gu, Jun; Hwang, Tzonelih; Gope, Prosanta
2017-08-01
This paper proposes a multi-party semi-quantum secret sharing (MSQSS) protocol which allows a quantum party (manager) to share a secret among several classical parties (agents) based on GHZ-like states. By utilizing the special properties of GHZ-like states, the proposed scheme can easily detect outside eavesdropping attacks and has the highest qubit efficiency among the existing MSQSS protocols. Then, we illustrate an efficient way to convert the proposed MSQSS protocol into a multi-party semi-quantum key distribution (MSQKD) protocol. The proposed approach is even useful to convert all the existing measure-resend type of semi-quantum secret sharing protocols into semi-quantum key distribution protocols.
Anti-tumor immunotherapy by blockade of the PD-1/PD-L1 pathway with recombinant human PD-1-IgV.
Zhang, C; Wu, S; Xue, X; Li, M; Qin, X; Li, W; Han, W; Zhang, Y
2008-01-01
Blockade of the programmed death-1 (PD-1)/PD-ligand 1 (PD-L1) pathway can delay tumor growth and prolong the survival of tumor-bearing mice. The extracellular immunoglobulin (Ig) V domain of PD-1 is important for the interaction between PD-1 and PD-L1, suggesting that PD-1-IgV may be a potential target for anti-tumor immunotherapy. The extracellular sequence of human PD-1-IgV (hPD-1-IgV) was expressed in Escherichia coli and purified. The anti-tumor effect of hPD-1-IgV on tumor-bearing mice was tested. hPD-1-IgV recombinant protein could bind PD-L1 at molecular and cellular levels and enhance Cytotoxic T Lymphocyte (CTL) activity and anti-tumor effect on tumor-bearing mice in vivo. The percentage of CD4(+)CD25(+) T cells in tumor-bearing mice was decreased compared with control mice after administration of the recombinant protein. Our results suggest that inhibition of the interaction between PD-1 and PD-L1 by hPD-1-IgV may be a promising strategy for specific tumor immunotherapy.
DEFF Research Database (Denmark)
Petersen, Michael Bang; Skov, Martin; Serritzlew, Søren
2013-01-01
. As part of the latter processes, the presence of party cues would make individuals engage in effortful motivated reasoning to produce arguments for the correctness of their party’s position. Following psychological research, we use response latency to measure processing effort and, in support......Extant research in political science has demonstrated that citizens’ opinions on policies are influenced by their attachment to the party sponsoring them. At the same time, little evidence exists illuminating the psychological processes through which such party cues are filtered. From...... the psychological literature on source cues, we derive two possible hypotheses: (1) party cues activate heuristic processing aimed at minimizing the processing effort during opinion formation, and (2) party cues activate group motivational processes that compel citizens to support the position of their party...
Partis islamistes et démocratisation : expérience du Parti de la ...
International Development Research Centre (IDRC) Digital Library (Canada)
Partis islamistes et démocratisation : expérience du Parti de la justice et du développement (Turquie). En Turquie, les élections de novembre 2002 ont été remportées par un nouveau parti politique d'orientation islamiste, l'AKP, qui détient environ les deux tiers des sièges au Parlement. La victoire de l'AKP traduit ...
DEFF Research Database (Denmark)
Demant, Jakob; Østergaard, Jeanette
2007-01-01
situates the event in everyday life. By drawing on Maffesoli's (1996) concept of ‘sociality' and Lincoln's (2005) concept of zoning the spatial and social logic of the house, partying is analysed using both qualitative and quantitative material. The analysis suggests that the consumption of alcohol (i.......e. collective intoxication) is one way the parents' dining room is transformed creatively into a space for teenage partying. Hence, the social logic of a party is to consume alcohol collectively as it symbolises commitment to both the party and to the specific group of friends. Finally, attention is drawn...... to reaffirm friendship and is therefore an integrated part of adolescents' everyday life. ...
Promoting Party Politics in Emerging Democracies
Burnell, P.; Gerrits, A.
2010-01-01
This opening section briefly introduces international political party support, that is, assistance to political parties by international organizations, mostly from the US and Europe, to strengthen individual political parties, to promote peaceful interaction between parties and to help to create a
Ion beam mixing isotopic metal bilayers
Energy Technology Data Exchange (ETDEWEB)
Fell, C.J. [Newcastle Univ., NSW (Australia). Dept. of Physics; Kenny, M.J. [CSIRO, Lindfield, NSW (Australia). Div. of Applied Physics
1993-12-31
In order to obtain an insight into the mechanisms of ion-solid interactions, bilayer targets can be prepared from two different isotopes. A mixing study SIMS is to be carried out using specially grown monocrystalline bilayers of {sup 58}Ni / {sup 60}Ni. An important aspect of the work is the preparation of high quality single-crystal thin films. The Ni layers will be grown on the (110) surface of pure Ni and verified for crystallinity using Reflection High-Energy Electron Diffraction and Rutherford Backscattering channelling analysis. The Pd bilayers will be grown on a Pd (100) surface. RHEED will be used to confirm the two-dimensional crystallinity of the surface before and after deposition of each layer, and channelling used to confirm bulk film crystallinity. Single crystal substrates are currently being prepared. Analysis of the Ni (110) surface using RHEED at 9 kV shows a streak spacing which corresponds to a lattice spacing of 2.47 {+-} 0.09 Angstroms. 9 refs., 1 fig.
Ion beam mixing isotopic metal bilayers
Energy Technology Data Exchange (ETDEWEB)
Fell, C J [Newcastle Univ., NSW (Australia). Dept. of Physics; Kenny, M J [CSIRO, Lindfield, NSW (Australia). Div. of Applied Physics
1994-12-31
In order to obtain an insight into the mechanisms of ion-solid interactions, bilayer targets can be prepared from two different isotopes. A mixing study SIMS is to be carried out using specially grown monocrystalline bilayers of {sup 58}Ni / {sup 60}Ni. An important aspect of the work is the preparation of high quality single-crystal thin films. The Ni layers will be grown on the (110) surface of pure Ni and verified for crystallinity using Reflection High-Energy Electron Diffraction and Rutherford Backscattering channelling analysis. The Pd bilayers will be grown on a Pd (100) surface. RHEED will be used to confirm the two-dimensional crystallinity of the surface before and after deposition of each layer, and channelling used to confirm bulk film crystallinity. Single crystal substrates are currently being prepared. Analysis of the Ni (110) surface using RHEED at 9 kV shows a streak spacing which corresponds to a lattice spacing of 2.47 {+-} 0.09 Angstroms. 9 refs., 1 fig.
Departies: conceptualizing extended youth parties
DEFF Research Database (Denmark)
Fjær, Eivind Grip; Tutenges, Sébastien
2017-01-01
Every year, millions of young people travel away from home to party for days or weeks on end in permissive environments, such as music festivals, dance parties, and nightlife resorts. The studies that have been conducted on these extended youth parties have focused primarily on specific risk...
Democracy, the Party, and Self-Emancipation
Raekstad, P.
2017-01-01
The Party is once again the subject of sustained discussion among academics and popular movements. Jodi Dean’s most recent book, Crowds and Party, is an attempt to re-think the party form for contemporary politics after the experiences and lessons of Occupy. Crowds and Party is engaging and
Latin American intra-party democracy
Directory of Open Access Journals (Sweden)
Aldo Adrián Martínez Hernández
2017-12-01
Full Text Available Research proposes to determine the level of internal democracy of political parties in Latin America from perception of its members, allowing the creation of an index that has parameters for the measurement and comparison of the parties according to its democratic features. At the same time, research supports designing a profile of the parties by subjecting to analysis the relationship between ideology and internal democracy, stressing that despite the differences between left and right, parties in Latin America do not have dichotomous democratic features, while maintaining low levels despite their ideological location.
Multi-party Quantum Computation
Smith, Adam
2001-01-01
We investigate definitions of and protocols for multi-party quantum computing in the scenario where the secret data are quantum systems. We work in the quantum information-theoretic model, where no assumptions are made on the computational power of the adversary. For the slightly weaker task of verifiable quantum secret sharing, we give a protocol which tolerates any t < n/4 cheating parties (out of n). This is shown to be optimal. We use this new tool to establish that any multi-party quantu...
Party Members in Context. Social networks and local branches as context for party membership
Paulis, Emilien
2018-01-01
In this doctoral dissertation, I put party members and activists back in context. I stress theimportance of two contextual dimensions, often overlooked in the scientific literature. On theone hand, I put forward social network explanations of party membership and activism,emphasizing the importance of social interactions, relations and structures, which were scarcelyexplored as potential triggers. Like other forms of participation, party membership haspredominantly been portrayed through indi...
Roberts, Jordan A; Gonzalez, Raul S; Das, Satya; Berlin, Jordan; Shi, Chanjuan
2017-12-01
Poorly differentiated neuroendocrine carcinoma of the digestive system has a dismal prognosis with limited treatment options. This study aimed to investigate expression of the PD-1/PD-L1 pathway in these tumors. Thirty-seven patients with a poorly differentiated neuroendocrine carcinoma of the digestive system were identified. Their electronic medical records, pathology reports, and pathology slides were reviewed for demographics, clinical history, and pathologic features. Tumor sections were immunohistochemically labeled for PD-1 and PD-L1, and expression of PD-1 and PD-L1 on tumor and tumor-associated immune cells was analyzed and compared between small cell and large cell neuroendocrine carcinomas. The mean age of patients was 61 years old with 18 men and 19 women. The colorectum (n=20) was the most common primary site; other primary sites included the pancreaticobiliary system, esophagus, stomach, duodenum, and ampulla. Expression of PD-1 was detected on tumor cells (n=6, 16%) as well as on tumor-associated immune cells (n=23, 63%). The 6 cases with PD-1 expression on tumor cells also had the expression on immune cells. Expression of PD-L1 was visualized on tumor cells in 5 cases (14%) and on tumor-associated immune cells in 10 cases (27%). There was no difference in PD-1 and PD-L1 expression between small cell and large cell neuroendocrine carcinomas. In conclusion, PD-1/PD-L1 expression is a frequent occurrence in poorly differentiated neuroendocrine carcinomas of the digestive system. Checkpoint blockade targeting the PD-1/PD-L1 pathway may have a potential role in treating patients with this disease. Copyright © 2017 Elsevier Inc. All rights reserved.
Party drugs - use and harm reduction.
Frei, Matthew
2010-08-01
Party drug use, the intermittent use of stimulants, ecstasy and so-called 'designer drugs' at dance parties or 'raves', is now part of the culture of many young Australians. This article discusses the risks associated with the use of 'party drugs' and describes an useful approach to general practitioner assessment and management of patients who may be using party drugs. Party drug use is associated with a range of harms, including risks associated with behaviour while drug affected, toxicity and overdose, mental health complications and physical morbidity. Multiple substance use, particularly combining sedatives, further amplifies risk. If GPs have some understanding of these drugs and their effects, they are well placed to provide an effective intervention in party drug users by supporting the reduction of harm.
International Nuclear Information System (INIS)
Bruechle, W.
1976-01-01
In this paper, chemical separation processes are described permitting fast and neat isolation of short-lived palladium and silver nuclides from fusion product mixtures. The process for palladium is based on the stability of palladium diethyldithiophosphate. From fission products of the reactions 238 U(n,f) and 249 Cf(nth,f), the following palladium niclides could be studied for the first time by gamma spectroscopy: 1.66 min 113 Pd, 2.45 min 114 Pd, 29 sec sup(115a)Pd, 54 sec sup(115b)Pd, 12.5 sec 116 Pd. 113 Pd could also be indentified according to the reaction 116 Cd(n,α) 113 Pd. The separation of silver is based on the fast isotopic exchange on AgCl. With this process, the following nuclides have been separated from fission product mixtures and studied by gamma spectroscopy: 70 sec sup(113m)Ag, 5.0 sec 114 Ag, 19.2 sec sup(115m)Ag, 2.65 min sup(116g)Ag, 10.5 sec sup(116m)Ag, 1.3 min sup(117g)Ag, 6.0 sec sup(117m)Ag, 4.0 sec 118 Ag. (orig./WL) [de
Which Party Gets the Mayoralty?
DEFF Research Database (Denmark)
Skjæveland, Asbjørn; Serritzlew, Søren
2010-01-01
expands the scope of these explanatory variables. However, the study also shows that being a large party is not sufficient for a party to have a good chance of winning the mayoralty. Furthermore, norms guiding appropriate behaviour seem important in addition to instrumental behaviour. It appears......In non-presidential multiparty systems, it is not only the voters but also coalition formation after the election that decides the government of the community. Some national-level studies investigate which parties are most likely to win the Prime Minister's office. The aim of this article...... is to investigate the same question at the local level:What makes a party more likely to win the post of mayor? The article finds that party size and change in size are important along with experience and ideological centrality. The results are similar to those obtained at the national level, and this study thus...
DEFF Research Database (Denmark)
Nielsen, Sigge Winther; Larsen, Martin Vinæs
2014-01-01
heuristics and voting models. Next, the article measures the brand value of Danish parties by utilizing a representative association analysis. Finally, this measure is used to conduct the very first empirical analysis of a party brand's effect on voting behavior. Overall, the primary finding demonstrates...
Isotopic variations in primitive meteorites
International Nuclear Information System (INIS)
Clayton, R.N.; Chicago Univ., IL; Chicago Univ., IL
1981-01-01
The presence of large internal 16 O variability in ordinary chondrites greatly extends the range of meteorite types in which this phenomenon has been observed. These results may lead to identification of major gas and dust reservoirs in the cloud from which the Solar System formed. The demonstration that live 107 Pd was present in the differentiated parent bodies of some iron meteorites supports the million year time scale between a major nucleosynthetic event and Solar System formation, as implied by the presence of live 26 Al in carbonaceous chondrites. However, the variability of radiogenic 26 Mg abundances in these meteorites makes it clear that the data cannot be interpreted simply in terms of time variations. Models of nucleosynthesis for elements from calcium to the iron peak should be aided by the new observations of abundances of titanium isotopes. Progress has been made in establishing the carrier phases of isotopically anomalous xenon and krypton. The apparent location of anomalous xenon and 14 N-rich nitrogen in identical carriers supports the notion that nucleosynthetic anomalies in nitrogen are also present in Allende. (author)
Directory of Open Access Journals (Sweden)
Enrico Calossi
2015-03-01
Full Text Available In the last 20 years an increasing number of scholars have centred their attention on the relationships between party national structures and party sub-national branches. A relevant part of the specialized literature has interpreted party change as the by-product of the denationalization of party politics. The aim of this contribution is to investigate to what extent eight relevant Italian parties have followed patterns of organizational change, after the reforms of the municipal, provincial and regional election sys-tems; and the process of devolution of administrative powers begun during the Nineties. By focusing on two analytical dimensions (the level of involvement and the level of autonomy of party regional units, we analyse diachronically continuity and change in party formal organization, through an in-depth analysis of the statutes adopted from 1992 to 2012
Barrier height and interface effect of Pt-n-GaN and Pd-n-GaN Schottky diodes
International Nuclear Information System (INIS)
Khan, M.R.H.; Saha, S.L.; Sawaki, N.
1999-01-01
Schottky barriers on n-type GaN films by Pt and Pd are fabricated and characterized. A thin Pt or Pd layer is deposited on n-GaN layers to form Schottky contacts in a vacuum below 1x10/sup -6/ Torr. The area of all diodes is 3.46 x 10-4 cm/sup 2/. Several samples of Pt-n GaN and Pd-n GaN were studied. The ideality factor of Pt-n-GaN diode is 1.26 and of Pd-n-GaN is 1.17. The breakdown voltage of Pt-n-GaN and Pd-n-GaN diodes is 21 V and 26 V respectively. In both the cases the leakage current varies between 1x10-9 A and 5x 10-9 A. The Schottky barrier heights (phi/sub B/ ) of Pt-GaN diode is been determined to be 1.02 eV by current voltage (I-V) and 1.07 eV by capacitance (C-V) measurements Also, phi/sub B/ of Pd-GaN diode is determined to be 0.91 eV by I-V and 0.98 eV, by C-V measurements. The departure of the values of the ideality factor is considered to be due to spatial inhomogeneities at the meal semiconductor interface. The difference in the values of phi/sub B/ determined by I-V and C-V measurements is attributed to the deformation of the spatial barrier distribution. (author)
PD-1/PD-L signaling pathway in chronic hepatitis B
Directory of Open Access Journals (Sweden)
TAO Lilin
2016-12-01
Full Text Available Hepatitis B is one of the major diseases that affect the health of Chinese people, and chronic hepatitis B virus (HBV infection can lead to disease progression. Programmed death-1 (PD-1 discovered in recent years is an important coordinated stimulus molecule which belongs to the B7/CD28 family. After its binding with programmed death ligand (PD-L, it can regulate the activation, differentiation, and proliferation of T lymphocytes. PD-1 and its ligand are differently expressed in different stages of chronic HBV infection. The interaction between PD-1 and its ligand in different immune cells induces immune tolerance in human body and finally leads to the chronicity of HBV infection. Blocking the PD-1/PD-L signaling pathway through different ways can improve T cell exhaustion, suggesting that this might be one of the directions of antiviral therapy in future.
Picturing the Party: Instagram and Party Campaigning in the 2014 Swedish Elections
Directory of Open Access Journals (Sweden)
Kirill Filimonov
2016-08-01
Full Text Available This article explores Swedish parties’ activities on Instagram during the 2014 elections. Understanding party campaign communication as highly strategic, that is, communication to persuade and mobilize voters in order to win the elections, we ask whether Instagram was used to (1 broadcast campaign messages, (2 mobilize supporters, (3 manage the party’s image, and (4 amplify and complement other campaign material (i.e., hybrid campaign use. With this study, we follow previous studies on the use of digital communication platforms in the hands of campaigning political actors, but we direct our attention to a new platform. We conducted a content analysis of 220 party postings on Instagram, collected during the hot phase of the campaign. The result shows that the platform was mainly used for broadcasting rather than for mobilization. The image the parties were presenting leaned toward personalization with a strong presence of top candidates in their postings. Top candidates were primarily displayed in a political/professional context. Finally, half of the analyzed postings showed signs of hybridized campaign practices. The presented findings give a first glimpse on how political parties use and perform on Instagram.
Nuclear opponents and party politics
International Nuclear Information System (INIS)
Tollmann, A.
1987-01-01
The question treated in this article is: what do the members of the Austrian parliament - of the different parties - against nuclear energy, in particular against nuclear installations in neighbour countries? Of special interest is the Green party, now also represented in the parliament. The conclusion is that even this party, though in principle definitely anti-nuclear, is of no help to nuclear opponents in general, and to the Working Group No to Zwentendorf in particular. (qui)
Third party financing of renewable energy sources
International Nuclear Information System (INIS)
IDAE.
1994-01-01
IDAE (Institute of Energy Saving and Diversification) Hosted the Third party on financing renewable energy sources. The meeting was articulated into chapters: 1.- Experiences in the renewable energy field. 2.- Third party financing of small hydro-power projects. 3.- Third party financing of biomass projects. 4.- Third party financing of wind energy projects
The niche party concept and its measurement
Meyer, Thomas M; Miller, Bernhard
2015-01-01
The concept of the niche party has become increasingly popular in analyses of party competition. Yet, existing approaches vary in their definitions and their measurement approaches. We propose using a minimal definition that allows us to compare political parties in terms of their ?nicheness?. We argue that the conceptual core of the niche party concept is based on issue emphasis and that a niche party emphasizes policy areas neglected by its rivals. Based on this definition, we propose a con...
The niche party concept and its measurement.
Meyer, Thomas M; Miller, Bernhard
2015-03-01
The concept of the niche party has become increasingly popular in analyses of party competition. Yet, existing approaches vary in their definitions and their measurement approaches. We propose using a minimal definition that allows us to compare political parties in terms of their 'nicheness'. We argue that the conceptual core of the niche party concept is based on issue emphasis and that a niche party emphasizes policy areas neglected by its rivals. Based on this definition, we propose a continuous measure that allows for more fine-grained measurement of a party's 'nicheness' than the dominant, dichotomous approaches and thereby limits the risk of measurement error. Drawing on data collected by the Comparative Manifesto Project, we show that (1) our measure has high face validity and (2) exposes differences among parties that are not captured by alternative, static or dichotomous measures.
28 CFR 51.7 - Political parties.
2010-07-01
... THE VOTING RIGHTS ACT OF 1965, AS AMENDED General Provisions § 51.7 Political parties. Certain activities of political parties are subject to the preclearance requirement of section 5. A change affecting... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Political parties. 51.7 Section 51.7...
Development of a software for the curimeter model cdn102
International Nuclear Information System (INIS)
Dotres Llera, Armando
2001-01-01
The characteristics of the software for the Curimeter Model CD-N102 developed at CEADEN are presented. The software consists of two main parts: a basic software for the electrometer block and an application software for a P C. The basic software is totally independent of the Pc and performs all the basic functions of the process of measurement. The application software is optional and offers a friendlier interface and additional options to the user. Among these is the possibility to keep a statistical record of the measurements in a database, to create labels and to introduce new isotopes and calibrate them. A more detailed explanation of both software is given
Recovery of high-purity metallic Pd from Pd(II)-sorbed biosorbents by incineration.
Won, Sung Wook; Lim, Areum; Yun, Yeoung-Sang
2013-06-01
This work reports a direct way to recover metallic palladium with high purity from Pd(II)-sorbed polyethylenimine-modified Corynebacterium glutamicum biosorbent using a combined method of biosorption and incineration. This study is focused on the incineration part which affects the purity of recovered Pd. The incineration temperature and the amount of Pd loaded on the biosorbent were considered as major factors in the incineration process, and their effects were examined. The results showed that both factors significantly affected the enhancement of the recovery efficiency and purity of the recovered Pd. SEM-EDX and XRD analyses were used to confirm that Pd phase existed in the ash. As a result, the recovered Pd was changed from PdO to zero-valent Pd as the incineration temperature was increased from 600 to 900°C. Almost 100% pure metallic Pd was recovered with recovery efficiency above 99.0% under the conditions of 900°C and 136.9 mg/g. Copyright © 2013 Elsevier Ltd. All rights reserved.
Investigating unexpected magnetism of mesoporous silica-supported Pd and PdO nanoparticles
Song, Hyon Min
2015-01-13
The synthesis and magnetic behavior of matrix-supported Pd and PdO nanoparticles (NPs) are described. Mesoporous silica with hexagonal columnal packing is selected as a template, and the impregnation method with thermal annealing is used to obtain supported Pd and PdO NPs. The heating rate and the annealing conditions determine the particle size and the phase of the NPs, with a fast heating rate of 30 °C/min producing the largest supported Pd NPs. Unusual magnetic behaviors are observed. (1) Contrary to the general belief that smaller Pd NPs or cluster size particles have higher magnetization, matrix-supported Pd NPs in this study maintain the highest magnetization with room temperature ferromagnetism when the size is the largest. (2) Twin boundaries along with stacking faults are more pronounced in these large Pd NPs and are believed to be the reason for this high magnetization. Similarly, supported PdO NPs were prepared under air conditions with different heating rates. Their phase is tetragonal (P42/mmc) with cell parameters of a = 3.050 Å and c = 5.344 Å, which are slightly larger than in the bulk phase (a = 3.03 Å, c = 5.33 Å). Faster heating rate of 30 °C/min also produces larger particles and larger magnetic hysteresis loop, although magnetization is smaller and few twin boundaries are observed compared to the supported metallic Pd NPs.
DEFF Research Database (Denmark)
Pallassana, Venkataraman; Neurock, Matthew; Hansen, Lars Bruno
1999-01-01
not appear to provide an independent parameter for assessing surface reactivity. The weak chemisorption of hydrogen on the Pd-ML/Re(0001) surface relates to substantial lowering of the d-band center of Pd, when it is pseudomorphically deposited as a monolayer on a Re substrate. [S0163-1829(99)00331-2].......Gradient-corrected density-functional theory (DFT-GGA) periodic slab calculations have been used to analyze the binding of atomic hydrogen on monometallic Pd(111), Re(0001), and bimetallic Pd-mL/Re(0001) [pseudomorphic monolayer of Pd(111) on Re(0001)] and Re-ML/Pd(111) surfaces. The computed...
PD-1/PD-L1 Inhibitors for Immuno-oncology: From Antibodies to Small Molecules.
Geng, Qiaohong; Jiao, Peifu; Jin, Peng; Su, Gaoxing; Dong, Jinlong; Yan, Bing
2018-02-12
The recent regulatory approvals of immune checkpoint protein inhibitors, such as ipilimumab, pembrolizumab, nivolumab, atezolizumab, durvalumab, and avelumab ushered a new era in cancer therapy. These inhibitors do not attack tumor cells directly but instead mobilize the immune system to re-recognize and eradicate tumors, which endows them with unique advantages including durable clinical responses and substantial clinical benefits. PD-1/PD-L1 inhibitors, a pillar of immune checkpoint protein inhibitors, have demonstrated unprecedented clinical efficacy in more than 20 cancer types. Besides monoclonal antibodies, diverse PD- 1/PD-L1 inhibiting candidates, such as peptides, small molecules have formed a powerful collection of weapons to fight cancer. The goal of this review is to summarize and discuss the current PD-1/PD-L1 inhibitors including candidates under clinical development, their molecular interactions with PD-1 or PD-L1, the disclosed structureactivity relationships of peptides and small molecules as inhibitors. Current PD-1/PD-L1 inhibitors under clinical development are exclusively dominated by antibodies. The molecular interactions of therapeutic antibodies with PD-1 or PD-L1 have been gradually elucidated for the design of novel inhibitors. Various peptides and traditional small molecules have been investigated in preclinical model to discover novel PD-1/PD-L1 inhibitors. Peptides and small molecules may play an important role in immuno-oncology because they may bind to multiple immune checkpoint proteins via rational design, opening opportunity for a new generation of novel PD-1/PD-L1 inhibitors. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.
International Nuclear Information System (INIS)
Villeneuve, Maxime; Leclerc, Ghyslain; Lessard, Etienne; Pouliot, Jean; Beaulieu, Luc
2008-01-01
The robustness of treatment planning to prostatic edema for three different isotopes ( 125 I, 103 Pd, and 131 Cs) is explored using dynamical dose calculations on 25 different clinical prostate cases. The treatment plans were made using the inverse planning by simulated annealing (IPSA) algorithm. The prescription was 144, 127, and 125 Gy for 125 I, 131 Cs, and 103 Pd, respectively. For each isotope, three dose distribution schemes were used to impose different protection levels to the urethra: V 120 =0%, V 150 =0%, and V 150 =30%. Eleven initial edema values were considered ranging from 1.0 (no edema) to 2.0 (100%). The edema was assumed to resolve exponentially with time. The prostate volume, seed positions, and seed activity were dynamically tracked to produce the final dose distribution. Edema decay half-lives of 10, 30, and 50 days were used. A total of 675 dynamical calculations were performed for each initial edema value. For the 125 I isotope, limiting the urethra V 120 to 0% leads to a prostate D 90 under 140 Gy for initial edema values above 1.5. Planning with urethra V 150 at 0% provides a good response to the edema; the prostate D 90 remains higher than 140 Gy for edema values up to 1.8 and a half-life of 30 days or less. For 103 Pd, the prostate D 90 is under 97% of the prescription dose for approximately 66%, 40%, and 30% of edema values for urethra V 120 =0%, V 150 =0%, and V 150 =30%, respectively. Similar behavior is seen for 131 Cs and the center of the prostate becomes 'cold' for almost all edema scenarios. The magnitude of the edema following prostate brachytherapy, as well as the half-life of the isotope used and that of the edema resorption, all have important impacts on the dose distribution. The 125 I isotope with its longer half-life is more robust to prostatic edema. Setting up good planning objectives can provide an adequate compromise between organ doses and robustness. This is even more important since seed misplacements will contribute
Coy, Shannon; Rashid, Rumana; Lin, Jia-Ren; Du, Ziming; Donson, Andrew M; Hankinson, Todd C; Foreman, Nicholas K; Manley, Peter E; Kieran, Mark W; Reardon, David A; Sorger, Peter K; Santagata, Sandro
2018-03-02
Craniopharyngiomas are neoplasms of the sellar/parasellar region that are classified into adamantinomatous (ACP) and papillary (PCP) subtypes. Surgical resection of craniopharyngiomas is challenging, and recurrence is common, frequently leading to profound morbidity. BRAF V600E mutations render PCP susceptible to BRAF/MEK inhibitors, but effective targeted therapies are needed for ACP. We explored the feasibility of targeting the PD-1/PD-L1 immune checkpoint pathway in ACP and PCP. We mapped and quantified PD-L1 and PD-1 expression in ACP and PCP resections using immunohistochemistry, immunofluorescence, and RNA in situ hybridization. We used tissue-based cyclic immunofluorescence (t-CyCIF) to map the spatial distribution of immune cells and characterize cell cycle and signaling pathways in ACP tumor cells which intrinsically express PD-1. All ACP (15±14% of cells, n=23, average±S.D.) and PCP (35±22% of cells, n=18) resections expressed PD-L1. In ACP, PD-L1 was predominantly expressed by tumor cells comprising the cyst-lining. In PCP, PD-L1 was highly-expressed by tumor cells surrounding the stromal fibrovascular cores. ACP also exhibited tumor cell-intrinsic PD-1 expression in whorled epithelial cells with nuclear-localized beta-catenin. These cells exhibited evidence of elevated mTOR and MAPK signaling. Profiling of immune populations in ACP and PCP showed a modest density of CD8+ T-cells. ACP exhibit PD-L1 expression in the tumor cyst-lining and intrinsic PD-1 expression in cells proposed to comprise an oncogenic stem-like population. In PCP, proliferative tumor cells express PD-L1 in a continuous band at the stromal-epithelial interface. Targeting PD-L1 and/or PD-1 in both subtypes of craniopharyngioma might therefore be an effective therapeutic strategy.
Directory of Open Access Journals (Sweden)
Albert Padró-Solanet
2008-02-01
Full Text Available
The article analyses the use of New Information and Communications Technologies (NICT by the political parties, going beyond approaches focusing on the potential of these technologies for political transformation and renovation. In order to do this a set of variables that characterise the strategic position of the Catalan parties is employed: ideology, organisation and position in the electoral market. The analysis shows three different forms of usage of the Internet. One group of parties (PSC, CDC-CiU uses it to promote participation and campaigning activities; a second group (ICV, Cs, to generate new resources, and finally, a third group (PSC, ERC uses it to build contact networks. The size, and to a lesser degree the type of organisation, stand out as the major explanatory variables. The major parties use the Internet to promote campaign activities and participation; in contrast, smaller parties tend to make use of the Internet to generate new sources of financing and workforce. Depending on the type of organisation, the parties of the masses seem to be more likely to use the Internet to set up and activate an extensive contact network which recreates the characteristic associative realm of these parties in cyberspace.
Ion source development for the on-line isotope separator at GSI
International Nuclear Information System (INIS)
Kirchner, R.; Burkard, K.; Hueller, W.; Klepper, O.
1991-08-01
The progress in the understanding of ion sources for isotope separation on-line and the feasibility of bunched beams of relatively refractory elements is reported. The ultra-high temperature FEBIAD-H ion source, facilitating the mounting of catchers and window compared to the earlier F-version, enables bunched beams of the elements with adsorption enthalpies up to almost 6 eV, e.g. of Be, Al, Ca, Cr, Fe, Co, Ni, Sr, Pd, Ba, Yb, and Au. This way also chemical selectivity for these elements may be achieved, at least to some extent, for isotopes with halflives > or approx.1 minute, including especially the difficult separation of alkaline-earth isotopes from isobaric alkalines. These studies reveal, however, also a principal difficulty in the on-line separation of refractory elements, namely their tendency, increasing with ΔH a , to re-diffuse after release from the catcher into the bulk of the hot source enclosure. (orig.)
Analysis and separation of boron isotopes; Analyse et separation des isotopes du bore
Energy Technology Data Exchange (ETDEWEB)
Perie, M [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1966-11-01
The nuclear applications of boron-10 justify the study of a method of measurement of its isotopic abundance as well as of very small traces of boron in different materials. A systematic study of thermionic emission of BO{sub 2}Na{sub 2}{sup +} has been carried out. In the presence of a slight excess of alkalis, the thermionic emission is considerably reduced. On the other hand, the addition of a mixture of sodium hydroxide-glycerol (or mannitol) to borax permits to obtain an intense and stable beam. These results have permitted to establish an operative method for the analysis of traces of boron by isotopic dilution. In other respects, the needs of boron-10 in nuclear industry Justify the study of procedures of separation of isotopes of boron. A considerable isotopic effect has been exhibited in the chemical exchange reaction between methyl borate and borate salt in solution. In the case of exchange between methyl borate and sodium borate, the elementary separation factor {alpha} is: {alpha}=(({sup 11}B/{sup 10}B)vap.)/(({sup 11}B/{sup 10}B)liq.)=1.03{sub 3}. The high value of this elementary effect has been multiplied in a distillation column in which the problem of regeneration of the reactive has been resolved. An alternative procedure replacing the alkali borate by a borate of volatile base, for example diethylamine, has also been studied ({alpha}=1,02{sub 5} in medium hydro-methanolic with 2,2 per cent water). (author) [French] Les applications nucleaires du bore 10 justifient l'etude d'une methode de mesure de son abondance isotopique dans divers materiaux ainsi que le dosage de tres faibles traces de bore. Une etude systematique de l'emission thermoionique de BO{sub 2} Na{sub 2}{sup +} a ete effectuee. En presence d'un leger exces d'alcalins, l'emission thermoionique est considerablement reduite. Par contre l'addition au borax d'un melange soude-glycerol (ou mannitol) permet d'obtenir un faisceau stable et intense. Ces resultats ont permis d'etablir un mode
Nanoporous materials for hydrogen storage and H2/D2 isotope separation
International Nuclear Information System (INIS)
Oh, Hyunchul
2014-01-01
This thesis presents a study of hydrogen adsorption properties at RT with noble metal doped porous materials and an efficient separation of hydrogen isotopes with nanoporous materials. Most analysis is performed via thermal desorption spectra (TDS) and Sieverts-type apparatus. The result and discussion is presented in two parts; Chapter 4 focuses on metal doped nanoporous materials for hydrogen storage. Cryogenic hydrogen storage by physisorption on porous materials has the advantage of high reversibility and fast refuelling times with low heat evolution at modest pressures. At room temperature, however, the physisorption mechanism is not abEle to achieve enough capacity for practical application due to the weak van der Waals interaction, i.e., low isosteric heats for hydrogen sorption. Recently, the ''spillover'' effect has been proposed by R. Yang et al. to enhance the room temperature hydrogen storage capacity. However, the mechanism of this storage enhancement by decoration of noble metal particles inside high surface area supports is not yet fully understood and still under debate. In this chapter, noble metal (Pt / Pd) doped nanoporous materials (i.e. porous carbon, COFs) have been investigated for room temperature hydrogen storage. Their textural properties and hydrogen storage capacity are characterized by various analytic techniques (e.g. SEM, HRTEM, XRD, BET, ICP-OES, Thermal desorption spectra, Sievert's apparatus and Raman spectroscopy). Firstly, Pt-doped and un-doped templated carbons possessing almost identical textural properties were successfully synthesized via a single step wet impregnation method. This enables the study of Pt catalytic activities and hydrogen adsorption kinetics on porous carbons at ambient temperature by TDS after H 2 /D 2 gas exposure and PCT measurement, respectively. While the H 2 adsorption kinetics in the microporous structure is enhanced by Pt catalytic activities (spillover), only a small enhancement of the hydrogen
Design of a Multi-Tube Pd-Membrane Module for Tritium Recovery from He in DEMO
Directory of Open Access Journals (Sweden)
Marco Incelli
2016-10-01
Full Text Available Dense self-supported Pd-alloy membranes are used to selectively separate hydrogen and hydrogen isotopes. In particular, deuterium (D and tritium (T are currently identified as the main elements for the sustainability of the nuclear fusion reaction aimed at carbon free power generation. In the fusion nuclear reactors, a breeding blanket produces the tritium that is extracted and purified before being sent to the plasma chamber in order to sustain the fusion reaction. In this work, the application of Pd-alloy membranes has been tested for recovering tritium from a solid breeding blanket through a helium purge stream. Several simulations have been performed in order to optimize the design of a Pd-Ag multi-tube module in terms of geometry, operating parameters, and membrane module configuration (series vs. parallel. The results demonstrate that a pre-concentration stage before the Pd-membrane unit is mandatory because of the very low tritium concentration in the He which leaves the breeding blanket of the fusion reactor. The most suitable operating conditions could be reached by: (i increasing the hydrogen partial pressure in the lumen side and (ii decreasing the shell pressure. The preliminary design of a membrane unit has been carried out for the case of the DEMO fusion reactor: the optimized membrane module consists of an array of 182 Pd-Ag tubes of 500 mm length, 10 mm diameter, and 0.100 mm wall thickness (total active area of 2.85 m2.
Pd-nanoparticles cause increased toxicity to kiwifruit pollen compared to soluble Pd(II)
International Nuclear Information System (INIS)
Speranza, Anna; Leopold, Kerstin; Maier, Marina; Taddei, Anna Rita; Scoccianti, Valeria
2010-01-01
In the present study, endpoints including in vitro pollen performance (i.e., germination and tube growth) and lethality were used as assessments of nanotoxicity. Pollen was treated with 5-10 nm-sized Pd particles, similar to those released into the environment by catalytic car exhaust converters. Results showed Pd-nanoparticles altered kiwifruit pollen morphology and entered the grains more rapidly and to a greater extent than soluble Pd(II). At particulate Pd concentrations well below those of soluble Pd(II), pollen grains experienced rapid losses in endogenous calcium and pollen plasma membrane damage was induced. This resulted in severe inhibition and subsequent cessation of pollen tube emergence and elongation at particulate Pd concentrations as low as 0.4 mg L -1 . Particulate Pd emissions related to automobile traffic have been increasing and are accumulating in the environment. This could seriously jeopardize in vivo pollen function, with impacts at an ecosystem level. - Nanoparticulate Pd - which resembles emissions from automobile catalysts - affects pollen to a higher extent than soluble Pd.
Pd-nanoparticles cause increased toxicity to kiwifruit pollen compared to soluble Pd(II)
Energy Technology Data Exchange (ETDEWEB)
Speranza, Anna, E-mail: anna.speranza@unibo.i [Dipartimento di Biologia, Universita di Bologna, via Irnerio 42, 40126 Bologna (Italy); Leopold, Kerstin, E-mail: kerstin.leopold@lrz.tu-muenchen.d [Arbeitsgruppe fuer Analytische Chemie, Technische Universitaet Muenchen, Garching (Germany); Maier, Marina, E-mail: marina.maier@ch.tum.d [Arbeitsgruppe fuer Analytische Chemie, Technische Universitaet Muenchen, Garching (Germany); Taddei, Anna Rita, E-mail: artaddei@unitus.i [CIME, Universita della Tuscia, Viterbo (Italy); Scoccianti, Valeria, E-mail: valeria.scoccianti@uniurb.i [Dipartimento di Scienze dell' Uomo, dell' Ambiente e della Natura, Universita di Urbino ' Carlo Bo' , Urbino (Italy)
2010-03-15
In the present study, endpoints including in vitro pollen performance (i.e., germination and tube growth) and lethality were used as assessments of nanotoxicity. Pollen was treated with 5-10 nm-sized Pd particles, similar to those released into the environment by catalytic car exhaust converters. Results showed Pd-nanoparticles altered kiwifruit pollen morphology and entered the grains more rapidly and to a greater extent than soluble Pd(II). At particulate Pd concentrations well below those of soluble Pd(II), pollen grains experienced rapid losses in endogenous calcium and pollen plasma membrane damage was induced. This resulted in severe inhibition and subsequent cessation of pollen tube emergence and elongation at particulate Pd concentrations as low as 0.4 mg L{sup -1}. Particulate Pd emissions related to automobile traffic have been increasing and are accumulating in the environment. This could seriously jeopardize in vivo pollen function, with impacts at an ecosystem level. - Nanoparticulate Pd - which resembles emissions from automobile catalysts - affects pollen to a higher extent than soluble Pd.
How to hold an ethical pox party.
Jamrozik, Euzebiusz
2018-04-01
Pox parties are a controversial alternative to vaccination for diseases such as chickenpox. Such parties involve parents infecting non-immune children by exposing them to a contagious child. If successful, infection will usually lead to immunity, thus preventing infection later in life, which, for several vaccine-preventable diseases, is more severe than childhood infection. Some may consider pox parties more morally objectionable than opting out of vaccination through non-medical exemptions. In this paper, I argue that this is not the case. Pox parties involve immediate risk of harm for children and reduce future harms, whereas opting out of vaccination places children at long-term risk of harms that increase with time, at least for some pathogens. Regarding harm to others through onward transmission of infection, this can be easily prevented in the case of pox parties-given the relatively controlled timing of infection-by quarantining attendees after the party, whereas opting out of vaccination involves risks to others that are more difficult to control. I defend three criteria for an ethical pox party: (1) that the disease is sufficiently low risk, (2) that parents consent to their child's attendance and (3) that children exposed to infection are quarantined and isolated appropriately. I argue that, if these criteria are met, pox parties are morally preferable to non-vaccination; such parties involve less risk to non-consenting others and, for some pathogens in some cases, even involve less risk for the children who participate. Thus, policies that permit non-medical exemption to vaccination should also permit ethical pox parties. Alternatively, if pox parties are not permitted, then vaccination should be mandated for those without medical contraindication. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
DEFF Research Database (Denmark)
Little, Conor
2017-01-01
This study contributes to the growing literature on the domestic politics of climate change by examining the climate policy preferences of Fianna Fáil, Fine Gael and the Labour Party over 20 years. Bringing the concept of ‘policy entrepreneurship’ into the study of intra-party politics, it uses...... who have engaged in policy entrepreneurship with the aim of strengthening their parties’ climate policy preferences. In instances where office-seeking incentives for climate policy have been strong, they have often contributed to changes in policy preferences, whether or not intra-party policy...... entrepreneurship has been present. Theoretically, the study argues that the concept of ‘policy entrepreneurship’ can be usefully borrowed from the public policy literature by researchers of party policy preferences and intra-party politics. Empirically, it adds to the small but growing body of research on climate...
Magnetotransport in Pd-rich PdFe alloys
Czech Academy of Sciences Publication Activity Database
Kudrnovský, Josef; Drchal, Václav; Turek, Ilja
2013-01-01
Roč. 26, č. 5 (2013), s. 1749-1752 ISSN 1557-1939 R&D Projects: GA ČR(CZ) GAP204/11/1228 Institutional support: RVO:68378271 ; RVO:68081723 Keywords : galvanomagnetic transport * Pd-rich PdFe * long-range order * effect of temperature * anisotropic magnetoresistance Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.930, year: 2013
New Isotopic clues to solar system formation
International Nuclear Information System (INIS)
Lee, T.
1979-01-01
The presence of two new extinct nuclides 26 Al and 107 Pd with half-lives approx.10 6 years in the early solar system implies that there were nucleosynthetic activities involving a great many elements almost at the instant of solar system formation. Rare gas and oxygen isotopic abundance variations [''anomalies''] relative to the ''cosmic'' composition were observed in a variety of planetary objects indicating that isotopic heterogeneities caused by the incomplete mixing of distinct nucleosynthetic components permeate of the entire solar system. The correlated nuclear [''FUN''] anomalies in O, Mg, Si, Ca, Sr, Ba, Nd, and Sm were found in three rare inclusions in the Allende meteorite, which show large mass-dependent isotopic fractionation effects. The signature of the nuclear component required to explain these anomalies suggests a source which has received a catastrophic neutron burst [e.g., an r-process event]. These extinct nuclides and nucleosynthetic anomalies provide new clues to solar system formation. In particular, these results have led to the speculation that a nearby supernova had injected freshly synthesized material into the early solar nebula and possibly triggered the collapse of the proto-solar interstellar cloud. Furthermore, these new results have major implications on cosmochronology, nucleosynthesis theory, star formation, planetary heating, and the genetic relationship between different planetary bodies
Inheritance and the Dynamics of Party Identification
Kroh, Martin; Selb, Peter
2009-01-01
Extensive research efforts notwithstanding, scholars continue to disagree on the nature and meaning of party identification. Traditionalists conceive of partisanship as a largely affective attachment to a political party that emerges in childhood through parental influences and tends to persist throughout life. The revisionist conception of partisanship is that of a running tally of party utilities that is updated based on current party performance. We attempt to reconcile both schools of tho...
Directory of Open Access Journals (Sweden)
Irina Lonean
2012-06-01
Full Text Available The article examines the party-state relationship in post-communist Romania. It shows the connections between the existence of patronage, corruption and the states’ weak administrative capacity, on one hand, and the dynamics of the political party system, as an explanatory variable, on the other hand. The instability of the political parties in Romania and their changing relations within the system make the electorates’ task of anticipating and sanctioning their politics impossible. Consequently, the political parties have the possibility of extracting resources from the state without being held accountable in elections, as an effect of their dynamic, but non-robust competition.
Directory of Open Access Journals (Sweden)
Junyu Long
2017-08-01
Full Text Available Abstract Gastrointestinal (GI malignancies are the most prevalent tumors worldwide, with increasing incidence and mortality. Although surgical resection, chemotherapy, radiotherapy, and molecular targeted therapy have led to significant advances in the treatment of GI cancer patients, overall survival is still low. Therefore, alternative strategies must be identified to improve patient outcomes. In the tumor microenvironment, tumor cells can escape the host immune response through the interaction of PD-1 and PD-L, which inhibits the function of T cells and tumor-infiltrating lymphocytes while increasing the function of immunosuppressive T regulatory cells. The use of an anti-PD-1/PD-L blockade enables reprogramming of the immune system to efficiently identify and kill tumor cells. In recent years, the efficacy of PD-1/PD-L blockade has been demonstrated in many tumors, and this treatment is expected to be a pan-immunotherapy for tumors. Here, we review the signaling pathway underlying the dysregulation of PD-1/PD-L in tumors, summarize the current clinical data for PD-1/PD-L inhibitors in GI malignancies, and discuss road toward precision immunotherapy in relation to PD-1/PD-L blockade. The preliminary data for PD-1/PD-L inhibitors are encouraging, and the precision immunotherapy of PD-1/PD-L inhibitors will be a viable and pivotal clinical strategy for GI cancer therapy.
Long, Junyu; Lin, Jianzhen; Wang, Anqiang; Wu, Liangcai; Zheng, Yongchang; Yang, Xiaobo; Wan, Xueshuai; Xu, Haifeng; Chen, Shuguang; Zhao, Haitao
2017-08-03
Gastrointestinal (GI) malignancies are the most prevalent tumors worldwide, with increasing incidence and mortality. Although surgical resection, chemotherapy, radiotherapy, and molecular targeted therapy have led to significant advances in the treatment of GI cancer patients, overall survival is still low. Therefore, alternative strategies must be identified to improve patient outcomes. In the tumor microenvironment, tumor cells can escape the host immune response through the interaction of PD-1 and PD-L, which inhibits the function of T cells and tumor-infiltrating lymphocytes while increasing the function of immunosuppressive T regulatory cells. The use of an anti-PD-1/PD-L blockade enables reprogramming of the immune system to efficiently identify and kill tumor cells. In recent years, the efficacy of PD-1/PD-L blockade has been demonstrated in many tumors, and this treatment is expected to be a pan-immunotherapy for tumors. Here, we review the signaling pathway underlying the dysregulation of PD-1/PD-L in tumors, summarize the current clinical data for PD-1/PD-L inhibitors in GI malignancies, and discuss road toward precision immunotherapy in relation to PD-1/PD-L blockade. The preliminary data for PD-1/PD-L inhibitors are encouraging, and the precision immunotherapy of PD-1/PD-L inhibitors will be a viable and pivotal clinical strategy for GI cancer therapy.
Between Party, Parents and Peers
DEFF Research Database (Denmark)
Bregnbæk, Susanne
2012-01-01
This article explores the lived contradictions entailed in being a young member of the Chinese Communist Party (ccp) today. The focus is on how political and existential issues intersect. It explores party membership as a strategy for personal mobility among Beijing elite university students by p...
Third-party online payment solutions in China
Yang, Qian
2017-01-01
The topic of this paper is third-party online payment solutions in China and the main purpose of this paper is to figure out the research question: What are the impacts of third-party online payment solutions on China? Generally speaking, the third-party online payment solutions, including mobile payments, usually used by customer who purchase online and usually used in transaction platform. However, in China, people can use third-party payment solutions in different platfor...
Gender differences in Assessments of Party Leaders
DEFF Research Database (Denmark)
Kosiara-Pedersen, Karina; Hansen, Kasper Møller
2015-01-01
Is there a relationship between party leader gender and voters' assessments? Yes, according to theses on gender identity and stereotyping. A voter survey during the 2011 Danish general election allows for a comprehensive analysis of a less likely case with four male and four female party leaders...... of gender does not increase with age, actually, the opposite is the case among men since younger male voters have smaller sympathy for female party leaders. Furthermore, there is no support for the expectation that voters with more education or with higher levels of political interest and knowledge are more....... Female party leaders are assessed more positively by female voters than male voters both in regard to general party leader sympathy and assessment of specific characteristics, whereas it is not the case that male party leaders are assessed more positively by male voters than female voters. The impact...
International Nuclear Information System (INIS)
Wuu, C.-S.; Ennis, Ronald D.; Schiff, Peter B.; Lee, Eva K.; Zaider, Marco
2000-01-01
Purpose: The dosimetric merit of a permanent prostate implant relies on two factors: the quality of the plan itself, and the fidelity of its implementation. The former factor depends on source type and on source strength, while the latter is a combination of skill and experience. The purpose of this study is to offer criteria by which to select a source type ( 125 I or 103 Pd) and activity. Methods and Materials: Given a prescription dose and potential seed positions along needles, treatment plans were designed for a number of seed types and activities, specifically for 125 I with activities ranging from 0.3 to 0.7 mCi, and for 103 Pd with activities in the range of 0.8 to 1.6 mCi. To avoid human planner bias, an automated computerized planning system based on integer programming was used to obtain optimal seed configurations for each seed type and activity. To simulate the effect of seed-placement inaccuracies, random seed-displacement 'errors' were generated for all plans. The displacement errors were assumed to be uniformly distributed within a cube with side equal to 2no. sigmano. The resulting treatment plans were assessed using two volumetric and two dosimetric indices. Results: For 125 I implants a coverage index (CI) of 98.5% or higher can be achieved for all activities (CI is the fraction of the target volume receiving the prescribed or larger dose). The external volume index (EI) (i.e., the amount of healthy tissue, as percentage of the target volume, receiving the prescribed or larger dose) increases from 13.9% to 20% as the activity increases from 0.3 to 0.7 mCi. For implants using 103 Pd, the external volume index increases from 10.2% to 13.9% whenever CI exceeds 98.5%. Volumetric and dosimetric indices (coverage index, external volume index, D90, and D80) are all sensitive to seed displacement, although the activity dependence of these indices is more pronounced for 125 I than for 103 Pd implants. Conclusions: For both isotopes, the lower activities
So Close But So Far: Voting Propensity and Party Choice for Left-�Wing Parties
DEFF Research Database (Denmark)
Bochsler, Daniel; Sciarini, Pascal
2010-01-01
While the bulk of the literature focuses on the vote for parties from different blocs, the purpose of our article is to study the vote for two parties that are ideologically very close to each other: The Social Democrats and the Greens in Switzerland. To that end, we develop a two-step model, where...... voters first make a selection of parties that are acceptable to them and then make their electoral choice out of this set of acceptable al- ternatives. We use voting propensities as a measure of the first, consideration step and we show that they strongly depend on the distance between voters and parties...... on the Left–Right scale. With regard to the second, choice stage of the electoral process we hypothesize about the factors that may account for the varying ability of the two par- ties to convert potential voters into real voters. Our empirical tests provide encourag- ing support for our hypotheses regarding...
Complete Fairness in Secure Two-Party Computation
DEFF Research Database (Denmark)
Gordon, S. Dov; Hazay, Carmit; Katz, Jonathan
2011-01-01
In the setting of secure two-party computation, two mutually distrusting parties wish to compute some function of their inputs while preserving, to the extent possible, various security properties such as privacy, correctness, and more. One desirable property is fairness which guarantees, informa...... for such functions must have round complexity super-logarithmic in the security parameter. Our results demonstrate that the question of completely fair secure computation without an honest majority is far from closed.......In the setting of secure two-party computation, two mutually distrusting parties wish to compute some function of their inputs while preserving, to the extent possible, various security properties such as privacy, correctness, and more. One desirable property is fairness which guarantees......-party setting. We demonstrate that this folklore belief is false by showing completely fair protocols for various nontrivial functions in the two-party setting based on standard cryptographic assumptions. We first show feasibility of obtaining complete fairness when computing any function over polynomial...
Ultrasonic Examination of Double-Shell Tank 241-AZ-102 Examination Completed August 2003
International Nuclear Information System (INIS)
Pardini, Allan F.; Posakony, Gerald J.
2003-01-01
COGEMA Engineering Corporation (COGEMA), under a contract from CH2M Hill Hanford Group (CH2M Hill), has performed an ultrasonic nondestructive examination of selected portions of Double-Shell Tank 241-AZ-102. The purpose of this examination was to provide information that could be used to evaluate the integrity of the wall of the primary tank. The requirements for the ultrasonic examination of Tank 241-AZ-102 were to detect, characterize (identify, size, and locate), and record measurements made of any wall thinning, pitting, or cracks that might be present in the wall of the primary tank. Any measurements that exceed the requirements set forth in the Engineering Task Plat (ETP), RPP-11832 (Jensen 2002) and summarized on page 1 of this document, are reported to CH2M Hill and the Pacific Northwest National Laboratory (PNNL) for further evaluation. Under the contract with CH2M Hill, all data is to be recorded on disk and paper copies of all measurements are provided to PNNL for third-party evaluation. PNNL is responsible for preparing a report that describes the results of the COGEMA ultrasonic examinations
Ultrasonic Examination of Double-Shell Tank 241-SY-102. Examination Completed June 2004
International Nuclear Information System (INIS)
Pardini, Allan F.; Posakony, Gerald J.
2004-01-01
COGEMA Engineering Corporation (COGEMA), under a contract from CH2M Hill Hanford Group (CH2M Hill), has performed an ultrasonic nondestructive examination of selected portions of Double-Shell Tank 241-SY-102. The purpose of this examination was to provide information that could be used to evaluate the integrity of the wall of the primary tank. The requirements for the ultrasonic examination of Tank 241-SY-102 were to detect, characterize (identify, size, and locate), and record measurements made of any wall thinning, pitting, or cracks that might be present in the wall of the primary tank. Any measurements that exceed the requirements set forth in the Engineering Task Plan (ETP), RPP-17750 (Jensen 2003) and/SUMmarized on page 1 of this document, are reported to CH2M Hill and the Pacific Northwest National Laboratory (PNNL) for further evaluation. Under the contract with CH2M Hill, all data is to be recorded on disk and paper copies of all measurements are provided to PNNL for third-party evaluation. PNNL is responsible for preparing a report that describes the results of the COGEMA
Runtime party switch in an inter-organizational collaboration
Pourmirza, S.
2016-01-01
During the execution of an inter-organizational business-to-business (B2B) collaboration, a collaborating party may drop out for technical reasons or for business reasons. In such a case, the leaving party must be replaced, at runtime, by a new party. Ideally, the new party can pick up where the old
Structure and formation mechanism of the transfermium isotope 254No
International Nuclear Information System (INIS)
Reiter, P.
1998-01-01
The ground-state band of the Z=102 isotope 254 No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadruple deformation, β = 0.27, is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of 254 No up to spin 14 means that its fission barrier persists at least up to that spin
Energy Technology Data Exchange (ETDEWEB)
Tobari, Kousuke, E-mail: tobari@futamoto.elect.chuo-u.ac.jp; Ohtake, Mitsuru; Nagano, Katsumasa; Futamoto, Masaaki
2011-09-30
Pd/Co/Pd tri-layer films were prepared on MgO substrates of (001), (111), and (011) orientations at room temperature by ultra high vacuum rf magnetron sputtering. The detailed film structures around the Co/Pd and the Pd/Co interfaces are investigated by reflection high energy electron diffraction. Pd layers of (001){sub fcc}, (111){sub fcc}, and (011){sub fcc} orientations epitaxially grow on the respective MgO substrates. Strained fcc-Co(001) single-crystal layers are formed on the Pd(001){sub fcc} layers by accommodating the fairly large lattice mismatch between the Co and the Pd layers. On the Co layers,, Pd polycrystalline layers are formed. When Co films are formed on the Pd(111){sub fcc} and the Pd(011){sub fcc} layers, atomic mixing is observed around the Co/Pd interfaces and fcc-CoPd alloy phases are coexisting with Co crystals. The Co crystals formed on the Pd(111){sub fcc} layers consist of hcp(0001) + fcc(111) and Pd(111){sub fcc} epitaxial layers are formed on the Co layers. Co crystals epitaxially grow on the Pd(011){sub fcc} layers with two variants, hcp(11-bar 00) and fcc(111). On the Co layers, Pd(011){sub fcc} epitaxial layers are formed.
Bilow, Marcel; Entrop, Alexis Gerardus; Lichtenberg, Jos; Stoutjesdijk, Pieter
2015-01-01
PD Lab explores the applications of building sector related product development. PD lab investigates and tests digital production technologies like CNC milled wood connections. It will also act as a platform in its wider meaning to investigate the effects and influences of file to factory
45 CFR 99.22 - Rights of parties.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Rights of parties. 99.22 Section 99.22 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION PROCEDURE FOR HEARINGS FOR THE CHILD CARE AND DEVELOPMENT FUND Hearing Procedures § 99.22 Rights of parties. All parties may: (a...
When can we trust a third party?
Hee, van K.M.; Sidorova, N.; Werf, van der J.M.E.M.; Koutny, M.; Aalst, van der W.M.P.; Yakovlev, A.
2013-01-01
Organizations often do not want to reveal the way a product is created or a service is delivered. As a consequence, if two organizations want to cooperate, they contact a trusted third party. Each specifies how it wants to communicate with the other party. The trusted third party then needs to
Investigating unexpected magnetism of mesoporous silica-supported Pd and PdO nanoparticles
Song, Hyon Min; Zink, Jeffrey I.; Khashab, Niveen M.
2015-01-01
supported Pd and PdO NPs. The heating rate and the annealing conditions determine the particle size and the phase of the NPs, with a fast heating rate of 30 °C/min producing the largest supported Pd NPs. Unusual magnetic behaviors are observed. (1) Contrary
Cytotoxicity of Pd nanostructures supported on PEN: Influence of sterilization on Pd/PEN interface
Energy Technology Data Exchange (ETDEWEB)
Polívková, M., E-mail: polivkoa@vscht.cz [Department of Solid State Engineering, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic); Siegel, J. [Department of Solid State Engineering, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic); Rimpelová, S. [Department of Biochemistry and Microbiology, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic); Hubáček, T. [Institute of Hydrobiology, Biology Centre of the AS CR, 370 05 Ceske Budejovice (Czech Republic); Kolská, Z. [Materials Centre of Usti n. L., J.E. Purkyne University, 400 96 Usti nad Labem (Czech Republic); Švorčík, V. [Department of Solid State Engineering, University of Chemistry and Technology Prague, 166 28 Prague (Czech Republic)
2017-01-01
Non-conventional antimicrobial agents, such as palladium nanostructures, have been increasingly used in the medicinal technology. However, experiences uncovering their harmful and damaging effects to human health have begun to appear. In this study, we have focused on in vitro cytotoxicity assessment of Pd nanostructures supported on a biocompatible polymer. Pd nanolayers of variable thicknesses (ranging from 1.1 to 22.4 nm) were sputtered on polyethylene naphthalate (PEN). These nanolayers were transformed by low-temperature post-deposition annealing into discrete nanoislands. Samples were characterized by AFM, XPS, ICP-MS and electrokinetic analysis before and after annealing. Sterilization of samples prior to cytotoxicity testing was done by UV irradiation, autoclave and/or ethanol. Among the listed sterilization techniques, we have chosen the gentlest one which had minimal impact on sample morphology, Pd dissolution and overall Pd/PEN interface quality. Cytotoxic response of Pd nanostructures was determined by WST-1 cell viability assay in vitro using three model cell lines: mouse macrophages (RAW 264.7) and two types of mouse embryonic fibroblasts (L929 and NIH 3T3). Finally, cell morphology in response to Pd/PEN was evaluated by means of fluorescence microscopy. - Highlights: • Annealing of Pd nanolayers on PEN resulted to Pd aggregation and formation of discrete nanoislands. • UV treatment was found as the gentlest sterilization method in term of physicochemical properties of Pd/PEN interface. • Autoclaving and chemical sterilization by ethanol resulted into remarkable changes of Pd/PEN interface. • Cytotoxicity of Pd samples was insignificant. • Pd nanostructures are potentially applicable as health-unobjectionable antibacterial coatings of medical devices.
Aqueous phase hydrogenation of phenol catalyzed by Pd and PdAg on ZrO 2
Energy Technology Data Exchange (ETDEWEB)
Resende, Karen A.; Hori, Carla E.; Noronha, Fabio B.; Shi, Hui; Gutierrez, Oliver Y.; Camaioni, Donald M.; Lercher, Johannes A.
2017-11-01
Hydrogenation of phenol in aqueous phase was studied over a series of ZrO2-supported Pd catalysts in order to explore the effects of particle size and of Ag addition on the activity of Pd. Kinetic assessments were performed in a batch reactor, on monometallic Pd/ZrO2 samples with different Pd loadings (0.5%, 1% and 2%), as well as on a 1% PdAg/ZrO2 sample. The turnover frequency (TOF) increases with the Pd particle size. The reaction orders in phenol and H2 indicate that the surface coverages by phenol, H2 and their derived intermediates are higher on 0.5% Pd/ZrO2 than on other samples. The activation energy was the lowest on the least active sample (0.5% Pd/ZrO2), while being identical on 1% and 2% Pd/ZrO2 catalysts. Thus, the significantly lower activity of the small Pd particles (1-2 nm on average) in 0.5%Pd/ZrO2 is explained by the unfavorable activation entropies for the strongly bound species. The presence of Ag increases considerably the TOF of the reaction by decreasing the Ea and increasing the coverages of phenol and H2.
26 CFR 301.7430-5 - Prevailing party.
2010-04-01
... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Prevailing party. 301.7430-5 Section 301.7430-5... Prevailing party. (a) In general. For purposes of an award of reasonable administrative costs under section... prevailing party only if— (1) The position of the Internal Revenue Service was not substantially justified...
6 CFR 13.17 - Rights of parties.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Rights of parties. 13.17 Section 13.17 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.17 Rights of parties. Except as otherwise limited by this part, all parties may: (a) Be accompanied...
International Nuclear Information System (INIS)
Loss, R.D.; Rosman, K.J.R.; De Laeter, J.
1984-01-01
The mass spectrometric isotope dilution technique was used to measure the elemental abundances of Pd, Ag, Cd and Te in Orgueil (C1), Ivuna (C1), Murray (C2) and Allende (C3) chondrites. The Pd abundance of 554 ppb for the Cl chondrites is almost identical to the recommended value of Anders and Ebihara (1982); that for Cd (712 ppb) is approximately 5% higher, whereas that for Ag (198 ppb) is approximately 10% lower than the recommended values. A smooth distribution for the abundances of the odd-A nuclides between 65 128 Te and 130 Te to lie approximately 30% above the r-process peak at A = 130, whereas the new value fits smoothly into the general trend. (author)
Isotope effects in the non enzymic glycation of hemoglobin catalyzed by DPG
International Nuclear Information System (INIS)
Gil, Herminia; Uzcategui, Jorge
1993-01-01
The paradigmatic reaction of glucose with hemoglobin (Hb A o ) has been studied and is known to occur most rapidly at the N-terminal valine of the β-subunit. An initial, rapid imine formation is succeeded by slower Amadori rearrangement. Non enzymic glycation of Hb A o was studied in vitro in buffer Tris 10 mM in H 2 O and D 2 O, pH 7.3, pD 7.8 at 37 deg C at a fixed concentration of 2,3 diphosphoglycerate (DPG). The reaction exhibits identical rates in protium and deuterium oxides. When D-glucose-2-h is compared with D-glucose-2-d, the kinetic isotope effect for the DPG-dependent rate is 2.1 ± 0.3, while the DPG-independent rate constant shows no isotope effect (1.1 ± 0.1). The absence of a rate in isotopic water solvents shows that proton donation for solvent, lyons or DPG does not limit the rate. The substrate isotope effect of around 2 for the DPG kinetic term indicates that the proton abstraction step of the Amadori rearrangement by DPG is wholly or partially rate-limiting for this reaction. (author)
High-temperature stability of Au/Pd/Cu and Au/Pd(P)/Cu surface finishes
Ho, C. E.; Hsieh, W. Z.; Lee, P. T.; Huang, Y. H.; Kuo, T. T.
2018-03-01
Thermal reliability of Au/Pd/Cu and Au/Pd(4-6 wt.% P)/Cu trilayers in the isothermal annealing at 180 °C were investigated by X-ray photoelectron spectroscopy (XPS), time-of-flight secondary ion mass spectrometry (TOF-SIMS), and transmission electron microscopy (TEM). The pure Pd film possessed a nanocrystalline structure with numerous grain boundaries, thereby facilitating the interdiffusion between Au and Cu. Out-diffusion of Cu through Pd and Au grain boundaries yielded a significant amount of Cu oxides (CuO and Cu2O) over the Au surface and gave rise to void formation in the Cu film. By contrast, the Pd(P) film was amorphous and served as a good diffusion barrier against Cu diffusion. The results of this study indicated that amorphous Pd(P) possessed better oxidation resistance and thermal reliability than crystalline Pd.
MIS gas sensors based on porous silicon with Pd and WO{sub 3}/Pd electrodes
Energy Technology Data Exchange (ETDEWEB)
Solntsev, V.S. [Institute of Semiconductor Physics, National Academy of Science of Ukraine, 03028, Kiev (Ukraine); Gorbanyuk, T.I., E-mail: tatyanagor@mail.r [Institute of Semiconductor Physics, National Academy of Science of Ukraine, 03028, Kiev (Ukraine); Litovchenko, V.G.; Evtukh, A.A. [Institute of Semiconductor Physics, National Academy of Science of Ukraine, 03028, Kiev (Ukraine)
2009-09-30
Pd and WO{sub 3}/Pd gate metal-oxide-semiconductor (MIS) gas sensitive structures based on porous silicon layers are studied by the high frequency C(V) method. The chemical compositions of composite WO{sub 3}/Pd electrodes are characterized by secondary-ion mass spectrometry (SIMS). The atomic force microscopy (AFM) was used for morphologic studies of WO{sub 3}/Pd films. As shown in the experiments, WO{sub 3}/Pd structures are more sensitive and selective to the adsorption of hydrogen sulphide compared to Pd gate. The analyses of kinetic characteristics allow us to determine the response and characteristic times for these structures. The response time of MIS-structures with thin composite WO{sub 3}/Pd electrodes (the thickness of Pd is about 50 nm with WO{sub 3} clusters on its surface) is slower compared to the structures with Pd electrodes. Slower sensor responses of WO{sub 3}-based gas sensors may be associated with different mechanism of gas sensitivity of given structures. The enhanced sensitivity and selectivity to H{sub 2}S action of WO{sub 3}/Pd MIS-structures can also be explained by the chemical reaction that occurs at the catalytic active surface of gate electrodes. The possible mechanisms of enhanced sensitivity and selectivity to H{sub 2}S adsorption of MIS gas sensors with WO{sub 3}/Pd composite gate electrodes compared to pure Pd have been analyzed.
Yuan, Qiang; Huang, Dabing; Wang, Honghui; Zhou, Zhiyou; Wang, Qingxiao
2014-01-01
Well-defined Pd-Pt@Pd core-shell nanocrystals with a Pd-Pt alloy core and a conformal Pd shell of ~2-3 nm were directly synthesized through a one-pot, aqueous solution approach without any preformed Pd or Pt seeds. These Pd-Pt@Pd core
From Protest to Political Parties: Online Deliberation in New Parties in Spain
Directory of Open Access Journals (Sweden)
Rosa Borge Bravo
2016-12-01
Full Text Available The new parties that emerged following the 15-M movement and against the austerity measures in Spain want to build parties open to the participation and deliberation for all the citizenry. To what extent are these ideals being fulfilled? The aim of this article is to describe and assess some of the main online deliberative processes of the two most important parties, Podemos and Barcelona En Comú, following commonly accepted criteria in the literature for measuring online deliberation. Specifically, we have examined the two most-voted proposals from the online platform Plaza Podemos and the online development of the electoral programme of Barcelona En Comú. Thus, we have conducted a content analysis of 713 (Plaza Podemos and 563 (Barcelona En Comú posts. Both platforms meet the structural and technical criteria for fostering deliberation, but the external impact is high only in the case of Barcelona En Comú. The deliberative quality of the communication is good but not the criteria of reflexivity, inclusion and plurality.
The Labour Party and British Republicanism
Directory of Open Access Journals (Sweden)
Kenneth O. MORGAN
2003-10-01
Full Text Available The famous detective, Sherlock Holmes, once solved a case by referring to “the dog that did not bark.” In the past 250 years of British history, republicanism is another dog that did not bark. This is particularly true of supposedly our most radical major political party, the Labour Party. Over the monarchy, as over constitutional matters generally, Labour’s instincts have been conservative. Even after 1997, when the party, led by Lord Irvine, has indeed embarked upon major constitutional ref...
The Institutionalisation of the Romanian Party System
Directory of Open Access Journals (Sweden)
Clara Volintiru
2012-12-01
Full Text Available This paper explores the level of institutionalisation achieved by the Romanian political system since transitioning to democracy. Following through the key components of an institutionalised party system, the inquiry looks at the stability of interparty competition in Romania and the depth of its parties’ roots in society. These components are measured through such indicators as electoral volatility or the cohesiveness of the ideological preferences. Their levels suggest that the Romanian party system isn’t fully instituionalised, with fluctuating volatility and a rather incohesive ideological positioning of both voters and parties. This paper argues that in response to the double challenge of poor institutionalisation of the political parties and the party system as a whole, informal remedies, such as patronage of public jobs, or proprietary use of state resources, become highly attractive solutions for electoral success.
Magnetic characteristics of CoPd and FePd antidot arrays on nanoperforated Al_2O_3 templates
International Nuclear Information System (INIS)
Maximenko, A.; Fedotova, J.; Marszałek, M.; Zarzycki, A.; Zabila, Y.
2016-01-01
Hard magnetic antidot arrays show promising results in context of designing of percolated perpendicular media. In this work the technology of magnetic FePd and CoPd antidot arrays fabrication is presented and correlation between surface morphology, structure and magnetic properties is discussed. CoPd and FePd antidot arrays were fabricated by deposition of Co/Pd and Fe/Pd multilayers (MLs) on porous anodic aluminum oxide templates with bowl-shape cell structure with inclined intercellular regions. FePd ordered L1_0 structure was obtained by successive vacuum annealing at elevated temperatures (530 °C) and confirmed by XRD analysis. Systematic analysis of magnetization curves evidenced perpendicular magnetic anisotropy of CoPd antidot arrays, while FePd antidot arrays revealed isotropic magnetic anisotropy with increased out-of-plane magnetic contribution. MFM images of antidots showed more complicated contrast, with alternating magnetic dots oriented parallel and antiparallel to tip magnetization moment. - Highlights: • CoPd and FePd antidots were fabricated on porous anodic aluminum oxide templates. • CoPd antidot arrays have perpendicular magnetic anisotropy. • FePd antidot arrays revealed isotropic magnetic behavior. • The complex morphology of nanoporous template resulted in a complex magnetic domains image.
7 CFR 955.91 - Additional parties.
2010-01-01
... Marketing Agreement § 955.91 Additional parties. After the effective date thereof, any handler may become a... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... then be effective as to such new contracting party. ...
Yuan, Qiang
2014-01-01
Well-defined Pd-Pt@Pd core-shell nanocrystals with a Pd-Pt alloy core and a conformal Pd shell of ~2-3 nm were directly synthesized through a one-pot, aqueous solution approach without any preformed Pd or Pt seeds. These Pd-Pt@Pd core-shell nanocrystals show an enhanced electrocatalytic activity for formic acid oxidation compared with commercial Pd black. This journal is © 2014 The Royal Society of Chemistry.
Leakage Resilient Secure Two-Party Computation
DEFF Research Database (Denmark)
Damgård, Ivan Bjerre; Hazay, Carmit; Patra, Arpita
2012-01-01
we initiate the study of {\\em secure two-party computation in the presence of leakage}, where on top of corrupting one of the parties the adversary obtains leakage from the content of the secret memory of the honest party. Our study involves the following contributions: \\BE \\item {\\em Security...... and returns its result. Almost independently of secure computation, the area of {\\em leakage resilient cryptography} has recently been evolving intensively, studying the question of designing cryptographic primitives that remain secure even when some information about the secret key is leaked. In this paper...
Political Marketing Mix in Indonesia Parties
Directory of Open Access Journals (Sweden)
Freddy Simbolon
2016-05-01
Full Text Available The reform era has changed the paradigm of Indonesian politics. Multiparty system has demanded a political party to be able to compete for their constituents. Article aimed to convey a political marketing concept that can helppolitical parties in planning a strategy to win the election. Research method used descriptive method analysis. The results suggest that the approach of the marketing mix that includes the product, price, place, and promotion areapproaches that are very helpful in presenting a plan to win the marketing strategy of political parties in elections.
Isotope effect of optical activity measurements on L-α-alanine
International Nuclear Information System (INIS)
Darge, W.; Laczko, I.; Thiemann, W.
1976-01-01
If an optically active organic substance is labelled in the chirality center with another isotopic species (such as 15 N for 14 N) a pronounced variation of rotatory power is predicted. It was tried to varify this idea experimentally on L-α-alanine and found an isotope effect in ORD (optical rotatory dispersion). The magnitude of the rotation is mainly dependent on the pH of the solvent. The ratio of the optical activity alanine- 14 N/alanine- 15 N is about 1.02. It can be seen that the ratios of the molecular rotations are consistently lower than the corresponding ratios of the specific rotations. This is of course due to the fact that the molecular mass 15 M is larger than 14 M. This means tthat the mass difference is already taken into account so that the ratio of the molecular rotations could be defined as the ''net'' isotope effect in the ORDs of 15 N-substitued alanine. From the fact the ORD is different for the isotope-substitued alanine, one can reasonably assume that the absorption coefficient is also different. This leads to speculations about certain problems in the chemical evolution of the biosphere, such as the origin of optical activity. (T.G.)
Social praxis, party, and class relations today
Directory of Open Access Journals (Sweden)
Egni Malo
2014-01-01
Full Text Available Today’s political sociologists are once again interested in the study of the crisis of mass-based parties, anti-politics and anti-parliamentarism, crisis in the authority of the political class, prevailing corporate interests within republican institutions, and populism. Political sociology however, takes the party, as a construct of political sociology alone, without consideration upon its militancy and action, as the party, which objectifies the foundation of a State, and as a result the party becomes, simply an historical category. We approach the problem of the modern state from many angles; analysing the nature of a political party as such; the ideological dangers of determinism and spontaneism which a party necessarily must struggle with; the type of non-administrative internal regime which is necessary for a party to be effective and so on. The problem we seek to elaborate is the specific character of the collective action that makes possible the passage from a sectored, corporate and subordinate role of purely negative opposition, to a leading role of conscious action towards not merely a partial adjustment within the system, but posing the issue of the State in its entirety. In developing this theme – as a study of the real relations between the political party, the classes and the State – a two-fold consideration is devoted to the study of Machiavelli and Marx: first from the angle of the real relations between the two, as thinkers of revolutionary politics, of action; and secondly from a perspective which would derive from the Marxist doctrines an articulated system of contemporary politics, as found in The Prince.
Progress of PD-1/PD-L1 Inhibitors in Non-small Cell Lung Cancer
Directory of Open Access Journals (Sweden)
Zhansheng JIANG
2017-02-01
Full Text Available Pembrolizumab, an inhibitor target programmed death 1 (PD-1, was approved into the first line therapy in advanced non-small cell lung cancer (NSCLC. It was a milestone that immune checkpoints drugs have played an important role in the treatment system of NSCLC. The results of clinical trials revealed the superiority of PD-1/programmed death ligand 1 (PD-L1 inhibitors compared with chemotherapy in first-line, second-line and multidrug resistance phase therapy. Objective response rate (ORR was up to 80% with pembrolizumab plus chemotherapy, and progression-free survival (PFS with single pembrolizumab in first line was nearly 1 year (10.3 months, the hazard ratio for death fell by 40%. Overall survival (OS was more or less 1 year with single drug pembrolizumab, nivolumab and atezolizumab for second line therapy. PD-L1 expression was a predictor of PD-1/PD-L1 inhibitors. The positive rate of PD-L1 (more than 1% in advanced NSCLC was about 60% with little difference between the tissue types. However, there was no gold standard test of PD-L1 expression.
Energy Technology Data Exchange (ETDEWEB)
Baumgartner, F.; Plata Bedmar, A.
1961-07-01
Ru and Rd isotopes with mass numbers 107 and 108 and {sup 1}09Rh, has been obtained from fission products. {sup 1}07 Ru has also been prepared by the nuclear process {sup 1}10Pd (n,{alpha}) {sup 1}07 Ru. Beta and gamma energies of these nuclides have been studied spectropolarimetry and the gamma lines found for {sup 1}07 Ru and {sup 1}08Ru ( and daughter) have been very useful for the precise determination of their half-lives. {sup 1}09Rh has been identified through its daughter {sup 1}09Pd in the mixture of rhodium isotopes from fission products. Irradiation of natural palladium with fast neutrons has lead to an activity that may only be attributed to {sup 1}10rh. Neither its half life nor its decay energy have been possible to determine accurately. (Author) 1 refs.
Terrorism and Political Parties
DEFF Research Database (Denmark)
Bourne, Angela
In the paper I address the empirical puzzle arising from different responses by political authorities in Spain and the UK to the existence of political parties integrated in the terrorist groups Euskadi Ta Askatasuna (ETA, Basque Homeland and Freedom) and the Irish Republican Army (IRA). More...... for realization of free speech rights and representation is also emphasized, and where proscription is seen as inimical to resolution of conflict underpinning violence. In the context of party competition, a winning coalition is required for one discourse to predominate. However, I also argued that both ideas...
The Organizational Weapon: Ruling Parties in Authoritarian Regimes
Meng, Anne
2016-01-01
This project examines party building in authoritarian regimes. The overarching puzzle I seek to address is: why are some autocratic ruling parties stronger organizations than others? What explains variation in the institutional capacity of autocratic rule? The collection of three essays in this dissertation outline the strategic logic of party institutionalization, in addition to providing new and original ways in which to measure this key concept of authoritarian party strength. It tests pre...
Chen, Lin; Lu, Lilin; Zhu, Hengli; Chen, Yueguang; Huang, Yu; Li, Yadong; Wang, Leyu
2017-01-01
Incorporating oxophilic metals into noble metal-based catalysts represents an emerging strategy to improve the catalytic performance of electrocatalysts in fuel cells. However, effects of the distance between the noble metal and oxophilic metal active sites on the catalytic performance have rarely been investigated. Herein, we report on ultrasmall (~5 nm) Pd-Ni-P ternary nanoparticles for ethanol electrooxidation. The activity is improved up to 4.95 A per mgPd, which is 6.88 times higher than commercial Pd/C (0.72 A per mgPd), by shortening the distance between Pd and Ni active sites, achieved through shape transformation from Pd/Ni-P heterodimers into Pd-Ni-P nanoparticles and tuning the Ni/Pd atomic ratio to 1:1. Density functional theory calculations reveal that the improved activity and stability stems from the promoted production of free OH radicals (on Ni active sites) which facilitate the oxidative removal of carbonaceous poison and combination with CH3CO radicals on adjacent Pd active sites.
Influence of Pd-precursor on the acetoxylation activity of Pd-Sb/TiO{sub 2} catalysts
Energy Technology Data Exchange (ETDEWEB)
Ben-homeid, A. [Benghazi Univ. (Libyan Arab Jamahiriya). Chemistry Dept.; Kalevaru, V.N.; Radnik, J.; Luecke, B.; Martin, A. [Leibniz-Institut fuer Katalyse e.V. an der Universitaet Rostock (Germany)
2013-11-01
The impact of palladium precursors (e.g. chloride-PdCl{sub 2}; acetate-Pd(OAc){sub 2}; nitrate-Pd(NO{sub 3}){sub 2}) on the catalytic properties of Pd-Sb/TiO{sub 2} catalysts used for acetoxylation of toluene has been investigated. The catalysts were characterized by different techniques such as N{sub 2}-adsorption (BET-surface area and pore volume), XRD, TEM, CO-Chemisorption and XPS for better understanding of the catalytic properties of the catalysts. The acetate and nitrate-type precursors exhibited higher surface areas, pore volumes and higher dispersion of Pd, but displayed poor performance compared to chloride precursor. TEM analysis indicated that the size of Pd particles depended upon the nature of Pd-precursor. Among the three, chloride precursor exhibited bigger Pd particles. XPS results revealed that all the fresh catalysts irrespective of Pd-precursor contained Pd in oxidized state (i.e. Pd{sup +2}), while in the spent catalysts such oxidized Pd species were reduced. The catalytic performance was found to depend strongly on the nature of precursor used. Among the three, the catalysts prepared from chloride-type precursor showed much higher overall catalytic activity (68%) than those of nitrate and/or acetate type precursors. Moreover, these two precursors (acetate and nitrate) gave higher total oxidation products due to oxidative decomposition of mainly acetic acid. Furthermore, the catalyst prepared from Cl-precursor revealed easy deactivation due to coke deposition and also due to loss of Pd in the near-surface-region. (orig.)
International Nuclear Information System (INIS)
Massillon-JL, G.; Minniti, R.; Mitch, M.G.; Soares, C.G.; Hearn, R.A.
2011-01-01
In this work, we have investigated the 3D absorbed dose distribution around 125 I and 103 Pd low-energy photon brachytherapy seeds using a high-spatial-resolution gel scanning system to address the current difficulty in measuring absorbed dose at close distances to these sources as a consequence of high dose rate gradient. A new version of BANG-gel coupled with a small format laser CT scanner has been used. Measurements were performed with 100 μm resolution in all dimensions. In particular, radial dose function and absorbed dose rate in the plane parallel to the sources longitudinal-axis were derived at radial distances smaller than or equal to 1 cm. In addition, the energy dependence was evaluated, finding that, within measurement uncertainties, the gel response is independent of the energy for energy photon values between 20 keV and 1250 keV. We have observed that at distances larger than 1.4 mm from the source, the delivered dose is similar to predictions from published Monte Carlo calculations (MC) for the 125 I seed. For distances between 1 mm and 3 mm, differences in magnitude and shape are significant for the 103 Pd seed, where an enhancement is observed. In the enhancement region, a difference of up to 70% in the radial dose function was obtained. Such observation suggests a contribution from other radionuclides emitting beta-particles or electrons, and not considered by MC. To understand the effect, spectrometry measurements were performed. A small contribution of 102 Rh/ 102m Rh radionuclide relative to 103 Pd was observed and its importance on the absorbed dose measured at close distances to the seed is time dependent and consequently, avoids reproducible measurements. Finally, the results obtained in this work underscore the importance of using high-spatial-resolution and water-equivalent detectors for measuring absorbed dose in low-energy photon radiation fields.
The doctrine of party autonomy in international commercial arbitration
African Journals Online (AJOL)
The freedom of parties to consensually execute arbitration agreement is known as the principle of party autonomy. The principle provides a right for the parties to international commercial arbitration to choose applicable substantive law and these laws when chosen shall govern the contractual relationship of the parties.
International Nuclear Information System (INIS)
Reniers, B; Vynckier, S; Verhaegen, F
2004-01-01
In this work we have compared 125 I or 103 Pd from a microdosimetric point of view. The photon spectra at different positions around the seeds have first been calculated using EGSnrc Monte Carlo (MC) code. These photon spectra are used as input for the event-by-event MC code TRION to calculate the microdosimetric lineal energy (y) distribution for each isotope. The microdosimetric dose average lineal energy, y D , calculated in a sphere of 1 μm is 3.5 keV μm -1 for 125 I and 4.0 keV μm -1 for 103 Pd, agreeing well with values reported in the literature. y D in a 1 μm sphere diminishes slightly with the distance from the seed for 103 Pd. This is due to the spectral hardening caused by the presence of a gamma-ray of 357.5 keV in the initial spectrum of 103 Pd. In parallel with the calculation of the microdosimetric spectra, we have analysed the distribution of the size of the energy deposition clusters generated by these low energy photons in structures of 2 and 10 nm of radius. Due to Compton interactions, the fraction of very low energy electrons ( 125 I photons is 51%, whereas it is only 27% for 103 Pd. As these electrons deposit their energy very locally, the pattern of energy depositions contains more clusters of a few nm of radius for 125 I than for 103 Pd; the mean cluster orders are respectively 3.3 and 3.0 for 10 nm clusters. This is in opposition with the prediction based on the microdosimetric spectrum and the parameter y D and could be of importance for the damage to the cells
Withers, Barbara; Blyth, Emily; Clancy, Leighton E; Yong, Agnes; Fraser, Chris; Burgess, Jane; Simms, Renee; Brown, Rebecca; Kliman, David; Dubosq, Ming-Celine; Bishop, David; Sutrave, Gaurav; Ma, Chun Kei Kris; Shaw, Peter J; Micklethwaite, Kenneth P; Gottlieb, David J
2017-11-14
Donor-derived adoptive T-cell therapy is a safe and effective treatment of viral infection posttransplant, but it is limited by donor serostatus and availability and by its personalized nature. Off-the-shelf, third-party virus-specific T cells (VSTs) appear promising, but the long-term safety and durability of responses have yet to be established. We conducted a prospective study of 30 allogeneic hemopoietic stem cell transplant (HSCT) patients with persistent or recurrent cytomegalovirus (CMV) (n = 28), Epstein-Barr virus (n = 1), or adenovirus (n = 1) after standard therapy. Patients were treated with infusions of partially HLA-matched, third-party, ex vivo-expanded VSTs (total = 50 infusions) at a median of 75 days post-HSCT (range, 37 to 349 days). Safety, viral dynamics, and immune recovery were monitored for 12 months. Infusions were safe and well tolerated. Acute graft versus host disease occurred in 2 patients, despite a median HLA match between VSTs and the recipient of 2 of 6 antigens. At 12 months, the cumulative incidence of overall response was 93%. Virological control was durable in the majority of patients; the reintroduction of antiviral therapy after the final infusion occurred in 5 patients. CMV-specific T-cell immunity rose significantly and coincided with a rise in CD8 + terminal effector cells. PD-1 expression was elevated on CD8 + lymphocytes before the administration of third-party T cells and remained elevated at the time of viral control. Third-party VSTs show prolonged benefit, with virological control achieved in association with the recovery of CD8 + effector T cells possibly facilitated by VST infusion. This trial was registered at www.clinicaltrials.gov as #NCT02779439 and www.anzctr.org.au as #ACTRN12613000603718.
Authoritarian Inheritance and Conservative Party-Building in Latin America
Loxton, James Ivor
2014-01-01
Beginning in the late 1970s, with the onset of the third wave of democratization, a host of new conservative parties emerged in Latin America. The trajectories of these parties varied tremendously. While some went on to enjoy long-term electoral success, others failed to take root. The most successful new conservative parties all shared a surprising characteristic: they had deep roots in former dictatorships. They were "authoritarian successor parties," or parties founded by high-level in...
The Chinese Communist Party in Reform
DEFF Research Database (Denmark)
Brødsgaard, Kjeld Erik; Yongnian, Zheng
Contrary to the expectations of many people, China's recent economic growth has not led to the collapse of the Chinese Communist Party. In fact, the party has recently carried out a peaceful and orderly transition to the so-called fourth generation of leadership, has revitalised itself, and created...... a new, younger and better trained cadre corps. Despite this successful transformation, there continue to be many problems that the party will need to overcome if it is to remain in power, including pressures for democratization in both urban and rural areas, widespread corruption, the emergence of new...
2004-01-01
http://www.cern.ch/cern50/All staff are invited to the Golden Jubilee Staff Party on the evening of 17 September. To mark CERN's 50th anniversary, the Director-General would like to invite all the people working at CERN to celebrate the success of the organization. The party will be held in the cafeteria and on the terrace (if the weather permits) of the Main Building on 17 September at 4:00 pm. The event will include an address by the DG, music, film clips, drinks, snacks and a surprise music show by the CERN Big Bang Orchestra! Your effort, hard work and enthusiasm have been the key to CERN's success. The first of the main events celebrating the organization's Golden Jubilee is for you, so come along and celebrate! Early closure of Restaurant No. 1 (Bldg. 501, Meyrin site): Friday 17 September at 2:00 p.m. On Friday, 17 September, Restaurant No. 1 (NOVAE) will close at 2:00 p.m. owing to the Golden Jubilee party for the CERN staff. No dinner will be served that evening.
2004-01-01
http://www.cern.ch/cern50/ All staff are invited to the Golden Jubilee Staff Party on the evening of 17 September. To mark CERN's 50th anniversary, the Director-General would like to invite all the people working at CERN to celebrate the success of the organization. Your Golden Jubilee Party Friday 17 September 2004 at 16:00 Restaurant 1, Main Building Programme Speech by Director-General Toast in honour of CERN Cocktails and ambient music Video projections of five decades of CERN and at 18:00 ... A surprise music show. Your effort, hard work and enthusiasm have been the key to CERN's success. The first of the main events celebrating the organization's Golden Jubilee is for you, so come along and celebrate! Early closure of Restaurant No. 1 (bldg. 501, Meyrin site): Friday 17 September at 2:00 p.m. On Friday, 17 September, Restaurant No. 1 (NOVAE) will close at 2:00 p.m. owing to the Golden Jubilee party for the CERN staff. No dinner will be served that evening.
49 CFR 1014.102 - Application.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Application. 1014.102 Section 1014.102 Transportation Other Regulations Relating to Transportation (Continued) SURFACE TRANSPORTATION BOARD, DEPARTMENT... HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE SURFACE TRANSPORTATION BOARD § 1014.102 Application...
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Publication. 152.102 Section 152.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PESTICIDE REGISTRATION AND CLASSIFICATION PROCEDURES Agency Review of Applications § 152.102 Publication. The Agency will...
Political parties in the Sverdlovsk region: stages of development
Directory of Open Access Journals (Sweden)
Mukhametov Ruslan Salikhovich
2013-12-01
Full Text Available This article analyzes the processes of party building in the Russian Federation. On the example of a single region – the Sverdlovsk region – we study the evolution of political parties. The factors favoring the process of formation and functioning of regional political parties and political movements in the Middle Urals are identified and classified. Much attention is paid to such factors of development of the parties in the region as a party-electoral law and the electoral system view.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Definitions. 225.102 Section 225.102 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PROTECTION OF HUMAN SUBJECTS § 225.102 Definitions. (a... includes communication or interpersonal contact between investigator and subject. “Private information...
45 CFR 2104.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2104.102 Section 2104.102 Public Welfare Regulations Relating to Public Welfare (Continued) COMMISSION OF FINE ARTS ENFORCEMENT OF....102 Application. This part applies to all programs or activities conducted by the agency. ...
29 CFR 1615.102 - Application.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Application. 1615.102 Section 1615.102 Labor Regulations Relating to Labor (Continued) EQUAL EMPLOYMENT OPPORTUNITY COMMISSION ENFORCEMENT OF NONDISCRIMINATION ON... COMMISSION AND IN ACCESSIBILITY OF COMMISSION ELECTRONIC AND INFORMATION TECHNOLOGY § 1615.102 Application...
45 CFR 1706.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1706.102 Section 1706.102 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL COMMISSION ON LIBRARIES AND... CONDUCTED BY NATIONAL COMMISSION ON LIBRARIES AND INFORMATION SCIENCE § 1706.102 Application. This part...
7 CFR 959.102 - Communications.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 959.102 Section 959.102 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Regulations General § 959.102 Communications. Unless otherwise provided in the order, or by specific direction...
Directory of Open Access Journals (Sweden)
Shuguang Tan
2016-11-01
Full Text Available Abstract Antibody-based PD-1/PD-L1 blockade therapies have taken center stage in immunotherapies for cancer, with multiple clinical successes. PD-1 signaling plays pivotal roles in tumor-driven T-cell dysfunction. In contrast to prior approaches to generate or boost tumor-specific T-cell responses, antibody-based PD-1/PD-L1 blockade targets tumor-induced T-cell defects and restores pre-existing T-cell function to modulate antitumor immunity. In this review, the fundamental knowledge on the expression regulations and inhibitory functions of PD-1 and the present understanding of antibody-based PD-1/PD-L1 blockade therapies are briefly summarized. We then focus on the recent breakthrough work concerning the structural basis of the PD-1/PD-Ls interaction and how therapeutic antibodies, pembrolizumab targeting PD-1 and avelumab targeting PD-L1, compete with the binding of PD-1/PD-L1 to interrupt the PD-1/PD-L1 interaction. We believe that this structural information will benefit the design and improvement of therapeutic antibodies targeting PD-1 signaling.
Public funding of political parties when campaigns are informative
DEFF Research Database (Denmark)
Ortín, Ignacio Ortuño; Schultz, Christian
dependence on vote shares induces fur- ther moderation and improves welfare. If parties are asymmetric, vote share dependent public funding bene…ts the large party and makes it moderate its candidate, while the smaller party reacts by choosing a more extremist candidate. On balance, however, if the parties......The paper considers public funding of political parties when some voters are poorly informed about parties’ candidates and campaigns are informative. For symmetric equilibria, it is shown that more pub- lic funding leads parties to chose more moderate candidates, and that an increase in the funding’s...... are not too asymmetric, an increase in vote share dependent funding improves welfare and increases the likelihood that a moderate candidate wins the election...
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Management. 541.102 Section 541.102 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS DEFINING AND... Executive Employees § 541.102 Management. Generally, “management” includes, but is not limited to...
2010-10-01
... 46 Shipping 9 2010-10-01 2010-10-01 false Application. 507.102 Section 507.102 Shipping FEDERAL MARITIME COMMISSION GENERAL AND ADMINISTRATIVE PROVISIONS ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE FEDERAL MARITIME COMMISSION § 507.102 Application. This...
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Application. 149.102 Section 149.102 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION ENFORCEMENT OF... COMMISSION § 149.102 Application. This part applies to all programs or activities conducted by the agency. ...
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Application. 16.102 Section 16.102 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... ACTIVITIES CONDUCTED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY § 16.102 Application. This regulation (§§ 16...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 36.102 Section 36.102... ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General § 36.102 Application. (a) General. This part applies to any... courses related to applications, licensing, certification, or credentialing for secondary or postsecondary...
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Application. 550.102 Section 550.102 Wildlife and Fisheries MARINE MAMMAL COMMISSION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY MARINE MAMMAL COMMISSION § 550.102 Application. This part...
45 CFR 1214.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 1214.102 Section 1214.102 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE....102 Application. This part applies to all programs or activities conducted by the agency, except for...
16 CFR 1028.102 - Definitions.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Definitions. 1028.102 Section 1028.102 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL PROTECTION OF HUMAN SUBJECTS § 1028.102... investigator and subject. “Private information” includes information about behavior that occurs in a context in...
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Application. 28.102 Section 28.102 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION § 28.102 Application. This part...
31 CFR 19.950 - Excluded Parties List System
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Excluded Parties List System 19.950 Section 19.950 Money and Finance: Treasury Office of the Secretary of the Treasury GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) Definitions § 19.950 Excluded Parties List System Excluded Parties...
Magnetic characteristics of CoPd and FePd antidot arrays on nanoperforated Al2O3 templates
Maximenko, A.; Fedotova, J.; Marszałek, M.; Zarzycki, A.; Zabila, Y.
2016-02-01
Hard magnetic antidot arrays show promising results in context of designing of percolated perpendicular media. In this work the technology of magnetic FePd and CoPd antidot arrays fabrication is presented and correlation between surface morphology, structure and magnetic properties is discussed. CoPd and FePd antidot arrays were fabricated by deposition of Co/Pd and Fe/Pd multilayers (MLs) on porous anodic aluminum oxide templates with bowl-shape cell structure with inclined intercellular regions. FePd ordered L10 structure was obtained by successive vacuum annealing at elevated temperatures (530 °C) and confirmed by XRD analysis. Systematic analysis of magnetization curves evidenced perpendicular magnetic anisotropy of CoPd antidot arrays, while FePd antidot arrays revealed isotropic magnetic anisotropy with increased out-of-plane magnetic contribution. MFM images of antidots showed more complicated contrast, with alternating magnetic dots oriented parallel and antiparallel to tip magnetization moment.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 39.102 Section 39.102 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE § 39.102 Application. This part applies to...
45 CFR 2490.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2490.102 Section 2490.102 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION... MADISON MEMORIAL FELLOWSHIP FOUNDATION § 2490.102 Application. This part (§§ 2490.101-2490.170) applies to...
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Application. 35.102 Section 35.102 Judicial Administration DEPARTMENT OF JUSTICE NONDISCRIMINATION ON THE BASIS OF DISABILITY IN STATE AND LOCAL GOVERNMENT SERVICES General § 35.102 Application. (a) Except as provided in paragraph (b) of this...
45 CFR 2301.102 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2301.102 Section 2301.102 Public Welfare Regulations Relating to Public Welfare (Continued) ARCTIC RESEARCH COMMISSION ENFORCEMENT OF... COMMISSION § 2301.102 Application. This part (§§ 2301.101-2301.170) applies to all programs or activities...
2010-01-01
... ASSISTANCE TO HIGH ENERGY COST COMMUNITIES RUS High Energy Cost Grant Program § 1709.102 Policy. (a) All high... 7 Agriculture 11 2010-01-01 2010-01-01 false Policy. 1709.102 Section 1709.102 Agriculture...). (b) RUS may give priority consideration to projects that benefit smaller rural communities...
2010-01-01
... 3 The President 1 2010-01-01 2010-01-01 false Employment. 102.140 Section 102.140 Presidential... PROGRAMS OR ACTIVITIES CONDUCTED BY THE EXECUTIVE OFFICE OF THE PRESIDENT § 102.140 Employment. No... employment under any program or activity conducted by the agency. The definitions, requirements, and...
7 CFR 948.102 - Communications.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 948.102 Section 948.102 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Rules and Regulations General § 948.102 Communications. Unless otherwise provided in §§ 948.1 to 948.92...
The Dark Side of Altruistic Third-Party Punishment
Leibbrandt, Andreas; Lopez-Perez, Raul
2011-01-01
This article experimentally studies punishment from unaffected third parties in ten different games. The authors show that third-party punishment exhibits several features that are arguably undesirable. First, third parties punish strongly a decider if she chooses a socially efficient or a Pareto efficient allocation and becomes the richest party…
Features of modern security policy UK political parties
Directory of Open Access Journals (Sweden)
A. V. Stalovierova
2015-12-01
Full Text Available The security policy of the British coalition government of D. Cameron (2010-2015 is summarized; it’s been proved that political forces of Tory and Liberal Democrat should have compromised to carry out unanimous course in the scope of national security, and the problems of the security strategy on parliamentary elections in 2015 are analyzed, particularly the comparative analysis of the modern safety strategy of leading British parties is exercised. Under conditions of the appearance of new challenges and threats, transformation of international safety system, the questions of safety policy often become the object of attention of the British community and experts. The absence of cross-party consensus on most terms of safety strategy of the United Kingdom during the election campaign in 2015 makes the discussion about perspectives of the British safety policy still more urgent. During the election campaign there was no unity on any aspect of security subject between parties. First of all, Labourists, Liberal Democrats, Scottish National Party and Green Party made a statement about readiness to develop cooperation with the EU and the Conservatives and the UK Independence Party were on the side of the Eurosceptics. The opinions of the parties were also divided on military operations abroad, financing and force level. In terms of one-party government and presence of majority in the House of Commons, the Conservatives have opportunities to realize their own vision of British safety policy.
Structure and formation mechanism of the transfermium isotope {sup 254}No.
Energy Technology Data Exchange (ETDEWEB)
Reiter, P.
1998-12-17
The ground-state band of the Z=102 isotope {sup 254}No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadruple deformation, {beta} = 0.27, is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of {sup 254}No up to spin 14 means that its fission barrier persists at least up to that spin.
The German Environmentalist Party - The Greens
International Nuclear Information System (INIS)
Mettke, J.R.
1982-01-01
The Greens are winning supporters throughout the FRG, quite a few of them are already members of the parliament of various lands. Will they cooperate with the established political parties in Bonn. Will they take over from the Free Democrats the role of holding the balance of power. In this book, Spiegel editors present their analyses of the changing concepts of the new political movement. The most outstanding members of the Environmentalist Party - the so-called Greens - define their position and state their opinions on the problems of coalition forming, and prominent members of the parties of the German Bundestag answer these statements. (orig.) [de
Pomfret, Michael B; Pietron, Jeremy J; Owrutsky, Jeffrey C
2010-05-04
Raman spectroscopy and electrochemical methods were used to study the behavior of the model adsorbate benzenethiol (BT) on nanostructured Pt, Pd, and PtPd electrodes as a function of applied potential. Benzenethiol adsorbs out of ethanolic solutions as the corresponding thiolate, and voltammetric stripping data reveal that BT is oxidatively removed from all of the nanostructured metals upon repeated oxidative and reductive cycling. Oxidative stripping potentials for BT increase in the order Pt oxidizing potentials via cleavage of the Pt-S bond. In contrast, on nanoscale Pd and PtPd, BT is irreversibly lost due to cleavage of BT C-S bonds at oxidizing potentials, which leaves adsorbed sulfur oxides on Pd and PtPd films and effects the desulfurization of BT. While Pd and PtPd films are less sulfur-resistant than Pt films, palladium oxides, which form at higher potentials than Pt oxides, oxidatively desulfurize BT. In situ spectroelectrochemical Raman spectroscopy provides real-time, chemically specific information that complements the cyclic voltammetric data. The combination of these techniques affords a powerful and convenient method for guiding the development of sulfur-tolerant PEMFC catalysts.
Sex Parties: Female Teen Sexual Experimentation
Toscano, Sharyl Eve
2006-01-01
Adolescent participants in a study aimed at exploring the nature and characteristics of girls' dating relationships revealed the phenomenon of sex parties. These teens defined a "sex party" as an opportunity to engage in sexual contact outside of typical dating relationships. Sexual activity could involve actual intercourse, but usually involved…
Server-Aided Two-Party Computation with Simultaneous Corruption
DEFF Research Database (Denmark)
Cascudo Pueyo, Ignacio; Damgård, Ivan Bjerre; Ranellucci, Samuel
We consider secure two-party computation in the client-server model where there are two adversaries that operate separately but simultaneously, each of them corrupting one of the parties and a restricted subset of servers that they interact with. We model security via the local universal composab......We consider secure two-party computation in the client-server model where there are two adversaries that operate separately but simultaneously, each of them corrupting one of the parties and a restricted subset of servers that they interact with. We model security via the local universal...
Isotope effects in the non enzymic glycation of hemoglobin catalyzed by DPG
Energy Technology Data Exchange (ETDEWEB)
Gil, Herminia; Uzcategui, Jorge [Universidad de Los Andes, Merida (Venezuela). Dept. de Quimica
1993-12-31
The paradigmatic reaction of glucose with hemoglobin (Hb A{sub o}) has been studied and is known to occur most rapidly at the N-terminal valine of the {beta}-subunit. An initial, rapid imine formation is succeeded by slower Amadori rearrangement. Non enzymic glycation of Hb A{sub o} was studied in vitro in buffer Tris 10 mM in H{sub 2} O and D{sub 2} O, pH 7.3, pD 7.8 at 37 deg C at a fixed concentration of 2,3 diphosphoglycerate (DPG). The reaction exhibits identical rates in protium and deuterium oxides. When D-glucose-2-h is compared with D-glucose-2-d, the kinetic isotope effect for the DPG-dependent rate is 2.1 {+-} 0.3, while the DPG-independent rate constant shows no isotope effect (1.1 {+-} 0.1). The absence of a rate in isotopic water solvents shows that proton donation for solvent, lyons or DPG does not limit the rate. The substrate isotope effect of around 2 for the DPG kinetic term indicates that the proton abstraction step of the Amadori rearrangement by DPG is wholly or partially rate-limiting for this reaction. (author) 23 refs., 4 figs.
Structural Biology of the Immune Checkpoint Receptor PD-1 and Its Ligands PD-L1/PD-L2
Zak, Krzysztof M.; Grudnik, Przemyslaw; Magiera, Katarzyna; Dömling, Alexander; Dubin, Grzegorz; Holak, Tad A.
2017-01-01
Cancer cells can avoid and suppress immune responses through activation of inhibitory immune checkpoint proteins, such as PD-1, PD-L1, and CTLA-4. Blocking the activities of these proteins with monoclonal antibodies, and thus restoring T cell function, has delivered breakthrough therapies against
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Application. 720.102 Section 720.102 Indians THE OFFICE OF NAVAJO AND HOPI INDIAN RELOCATION ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE NAVAJO AND HOPI INDIAN RELOCATION COMMISSION § 720.102 Application...
International Nuclear Information System (INIS)
Pardini, Allan F.; Posakony, Gerald J.
2003-01-01
COGEMA Engineering Corporation (COGEMA), under a contract from CH2M Hill Hanford Group (CH2M Hill), has performed an ultrasonic examination of the knuckle region of Double-Shell Tank 241-AW-102 utilizing the Remotely Operated Nondestructive Examination (RONDE) system. The purpose of this examination was to provide information that could be used to evaluate the integrity of the knuckle region of the primary tank. The requirements for the ultrasonic examination of Tank 241-AW-102 were to detect, characterize (identify, size, and locate), and record measurements made of any circumferentially oriented cracks that might be present in the knuckle area of the primary tank. Any measurements that exceed the requirements set forth in the Engineering Task Plan (ETP), RPP-7869, are reported to CH2M Hill and the Pacific Northwest National Laboratory (PNNL) for further evaluation. Under the contract with CH2M Hill, all data is to be recorded on disk and paper copies of all measurements are provided t o PNNL for third-party evaluation. PNNL is responsible for preparing a report(s) that describes the results of the COGEMA ultrasonic examinations
International Nuclear Information System (INIS)
Geraldes, Adriana Napoleao; Silva, Dionisio Fortunato da; Pino, Eddy Segura; Spinace, Estevan Vitorio; Oliveira Neto, Almir; Linardi, Marcelo; Santos, Mauro Coelhos dos
2013-01-01
Carbon-supported metal nanoparticles were prepared for fuel cell applications by radiation-induced reduction of metal ions precursors. Pd/C and PdSn/C electrocatalysts (Pd:Sn atomic ratio 90:10), prepared by using electron beam irradiation, were tested for glycerol electro-oxidation in single alkaline direct glycerol fuel cell (ADGFC). EDX analysis showed that the Pd:Sn atomic ratio is very similar to the nominal one. X-ray diffractograms of PdSn/C electrocatalyst showed the presence of Pd (fcc) phase. Cyclic voltammetry (CV) indicated that Pd/C and PdSn/C electrocatalysts have good activity for glycerol electro-oxidation, at room temperature. Experiments with single ADGFC were carried out from 60 to 90 deg C, using Pd/C and PdSn/C electrocatalysts and glycerol 2.0 mol.L -1 , as fuel. The best performance was obtained at 85 deg C, for both electrocatalysts. The Pd/C and PdSn/C electrocatalysts showed similar performance (34 mW cm -2 ), at 85 deg C. (author)
12 CFR 747.603 - Prevailing party.
2010-01-01
... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Prevailing party. 747.603 Section 747.603 Banks... in NCUA Board Adjudications § 747.603 Prevailing party. An eligible applicant may be a “prevailing... dismissed. In appropriate situations an applicant may also have prevailed if the outcome of the proceeding...
12 CFR 308.173 - Prevailing party.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Prevailing party. 308.173 Section 308.173 Banks....173 Prevailing party. (a) General rule. An eligible applicant who, following an adversary adjudication has gained victory on the merits in the proceeding is a “prevailing party”. An eligible applicant may...
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Settlement. 102.151 Section 102.151 Labor Regulations... Expenses § 102.151 Settlement. The applicant and the General Counsel may agree on a proposed settlement of... on a proposed settlement of an award before an application has been filed, the proposed settlement...
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Application. 410.102 Section 410.102 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.102 Application...
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false State. 102.7 Section 102.7 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Definitions § 102.7 State. The term State as used herein shall include the District of Columbia and all States, Territories, and possessions...
2010-01-01
...) NOTIFICATION OF POST-EMPLOYMENT RESTRICTIONS § 730.102 Definitions. Agency means an Executive agency as defined in 5 U.S.C. 105, but does not include the General Accounting Office. Senior executive means a member... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Definitions. 730.102 Section 730.102...
6 CFR 13.13 - Parties to the hearing.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Parties to the hearing. 13.13 Section 13.13 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.13 Parties to the hearing. (a) The parties to the hearing will be the Defendant and the Authority...
The PD-1/PD-L1 complex resembles the antigen-binding Fv domains of antibodies and T cell receptors
Energy Technology Data Exchange (ETDEWEB)
Lin, David Yin-wei; Tanaka, Yoshimasa; Iwasaki, Masashi; Gittis, Apostolos G.; Su, Hua-Poo; Mikami, Bunzo; Okazaki, Taku; Honjo, Tasuku; Minato, Nagahiro; Garboczi, David N. (NIH); (Kyoto)
2008-07-29
Signaling through the programmed death 1 (PD-1) inhibitory receptor upon binding its ligand, PD-L1, suppresses immune responses against autoantigens and tumors and plays an important role in the maintenance of peripheral immune tolerance. Release from PD-1 inhibitory signaling revives 'exhausted' virus-specific T cells in chronic viral infections. Here we present the crystal structure of murine PD-1 in complex with human PD-L1. PD-1 and PD-L1 interact through the conserved front and side of their Ig variable (IgV) domains, as do the IgV domains of antibodies and T cell receptors. This places the loops at the ends of the IgV domains on the same side of the PD-1/PD-L1 complex, forming a surface that is similar to the antigen-binding surface of antibodies and T cell receptors. Mapping conserved residues allowed the identification of residues that are important in forming the PD-1/PD-L1 interface. Based on the structure, we show that some reported loss-of-binding mutations involve the PD-1/PD-L1 interaction but that others compromise protein folding. The PD-1/PD-L1 interaction described here may be blocked by antibodies or by designed small-molecule drugs to lower inhibitory signaling that results in a stronger immune response. The immune receptor-like loops offer a new surface for further study and potentially the design of molecules that would affect PD-1/PD-L1 complex formation and thereby modulate the immune response.
Celani, F; Righi, E; Trenta, G; Catena, C; D’Agostaro, G; Quercia, P; Andreassi, V; Marini, P; Di Stefano, V; Nakamura, M; Mancini, A; Sona, P G; Fontana, F; Gamberale, L; Garbelli, D; Celia, E; Falcioni, F; Marchesini, M; Novaro, E; Mastromatteo, U
2005-01-01
Abstract They were continued, at National Institute of Nuclear Physics, Frascati National Laboratories-Italy, the systematic studies about detection of new elements, some even with isotopic composition different from natural one, after prolonged electrolysis of Pd wires. The electrolytic solution adopted is the, unusual, used from our experimental group since 1999. In short, it was a mixture of both heavy ethyl alcohol (C2H5OD at 90-95%) and water (D2O, at 10-5%), with Th salts at micromolar concentration and Hg at even lower concentration (both of spectroscopic purity). The liquid solutions, before use, were carefully vacuum distilled (and on line 100nm filtered) at low temperatures (30-40°C) and analysed by ICP-MS. The pH was kept quite mild (acidic at about 3-4). The cathode is Pd (99.9% purity) in the shape of long (60cm) and thin wires (diameter only 0.05mm). Before use, it is carefully cleaned and oxidised by Joule heating in air following a (complex) procedure from us continuously improved (since 1995...
Energy Technology Data Exchange (ETDEWEB)
Leyva Noyola, Fatima; Solorza Feria, Omar [Centro de Investigacion y Estudios Superiores del IPN, Mexico, D.F. (Mexico)]. E-mail: fleyva@cinvestav.mx
2009-09-15
This work reports on the catalytic activity of RuPd, RuCo, PdCo and RuPdCo material for oxygen reduction reaction (ORR). These materials were synthesized using chemical reduction with NaBH{sub 4} as a reducing agent in THF, in ambient temperature and pressure conditions. The evaluation of the catalytic activity was done using cyclic voltamperometry (CV) and rotary disc electrode (RDE) in H{sub 2}SO{sub 4} 0.5 M. The kinetic results showed that the electrochemical reaction involves 4 electrons and the transfer of the first electron is the determinant stage. The values of {alpha}, i0 and the Tafel slope were very similar for the four materials studied, around 0.4, 5x10{sup -6} mA cm{sup -2} and 60 mV dec-1, respectively. Although these values are less than those reported for nanostructured platinum, they are better than those reported for other materials such as pure Pd, which enables them to be considered as cathode catalysts for a proton exchange membrane fuel cell. [Spanish] En este trabajo se reporta la actividad catalitica de los materiales RuPd, RuCo, PdCo y RuPdCo para la reaccion de reduccion de oxigeno (RRO). Estos materiales fueron sintetizados por el metodo de reduccion quimica, usando NaBH{sub 4} como agente reductor en THF, en condiciones de temperatura y presion ambiental. La evaluacion de la actividad catalitica fue realizada usando Voltamperometria Ciclica (VC) y Electrodo Disco Rotatorio (EDR) en H{sub 2}SO{sub 4} 0.5 M. Los resultados cineticos mostraron que la reaccion electroquimica procede por la via de 4 electrones y la etapa determinante es la transferencia del primer electron. Los valores de {alpha}, i0 y pendiente de Tafel fueron muy similares para los 4 materiales estudiados, siendo estos de alrededor de 0.4, 5x10{sup -6} mA cm{sup -2} y 60 mV dec{sup -1}, respectivamente. Sin embargo, aun cuando estos valores son menores que los reportados para platino nanoestructurado, son mejores que los reportados para otros materiales como el Pd puro
Social Networks and Political Parties in Chile
Adler Lomnitz, Larissa
2002-01-01
This paper describes the origin and evolution of two Chilean political parties (the Radical Party and the Christian Democrat Party) through the analysis of the social networks that originated and composed them. The aim of this study is to propose a model of national political cultures on the basis of the structure of social networks related to power and of the symbol system, which legitimizes it. The structure of social networks, horizontal and vertical, are based on reciprocal or redistribut...
Economic Beliefs and Party Preference
Michael W.M. Roos; Andreas Orland
2014-01-01
This paper reports the results of a questionnaire study used to explore the economic understanding, normative positions along the egalitarian-libertarian spectrum, and the party preferences of a large student sample. The aim of the study is both to find socio-economic determinants of normative and positive beliefs and to explore how beliefs about the economy influence party support. We find that positive beliefs of lay people differ systematically from those of economic experts. Positive beli...
Internal party democracy as a factor of transitional societiy consolidation
Directory of Open Access Journals (Sweden)
O. L. Tupitzya
2016-08-01
The possibility of intra-party democracy appearance as a sustainable and well played phenomena can only be based on the formation of political parties as a competitive and dynamic structures that have a high degree of internal relationships and a clear understanding of a common goal that is shared by both the governing parties and the basis of parties and ordinary party members. Distribution of party members in top management, middle functional rank and ordinary members is an obvious consequence of the organizational functioning of any extensive and systematic organization.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Information. 935.102 Section 935.102 National... WAKE ISLAND CODE Criminal Actions § 935.102 Information. (a) Any offense may be prosecuted by a written information signed by the Island Attorney. However, if the offense is one for which issue of a citation is...
2004-01-01
All staff are invited to the Golden Jubilee Staff Party on the evening of 17 September. To mark CERN's 50th anniversary, the Director General would like to invite all staff working at CERN to celebrate the success of the organization. The party will be held on the terrace of the Main Building on 17 September at 4:00 pm. The event will include an address by the DG, music, film clips, drinks and snacks. Your effort, hard work and enthusiasm have been the key to CERN's success. The first of the main events celebrating the organization's Golden Jubilee is for you, so come along and celebrate!
Wall, M.; Sudulich, M.L.
2010-01-01
This article investigates the characteristics of political parties' websites in the Republic of Ireland and seeks to evaluate whether parties' organizational structures influence the manner in which they present themselves online. Ireland has been chosen as a research environment because there is
CO tolerance of PdPt/C and PdPtRu/C anodes for PEMFC
International Nuclear Information System (INIS)
Garcia, Amanda C.; Paganin, Valdecir A.; Ticianelli, Edson A.
2008-01-01
The performance of H 2 /O 2 proton exchange membrane fuel cells (PEMFCs) fed with CO-contaminated hydrogen was investigated for anodes with PdPt/C and PdPtRu/C electrocatalysts. The physicochemical properties of the catalysts were characterized by energy dispersive X-ray (EDX) analyses, X-ray diffraction (XRD) and 'in situ' X-ray absorption near edge structure (XANES). Experiments were conducted in electrochemical half and single cells by cyclic voltammetry (CV) and I-V polarization measurements, while DEMS was employed to verify the formation of CO 2 at the PEMFC anode outlet. A quite high performance was achieved for the PEMFC fed with H 2 + 100 ppm CO with the PdPt/C and PdPtRu/C anodes containing 0.4 mg metal cm -2 , with the cell presenting potential losses below 200 mV at 1 A cm -2 , with respect to the system fed with pure H 2 . For the PdPt/C catalysts no CO 2 formation was seen at the PEMFC anode outlet, indicating that the CO tolerance is improved due to the existence of more free surface sites for H 2 electrooxidation, probably due to a lower Pd-CO interaction compared to pure Pd or Pt. For PdPtRu/C the CO tolerance may also have a contribution from the bifunctional mechanism, as shown by the presence of CO 2 in the PEMFC anode outlet
Direct and indirect welfare chauvinism as party strategies
DEFF Research Database (Denmark)
Careja, Romana; Elmelund-Præstekær, Christian; Klitgaard, Michael Baggesen
2016-01-01
negatively affect immigrants the most. Combining quantitative and qualitative analysis of labour market reforms in Denmark, where one of the most successful populist right-wing parties in Europe – the Danish People's Party – held a pivotal position in the period 2001–11, the article traces the intentions...... and deliberate policy-making strategies of the party. It shows that the distinction between direct and indirect chauvinism is a useful theoretical tool for understanding how the Danish People's Party can fulfill the expectations of both its electorate and its coalition partners, even if they point in different...
International Nuclear Information System (INIS)
Silva, Dionisio Furtunato da; Geraldes, Adriana Napoleao; Pino, Eddy Segura; Spinace, Estevam Vitorio; Oliveira Neto, Almir; Linardi, Marcelo
2013-01-01
In this study, carbon-supported Pd (Pd/C) and bimetallic PdRh (Pd:Rh 90:10 atomic ratio) (PdRh/C) electrocatalysts were prepared using electron beam irradiation. The morphology and composition of the obtained materials were characterized by Cyclic voltammetry (VC), Chronoamperometry (CA), Energy dispersive X-ray (EDX), X-ray Diffraction (XRD) and Thermo-gravimetric analysis (TGA). The catalytic activities of the electrocatalysts toward the ethanol electro-oxidation were evaluated in alkaline medium in a single alkaline direct ethanol fuel cell (ADEFC), in a range temperature of 50 to 85 deg C. The best performances were obtained at 85 deg C (25 mW.cm -2 ) and 75 deg C (38 mW.cm -2 ) for Pd/C and PdRh/C electrocatalysts, respectively. The XRD of the PdRh/C electrocatalyst showed the presence of Pd-rich (fcc) phase. CV and CA experiments showed that PdRh/C electrocatalyst demonstrated superior activity toward ethanol electro-oxidation at room temperature, compared to Pd/C electrocatalyst. (author)
Psychometric Analyses of the Birthday Party
Lee, Young-Sun
2016-01-01
The present research focuses on the psychometric properties of the Birthday Party measure for ages 3-5. The Birthday Party was developed to provide a reliable, valid, and engaging measure of early mathematical content--Number and Operation, Shape, Space, and Pattern--that can be given in either a short or a long form to English and Spanish…
The gender of party leadership and its impact on voter's asessment
DEFF Research Database (Denmark)
Kosiara-Pedersen, Karina
Even though most political parties are still male dominated, an increasing number of women reach the top position of party leader. Furthermore, party leadership is increasingly regarded as an important part of party images due to the personalization of politics. Does the gender of the party leader...... leader characteristics appreciated by men and women. If this holds, the gender of party leadership matters to women because they value woman party leaders higher, not because they value other characteristics than men....
The Hobby Horse of the Party for the Animals
Otjes, Simon
2016-01-01
Can a small, new political party increase the attention to nonhuman animal welfare? This paper traces the effect of the Party for the Animals on the Dutch parliament. This was the first animal advocacy party to enter parliament.
STEM and the Evolution of the Astronomical Star Party
Day, B. H.; Munive, P.; Franco, J.; Jones, A. P.; Shaner, A. J.; Buxner, S.; Bleacher, L.
2015-12-01
The astronomical star party has long been a powerful and effective way to engage the public and enhance cohesiveness within the amateur astronomy community. Early star parties tended to be strictly small, local events. But with improvements in transportation, larger regional star parties became popular. These advanced the considerable capabilities for citizen science in the amateur community, shared technology and engineering innovations in the field of telescope making, and refined numerous mathematical techniques in areas such instrument design and ephemeris generation, covering the full breadth of STEM. Advancements in astrophotography showcased at these events brought the star party from STEM to STEAM. Now, the advent of social media, web streaming, and virtual presence has facilitated the phenomenon of very large, networked star parties with international scope. These mega star parties take public engagement to a new, far greater levels, giving a vastly larger and more diverse public the opportunity to directly participate in exciting first-hand STEM activities. This presentation will recount the evolution of the star party and will focus on two examples of large, multinational, networked star parties, International Observe the Moon Night and Noche de las Estrellas. We will look at lessons learned and ways to participate.
Race, ideology, and the tea party: a longitudinal study.
Directory of Open Access Journals (Sweden)
Eric D Knowles
Full Text Available The Tea Party movement, which rose to prominence in the United States after the election of President Barack Obama, provides an ideal context in which to examine the roles of racial concerns and ideology in politics. A three-wave longitudinal study tracked changes in White Americans' self-identification with the Tea Party, racial concerns (prejudice and racial identification, and ideologies (libertarianism and social conservatism over nine months. Latent Growth Modeling (LGM was used to evaluate potential causal relationships between Tea Party identification and these factors. Across time points, racial prejudice was indirectly associated with movement identification through Whites' assertions of national decline. Although initial levels of White identity did not predict change in Tea Party identification, initial levels of Tea Party identification predicted increases in White identity over the study period. Across the three assessments, support for the Tea Party fell among libertarians, but rose among social conservatives. Results are discussed in terms of legitimation theories of prejudice, the "racializing" power of political judgments, and the ideological dynamics of the Tea Party.
Race, Ideology, and the Tea Party: A Longitudinal Study
Knowles, Eric D.; Lowery, Brian S.; Shulman, Elizabeth P.; Schaumberg, Rebecca L.
2013-01-01
The Tea Party movement, which rose to prominence in the United States after the election of President Barack Obama, provides an ideal context in which to examine the roles of racial concerns and ideology in politics. A three-wave longitudinal study tracked changes in White Americans’ self-identification with the Tea Party, racial concerns (prejudice and racial identification), and ideologies (libertarianism and social conservatism) over nine months. Latent Growth Modeling (LGM) was used to evaluate potential causal relationships between Tea Party identification and these factors. Across time points, racial prejudice was indirectly associated with movement identification through Whites’ assertions of national decline. Although initial levels of White identity did not predict change in Tea Party identification, initial levels of Tea Party identification predicted increases in White identity over the study period. Across the three assessments, support for the Tea Party fell among libertarians, but rose among social conservatives. Results are discussed in terms of legitimation theories of prejudice, the “racializing” power of political judgments, and the ideological dynamics of the Tea Party. PMID:23825630
Turkish Political Market and the Perception of Political Parties
Directory of Open Access Journals (Sweden)
Cihat Polat
2015-06-01
Full Text Available This study attempts to describe the Turkish political market and determine where and how Turkish political parties are perceived by voters. The study uses a two-dimensional map to determine the voter perceptions of the parties in the Turkish political market based on a survey questionnaire applied to 400 young voters. It also investigates whether there are any major differences in the perception of parties in the political space based on voter ideologies. The study finds that young voters have clear perceptions of the positions of Turkish parties. It also finds that voter perceptions of parties vary based on voters’ ideological positions.
Energy Technology Data Exchange (ETDEWEB)
Maximenko, A., E-mail: Alexey.Maximenko@ifj.edu.pl [The Henryk Niewodniczanski Institute of Nuclear Physics Polish Academy of Sciences, Radzikowskiego Str. 152, 31-342 Krakow (Poland); Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya Str. 11, 220030 Minsk (Belarus); Fedotova, J. [Research Institute for Nuclear Problems of Belarusian State University, Bobruiskaya Str. 11, 220030 Minsk (Belarus); Marszałek, M.; Zarzycki, A.; Zabila, Y. [The Henryk Niewodniczanski Institute of Nuclear Physics Polish Academy of Sciences, Radzikowskiego Str. 152, 31-342 Krakow (Poland)
2016-02-15
Hard magnetic antidot arrays show promising results in context of designing of percolated perpendicular media. In this work the technology of magnetic FePd and CoPd antidot arrays fabrication is presented and correlation between surface morphology, structure and magnetic properties is discussed. CoPd and FePd antidot arrays were fabricated by deposition of Co/Pd and Fe/Pd multilayers (MLs) on porous anodic aluminum oxide templates with bowl-shape cell structure with inclined intercellular regions. FePd ordered L1{sub 0} structure was obtained by successive vacuum annealing at elevated temperatures (530 °C) and confirmed by XRD analysis. Systematic analysis of magnetization curves evidenced perpendicular magnetic anisotropy of CoPd antidot arrays, while FePd antidot arrays revealed isotropic magnetic anisotropy with increased out-of-plane magnetic contribution. MFM images of antidots showed more complicated contrast, with alternating magnetic dots oriented parallel and antiparallel to tip magnetization moment. - Highlights: • CoPd and FePd antidots were fabricated on porous anodic aluminum oxide templates. • CoPd antidot arrays have perpendicular magnetic anisotropy. • FePd antidot arrays revealed isotropic magnetic behavior. • The complex morphology of nanoporous template resulted in a complex magnetic domains image.
Comparing PD results with visual inspection
International Nuclear Information System (INIS)
Rossi, A.; Stone, G.C.
2005-01-01
ENEL is the main generation utility in Italy, with more than 200 hydro units and 120 turbine generators, totaling 39,000 MW of capacity. To help identify the maintenance needs of the stator windings in these units, ENEL has been gradually equipping the generators with partial discharge (PD) sensors that facilitate an on-line measurement of the PD. The paper describes results from several machines that have PD. In all cases, the high PD was confirmed by visual inspections. Although PD usually found the units with severe insulation problems, it was not always possible to determine the causes of the deterioration from the PD pattern. (author)
Energy Technology Data Exchange (ETDEWEB)
Santana, A.; Ramos-Sanchez, G.; Vazquez, G.; Solorza-Feria, O. [Centro de Investigaciones y de Estudios Avanzados del IPN, Mexico D.F. (Mexico)]. E-mail: gramos@cinvestav.mx
2009-09-15
The search for new materials capable of catalyzing oxygen reactions in low temperature fuel cells continues to be one of the key issues in the development of a hydrogen economy. Electrochemical and physical characterization studies have demonstrated that the PdNi and PdNiSe catalysts have adequate properties for use as cathodes in fuel cells. Nevertheless, the performance of the materials in proton exchange membrane (PEM) fuel cells depends not only on the catalytic properties but also on the adequate preparation of the electrocatalyst membrane interface (EMI). This work presents the results of the search for optimal conditions to prepare the EMIs with PdNi and PdNiSe cathodes. There are many variables for handling the preparation of the interfaces, nevertheless our search focuses on two: catalyst ratio/Vulcan Carbon® and the catalyst amount. Interfaces were prepared with an active area of 5 cm{sup 2} with PdNi and PdNiSe cathodes and carbon fabric anode with Pt E-tek®. These interfaces were tested with an ElectroChem model under different gas pressure and temperature conditions. The optimization method was carried out using a simplex method with the variables mentioned above and power density per unit mass and catalyst area as response variables. [Spanish] La busqueda de nuevos materiales capaces de catalizar la Reaccion de Oxigeno (RRO) en celdas de combustible de baja temperatura, sigue siendo uno de los temas clave para el desarrollo de una Economia del Hidrogeno. Estudios electroquimicos y de caracterizacion fisica han demostrado que los catalizadores PdNi y PdNiSe, tienen las propiedades adecuadas para poder ser utilizados como catodos en celdas de combustible; sin embargo el desempeno de los materiales en celdas de combustible de membrana de intercambio protonico (PEM), no solo depende de las propiedades del catalizador, sino tambien de la preparacion adecuada del Ensamble Membrana Electrocatalizador (EME). En este trabajo se presentan los resultados de la
Directory of Open Access Journals (Sweden)
Marcel Bilow
2015-08-01
Full Text Available PD Lab explores the applications of building sector related product development. PD lab investigates and tests digital production technologies like CNC milled wood connections. It will also act as a platform in its wider meaning to investigate the effects and influences of file to factory production, to explore the potential in the field of sustainability, material use, logistics and the interaction of stakeholders within the chain of the building process.
Energy Technology Data Exchange (ETDEWEB)
Bilous, O [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1958-07-01
This report describes the major problems which arise in the choice of characteristics required in a gaseous diffusion installation for the separation of uranium isotopes. This choice depends largely on economic evaluations, and also on considerations of simplicity. The choice of working pressures and of the characteristics of the membrane are described, as are the possible alternatives regarding the structure of the stages and the problems of control. (author) [French] Ce rapport decrit les problemes majeurs qui se posent dans le choix des caracteristiques d'une installation de diffusion gazeuse destinee a la separation des isotopes de l'uranium. Ce choix depend en grande partie d'evaluations economiques et repose egalement sur des considerations de simplicite. On decrit ainsi le choix des pressions d'operation, celui des caracteristiques de la barriere, les alternatives possibles concernant la structure des etages et les problemes de regulation. (auteur)
Energy Technology Data Exchange (ETDEWEB)
Silva, Dionisio Furtunato da; Geraldes, Adriana Napoleao; Pino, Eddy Segura; Spinace, Estevam Vitorio; Oliveira Neto, Almir; Linardi, Marcelo, E-mail: dfsilva@ipen.br, E-mail: drinager@ig.com.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2013-07-01
In this study, carbon-supported Pd (Pd/C) and bimetallic PdRh (Pd:Rh 90:10 atomic ratio) (PdRh/C) electrocatalysts were prepared using electron beam irradiation. The morphology and composition of the obtained materials were characterized by Cyclic voltammetry (VC), Chronoamperometry (CA), Energy dispersive X-ray (EDX), X-ray Diffraction (XRD) and Thermo-gravimetric analysis (TGA). The catalytic activities of the electrocatalysts toward the ethanol electro-oxidation were evaluated in alkaline medium in a single alkaline direct ethanol fuel cell (ADEFC), in a range temperature of 50 to 85 deg C. The best performances were obtained at 85 deg C (25 mW.cm{sup -2}) and 75 deg C (38 mW.cm{sup -2}) for Pd/C and PdRh/C electrocatalysts, respectively. The XRD of the PdRh/C electrocatalyst showed the presence of Pd-rich (fcc) phase. CV and CA experiments showed that PdRh/C electrocatalyst demonstrated superior activity toward ethanol electro-oxidation at room temperature, compared to Pd/C electrocatalyst. (author)
2004-01-01
All staff are invited to the Golden Jubilee Staff Party on the evening of 17 September. To mark CERN's 50th anniversary, the Director General would like to invite all staff working at CERN to celebrate the success of the organization. The party will be held on the terrace of the Main Building on 17 September at 4:00 pm. The event will include an address by the DG, music, film clips, drinks and snacks! Your effort, hard work and enthusiasm have been the key to CERN's success. The first of the main events celebrating the organization's Golden Jubilee is for you, so come along and celebrate! http://www.cern.ch/cern50/
2004-01-01
All staff are invited to the Golden Jubilee Staff Party on the evening of 17 September To mark CERN's 50th anniversary, the Director General would like to invite all staff working at CERN to celebrate the success of the organization. The party will be held on the terrace of the Main Building on 17 September at 4:00 pm. The event will include an address by the DG, music, film clips, drinks and snacks. Your effort, hard work and enthusiasm have been the key to CERN's success. The first of the main events celebrating the organization's Golden Jubilee is for you, so come along and celebrate! http://www.cern.ch/cern50/
Gwynn, Morgan E; DeRemer, David L
2018-01-01
To summarize and evaluate immunotherapy agents targeting programmed cell death protein-1 (PD-1) and programmed death ligand-1 (PD-L1) recently approved for the treatment of metastatic urothelial carcinomas (UC). A literature review was performed using PubMed (2012 to June 2017), the American Society of Clinical Oncology abstract databases (2012 to June 2017 Annual Meetings/symposia), and the America Association for Cancer Research symposia (2012 to June 2017). A search using clinicaltrials.gov was conducted to identify studies for atezolizumab, avelumab, durvalumab, nivolumab, and pembrolizumab. English language phase I to III studies assessing PD-1 and PD-L1 in UC were incorporated. Atezolizumab, avelumab, durvalumab, nivolumab, and pembrolizumab have demonstrated clinical efficacy with tolerable toxicities in patients with metastatic UC with disease progression following platinum-based chemotherapy. Anti-PD-1/PD-L1 therapies may provide overall survival advantage; these are currently being evaluated in ongoing phase 3 studies. Greater objective response rates seem to be observed in PD-L1-positive patients versus PD-L1-negative patients, but methodologies in this assessment differ among clinical trials. The identification of biomarkers that provide greater insight into patients who positively respond to PD-1/PD-L1 therapies are needed. Treatment options for metastatic UC have expanded to include PD-1/PD-L1 therapies. These agents should be strongly considered as second-line therapy over single-agent chemotherapy for patients who fail or progress after platinum-based treatment.
Directory of Open Access Journals (Sweden)
Sheetal eBodhankar
2014-08-01
Full Text Available Stroke outcome is worsened by the infiltration of inflammatory immune cells into ischemic brains. Our recent study demonstrated that PD-L1- and to a lesser extent PD-L2-deficient mice had smaller brain infarcts and fewer brain-infiltrating cells vs. WT mice, suggesting a pathogenic role for PD-Ligands in experimental stroke. We sought to ascertain PD-L1 and PD-L2-expressing cell types that affect T-cell activation, post-stroke in the context of other known co-stimulatory molecules. Thus, cells from male WT and PD-L-deficient mice undergoing 60 min of middle cerebral artery occlusion (MCAO followed by 96h of reperfusion were treated with neutralizing antibodies to study co-stimulatory and co-inhibitory interactions between CD80, CTLA-4, PD-1 and PD-Ls that regulate CD8+ and CD4+ T-cell activation. We found that antibody neutralization of PD-1 and CTLA-4 signaling post-MCAO resulted in higher proliferation in WT CD8+ and CD4+ T-cells, confirming an inhibitory role of PD-1 and CTLA-4 on T-cell activation. Also, CD80/CD28 interactions played a prominent regulatory role for the CD8+ T-cells and the PD-1/PD-L2 interactions were dominant in controlling the CD4+ T-cell responses in WT mice after stroke. A suppressive phenotype in PD-L1-deficient mice was attributed to CD80/CTLA-4 and PD-1/PD-L2 interactions. PD-L2 was crucial in modulating CD4+ T-cell responses, whereas PD-L1 regulated both CD8+ and CD4+ T-cells. To establish the contribution of PD-L1 and PD-L2 on regulatory B-cells (Bregs, infarct volumes were evaluated in male PD-L1- and PD-L2-deficient mice receiving IL-10+ B-cells 4h post-MCAO. PD-L2- but not PD-L1-deficient recipients of IL-10+ B-cells had markedly reduced infarct volumes, indicating a regulatory role of PD-L2 on Bregs. These results imply that PD-L1 and PD-L2 differentially control induction of T- and Breg-cell responses after MCAO, thus suggesting that selective targeting of PD-L1 and PD-L2 might represent a valuable therapeutic
13 CFR 120.920 - Required participation by the Third Party Lender.
2010-01-01
...) Third Party Loan collateral. Third Party Loans usually are collateralized by a first lien on the Project... BUSINESS LOANS Development Company Loan Program (504) Third Party Loans § 120.920 Required participation by the Third Party Lender. (a) Amount of Third Party Loans. A Project financing must include one or more...
Crossing boundaries : Involving external parties in innovation
Slot, J.H.
2013-01-01
To improve the return on investments in innovation, firms increasingly open up their new product development (NPD) processes by inviting external parties to participate. This dissertation focuses on the involvement of three different types of external parties in the NPD process: suppliers,
Robert E. Keane
2006-01-01
The Plot Description (PD) form is used to describe general characteristics of the FIREMON macroplot to provide ecological context for data analyses. The PD data characterize the topographical setting, geographic reference point, general plant composition and cover, ground cover, fuels, and soils information. This method provides the general ecological data that can be...
Major trends in party system in Ukraine for 1998-2014 years
Directory of Open Access Journals (Sweden)
D. K. Nosenko
2015-01-01
Full Text Available The current party system of Ukraine, defined its main features and trends with regard of parliamentary elections 2014 was investigated. The classification, which distinguish the parliamentary system was determined. It is established that the party system has undergone significant changes compared to previous years. Thus, according to classification Mayra Ukrainian party system evolved from a secondary party system to a system of small parties because the two largest parties have 47.5% of votes in parliament. Meyer’s Index fell by almost a factor of 2, indicating that the party system became more competitive, the process of forming a coalition will be longer, and the stability of the government will be lower than in previous years. The calculated effective indices of the number of parties suggested Laakso, Taagepera and Golosov also show that the party system became more fragmented. Based on the analyzed results of parliamentary elections for 19982014 years, it has found that increasing or decreasing the percentage threshold of 1%, not significantly affected by the number of parties represented in Parliament; none of the parties could not be present in every convocation; there is uncertainty in electoral preferences.
5 CFR 430.102 - Performance management.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Performance management. 430.102 Section 430.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE MANAGEMENT Performance Management § 430.102 Performance management. (a) Performance management is the...
Li, Yujing; Wang, Zhi Wei; Chiu, Chin-Yi; Ruan, Lingyan; Yang, Wenbing; Yang, Yang; Palmer, Richard E.; Huang, Yu
2012-01-01
Bimetallic Pt-Pd core-shell nanocrystals (NCs) are synthesized through a two-step process with controlled Pd thickness from sub-monolayer to multiple atomic layers. The oxygen reduction reaction (ORR) catalytic activity and methanol oxidation reactivity of the core-shell NCs for fuel cell applications in alkaline solution are systematically studied and compared based on different Pd thickness. It is found that the Pd shell helps to reduce the over-potential of ORR by up to 50mV when compared to commercial Pd black, while generating up to 3-fold higher kinetic current density. The carbon monoxide poisoning test shows that the bimetallic NCs are more resistant to the CO poisoning than Pt NCs and Pt black. It is also demonstrated that the bimetallic Pt-Pd core-shell NCs can enhance the current density of the methanol oxidation reaction, lowering the over-potential by 35 mV with respect to the Pt core NCs. Further investigation reveals that the Pd/Pt ratio of 1/3, which corresponds to nearly monolayer Pd deposition on Pt core NCs, gives the highest oxidation current density and lowest over-potential. This study shows for the first time the systematic investigation of effects of Pd atomic shells on Pt-Pd bimetallic nanocatalysts, providing valuable guidelines for designing high-performance catalysts for fuel cell applications.Bimetallic Pt-Pd core-shell nanocrystals (NCs) are synthesized through a two-step process with controlled Pd thickness from sub-monolayer to multiple atomic layers. The oxygen reduction reaction (ORR) catalytic activity and methanol oxidation reactivity of the core-shell NCs for fuel cell applications in alkaline solution are systematically studied and compared based on different Pd thickness. It is found that the Pd shell helps to reduce the over-potential of ORR by up to 50mV when compared to commercial Pd black, while generating up to 3-fold higher kinetic current density. The carbon monoxide poisoning test shows that the bimetallic NCs are more
Modelling the dynamics of two political parties in the presence of switching.
Nyabadza, F; Alassey, Tobge Yawo; Muchatibaya, Gift
2016-01-01
This paper generalizes the model proposed by Misra, by considering switching between political parties. In the model proposed, the movements of members from political party B to political party C and vice versa, are considered but the net movement is considered by assuming that [Formula: see text] (a constant), which implies that the movement of members is either from party B to party C or from party C to party B. In this paper we remodel these movements through switching functions to capture how individuals switch between parties. The results provide a more comprehensive synopsis of the dynamics between two political parties.
Wang, An-Liang; Xu, Han; Feng, Jin-Xian; Ding, Liang-Xin; Tong, Ye-Xiang; Li, Gao-Ren
2013-07-24
Low cost, high activity, and long-term durability are the main requirements for commercializing fuel cell electrocatalysts. Despite tremendous efforts, developing non-Pt anode electrocatalysts with high activity and long-term durability at low cost remains a significant technical challenge. Here we report a new type of hybrid Pd/PANI/Pd sandwich-structured nanotube array (SNTA) to exploit shape effects and synergistic effects of Pd-PANI composites for the oxidation of small organic molecules for direct alcohol fuel cells. These synthesized Pd/PANI/Pd SNTAs exhibit significantly improved electrocatalytic activity and durability compared with Pd NTAs and commercial Pd/C catalysts. The unique SNTAs provide fast transport and short diffusion paths for electroactive species and high utilization rate of catalysts. Besides the merits of nanotube arrays, the improved electrocatalytic activity and durability are especially attributed to the special Pd/PANI/Pd sandwich-like nanostructures, which results in electron delocalization between Pd d orbitals and PANI π-conjugated ligands and in electron transfer from Pd to PANI.
Third party objection and action against enforcement: Request for exclusion
Directory of Open Access Journals (Sweden)
Salma Marija
2014-01-01
Full Text Available This paper deals with a right of a third party to prevent enforcement on the basis of a claim and evidence that rights or assets seized in enforcement proceeding belong to him (third party and not to the enforcement debtor. In most of jurisdictions that were subject of analysis of this paper, this right of a third party is exercised by filing an objection to the court conducting enforcement proceedings. The claim of the third party is directed towards the enforcement creditor as well as against the enforcement debtor. In the event the claim of the third party is being contested, the court instructs the third party to initiate litigation proceedings for determining whether the third party is entitled to exclusion of such rights or assets from enforcement, especially if such third party holds property rights or some other rights over the assets that are being subject to enforcement proceedings. In majority of analyzed jurisdictions, enforcement proceedings are being suspended provided the third party, in the objection being filed makes prima facie likely, on the basis of credible evidence, that his assets were seized in the enforcement proceedings. However, according to the law of the Republic of Serbia, a credible objection of a third party does not result in suspension of enforcement proceedings, something that is being criticized in this paper. As a result of this provision of the law, a bona fide third party is forced to endure the enforcement although his claim has been made likely and subsequently confirmed in the litigation proceedings. The author, in particular, points to the legal consequences of mala fide enforcement creditor that knew that the assets that are being subject of the enforcement proceedings do not belong to the enforcement debtor. The author is of the opinion that, in such cases, the enforcement creditor should be obliged to pay to the third party damages that such party suffered as a result of enforcement proceedings being
Public Funding of Political Parties
DEFF Research Database (Denmark)
Ortuno-Ortin, Ignacio; Schultz, Christian
This paper concerns public funding of parties. Parteis receive public funds depending on their vote share. Funds finance electoral campaigns. Two cases are investigated. In the first, some voters are policy motivated and some are ?impressionable? ? their vote depends directly on campaign...... expenditures. In the second, campaigning is informative and all voters are policy motivated. Public funds increase policy convergence in both cases. The effect is larger, the more funding depends on vote shares. When campaigns are informative, there may be multiple euqilibria. Intuitively, a large party can...
Bewitched - The Tea Party Movement
DEFF Research Database (Denmark)
Ashbee, Edward
2011-01-01
This article considers the development of the Tea Party movement, the character of its thinking and the nature of the interests and constituencies to which it is tied. The article suggests that despite the importance of ideas and interests, and the process of interaction between them, the movement....... The political friction that this creates has contributed to the anger that has characterised the movement. While the Tea Party movement may, as such, have only an ephemeral existence, independent conservatives are likely to remain a significant and potent constituency and will, within the institutional...
48 CFR 4.102 - Contractor's signature.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contractor's signature. 4.102 Section 4.102 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL ADMINISTRATIVE MATTERS Contract Execution 4.102 Contractor's signature. (a) Individuals. A contract with an...
Preparation of 103Pd seed-molecular plating of 103Pd onto silver rod
International Nuclear Information System (INIS)
Zhang Chunfu; Wang Yongxian; Tian Haibin; Yin Duanzhi
2002-01-01
A method for 103 Pd 'molecular plating' onto the surface of a silver rod is reported. The optimal composition of the plating bath is as follows: palladium chloride 0.1 mol/l, formaldehyde 2 mol/l, nitric acid 1 mol/l, and formic acid 0.4 mol/l. The 103 Pd molecular plating procedure will last 25 min at 30 deg. C. This article provides a valuable experience for the preparation of 103 Pd brachytherapy seed
Domain structures and magnetization reversal in Co/Pd and CoFeB/Pd multilayers
Energy Technology Data Exchange (ETDEWEB)
Sbiaa, R., E-mail: rachid@squ.edu.om [Department of Physics, Sultan Qaboos University, P.O. Box 36, PC 123 (Oman); Ranjbar, M. [Physics Department, University of Gothenburg, 412 96 Gothenburg (Sweden); Åkerman, J. [Physics Department, University of Gothenburg, 412 96 Gothenburg (Sweden); Materials Physics, School of ICT, Royal Institute of Technology (KTH), 164 40 Kista (Sweden)
2015-05-07
Domain structures and magnetization reversal of (Co/Pd) and (CoFeB/Pd) multilayers with 7 and 14 repeats were investigated. The Co-based multilayers show much larger coercivities, a better squareness, and a sharper magnetization switching than CoFeB-based multilayers. From magnetic force microscopy observations, both structures show strong reduction in domains size as the number of repeats increases but the magnetic domains for Co-based multilayers are more than one order of magnitude larger than for CoFeB-based multilayers. By imaging domains at different times, breaks in the (CoFeB/Pd) multilayer stripes were observed within only few hours, while no change could be seen for (Co/Pd) multilayers. Although CoFeB single layers are suitable for magnetoresistive devices due to their large spin polarization and low damping constants, their lamination with Pd suffers mainly from thermal instability.
Golkar Party's Political Communications the New Paradigm Bakrie Leadership 2009-2013
Directory of Open Access Journals (Sweden)
Khoiruddin Muchtar
2013-11-01
Full Text Available This study base on the efforts of the Golkar Party's to the process of interpretation, socialization, and implementation of the new paradigm, the paradigm guide to reformations Golkar Party's become to democratic, independent, solid, strong, foundamental, and responsive. How Golkar party's political communication about socialization and implementation of a new paradigm of Golkar Party's leadership Aburizal Bakrie-year period from 2009 to 2012.The aim of this research is to study and overview of the process of socialization and implementation new paradigm Golkar Party's of the Aburizal Bakrie’s leadership. This contect described to using constructivist paradigm through the theory of Performance of Communication and Structuration. Research using the case study method. Data obtained by participation observer, unstructured interviews, and documentary study. The data also collected from informants. The results of this research show: 1 The Golkar Party's has a very significant infrastructure, so the making easier to socialization new paradigm to internal party, but Golkar Party's can not erase stigma society as the New Order party. Socializing new paradigm Golkar Party's to be done in integrated, systematic and continuous addressed to all cadres of various levels from the center to the village. 2 the new paradigm Golkar Party's ideals as the basis and foundation values stand for the Golkar Party's, the implementation is faced with the reality of the condition of the various political considerations and the interests of power, so it can not shown the Golkar Party's political communication with the direction of the reality, Golkar Party's must be have to political communication with the role of multi faces.
Flawed Political Party Primaries In Nigeria's Fourth Republic: The ...
African Journals Online (AJOL)
African Journal for the Psychological Study of Social Issues ... However, through an assessment of extant secondary data, this paper submits that the experience in the Peoples Democratic Party; the ruling party, during the 2007 General Elections was a case of deliberate imposition of candidates by powerful party leaders.
Isotopic exchange between deuterium and neohexane on supported platinum and palladium catalysts
International Nuclear Information System (INIS)
Eskinazi, V.
1979-01-01
The isotopic exchange reaction between neohexane and deuterium on supported Pt/SiO 2 and Pd/SiO 2 catalysts has been investigated in the temperature range 86.5 to 110 0 C. Rates of exchange were studied as functions of percentage of metal atoms exposed, the conditions of catalyst pretreatment, and the reaction temperature. The rates of exchange were not strongly dependent upon percentage exposed; however, the relative yields of d 1 through d 5 in the ethyl moiety or neohexane were dependent on the percentage metal atoms exposed. The Pt/SiO 2 catalysts were found to be more active for exchange than the Pd/SiO 2 catalysts by an order of magnitude. Both the turnover frequencies and the exchange pattern were observed to be influenced by the pretreatment of the catalyst. Maxima in the exchange pattern occurred at d 3 and d 5 in the case of Pt/SiO 2 and at d 5 only in the case of the Pd/SiO 2 catalysts. In order to account for the d 3 maximum observed for Pt catalysts, some extension of the Horiuti-Polanyi mechanism is required. Mechanisms by which the d 3 species might be formed are proposed and discussed. On Pd/SiO 2 catalysts exchange occurs preferentially in the ethyl substituent of the quaternary carbon atom rather than on the three methyl substituents of the quaternary carbon atom. Such preference is not observed on Pt/SiO 2 catalysts; in fact, in some cases, this preference is reversed. Whenever exchange occurs in the three methyl substituents, mostly the d 1 product is obtained. For Pt/SiO 2 catalysts, the exchange pattern appears to be influenced by steric effects, but the data suggest that factors other than steric effects are important on Pd
Staff Association
2011-01-01
The Christmas party organized by the Staff Association took place on Saturday 3 December. 200 children from 5 to 7 years old attended a magic show which filled them with wonder. Then they were served a snack in the Novae restaurant. Finally, just before their parents came to pick them up, Father Christmas gave them a present. The Staff Association wishes you a Merry Christmas and a Happy New Year!
5 CFR 847.102 - Regulatory structure.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Regulatory structure. 847.102 Section 847.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS... INSTRUMENTALITIES General Provisions § 847.102 Regulatory structure. (a)(1) Subpart A of this part contains...
Party-political and electoral system of Uruguay
Directory of Open Access Journals (Sweden)
Samuel Decresci
2015-06-01
Full Text Available The Oriental Republic of Uruguay is seen by many as a pioneer among Latin American nations to modernize its state and its policy. Since the late nineteenth century to the twentieth, Uruguayan political actors operate significant changes such as the separation of church and state, labor regulation, divorce law, women's vote, etc. Because of this and the progressive modernization, it was called the “Switzerland of the Americas”. Today, it still stands out in this area by regularizing abortion, homoaffective marriage, liberalization and access to marijuana. Moreover, noteworthy that such measures were achieved largely because of governance that the executive enjoys in the midst of this political system. Thus, this work aims to analyze such Uruguayan political system. In short, a political system is understood by the government system, the electoral system and the party system. That said, it will be analyzed in the political scenario of the country, their characteristics, party and election rules, political parties, party dynamics and relations between the powers.
Asanova, Tatyana I.; Asanov, Igor P.; Kim, Min-Gyu; Gerasimov, Evgeny Yu.; Zadesenets, Andrey V.; Plyusnin, Pavel E.; Korenev, Sergey V.
2013-10-01
The formation mechanism of Pd-Ir nanoparticles during thermal decomposition of double complex salt [Pd(NH3)4][IrCl6] has been studied by in situ X-ray absorption (XAFS) and photoelectron (XPS) spectroscopies. The changes in the structure of the Pd and Ir closest to the surroundings and chemical states of Pd, Ir, Cl, and N atoms were traced in the range from room temperature to 420 °C in inert atmosphere. It was established that the thermal decomposition process is carried out in 5 steps. The Pd-Ir nanoparticles are formed in pyramidal/rounded Pd-rich (10-200 nm) and dendrite Ir-rich (10-50 nm) solid solutions. A d charge depletion at Ir site and a gain at Pd, as well as the intra-atomic charge redistribution between the outer d and s and p electrons of both Ir and Pd in Pd-Ir nanoparticles, were found to occur.
23 CFR 810.102 - Eligible projects.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Eligible projects. 810.102 Section 810.102 Highways... SPECIAL USE HIGHWAY PROJECTS Highway Public Transportation Projects and Special Use Highway Facilities § 810.102 Eligible projects. Under this subpart the Federal Highway Administrator may approve on any...
5 CFR 10.2 - Accountability systems.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Accountability systems. 10.2 Section 10.2 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE RULES AGENCY ACCOUNTABILITY SYSTEMS; OPM AUTHORITY TO REVIEW PERSONNEL MANAGEMENT PROGRAMS (RULE X) § 10.2 Accountability systems. The Director of...
42 CFR 422.102 - Supplemental benefits.
2010-10-01
... 42 Public Health 3 2010-10-01 2010-10-01 false Supplemental benefits. 422.102 Section 422.102... (CONTINUED) MEDICARE PROGRAM MEDICARE ADVANTAGE PROGRAM Benefits and Beneficiary Protections § 422.102 Supplemental benefits. (a) Mandatory supplemental benefits. (1) Subject to CMS approval, an MA organization may...
DEFF Research Database (Denmark)
Ahmad, Shamaila Munir; Borch, Troels Holz; Hansen, Morten
2016-01-01
-specific T cells that recognize both PD-L1-expressing immune cells and malignant cells. Thus, PD-L1-specific T cells have the ability to modulate adaptive immune reactions by reacting to regulatory cells. Thus, utilization of PD-L1-derived T cell epitopes may represent an attractive vaccination strategy...... for targeting the tumor microenvironment and for boosting the clinical effects of additional anticancer immunotherapy. This review summarizes present information about PD-L1 as a T cell antigen, depicts the initial findings about the function of PD-L1-specific T cells in the adjustment of immune responses...
Directory of Open Access Journals (Sweden)
Feng YC
2018-01-01
Full Text Available Yang-chun Feng,1,2 Wen-li Ji,3 Na Yue,3 Yan-chun Huang,2 Xiu-min Ma1 1Clinical Laboratory Center, The First Affiliated Hospital of Xinjiang Medical University, 2Clinical Laboratory Center, 3Clinical Pathology Center, Tumor Hospital Affiliated to Xinjiang Medical University, Urumqi, People’s Republic of China Background: According to recent clinical observations, deficient DNA mismatch repair (dMMR is capable of improving antitumor effects of the PD-1/PD-L1 pathway, suggesting that dMMR may act as a prognostic indicator of PD-1/PD-L1 antibody drugs. In this study, we examined the dMMR and PD-1/PD-L1 expression, as well as explored the correlation of dMMR status with PD-1/PD-L1 expression in cervical cancer patients, in order to optimize cervical cancer patient selection for PD-1/PD-L1 antibody drug treatment, which is helpful to avoid adverse effects and keep costs manageable. Methods: Sixty-six tissue samples from patients with squamous cell carcinoma were collected, and data of their clinical characteristics were also gathered. Based on these samples, the expression levels of MLH1, MSH2, and PD-L1 in cancer cells were tested by immunohistochemical assay (IHC. Moreover, PD-1/PD-L1 expression in tumor-invading lymphocytes (TILs was detected by IHC as well. Six single-nucleotide-repeat markers of microsatellite instability (MSI, including NR-27, MONO-27, BAT-25, NR-24, NR-21, and BAT-26, were tested by capillary electrophoresis sequencer analysis. According to expression of MLH1, MSH2 and the MSI test, all 66 cases were divided into dMMR or proficient DNA mismatch repair (pMMR groups. The comparisons of dMMR and PD-L1 in cancer cells and of PD-1/PD-L1 in TILs were conducted categorized by age, childbearing history, history of abortion, ethnicity, and cancer cell differentiation subgroup. Furthermore, PD-L1 levels in cancer cells and PD-1/PD-L1 in TILs were analyzed and compared in both dMMR and pMMR subgroups. Results: Of the patient samples, 25
Alternative splice variants of the human PD-1 gene
DEFF Research Database (Denmark)
Nielsen, Christian; Ohm-Laursen, Line; Barington, Torben
2005-01-01
PD-1 is an immunoregulatory receptor expressed on the surface of activated T cells, B cells, and monocytes. We describe four alternatively spliced PD-1 mRNA transcripts (PD-1Deltaex2, PD-1Deltaex3, PD-1Deltaex2,3, and PD-1Deltaex2,3,4) in addition to the full length isoform. PD-1Deltaex2 and PD-1...... and flPD-1 upon activation suggests an important interplay between the putative soluble PD-1 and flPD-1 possibly involved in maintenance of peripheral self-tolerance and prevention of autoimmunity....
Secure Two-Party Computation with Low Communication
DEFF Research Database (Denmark)
Damgård, Ivan Bjerre; Faust, Sebastian; Hazay, Carmit
2011-01-01
We propose a 2-party UC-secure computation protocol that can compute any function securely. The protocol requires only two messages, communication that is poly-logarithmic in the size of the circuit description of the function, and the workload for one of the parties is also only poly-logarithmic...
Third party financing of renewable energy sources
International Nuclear Information System (INIS)
1994-01-01
The Institut of Energy Saving and Diversification (IDAE) hosted the third party on financing Renewable Energy Sources in Spain. The main aspects were : 1) Experiences in renewable energy. 2) Financing of small hydro-power projects. 3) Third party financing of biomass projects. 4) Financing of wind energy projects
Kolar, Z. I.; Ware, A. R.
2003-01-01
The European Radiochemists Association started almost simultaneously with the appearance of the first issue of the Radiochemistry in Europe newsletter in August 1995. The objective of the European Radiochemists Association (ERA) is to extend and improve communication between radiochemists in Europe through a newsletter. Liaison persons within each country or group exchange details of their activities, set up a diary of relevant international events and exchange details of specialist equipment, facilities and technology. In the year 2000 the Federation of European Chemical Societies decided to form a working party on nuclear and radiochemistry. It is a formalisation of the European Radiochemists Association. Each chemical society is allowed to nominate a member to the Working Party on Nuclear and Radiochemistry. Currently we have 12 nominated members plus two invited and one observer. In addition to the ERA aims and objectives it proposes to put together a syllabus of radiochemistry for undergraduate and post-graduate students—this aspect has been a part of our support of the International Atomic Energy Agency initiative. Also the aim of the working party is to support other working parties and divisions, to press the Federation of the European Chemical Societies for financial structure. To this end an Expression of Interest has been tabled with the Framework 6 Programme for networking within radiochemistry in Europe. The WP will liaise with the International Isotope Society and the International Society on Radiopharmaceutical Chemistry and Biology to seek to communicate and to consider ways of working together.
Description of the Gamov-Teller β+-decay of tin isotopes
International Nuclear Information System (INIS)
Kuz'min, V.A.; Solov'ev, V.G.
1988-01-01
The integrated log(ft) values of Gamow-Teller β + decays of the neutron-deficient tine isotopes are calculated in the random phase approximation with particle-hole and particle-particle residual interactions which parameters have been fixed earlier. For |g A /g V |=1 and |g A /g V |=1.263 a good correspondence with the experimental data is obtained for 104,106,108 Sn and a prediction is made for 102 Sn. It is shown that one cannot define from the rate of neutron-deficient nuclei β + decay the renormalization of the axial-vector weak interaction constant g A
Party Governance and the Selection of Parliamentarians
K.J. Beniers (Klaas)
2005-01-01
textabstractThis paper examines the incentives for a party leader in office and for a parties' rank-and-file to replace a sitting member of parliament. As to the leader's decision, we show that the leader prefers to replace a critical member of parliament who votes against the leader's policy. A
International Nuclear Information System (INIS)
Lin, Yu-Wei; Wang, Ren-You; Ke, Wun-Bin; Wang, I-Sheng; Chiu, Ying-Ta; Lu, Kuo-Chang; Lin, Kwang-Lung; Lai, Yi-Shao
2012-01-01
Highlights: ► Pd distribution in Pd-plated Cu wires reveals the whirlpool flow pattern of Cu. ► The mechanisms of the Cu flow behavior and Pd distribution are proposed. ► At Pd-rich phases, small voids formed and followed the direction of Cu flow. ► Nanoindentation studies show the Cu ball bond is harder in regions with Pd. - Abstract: The Pd plating on the 20 μm Cu wire dissolves in the free air ball (FAB) and the Cu ball bond during the wire bonding process without forming intermetallic compounds. The limiting supply of Pd and the short bonding process, 15 ms of thermosonic bonding, result in uneven distribution of Pd in the as produced Cu ball bond. Also, the Pd-rich phase may accompany small voids formed within the FAB and the wire bond, and following the direction of semi-solid Cu flow. The Pd distribution, as evidenced by the focused ion beam (FIB) and wavelength dispersive X-ray spectroscopy (WDS) mapping, reveals the whirlpool flow pattern of Cu within the FAB and the ball bond. Pd distributes within the copper ball through convective transport by the copper flow. Additionally, hardness measurements by nanoindentation testing show that the Cu ball bond is harder in the regions where Pd exists.
Parties, rituals and symbolisms in schools
Directory of Open Access Journals (Sweden)
Ana Cecilia Valencia Aguirre
2015-07-01
Full Text Available This paper aims at analyzing school parties from interaction spaces and principals’ narratives in six schools in the state of Jalisco. A party is a ritual where participants share symbols related to imaginary –hence the importance of conducting an analysis for understanding institutions as a symbolic framework. A core argument is that established actors are configured from symbolic practices in the institutional space (schools. The repetition of these practices awash with symbolism leads to daily rituals or micro rituals that are ratified in institutions. Methodologically, interviews and non-participant observation in school interaction spaces were used. Based on the findings, it may be stated that the nuclear family, rooted in the Christian image in which authority is a central point, becomes a fundamental factor in shaping institutional life as well as the imaginary linked to school parties.
A novel quantum solution to secure two-party distance computation
Peng, Zhen-wan; Shi, Run-hua; Wang, Pan-hong; Zhang, Shun
2018-06-01
Secure Two-Party Distance Computation is an important primitive of Secure Multiparty Computational Geometry that it involves two parties, where each party has a private point, and the two parties want to jointly compute the distance between their points without revealing anything about their respective private information. Secure Two-Party Distance Computation has very important and potential applications in settings of high secure requirements, such as privacy-preserving Determination of Spatial Location-Relation, Determination of Polygons Similarity, and so on. In this paper, we present a quantum protocol for Secure Two-Party Distance Computation by using QKD-based Quantum Private Query. The security of the protocol is based on the physical principles of quantum mechanics, instead of difficulty assumptions, and therefore, it can ensure higher security than the classical related protocols.
Candidate nomination, intra-party democracy, and election violence in Africa
DEFF Research Database (Denmark)
Seeberg, Merete Bech; Wahman, Michael; Skaaning, Svend-Erik
2018-01-01
. When local-level or national-level competition between parties is low, as in much of Africa, electoral politics become a matter of intra-party rather than inter-party competition. Nominations are a part of the electoral process often left to the discretion of poorly institutionalized parties, free......This article introduces a special issue on candidate nomination, intra-party democracy, and election violence in Africa. Although a burgeoning literature on African democratization has focused on the topic of electoral violence, little attention has been given to violence during party nominations...... of the involvement of electoral management bodies and external monitors, and violence often results. Rather than developing an elaborate theoretical framework on the causes of nomination violence, our ambition in this introduction is to introduce the concept of nomination violence and situate it in the literatures...
Secure multi-party quantum summation based on quantum Fourier transform
Yang, Hui-Yi; Ye, Tian-Yu
2018-06-01
In this paper, we propose a novel secure multi-party quantum summation protocol based on quantum Fourier transform, where the traveling particles are transmitted in a tree-type mode. The party who prepares the initial quantum states is assumed to be semi-honest, which means that she may misbehave on her own but will not conspire with anyone. The proposed protocol can resist both the outside attacks and the participant attacks. Especially, one party cannot obtain other parties' private integer strings; and it is secure for the colluding attack performed by at most n - 2 parties, where n is the number of parties. In addition, the proposed protocol calculates the addition of modulo d and implements the calculation of addition in a secret-by-secret way rather than a bit-by-bit way.
Methanol steam reforming over Pd/ZnO and Pd/CeO{sub 2} catalysts
Energy Technology Data Exchange (ETDEWEB)
Ranganathan, Easwar S.; Bej, Shyamal K.; Thompson, Levi T. [University of Michigan, Department of Chemical Engineering, 3026 H.H. Dow Building, 2300 Hayward Avenue, Ann Arbor, MI 48109-2136 (United States)
2005-08-10
The goal of work described in this paper was to better understand the methanol steam reforming (MSR) activity and selectivity patterns of ZnO and CeO{sub 2} supported Pd catalysts. This reaction is being used to produce H{sub 2}-rich gas for a number of applications including hydrogen fuel cells. The Pd/ZnO catalysts had lower MSR rates but were more selective for the production of CO{sub 2} than the Pd/CeO{sub 2} catalysts. The CH{sub 3}OH conversion rates were proportional to the H{sub 2} chemisorption uptake suggesting that the rate determining step was catalyzed by Pd. The corresponding turnover frequencies averaged 0.8+/-0.3s{sup -1} and 0.4+/-0.2s{sup -1} at 230{sup o}C for the Pd/ZnO and Pd/CeO{sub 2} catalysts, respectively. The selectivities are explained based on the reaction pathways, and characteristics of the support. The key surface intermediate appeared to be a formate. The ZnO supported catalysts had a higher density of acidic sites and favored pathways where the intermediate was converted to CO{sub 2} while the CeO{sub 2} supported catalysts had a higher density of basic sites and favored the production of CO.
7 CFR 1900.102 - Applicable law.
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Applicable law. 1900.102 Section 1900.102 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... GENERAL Applicability of Federal Law § 1900.102 Applicable law. Loans made by FmHA or its successor agency...
2010-07-01
... 40 Protection of Environment 26 2010-07-01 2010-07-01 false Trust fund. 280.102 Section 280.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) TECHNICAL STANDARDS AND CORRECTIVE ACTION REQUIREMENTS FOR OWNERS AND OPERATORS OF UNDERGROUND STORAGE TANKS (UST) Financial Responsibility § 280.102 Trust...
41 CFR 51-10.102 - Application.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Application. 51-10.102 Section 51-10.102 Public Contracts and Property Management Other Provisions Relating to Public Contracts... WHO ARE BLIND OR SEVERELY DISABLED § 51-10.102 Application. This part applies to all programs or...
20 CFR 653.102 - Job information.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Job information. 653.102 Section 653.102... SERVICE SYSTEM Services for Migrant and Seasonal Farmworkers (MSFWs) § 653.102 Job information. All State agencies shall make job order information conspicuous and available to MSFWs in all local offices. This...
19 CFR 360.102 - Online registration.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Online registration. 360.102 Section 360.102... ANALYSIS SYSTEM § 360.102 Online registration. (a) In general. (1) Any importer, importing company, customs.... boxes will not be accepted. A user identification number will be issued within two business days...
Chen, Xiaoying; Farrokhi, Vahid; Singh, Pratap; Ocana, Mireia Fernandez; Patel, Jenil; Lin, Lih-Ling; Neubert, Hendrik; Brodfuehrer, Joanne
2018-01-01
Discovery of the upregulation of fibroblast growth factor-inducible-14 (Fn14) receptor following tissue injury has prompted investigation into biotherapeutic targeting of the Fn14 receptor for the treatment of conditions such as chronic kidney diseases. In the development of monoclonal antibody (mAb) therapeutics, there is an increasing trend to use biomeasures combined with mechanistic pharmacokinetic/pharmacodynamic (PK/PD) modeling to enable decision making in early discovery. With the aim of guiding preclinical efforts on designing an antibody with optimized properties, we developed a mechanistic site-of-action (SoA) PK/PD model for human application. This model incorporates experimental biomeasures, including concentration of soluble Fn14 (sFn14) in human plasma and membrane Fn14 (mFn14) in human kidney tissue, and turnover rate of human sFn14. Pulse-chase studies using stable isotope-labeled amino acids and mass spectrometry indicated the sFn14 half-life to be approximately 5 hours in healthy volunteers. The biomeasures (concentration, turnover) of sFn14 in plasma reveals a significant hurdle in designing an antibody against Fn14 with desired characteristics. The projected dose (>1 mg/kg/wk for 90% target coverage) derived from the human PK/PD model revealed potential high and frequent dosing requirements under certain conditions. The PK/PD model suggested a unique bell-shaped relationship between target coverage and antibody affinity for anti-Fn14 mAb, which could be applied to direct the antibody engineering towards an optimized affinity. This investigation highlighted potential applications, including assessment of PK/PD risks during early target validation, human dose prediction and drug candidate optimization.
Energy Technology Data Exchange (ETDEWEB)
Teng, Chih-Chuan [Institute of Nursing and Department of Nursing, Chang Gung University of Science and Technology, Chronic Diseases and Health Promotion Research Center, CGUST, Taiwan (China); Institute of Basic Medicine Science, National Cheng Kung University, Tainan, Taiwan (China); Kuo, Hsing-Chun [Institute of Nursing and Department of Nursing, Chang Gung University of Science and Technology, Chronic Diseases and Health Promotion Research Center, CGUST, Taiwan (China); Cheng, Ho-Chen [Department of General Education, Chang Gung University of Science and Technology, CGUST, Taiwan (China); Wang, Ting-Chung [Department of Neurosurgery, Chang Gung Memorial Hospital, Chia-Yi Center, Chiayi, Taiwan (China); Graduate Institute of Clinical Medical Sciences, Chang Gung University, Gueishan, Taiwan (China); Sze, Chun-I, E-mail: szec@mail.ncku.edu.tw [Institute of Basic Medicine Science, Department of Cell Biology and Anatomy and Pathology, National Cheng Kung University, Tainan, Taiwan (China)
2012-08-15
CIL-102 (1-[4-(furo[2,3-b]quinolin-4-ylamino)phenyl]ethanone) is the major active agent of the alkaloid derivative of Camptotheca acuminata, with multiple pharmacological activities, including anticancer effects and promotion of apoptosis. The mechanism by which CIL-102 inhibits growth remains poorly understood in human astrocytoma cells. Herein, we investigated the molecular mechanisms by which CIL-102 affects the generation of reactive oxygen species (ROS) and cell cycle G2/M arrest in glioma cells. Treatment of U87 cells with 1.0 μM CIL-102 resulted in phosphorylation of extracellular signal-related kinase (ERK1/2), downregulation of cell cycle-related proteins (cyclin A, cyclin B, cyclin D1, and cdk1), and phosphorylation of cdk1Tyr{sup 15} and Cdc25cSer{sup 216}. Furthermore, treatment with the ERK1/2 inhibitor PD98059 abolished CIL-102-induced Cdc25cSer{sup 216} expression and reversed CIL-102-inhibited cdk1 activation. In addition, N-acetyl cysteine (NAC), an ROS scavenger, blocked cell cycle G2/M arrest and phosphorylation of ERK1/2 and Cdc25cSer{sup 216} in U87 cells. CIL-102-mediated ERK1/2 and ROS production, and cell cycle arrest were blocked by treatment with specific inhibitors. In conclusion, we have identified a novel CIL-102-inhibited proliferation in U87 cells by activating the ERK1/2 and Cdc25cSer{sup 216} cell cycle-related proteins and inducing ROS production; this might be a new mechanism in human astrocytoma cells. -- Highlights: ► We show the effects of CIL-102 on the G2/M arrest of human astrocytoma cells. ► ROS and the Ras/ERK1/2 triggering pathways are involved in the CIL-102 treatment. ► CIL-102 induces sustained activation of ERK1/2 and Cdc25c and ROS are required.
International Nuclear Information System (INIS)
Teng, Chih-Chuan; Kuo, Hsing-Chun; Cheng, Ho-Chen; Wang, Ting-Chung; Sze, Chun-I
2012-01-01
CIL-102 (1-[4-(furo[2,3-b]quinolin-4-ylamino)phenyl]ethanone) is the major active agent of the alkaloid derivative of Camptotheca acuminata, with multiple pharmacological activities, including anticancer effects and promotion of apoptosis. The mechanism by which CIL-102 inhibits growth remains poorly understood in human astrocytoma cells. Herein, we investigated the molecular mechanisms by which CIL-102 affects the generation of reactive oxygen species (ROS) and cell cycle G2/M arrest in glioma cells. Treatment of U87 cells with 1.0 μM CIL-102 resulted in phosphorylation of extracellular signal-related kinase (ERK1/2), downregulation of cell cycle-related proteins (cyclin A, cyclin B, cyclin D1, and cdk1), and phosphorylation of cdk1Tyr 15 and Cdc25cSer 216 . Furthermore, treatment with the ERK1/2 inhibitor PD98059 abolished CIL-102-induced Cdc25cSer 216 expression and reversed CIL-102-inhibited cdk1 activation. In addition, N-acetyl cysteine (NAC), an ROS scavenger, blocked cell cycle G2/M arrest and phosphorylation of ERK1/2 and Cdc25cSer 216 in U87 cells. CIL-102-mediated ERK1/2 and ROS production, and cell cycle arrest were blocked by treatment with specific inhibitors. In conclusion, we have identified a novel CIL-102-inhibited proliferation in U87 cells by activating the ERK1/2 and Cdc25cSer 216 cell cycle-related proteins and inducing ROS production; this might be a new mechanism in human astrocytoma cells. -- Highlights: ► We show the effects of CIL-102 on the G2/M arrest of human astrocytoma cells. ► ROS and the Ras/ERK1/2 triggering pathways are involved in the CIL-102 treatment. ► CIL-102 induces sustained activation of ERK1/2 and Cdc25c and ROS are required.
Simple multi-party set reconciliation
DEFF Research Database (Denmark)
Mitzenmacher, Michael; Pagh, Rasmus
2017-01-01
set reconciliation: two parties A1A1 and A2A2 each hold a set of keys, named S1S1 and S2S2 respectively, and the goal is for both parties to obtain S1∪S2S1∪S2. Typically, set reconciliation is interesting algorithmically when sets are large but the set difference |S1−S2|+|S2−S1||S1−S2|+|S2−S1| is small...
Energy Technology Data Exchange (ETDEWEB)
Atwan, M.H. [General Motors R and D Technical Center, Warren, MI (United States); Gyenge, E.L. [British Columbia Univ., Vancouver, BC (Canada). Dept. of Chemical and Biological Engineering; Northwood, D.O. [Windsor Univ., ON (Canada). Dept. of Mechanical, Automotive and Materials Engineering
2010-07-01
An evaluation was conducted to assess the use of colloidal palladium (Pd) and Pd alloys as anode electrocatalysts for direct borohydride fuel cell applications. A modified Bonneman method was used to investigate borohydride oxidation on supported Pd and Pd-alloy nano-electrocatalysts. Cyclic voltammetry (CV), rotating disk electrode (RDE) voltammetry, and single fuel cell test stations were used to determine Tafel slopes, exchange current densities, oxidation peak potentials, and fuel cell performance. The study also investigated the influence of temperature and oxidant flow and fuel flow rates on fuel cell performance. The study showed that the current density of the fuel cell increased with increases in temperature for all the investigated Pd electrocatalysts. However, the increase in current density was not as high as expected when fuel flow rates were increased. A current density of 50 mA cm{sup -2} was observed at 298 K with a Pd-Ir anode catalyst operating at a cell voltage of 0.5 V. 28 refs., 1 tab., 15 figs.
A contextual analysis of party system formation in Nigeria, 1960-2011
Directory of Open Access Journals (Sweden)
Aliyu Mukhtar Katsina
2013-12-01
Full Text Available This article investigates the parties and party systems in Nigeria since independence. The article argues that the country has witnessed four different types of party systems corresponding to the four democratisation attempts that saw the emergence of constitutional governments since 1960. Special focus is awarded to the transformations of the four party systems and developments in their various institutional designs including regulating the number of parties that participate in the electoral politics of the country. In trying to achieve its objective, the article adopts chronological and thematic approaches. Chronologically, the paper investigates these party systems in successive order beginning with the First Republic when the elements of party politics were first adopted in Nigeria. Thematically, the article focuses on those issues that influenced the formation and transformation of the party systems from the First Republic in 1960 to the present Fourth Republic.
Hotel Overbooking and Cooperation with Third-Party Websites
Directory of Open Access Journals (Sweden)
Yufeng Dong
2015-08-01
Full Text Available Hotels cooperate with third-party websites to enhance their competitive position and attain sustainable development in the era of e-commerce. Furthermore, hotel managers overbook to hedge against last-minute cancellations and customer no-shows. This paper discusses pricing and overbooking strategies of a hotel in the context of cooperation with multiple third-party websites and analyzes how these strategies influence the cooperation process. The increase in profits resulting from the overbooking strategy is also examined. A model of a Stackelberg game between the hotel and third-party websites and a Nash game among the third-party websites are developed to analyze the process. Results indicate that the compensation coefficient has a slight influence on hotel pricing strategy, but causes a sharp decrease in overbooking level. As the hotel demands to lessen the probability of denying under higher compensation rate, the third-party websites would exert less sales effort to reduce the demand of online customers. Results also show that under a given market demand, hotel effort only serves to redistribute market shares among the hotel and third-party websites, without influencing hotel pricing and overbooking decisions. Specifically, the market shares of the third-party websites decrease in the effort level of the hotel resulting from an increase in the hotel market share. Finally, in the numerical example where one hotel and two websites are analyzed, hotel overbooking strategy improves hotel profit by 4.20%, whereas profit improvements for Websites 1 and 2 are as high as 5.26% and 5.21%, respectively. Managerial implications of the study are also provided.
Directory of Open Access Journals (Sweden)
Mitsuo Fukuchi
1996-03-01
Full Text Available Summer activities in the 1991/92 austral summer and winter activities in 1992 of the 33rd Japanese Antarctic Research Expedition (JARE are described. The JARE-33 consisted of 16 members of the summer party and 37 members of the wintering party (one member of the wintering party returned with the summer party. Two Brazilian fish physiologists joined the summer party based on the exchange scientist program of the Antarctic Treaty. The icebreaker SHIRASE left Tokyo on 14 November 1991 and arrived at Breid Bay on 18 December, where the closing of Asuka Camp was completed. Then she headed to Syowa Station and arrived there on 4 January 1992. Transportation of cargo by helicopter to Syowa Station was carried out between 23 December 1991 and 18 January 1992. A total of 848t of cargo, including pipe transport of light oil (342kl and freight by oversnow vehicles (215t, were transported. A new central building was constructed from 23 December to 17 February as the start of an 8-year reintegration project of Syowa Station. Three generator engines of 200kVA capacity were overhauled. Concurrently, various research programs such as absolute gravity measurement and field surveys including inland oversnow traverse were performed. However, there were some problems with a super conducting gravity meter while the gravity meter was being tested for winter operation. Therefore, one scientist working on the gravity meter who planned to winter-over decided to leave Syowa Station with the gravity meter. all of the summer party left Syowa Station on 17 February and headed to Sydney, Australia, while oceanographic and marine biological observations were carried out on board. Members of the summer party of JARE-33 and the wintering party of JARE-32 returned to Narita by air on 27 March 1992. The wintering party of JARE-33 worked at Syowa Station from 1 February 1992 to 31 January 1993. The scientific research programs cover the following four major disciplines : (1 upper
The PD1:PD-L1/2 Pathway from Discovery to Clinical Implementation.
Bardhan, Kankana; Anagnostou, Theodora; Boussiotis, Vassiliki A
2016-01-01
The immune system maintains a critically organized network to defend against foreign particles, while evading self-reactivity simultaneously. T lymphocytes function as effectors and play an important regulatory role to orchestrate the immune signals. Although central tolerance mechanism results in the removal of the most of the autoreactive T cells during thymic selection, a fraction of self-reactive lymphocytes escapes to the periphery and pose a threat to cause autoimmunity. The immune system evolved various mechanisms to constrain such autoreactive T cells and maintain peripheral tolerance, including T cell anergy, deletion, and suppression by regulatory T cells (T Regs ). These effects are regulated by a complex network of stimulatory and inhibitory receptors expressed on T cells and their ligands, which deliver cell-to-cell signals that dictate the outcome of T cell encountering with cognate antigens. Among the inhibitory immune mediators, the pathway consisting of the programed cell death 1 (PD-1) receptor (CD279) and its ligands PD-L1 (B7-H1, CD274) and PD-L2 (B7-DC, CD273) plays an important role in the induction and maintenance of peripheral tolerance and for the maintenance of the stability and the integrity of T cells. However, the PD-1:PD-L1/L2 pathway also mediates potent inhibitory signals to hinder the proliferation and function of T effector cells and have inimical effects on antiviral and antitumor immunity. Therapeutic targeting of this pathway has resulted in successful enhancement of T cell immunity against viral pathogens and tumors. Here, we will provide a brief overview on the properties of the components of the PD-1 pathway, the signaling events regulated by PD-1 engagement, and their consequences on the function of T effector cells.
The PD1: PD-L1/2 pathway from discovery to clinical implementation
Directory of Open Access Journals (Sweden)
Kankana Bardhan
2016-12-01
Full Text Available The immune system has the difficult challenge of discerning and defending against a diversity of microbial pathogens, while simultaneously avoiding self-reactivity. T lymphocytes function as effectors and regulators of the immune system. While central tolerance mechanism results in deletion of the majority of self-reactive T lymphocytes during thymic selection, a fraction of self reactive lymphocytes escapes to the periphery and retains the potential to inflict destructive autoimmune pathology. The immune system evolved various mechanisms to restrain such auto-reactive T cells and maintain peripheral tolerance, including T cell anergy, deletion, and suppression by regulatory T cells (TRegs. These effects are regulated by a complex network of stimulatory and inhibitory receptors expressed on T cells and their ligands, which deliver cell-to-cell signals that dictate the outcome of T cell encountering with cognate antigens. Among the inhibitory immune mediators, the pathway consisting of the programmed cell death 1 (PD-1 receptor (CD279 and its ligands PD-L1 (B7-H1, CD274 and PD-L2 (B7-DC; CD273 plays a vital role in the induction and maintenance of peripheral tolerance and for the maintenance of T cell homeostasis. In contrast to its beneficial role in self-tolerance, the PD-1: PD-L1/L2 pathway mediates potent inhibitory signals that prevent the expansion and function of T effector cells and have detrimental effects on antiviral and antitumor immunity. Therapeutic targeting of this pathway has resulted in successful enhancement of T cell immunity against viral pathogens and tumors. Here, we will provide a brief overview on the properties of the components of the PD-1 pathway, the signaling events that are regulated by PD-1 triggering, and their consequences on the function of T effector cells.
22 CFR 102.8 - Reporting accidents.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Reporting accidents. 102.8 Section 102.8... Accidents Abroad § 102.8 Reporting accidents. (a) To airline and Civil Aeronautics Administration... probably be the first to be informed of the accident, in which event he will be expected to report the...
21 CFR 102.5 - General principles.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false General principles. 102.5 Section 102.5 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION COMMON OR USUAL NAME FOR NONSTANDARDIZED FOODS General Provisions § 102.5 General principles. (a...
Colloidal lithography nanostructured Pd/PdO x core–shell sensor for ppb level H2S detection
Benedict, Samatha; Lumdee, Chatdanai; Dmitriev, Alexandre; Anand, Srinivasan; Bhat, Navakanta
2018-06-01
In this work we report on plasma oxidation of palladium (Pd) to form reliable palladium/palladium oxide (Pd/PdO x ) core–shell sensor for ppb level H2S detection and its performance improvement through nanostructuring using hole-mask colloidal lithography (HCL). The plasma oxidation parameters and the sensor operating conditions are optimized to arrive at a sensor device with high sensitivity and repeatable response for H2S. The plasma oxidized palladium/palladium oxide sensor shows a response of 43.1% at 3 ppm H2S at the optimum operating temperature of 200 °C with response and recovery times of 24 s and 155 s, respectively. The limit of detection (LoD) of the plasma oxidised beam is 10 ppb. We further integrate HCL, a bottom-up and cost-effective process, to create nanodiscs of fixed diameter of 100 nm and varying heights (10, 15 and 20 nm) on 10 nm thin Pd beam which is subsequently plasma oxidized to improve the H2S sensing characteristics. The nanostructured Pd/PdO x sensor with nanodiscs of 100 nm diameter and 10 nm height shows an enhancement in sensing performance by 11.8% at same operating temperature and gas concentration. This nanostructured sensor also shows faster response and recovery times (15 s and 100 s, respectively) compared to the unstructured Pd/PdO x counterpart together with an experimental LoD of 10 ppb and the estimated limit going all the way down to 2 ppb. Material characterization of the fabricated Pd/PdO x sensors is done using UV–vis spectroscopy and x-ray photoemission spectroscopy.
Directory of Open Access Journals (Sweden)
Shifaa M. Abdin
2018-01-01
Full Text Available Cancer therapy has been constantly evolving with the hope of finding the most effective agents with the least toxic effects to eradicate tumors. Cancer immunotherapy is currently among the most promising options, fulfilling this hope in a wide range of tumors. Immunotherapy aims to activate immunity to fight cancer in a very specific and targeted manner; however, some abnormal immune reactions known as immune-related adverse events (IRAEs might occur. Therefore, many researchers are aiming to define the most proper protocols for managing these complications without interfering with the anticancer effect. One of these targeted approaches is the inhibition of the interaction between the checkpoint protein, programmed death-receptor 1 (PD-1, and its ligand, programmed death-ligand 1 (PD-L1, via a class of antibodies known as PD-1/PD-L1 inhibitors. These antibodies achieved prodigious success in a wide range of malignancies, including those where optimal treatment is not yet fully identified. In this review, we have critically explored and discussed the outcome of the latest PD-1 and PD-L1 inhibitor studies in different malignancies compared to standard chemotherapeutic alternatives with a special focus on the clinical efficacy and safety. The approval of the clinical applications of nivolumab, pembrolizumab, atezolizumab, avelumab, and durvalumab in the last few years clearly highlights the hopeful future of PD-1/PD-L1 inhibitors for cancer patients. These promising results of PD-1/PD-L1 inhibitors have encouraged many ongoing preclinical and clinical trials to explore the extent of antitumor activity, clinical efficacy and safety as well as to extend their applications.
Abdin, Shifaa M; Zaher, Dana M; Arafa, El-Shaimaa A; Omar, Hany A
2018-01-25
Cancer therapy has been constantly evolving with the hope of finding the most effective agents with the least toxic effects to eradicate tumors. Cancer immunotherapy is currently among the most promising options, fulfilling this hope in a wide range of tumors. Immunotherapy aims to activate immunity to fight cancer in a very specific and targeted manner; however, some abnormal immune reactions known as immune-related adverse events (IRAEs) might occur. Therefore, many researchers are aiming to define the most proper protocols for managing these complications without interfering with the anticancer effect. One of these targeted approaches is the inhibition of the interaction between the checkpoint protein, programmed death-receptor 1 (PD-1), and its ligand, programmed death-ligand 1 (PD-L1), via a class of antibodies known as PD-1/PD-L1 inhibitors. These antibodies achieved prodigious success in a wide range of malignancies, including those where optimal treatment is not yet fully identified. In this review, we have critically explored and discussed the outcome of the latest PD-1 and PD-L1 inhibitor studies in different malignancies compared to standard chemotherapeutic alternatives with a special focus on the clinical efficacy and safety. The approval of the clinical applications of nivolumab, pembrolizumab, atezolizumab, avelumab, and durvalumab in the last few years clearly highlights the hopeful future of PD-1/PD-L1 inhibitors for cancer patients. These promising results of PD-1/PD-L1 inhibitors have encouraged many ongoing preclinical and clinical trials to explore the extent of antitumor activity, clinical efficacy and safety as well as to extend their applications.
Church parties in the Arian controversy: problems of typologization
Directory of Open Access Journals (Sweden)
Georgy Zakharov
2017-12-01
Full Text Available The article is devoted to the problems of typologization of the church parties of the 4th century. This historical phenomenon arises within the framework of a long church conflict, called the Arian crisis. The designations of the church parties used by contemporaries are polemical concepts and do not correspond to the self-consciousness of their supporters. In the early Christian heresiological tradition and in the modern historiography, the basis of church parties’ classification is their theological position. However, it is necessary to take into account other consolidating factors, such as Eucharistic communion and church-political activity. The formation of church parties, as a rule, was directly related to the development of the synodal institution. Analysis of sources in the 4th century allows us to distinguish, in addition to the extensive currents - macro-parties - claiming a universal or regional consensus based on the heritage of one of the representative and authoritative councils, some small consolidated groups - micro-parties, which gather for little councils and constantly coordinate their actions within the ecclesiastical confrontation. Micro-parties could exist both within the limits of macro-party, in many respects determining the trends of it’s development, and beyond it’s boundaries. In the latter case, it is actually a marginal church group rallied around one or more extraordinary theologian, sometimes even without the episcopal rank.
39 CFR 10.2 - Advisory service.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Advisory service. 10.2 Section 10.2 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE RULES OF CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.2 Advisory service. (a) The General Counsel is the Ethical...
29 CFR 102.70 - Runoff election.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Runoff election. 102.70 Section 102.70 Labor Regulations... Runoff election. (a) The regional director shall conduct a runoff election, without further order of the... objections are filed as provided in § 102.69. Only one runoff shall be held pursuant to this section. (b...
29 CFR 102.4 - Region; subregion.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Region; subregion. 102.4 Section 102.4 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Definitions § 102.4 Region; subregion. The term region as used herein shall mean that part of the United States or any Territory thereof...
Hunt, Alison C; Ek, Mattias; Schönbächler, Maria
2017-12-01
This study presents a new measurement procedure for the isolation of Pt from iron meteorite samples. The method also allows for the separation of Pd from the same sample aliquot. The separation entails a two-stage anion-exchange procedure. In the first stage, Pt and Pd are separated from each other and from major matrix constituents including Fe and Ni. In the second stage, Ir is reduced with ascorbic acid and eluted from the column before Pt collection. Platinum yields for the total procedure were typically 50-70%. After purification, high-precision Pt isotope determinations were performed by multi-collector ICP-MS. The precision of the new method was assessed using the IIAB iron meteorite North Chile. Replicate analyses of multiple digestions of this material yielded an intermediate precision for the measurement results of 0.73 for ε 192 Pt, 0.15 for ε 194 Pt and 0.09 for ε 196 Pt (2 standard deviations). The NIST SRM 3140 Pt solution reference material was passed through the measurement procedure and yielded an isotopic composition that is identical to the unprocessed Pt reference material. This indicates that the new technique is unbiased within the limit of the estimated uncertainties. Data for three iron meteorites support that Pt isotope variations in these samples are due to exposure to galactic cosmic rays in space.
Search for isobar-analog states of superheavy hydrogen isotopes5-7He
Chernyshev, B. A.; Gurov, Yu B.; Korotkova, L. Yu; Kuznetsov, D. S.; Lapushkin, S. V.; Tel'kushev, M. V.; Schurenkova, T. D.
2016-02-01
Search for isobar-analog states (IAS) of superheavy hydrogen isotopes 5-7H was performed among the high-excited states of helium isotopes 5-7He. The excited spectra were measured in stopped pion absorption by light nuclei. The experiment was performed at low energy pion channel of LANL with two-arm multilayer semiconductor spectrometer. Excited states of 5-7He were observed in three-body reaction channels on 10,11B nuclei. Several excited levels were observed for the first time. 6He excited state with Ex = 27.0(8) MeV observed in 10B(π-,pt)X channel is an IAS candidate for 6H with Er ∼ 5.5 MeV. 7He excited state with Ex = 24.8(4) MeV observed in 10B(π-,pd)X, nB(π-,pt)X and nB(π-,dd)X channels is an IAS candidate for 7H with Er ∼ 3 MeV.
The value of political parties to representative democracy
Kölln, Ann-Kristin
2015-01-01
Political parties play a major role in democratic processes around the world. Recent empirical research suggests that parties are increasingly less important to citizens. Simultaneously, classic and contemporary theories of representative democracy specifically still minimally incorporate accounts
Carbon-Supported Pd and PdFe Alloy Catalysts for Direct Methanol Fuel Cell Cathodes
Directory of Open Access Journals (Sweden)
Luis M. Rivera Gavidia
2017-05-01
Full Text Available Direct methanol fuel cells (DMFCs are electrochemical devices that efficiently produce electricity and are characterized by a large flexibility for portable applications and high energy density. Methanol crossover is one of the main obstacles for DMFC commercialization, forcing the search for highly electro-active and methanol tolerant cathodes. In the present work, carbon-supported Pd and PdFe catalysts were synthesized using a sodium borohydride reduction method and physico-chemically characterized using transmission electron microscopy (TEM and X-ray techniques such as photoelectron spectroscopy (XPS, diffraction (XRD and energy dispersive spectroscopy (EDX. The catalysts were investigated as DMFC cathodes operating at different methanol concentrations (up to 10 M and temperatures (60 °C and 90 °C. The cell based on PdFe/C cathode presented the best performance, achieving a maximum power density of 37.5 mW·cm−2 at 90 °C with 10 M methanol, higher than supported Pd and Pt commercial catalysts, demonstrating that Fe addition yields structural changes to Pd crystal lattice that reduce the crossover effects in DMFC operation.
Directory of Open Access Journals (Sweden)
Laura Wills-Otero
2009-04-01
Full Text Available Review Article:Alcántara Sáez, Manuel (ed. (2008, Politicians and Politics in Latin America, Boulder: Lynne Rienner Publishers. Greene, Kenneth F. (2007, Why Dominant Parties Lose. Mexico’s Democratization in Comparative Perspective, New York: Cambridge University Press. Levitsky, Steven (2003, Transforming Labor-based Parties in Latin America: Argentine Peronism in Comparative Perspective, New York: Cambridge University Press. The study of party systems and political parties is one of the largest subfields in political science. Classic studies in advanced democracies focused primarily on party systems and developed theories about the causes and consequences of different types of systems. In recent years, new academic work begun to differentiate parties within systems by understanding their organizational structure, their internal dynamics, the different ways in which they interact with their constituencies, and the strategies that they use to attract voters. Studies show that parties within the same system behave and react differently given their internal conditions. This article reviews three scholarly books that deal with this issue. The works analyze the internal dynamics of Latin American political parties and their capacity to respond and adapt their structures when environmental challenges take place. Review Article:Alcántara Sáez, Manuel (ed. (2008, Politicians and Politics in Latin America, Boulder: Lynne Rienner Publishers. Greene, Kenneth F. (2007, Why Dominant Parties Lose. Mexico���s Democratization in Comparative Perspective, New York: Cambridge University Press. Levitsky, Steven (2003, Transforming Labor-based Parties in Latin America: Argentine Peronism in Comparative Perspective, New York: Cambridge University Press. El estudio de los sistemas de partidos y partidos políticos es una de las áreas más amplias en la ciencia política. Trabajos clásicos llevados a cabo en democracias avanzadas, enfocaron su atenci
Directory of Open Access Journals (Sweden)
Paul W. Chambers
2010-01-01
Full Text Available In democracies throughout the world, intra-party factions manifest themselves in parties and governments. Formal and informal institutions have, however, proved crucial in managing factionalism. This is especially true in Thailand’s emerging parliamentary democracy where the management of factionalism has become a major objective for Thai parties. This study explores factions and factionalism as well as how different types of parties try to manage intra-party dissension especially in the case of Thailand. The findings suggest that management style tends to be a function of a party’s organization, with parties which practice a collegial style tending to be the more successful in controlling intra-party cliques over time. At the same time, the most important tools which party leaderships can use to control factions are the careful use of constitutional provisions and manipulation of party finance.
11 CFR 109.37 - What is a “party coordinated communication”?
2010-01-01
... Provisions for Political Party Committees § 109.37 What is a “party coordinated communication”? (a) Definition. A political party communication is coordinated with a candidate, a candidate's authorized... paragraphs (a)(1), (a)(2), and (a)(3) of this section. (1) The communication is paid for by a political party...
25 CFR 11.906 - Rights of parties.
2010-04-01
... ORDER CODE Children's Court § 11.906 Rights of parties. (a) In all hearings and proceedings under §§ 11.900-11.1114 of this part the following rights will be observed unless modified by the particular... 25 Indians 1 2010-04-01 2010-04-01 false Rights of parties. 11.906 Section 11.906 Indians BUREAU...
Device-independent two-party cryptography secure against sequential attacks
DEFF Research Database (Denmark)
Kaniewski, Jedrzej; Wehner, Stephanie
2016-01-01
The goal of two-party cryptography is to enable two parties, Alice and Bob, to solve common tasks without the need for mutual trust. Examples of such tasks are private access to a database, and secure identification. Quantum communication enables security for all of these problems in the noisy......-storage model by sending more signals than the adversary can store in a certain time frame. Here, we initiate the study of device-independent (DI) protocols for two-party cryptography in the noisy-storage model. Specifically, we present a relatively easy to implement protocol for a cryptographic building block...... known as weak string erasure and prove its security even if the devices used in the protocol are prepared by the dishonest party. DI two-party cryptography is made challenging by the fact that Alice and Bob do not trust each other, which requires new techniques to establish security. We fully analyse...
Energy Technology Data Exchange (ETDEWEB)
Lapolli, Andre Luis
2006-07-01
Systematic behavior of magnetic hyperfine field (B{sub hf}) in the intermetallic compounds Gd(Ni,Pd,Cu)In Tb(Ni,Pd)In, Dy(Ni,Pd)In and Ho(Ni,Pd)In was studied by Perturbed Gamma-Gamma Angular Correlation spectroscopy. The measurements of B{sub hf} were carried out at the rare earth atom and in sites using the nuclear probes {sup 140}Ce and {sup 11}'1Cd respectively. The variation of hyperfine field with temperature, in most cases, follows the Brillouin function predicted from the molecular field theory. The hyperfine field values at rare earth atom sites obtained from {sup 140}Ce probe as well as at in sites obtained from {sup 111}Cd probe for each series of compounds were extrapolated to zero Kelvin B{sub hf}(T=0) from these curves. These values were compared with the values of the literature for other compounds containing the same rare earth element and all of them show a linear relationship with the ordering temperature. This indicates that the main contribution to B{sub hf} comes from the conduction electron polarization (CEP) through Fermi contact interaction and the principal mechanism of magnetic interaction in these compounds can be described by the RKKY type interaction. The values of B{sub hf}(T=0) for each family of intermetallic compounds RNiIn and RPdIn when plotted as a function of 4f spin projection of rare earth element also shows a linear relationship. Exceptions are the results for the compounds RNiIn obtained with {sup 111}Cd probe where a small deviation from linearity is observed. The results of the measurements carried out with the {sup 111}Cd probe were also analyzed to obtain the hyperfine parameters of the quadrupole interaction as a function of temperature for RPdln and GdNiIn compounds. The results show that for the compound GdPdIn there might be some Gd-In disorder at high temperature. (author)
Energy Technology Data Exchange (ETDEWEB)
Lapolli, Andre Luis
2006-07-01
Systematic behavior of magnetic hyperfine field (B{sub hf}) in the intermetallic compounds Gd(Ni,Pd,Cu)In Tb(Ni,Pd)In, Dy(Ni,Pd)In and Ho(Ni,Pd)In was studied by Perturbed Gamma-Gamma Angular Correlation spectroscopy. The measurements of B{sub hf} were carried out at the rare earth atom and in sites using the nuclear probes {sup 140}Ce and {sup 11}'1Cd respectively. The variation of hyperfine field with temperature, in most cases, follows the Brillouin function predicted from the molecular field theory. The hyperfine field values at rare earth atom sites obtained from {sup 140}Ce probe as well as at in sites obtained from {sup 111}Cd probe for each series of compounds were extrapolated to zero Kelvin B{sub hf}(T=0) from these curves. These values were compared with the values of the literature for other compounds containing the same rare earth element and all of them show a linear relationship with the ordering temperature. This indicates that the main contribution to B{sub hf} comes from the conduction electron polarization (CEP) through Fermi contact interaction and the principal mechanism of magnetic interaction in these compounds can be described by the RKKY type interaction. The values of B{sub hf}(T=0) for each family of intermetallic compounds RNiIn and RPdIn when plotted as a function of 4f spin projection of rare earth element also shows a linear relationship. Exceptions are the results for the compounds RNiIn obtained with {sup 111}Cd probe where a small deviation from linearity is observed. The results of the measurements carried out with the {sup 111}Cd probe were also analyzed to obtain the hyperfine parameters of the quadrupole interaction as a function of temperature for RPdln and GdNiIn compounds. The results show that for the compound GdPdIn there might be some Gd-In disorder at high temperature. (author)
Kitazawa, Takafumi; Kishida, Takanori; Kawasaki, Takeshi; Takahashi, Masashi
2017-11-01
We have prepared the 2D spin crossover complexes Fe(L)2Pd(CN)4 (L = py : 1a; py-D5 : 1b and py-15N : 1c). 1a has been characterised by 57Fe Mossbauer spectroscopic measurements, single crystal X-ray determination and SQUID measurements. The Mössbauer spectra for 1a indicate that the iron(II) spin states are in high spin states at 298 K and are in low spin states at 77 K. The crystal structures of 1a at 298 K and 90 K also show the high spin state and the low spin state respectively, associated with the Fe(II)-N distances. The spin transition temperature range of 1a is higher than that of Fe(py)2Ni(CN)4 since Pd(II) ions are larger and heavier than Ni(II) ions. SQUID data indicate isotope effects among 1a, 1b and 1c are observed in very small shifts of the transition temperatures probably due to larger and heavier Pd(II) ions. The delicate shifts would be associated with subtle balances between different vibrations around Fe(II) atoms and electronic factors.
The 2014 Elections and the Brazilian Party System
Directory of Open Access Journals (Sweden)
Carlos Ranulfo Melo
2015-04-01
Full Text Available The Brazilian party system presents a paradox. Although the Workers Party (PT and the Brazilian Social Democratic Party (PSDB have controlled presidential elections for the last 20 years, their force at the other levels of electoral competition has not grown. The objective of this study is to undertake a discussion of this situation through the 2014 general elections. After attempting to explain why successive challengers have not been able to change the structure of competition for the Brazilian presidency, I will analyze the relation established between the pattern observed at this level and the other “connected” electoral disputes—both those for state executive and federal legislative office. The general conclusion is that even if the pattern continues, it is quite improbable that this will significantly impact the other levels of national political party competition.
Third Party Liability governing Dangerous and Nuclear Activities
International Nuclear Information System (INIS)
Di Martino, Vittorio.
1979-01-01
The introductory chapters of this book analyse the concept of fault as a basis for third party liability and the evolution of jurisprudence and doctrine towards the concept of absolute liability. The following part covers the Italian system of liability for hazardous activities. The nuclear third party liability system is then analysed according to existing international conventions and nuclear legislation in several countries. The Appendix contains various legislative and regulatory texts on nuclear third party liability in Italy and in other countries which provide for special legislation in this field. (NEA) [fr
Inequality and anti-globalization backlash by political parties
Burgoon, B.
2013-01-01
Does income inequality increase political backlash against European and global integration? This paper reports research suggesting that it can. The article analyses party opposition to and support for trade openness, European Union integration and general internationalism of political party
Targeting PD-1/PD-L1 in lung cancer: current perspectives
Directory of Open Access Journals (Sweden)
González-Cao M
2015-07-01
Full Text Available María González-Cao,1 Niki Karachaliou,1 Santiago Viteri,1 Daniela Morales-Espinosa,1 Cristina Teixidó,2 Jesús Sánchez Ruiz,3 Miquel Ángel Molina-Vila,2 Mariacarmela Santarpia,4 Rafael Rosell1,2,5,61Translational Cancer Research Unit, Instituto Oncológico Dr Rosell, Quirón Dexeus University Hospital, Barcelona, Spain; 2Pangaea Biotech SL, Barcelona, Spain; 3Centro Nacional de Investigación Oncología (CNIO, Madrid, Spain; 4Medical Oncology Unit, Human Pathology Department, University of Messina, Messina, Italy; 5Cancer Biology and Precision Medicine Program, Catalan Institute of Oncology, Germans Trias i Pujol Health Sciences Institute and Hospital, Campus Can Ruti, Badalona, Barcelona, Spain; 6Fundación Molecular Oncology Research, Barcelona, SpainAbstract: Increased understanding of tumor immunology has led to the development of effective immunotherapy treatments. One of the most important advances in this field has been due to pharmacological design of antibodies against immune checkpoint inhibitors. Anti-PD-1/PD-L1 antibodies are currently in advanced phases of clinical development for several tumors, including lung cancer. Results from Phase I–III trials with anti-PD-1/PD-L1 antibodies in non-small-cell lung cancer have demonstrated response rates of around 20% (range, 16%–50%. More importantly, responses are long-lasting (median duration of response, 18 months and fast (50% of responses are detected at time of first tumor evaluation with very low grade 3–4 toxicity (less than 5%. Recently, the anti-PD-1 antibody pembrolizumab received US Food and Drug Administration (FDA breakthrough therapy designation for treatment of non-small-cell lung cancer, supported by data from a Phase Ib trial. Another anti-PD-1 antibody, nivolumab, has also been approved for lung cancer based on survival advantage demonstrated in recently released data from a Phase III trial in squamous cell lung cancer.Keywords: immunotherapy, immunoncology
Energy Technology Data Exchange (ETDEWEB)
Gulson, Brian, E-mail: brian.gulson@mq.edu.au [Graduate School of the Environment, Faculty of Science, Macquarie University, Sydney, NSW 2109 (Australia); CSIRO Earth Science and Resource Engineering North Ryde, NSW 1670 (Australia); Korsch, Michael [CSIRO Earth Science and Resource Engineering North Ryde, NSW 1670 (Australia); Winchester, Wayne; Devenish, Matthew; Hobbs, Thad [Esperance Cleanup and Recovery Project, Western Australia (WA) Department of Transport, Esperance 6450 (Australia); Main, Cleve; Smith, Gerard [Animal Health Laboratory, Department of Agriculture and Food, Perth 6151, WA (Australia); Rosman, Kevin; Howearth, Lynette; Burn-Nunes, Laurie [Curtin University, Department of Imaging and Applied Physics, Bentley 6102, WA (Australia); Seow, Jimmy; Oxford, Cameron [Department of Environment and Conservation, Booragoon 6154, WA (Australia); Yun, Gracie; Gillam, Lindsay [Department of Health, East Perth 6004, WA (Australia); Crisp, Michelle [LED (Locals for Esperance Development), Esperance 6450, WA (Australia)
2012-01-15
In late 2006, the seaside community in Esperance Western Australia was alerted to thousands of native bird species dying. The source of the lead (Pb) was determined by Pb isotopes to derive from the handling of Pb carbonate concentrate through the Port, which began in July 2005. Concern was expressed for the impact of this on the community. Our objectives were to employ Pb isotope ratios to evaluate the source of Pb in environmental samples for use in legal proceedings, and for use in remediation and monitoring. Isotope measurements were undertaken of bird livers, plants, drinking water, soil, harbour sediments, air, bulk ceiling dust, gutter sludge, surface swabs and blood. The unique lead isotopic signature of the contaminating Pb carbonate enabled diagnostic apportionment of lead in samples. Apart from some soil and water samples, the proportion of contaminating Pb was >95% in the environmental samples. Lead isotopes were critical in resolving legal proceedings, are being used in the remediation of premises, were used in monitoring of workers involved in the decontamination of the storage facility, and monitoring transport of the concentrate through another port facility. Air samples show the continued presence of contaminant Pb, more than one year after shipping of concentrate ceased, probably arising from dust resuspension. Brief details of the comprehensive testing and cleanup of the Esperance community are provided along with the role of the Community. Lead isotopic analyses can provide significant benefits to regulatory agencies, interested parties, and the community where the signature is able to be characterised with a high degree of certainty. - Highlights: Black-Right-Pointing-Triangle Lead carbonate concentrate. Black-Right-Pointing-Triangle Successful use of Pb isotopes in identifying sources of Pb arising from transport and shipping. Black-Right-Pointing-Triangle Use of Pb isotopes in legal proceedings and their use in cleanup of residences. Black
Role of political parties in the formation of civil society in Uzbekistan
Directory of Open Access Journals (Sweden)
Сирожжон Насипкулович Бердикулов
2015-06-01
Full Text Available The article considers the role of political parties in the development of civil society and the rule of law, as well as issues of political parties differ from other public organizations, the concept of a multi-party system, the importance of a multi-party system in ensuring political pluralism, inter-party competition, constructive opposition, the expression of the interests of the electorate, the space of political parties in parliament and local councils (soviets
Third party bargaining and contract terms: a link over time?
Brooks, John M; Doucette, William R; Sorofman, Bernard A
2002-01-01
To evaluate whether prior pharmacy bargaining process strategies and pharmacy dependence on third parties affect the bargaining power of pharmacies in price negotiations with third parties. One-time survey. Random sample of 900 independent and small chain pharmacies in nine states: Colorado, Connecticut, Georgia, Kentucky, Minnesota, Oklahoma, Oregon, Pennsylvania, and Wisconsin. Two hundred sixteen of the returned surveys contained sufficient responses for this analysis. Survey data on pharmacy bargaining power and prior pharmacy bargaining strategies, pharmacy dependence, and market characteristics were analyzed using multiple regression in a previously developed and modified provider/third party bargaining model. Pharmacy bargaining power. Pharmacy bargaining power varied across our sample. Pharmacy bargaining power was positively related to whether a pharmacy previously bargained with the third parties, negatively related to prior requests for contract changes, and negatively related to the pharmacy's dependence on third parties in total. Pharmacy bargaining power is related to the bargaining strategies employed by pharmacies during the previous year and the dependence of pharmacies on third party payers in total. With the prevalence of "take-it-or-leave-it" contracts from third parties, prior pharmacy bargaining behavior may affect the initial terms of the contracts that pharmacies are offered.
International Nuclear Information System (INIS)
Boulyga, Sergei F.; Prohaska, Thomas
2008-01-01
This paper presents the application of a multicollector inductively coupled plasma mass spectrometer (MC-ICP-MS) - a Nu Plasma HR - equipped with three ion-counting multipliers and coupled to a laser ablation system (LA) for the rapid and sensitive determination of the 235 U/ 238 U, 236 U/ 238 U, 145 Nd/ 143 Nd, 146 Nd/ 143 Nd, 101 Ru/( 99 Ru+ 99 Tc) and 102 Ru/( 99 Ru+ 99 Tc) isotope ratios in microsamples collected in the vicinity of Chernobyl. Microsamples with dimensions ranging from a hundred μm to about 1 mm and with surface alpha activities of 3-38 mBq were first identified using nuclear track radiography. U, Nd and Ru isotope systems were then measured sequentially for the same microsample by LA-MC-ICP-MS. The application of a zoom ion optic for aligning the ion beams into the ion counters allows fast switching between different isotope systems, which enables all of the abovementioned isotope ratios to be measured for the same microsample within a total analysis time of 15-20 min (excluding MC-ICP-MS optimization and calibration). The 101 Ru/( 99 Ru+ 99 Tc) and 102 Ru/( 99 Ru+ 99 Tc) isotope ratios were measured for four microsamples and were found to be significantly lower than the natural ratios, indicating that the microsamples were contaminated with the corresponding fission products (Ru and Tc). A slight depletion in 146 Nd of about 3-5% was observed in the contaminated samples, but the Nd isotopic ratios measured in the contaminated samples coincided with natural isotopic composition within the measurement uncertainty, as most of the Nd in the analyzed samples originates from the natural soil load of this element. The 235 U/ 238 U and 236 U/ 238 U isotope ratios were the most sensitive indicators of irradiated uranium. The present work yielded a significant variation in uranium isotope ratios in microsamples, in contrast with previously published results from the bulk analysis of contaminated samples originating from the vicinity of Chernobyl. Thus
Boulyga, Sergei F; Prohaska, Thomas
2008-01-01
This paper presents the application of a multicollector inductively coupled plasma mass spectrometer (MC-ICP-MS)--a Nu Plasma HR--equipped with three ion-counting multipliers and coupled to a laser ablation system (LA) for the rapid and sensitive determination of the 235U/238U, 236U/238U, 145Nd/143Nd, 146Nd/143Nd, 101Ru/(99Ru+99Tc) and 102Ru/(99Ru+99Tc) isotope ratios in microsamples collected in the vicinity of Chernobyl. Microsamples with dimensions ranging from a hundred mum to about 1 mm and with surface alpha activities of 3-38 mBq were first identified using nuclear track radiography. U, Nd and Ru isotope systems were then measured sequentially for the same microsample by LA-MC-ICP-MS. The application of a zoom ion optic for aligning the ion beams into the ion counters allows fast switching between different isotope systems, which enables all of the abovementioned isotope ratios to be measured for the same microsample within a total analysis time of 15-20 min (excluding MC-ICP-MS optimization and calibration). The 101Ru/(99Ru+99Tc) and 102Ru/(99Ru+99Tc) isotope ratios were measured for four microsamples and were found to be significantly lower than the natural ratios, indicating that the microsamples were contaminated with the corresponding fission products (Ru and Tc). A slight depletion in 146Nd of about 3-5% was observed in the contaminated samples, but the Nd isotopic ratios measured in the contaminated samples coincided with natural isotopic composition within the measurement uncertainty, as most of the Nd in the analyzed samples originates from the natural soil load of this element. The 235U/238U and 236U/238U isotope ratios were the most sensitive indicators of irradiated uranium. The present work yielded a significant variation in uranium isotope ratios in microsamples, in contrast with previously published results from the bulk analysis of contaminated samples originating from the vicinity of Chernobyl. Thus, the 235U/238U ratios measured in ten
Évolution des partis politiques dans le monde arabe | IDRC ...
International Development Research Centre (IDRC) Digital Library (Canada)
Orient et en Afrique du Nord subir diverses mutations. Le soutien dont bénéficiaient les partis nationalistes a diminué au profit des partis islamistes. Ce sont ces derniers qui sont désormais les plus dynamiques et les plus contestataires des partis ...
Size and alloying induced shift in core and valence bands of Pd-Ag and Pd-Cu nanoparticles
International Nuclear Information System (INIS)
Sengar, Saurabh K.; Mehta, B. R.; Govind
2014-01-01
In this report, X-ray photoelectron spectroscopy studies have been carried out on Pd, Ag, Cu, Pd-Ag, and Pd-Cu nanoparticles having identical sizes corresponding to mobility equivalent diameters of 60, 40, and 20 nm. The nanoparticles were prepared by the gas phase synthesis method. The effect of size on valence and core levels in metal and alloy nanoparticles has been studied by comparing the values to those with the 60 nm nanoparticles. The effect of alloying has been investigated by comparing the valence and core level binding energies of Pd-Cu and Pd-Ag alloy nanoparticles with the corresponding values for Pd, Ag, and Cu nanoparticles of identical sizes. These effects have been explained in terms of size induced lattice contractions, alloying induced charge transfer, and hybridization effects. The observation of alloying and size induced binding energy shifts in bimetallic nanoparticles is important from the point of view of hydrogen reactivity
Preparation of supported Au–Pd and Cu–Pd by the combined strong ...
Indian Academy of Sciences (India)
BOONTIDA PONGTHAWORNSAKUN
2017-10-25
Oct 25, 2017 ... Bimetallic catalyst; Au–Pd/TiO2; Cu–Pd/TiO2; strong electrostatic adsorption; electroless deposition .... The liquid samples .... composition and gas mixture product at the outlet of reactor ... the TiO2 support (no change in the deposition curve of. TiO2). ..... TrimmDL1980In Design of Industrial Catalysts (Ams-.
Inequality and anti-globalization backlash by political parties
Burgoon, B.
2011-01-01
Does inequality fuel anti-globalization backlash? This paper answers this question by analyzing how income inequality affects the embrace or eschew of globalization by political parties. It focuses on party opposition to and support for trade openness, European-Union integration, and general
Creating A Nationwide Nonpartisan Initiative for Family Caregivers in Political Party Platforms.
Scribner, Ben; Lynn, Joanne; Walker, Victoria; Morgan, Les; Montgomery, Anne; Blair, Elizabeth; Baird, Davis; Goldschmidt, Barbara; Kirschenbaum, Naomi
2017-06-01
Policymakers have been slow to support family caregivers, and political agendas mostly fail to address the cost burdens, impact on employment and productivity, and other challenges in taking on long-term care tasks. This project set out to raise policymakers' awareness of family caregivers through proposals to Republican and Democratic party platforms during the 2016 political season. The Family Caregiver Platform Project (FCPP) reviewed the state party platform submission process for Democratic and Republican parties in all 50 states and the District of Columbia. We built a website to make each process understandable by caregiver advocates. We designed model submissions to help volunteers tailor a proposal and recruited caregiver advocates participating in their state process. Finally, we mobilized a ground operation in many states and followed the progress of submissions in each state, as well as the formation of the national platforms. In 39 states, at least one party, Republican or Democrat, hosted a state party platform process. As of September 2016 FCPP volunteers submitted proposals to 29 state parties in 22 states. Family caregiver language was added to eight state party platforms, one state party resolution, two bipartisan legislative resolutions, and one national party platform. The FCPP generated a non-partisan grassroots effort to educate and motivate policymakers to address caregiving issues and solutions. Democratic party leaders provided more opportunities to connect with political leaders, with seven Democratic parties and one Republican party, addressing family caregiver issues in their party platforms. © 2017, Copyright the Authors Journal compilation © 2017, The American Geriatrics Society.
Maekawa, Naoya; Konnai, Satoru; Okagawa, Tomohiro; Nishimori, Asami; Ikebuchi, Ryoyo; Izumi, Yusuke; Takagi, Satoshi; Kagawa, Yumiko; Nakajima, Chie; Suzuki, Yasuhiko; Kato, Yukinari; Murata, Shiro; Ohashi, Kazuhiko
2016-01-01
Spontaneous cancers are common diseases in dogs. Among these, some malignant cancers such as oral melanoma, osteosarcoma, hemangiosarcoma, and mast cell tumor are often recognized as clinical problems because, despite their high frequencies, current treatments for these cancers may not always achieve satisfying outcomes. The absence of effective systemic therapies against these cancers leads researchers to investigate novel therapeutic modalities, including immunotherapy. Programmed death 1 (PD-1) is a costimulatory receptor with immunosuppressive function. When it binds its ligands, PD-ligand 1 (PD-L1) or PD-L2, PD-1 on T cells negatively regulates activating signals from the T cell receptor, resulting in the inhibition of the effector function of cytotoxic T lymphocytes. Aberrant PD-L1 expression has been reported in many human cancers and is considered an immune escape mechanism for cancers. In clinical trials, anti-PD-1 or anti-PD-L1 antibodies induced tumor regression for several malignancies, including advanced melanoma, non-small cell lung carcinoma, and renal cell carcinoma. In this study, to assess the potential of the PD-1/PD-L1 axis as a novel therapeutic target for canine cancer immunotherapy, immunohistochemical analysis of PD-L1 expression in various malignant cancers of dogs was performed. Here, we show that dog oral melanoma, osteosarcoma, hemangiosarcoma, mast cell tumor, mammary adenocarcinoma, and prostate adenocarcinoma expressed PD-L1, whereas some other types of cancer did not. In addition, PD-1 was highly expressed on tumor-infiltrating lymphocytes obtained from oral melanoma, showing that lymphocytes in this cancer type might have been functionally exhausted. These results strongly encourage the clinical application of PD-1/PD-L1 inhibitors as novel therapeutic agents against these cancers in dogs.
Directory of Open Access Journals (Sweden)
Naoya Maekawa
Full Text Available Spontaneous cancers are common diseases in dogs. Among these, some malignant cancers such as oral melanoma, osteosarcoma, hemangiosarcoma, and mast cell tumor are often recognized as clinical problems because, despite their high frequencies, current treatments for these cancers may not always achieve satisfying outcomes. The absence of effective systemic therapies against these cancers leads researchers to investigate novel therapeutic modalities, including immunotherapy. Programmed death 1 (PD-1 is a costimulatory receptor with immunosuppressive function. When it binds its ligands, PD-ligand 1 (PD-L1 or PD-L2, PD-1 on T cells negatively regulates activating signals from the T cell receptor, resulting in the inhibition of the effector function of cytotoxic T lymphocytes. Aberrant PD-L1 expression has been reported in many human cancers and is considered an immune escape mechanism for cancers. In clinical trials, anti-PD-1 or anti-PD-L1 antibodies induced tumor regression for several malignancies, including advanced melanoma, non-small cell lung carcinoma, and renal cell carcinoma. In this study, to assess the potential of the PD-1/PD-L1 axis as a novel therapeutic target for canine cancer immunotherapy, immunohistochemical analysis of PD-L1 expression in various malignant cancers of dogs was performed. Here, we show that dog oral melanoma, osteosarcoma, hemangiosarcoma, mast cell tumor, mammary adenocarcinoma, and prostate adenocarcinoma expressed PD-L1, whereas some other types of cancer did not. In addition, PD-1 was highly expressed on tumor-infiltrating lymphocytes obtained from oral melanoma, showing that lymphocytes in this cancer type might have been functionally exhausted. These results strongly encourage the clinical application of PD-1/PD-L1 inhibitors as novel therapeutic agents against these cancers in dogs.
Gulson, Brian; Korsch, Michael; Winchester, Wayne; Devenish, Matthew; Hobbs, Thad; Main, Cleve; Smith, Gerard; Rosman, Kevin; Howearth, Lynette; Burn-Nunes, Laurie; Seow, Jimmy; Oxford, Cameron; Yun, Gracie; Gillam, Lindsay; Crisp, Michelle
2012-01-01
In late 2006, the seaside community in Esperance Western Australia was alerted to thousands of native bird species dying. The source of the lead (Pb) was determined by Pb isotopes to derive from the handling of Pb carbonate concentrate through the Port, which began in July 2005. Concern was expressed for the impact of this on the community. Our objectives were to employ Pb isotope ratios to evaluate the source of Pb in environmental samples for use in legal proceedings, and for use in remediation and monitoring. Isotope measurements were undertaken of bird livers, plants, drinking water, soil, harbour sediments, air, bulk ceiling dust, gutter sludge, surface swabs and blood. The unique lead isotopic signature of the contaminating Pb carbonate enabled diagnostic apportionment of lead in samples. Apart from some soil and water samples, the proportion of contaminating Pb was >95% in the environmental samples. Lead isotopes were critical in resolving legal proceedings, are being used in the remediation of premises, were used in monitoring of workers involved in the decontamination of the storage facility, and monitoring transport of the concentrate through another port facility. Air samples show the continued presence of contaminant Pb, more than one year after shipping of concentrate ceased, probably arising from dust resuspension. Brief details of the comprehensive testing and cleanup of the Esperance community are provided along with the role of the Community. Lead isotopic analyses can provide significant benefits to regulatory agencies, interested parties, and the community where the signature is able to be characterised with a high degree of certainty. Crown Copyright © 2011. Published by Elsevier Inc. All rights reserved.
Political Parties and Popular Representation in Myanmar’s Democratisation Process
Directory of Open Access Journals (Sweden)
Kristian Stokke
2015-01-01
Full Text Available The article examines the role of political parties in Myanmar’s democratisation process. We argue that the substance of democratisation depends on popular representation through political parties but question their capacity to provide such representation. Examining capacity through the concept of party institutionalisation, we find that most parties have not been able to build effective organisational structures. However, we also find a degree of party institutionalisation in the form of rootedness in society. Political cleavages between those favouring authoritarian rule over democratic rule and Burman nationhood over ethnic notions of nationhood have produced divisions between state-centred parties associated with Myanmar’s authoritarian legacy and society-centred pro-democracy and ethnic parties. Although being less dichotomous than in the past, we argue that these cleavages continue to provide a basis for party identity and rootedness in society. We conclude that further development of political parties and popular representation will be shaped by the relations between parties, the state, and society – where individual parties are shaped according to their tendencies towards state-centred cartel parties or society-centred mass parties.
16 CFR 1034.102 - Application.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Application. 1034.102 Section 1034.102 Commercial Practices CONSUMER PRODUCT SAFETY COMMISSION GENERAL ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS... Application. This part applies to all programs or activities conducted by the agency. ...
Energy-political ideas of environmentalist parties in Western Europe
International Nuclear Information System (INIS)
Hrbek, R.
1990-01-01
By and large the green-alternative parties embrace the same energy policies: They reject nuclear energy, they demand a radically new approach to energy politics and they want to realise their programmes within a comprehensive restructuring of the political and economic order of the respective states. The reasons for this categorical NO to nuclear energy seen in its social and environmental compatibility. In the following we will explain how this type of party works and functions. The reasons for the formation of these parties and the profile of green-alternative parties on a national and international level are described in detail as well as the resonance in society and their chances of success in general. (orig./HSCH) [de
Preparation of 103Pd seeds. Part 2. 'Molecular Plating' of 103Pd onto copper rod
International Nuclear Information System (INIS)
Chunfu Zhang; Yongxian Wang; Haibin Tian; Duanzhi Yin
2002-01-01
A method for 103 Pd 'molecular plating' onto the surface of the copper rod is reported. The optimal composition of the plating bath was: palladium chloride 2 g/l, ammonium hydroxide (28%) 150 ml/l, sodium hypophosphite 12 g/l, and ammonium chloride 37 g/l. The whole procedure of 103 Pd 'molecular plating' will last 50 minutes at 40 deg C. Valuable experience for the preparation of 103 Pd seeds is provided. (author)
THE CHALLENGE OF PD PATIENTS: GLUCOSE AND GLUCOSE DEGRADATION PRODUCTS IN PD SOLUTION
Directory of Open Access Journals (Sweden)
Yong-Lim Kim
2012-06-01
Full Text Available The main osmotic agent found in the peritoneal dialysis (PD solution is glucose. It has been of a wide use for great crystalloid osmotic power at a low concentration, simple metabolism, and excellent safety. On the other hand, anywhere between 60 to 80% of the glucose in the PD solution is absorbed - a 100 to 300 mg of daily glucose absorption. Once into the systemic circulation, glucose can be a cause for metabolic complications including obesity. Indeed, the diabetiform change observed in the peritoneal membrane in the long-term PD patients is believed attributable to the high-concentration glucose in the PD solution. The glucose absorbed from peritoneal cavity raises the risk of ‘glucose toxicity’, leading to insulin resistance and beta cell failure. Clinical similarity can be found in postprandial hyperglycemia, which is known to be associated with oxidative stress, endothelial dysfunction, NF-κb, and inflammation, affecting myocardial blood flow. Moreover, it is a proven independent risk factor of coronary artery disease in patients with type 2 diabetes, particularly of female gender. Though speculative yet, glucose toxicity might explain a higher mortality of PD patients after the first year compared with those on hemodialysis (more so in female, advanced-age patients with diabetes. Also included in the picture are glucose degradation products (GDPs generated along the course of heat sterilization or storage of the PD solution. They have been shown to induce apoptosis of peritoneal mesothelial cells, renal tubular epithelial cells, and endothelial cells, while spurring production of TGF-β and VEGF and facilitating epithelial mesenchymal transition. GDPs provide a stronger reactivity than glucose in the formation of AGEs, a known cause for microvascular complications and arteriosclerosis. Unfortunately, clinical studies using a low-GDP PD solution have provided mixed results on the residual renal function, peritonitis, peritoneal
47 CFR 25.102 - Station authorization required.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station authorization required. 25.102 Section 25.102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS General § 25.102 Station authorization required. (a) No person shall use or operate...
29 CFR 1425.6 - Use of third-party mediation assistance.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Use of third-party mediation assistance. 1425.6 Section 1425.6 Labor Regulations Relating to Labor (Continued) FEDERAL MEDIATION AND CONCILIATION SERVICE MEDIATION ASSISTANCE IN THE FEDERAL SERVICE § 1425.6 Use of third-party mediation assistance. If the parties...
Solubility of tritium in Pd1-YAgY alloys (Y = 0.00, 0.10, 0.20, 0.30)
International Nuclear Information System (INIS)
Lasser, R.; Powell, G.L.
1988-01-01
Solubility measurements of tritium (T) in Pd 1-Y Ag Y alloys (Y = 0.00, 0.10, 0.20, 0.30) are reported in the temperature range of 250 K to 733 K, the pressure range below 3 bar, and the concentration range of 0.001 to 0.64 hydrogen to metal atom ratio. To study isotopic effects, the pressure-concentration-temperature relationships of the hydrogen isotopes protium (H) and deuterium (D) have been measured using the same samples and experimental setup and to temperatures as high as 1500 K using a different set up and samples. The experimental data are compared with values for H and D determined by other groups. In the case of T, most of the data presented have not been determined before. From these data the Sieverts' constants were calculated which show a strong temperature and isotope dependence. Analytical expressions, based on models that assume various degrees to which the hydrogen can perceive the alloy composition of individual sites in an alloy, are given for the Sieverts' constants that allow the calculation of the standard Gibbs free energies, enthalpies and entropies of H, D and T in these alloys
Two-party secret key distribution via a modified quantum secret sharing protocol.
Grice, W P; Evans, P G; Lawrie, B; Legré, M; Lougovski, P; Ray, W; Williams, B P; Qi, B; Smith, A M
2015-03-23
We present and demonstrate a novel protocol for distributing secret keys between two and only two parties based on N-party single-qubit Quantum Secret Sharing (QSS). We demonstrate our new protocol with N = 3 parties using phase-encoded photons. We show that any two out of N parties can build a secret key based on partial information from each other and with collaboration from the remaining N - 2 parties. Our implementation allows for an accessible transition between N-party QSS and arbitrary two party QKD without modification of hardware. In addition, our approach significantly reduces the number of resources such as single photon detectors, lasers and dark fiber connections needed to implement QKD.
Effects and outcomes of third-party reproduction: parents.
Greenfeld, Dorothy A
2015-09-01
Third-party reproduction has introduced a host of changing family constellations. Research has shown that children conceived through third-party reproduction are doing well psychologically and developmentally, but what about their parents? How have they coped with the transition to third-party reproduction? Has the experience impacted their marital stability or the quality of their parenting? This review will address parents of children conceived through oocyte donation, parents of children conceived through gestational surrogacy, and gay male parents of children conceived through oocyte donation and gestational surrogacy. Copyright © 2015 American Society for Reproductive Medicine. Published by Elsevier Inc. All rights reserved.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Definitions. 26.102 Section 26.102 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL PROTECTION OF HUMAN SUBJECTS Basic EPA...) Human subject means a living individual about whom an investigator (whether professional or student...
18 CFR 376.102 - Organization.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Organization. 376.102... OF ENERGY REVISED GENERAL RULES ORGANIZATION, MISSION, AND FUNCTIONS; OPERATIONS DURING EMERGENCY CONDITIONS Organization, Mission, and Functions § 376.102 Organization. The Commission is established as an...
International Nuclear Information System (INIS)
Kusakabe, K; Ikuno, Y k; Nagara, H; Harada, K
2009-01-01
Stable oxygen sites on a PdO film over a Pd(100) thin structure with a (√5x√5)R27 o surface unit cell are determined using the first-principles electronic structure calculations with the generalized gradient approximation. The adsorbed monatomic oxygen goes to a site bridging two twofold-coordinated Pd atoms or to a site bridging a twofold-coordinated Pd atom and a fourfold-coordinated Pd atom. Estimated reaction energies of CO oxidation by reduction of the oxidized PdO film and N 2 O reduction mediated by oxidation of the PdO film are both exothermic. Motion of the adsorbed oxygen atom between the two stable sites is evaluated using the nudged elastic band method, where an energy barrier for a translational motion of the adsorbed oxygen may become ∼0.45 eV, which is low enough to allow fluxionality of the surface oxygen at high temperatures. The oxygen fluxionality is allowed by the existence of twofold-coordinated Pd atoms on the PdO film, whose local structure has a similarity to that of Pd catalysts for the Suzuki-Miyaura cross-coupling. Although NO x (including NO 2 and NO) reduction is not always catalyzed by the PdO film only, we conclude that continual redox reactions may happen mediated by oxygen-adsorbed PdO films over a Pd surface structure, when the influx of NO x and CO continues, and when the reaction cycle is kept on a well-designed oxygen surface.
Neutron Activation Resonance Integrals of 64Zn, 68Zn, 85Rb, 100Mo, 102Ru, 113In, 123Sb, and 180Hf
International Nuclear Information System (INIS)
Ricabarra, M. D.; Turjanski, R.; Ricabarra, G. H.
1969-01-01
The ratio of resonance integral to thermal activation cross sections of the isotopes 64 Zn, 68 Zn, 85 Rb, 100 Mo, 102 Ru, 113 In, 123 Sb, and 180 Hf relative to gold has been determined by measuring cadmium ratios. The standard gold or a secondary standard was mixed uniformly in the samples and the activities resolved with a lithium-drift germanium γ-ray spectrometer. Expressed as Westcott S 0 values the results were: 64 Zn = 2.06 ± 0.03, 68 Zn = 3.72 ± 0.14, 85 Rb = 18.4 ± 0.6, 100 Mo = 21.7 ± 0.8, 102 Ru = 3.76 ± 0.03, 113 In = 24.7 ± 0.5, 123 Sb = 28.3 ± 2.1, 180 Hf = 2.17 ± 0.09. All measurements are relative to S 0 = 17.7 for gold. (author)
International Nuclear Information System (INIS)
Dudu, Dorin; Racolta, Petru Mihai
2000-01-01
All the radioisotopes used in nuclear medicine are produced artificially using either a nuclear reactor or a cyclotron. By attaching suitable chemical labels to the radioisotopes, radiopharmaceuticals are obtained, which can be made to seek a desired organ by taking part in the metabolic processes. When radiopharmaceuticals are injected into the human body and specifically taken up by an organ of choice, a lack of uptake, or delay in uptake, denotes loss of function in the organ. There are 297 operating research reactors listed in the 1994 IAEA reactor database and this number has been declining over the last ten years. Of these, only 20-25 reactors have the appropriate performance specifications, appropriate operating schedules and the motivation to support the regular 7-day and regular 4-week schedules required for production of nuclides. In numerical terms, it can be argued that there is a vast global over-capacity of neutrons and target positions, but, in practice, the availability of such irradiation positions is significantly compromised by the reactors' own schedules and maintenance shutdowns. This capacity position will be gradually eroded over the next ten years, as many research reactors reach an age beyond which they become economically viable as research tools, and government-based funding programs disappear. Although the majority of the radioisotopes used in nuclear medicine have been produced from research reactors for over 45 years and the methods are generally well established, several new initiatives and developments have occurred recently. One example is 103 Pd which is one of the few accelerator generated isotopes to be in common use for therapy, in this case as a short-lived isotope for permanent implant treatment of prostate cancer. Historically, 103 Pd used to be generated via the 102 Pd(n,γ) 103 Pd reaction which relied on the availability of 1% naturally abundant 102 Pd, in an enriched form and its moderately high neutron capture cross
Nanostructure analysis of friction welded Pd-Ni-P/Pd-Cu-Ni-P metallic glass interface
International Nuclear Information System (INIS)
Ohkubo, T.; Shoji, S.; Kawamura, Y.; Hono, K.
2005-01-01
Friction welded Pd 40 Ni 40 P 20 /Pd 40 Cu 30 Ni 10 P 20 metallic glass interface has been characterized by energy filtering transmission electron microscopy. The interface is fully amorphous with a gradual compositional change of Cu and Ni in the range of 30 nm. By annealing above T g , the interdiffusion of Cu and Ni progressed in the supercooled liquid region, and the crystallization occurred from the Pd 40 Ni 40 P 20 glass
Political Party Financing and why it Matters in Tanzania | Walwa ...
African Journals Online (AJOL)
Among the key recommendations is that public funding for ongoing party activities and campaigns should be allocated by a mix of proportional rules and flat subsidies to all parties that meet reasonable thresholds and flat subsidies as refers here imply providing subsidies to all political parties on equal basis. The other key ...
Crescent and Electoral Strength: Islamic Party Portrait of Reform Era In Indonesia
Directory of Open Access Journals (Sweden)
LILI ROMLI
2013-12-01
Full Text Available The establishment of Islamic political parties in the reform era in Indonesia after the fall of Suharto (1998, considered as resurgence of political stream. There are several factors that led to the revival of Islamic parties after the New Order, the theological factor, historical, sociological, and reform factor. The presence of Islamic political parties after the New Order was apparently diverse and fragmented. In the political elite of Islam itself in establishing a political party based on Islam and there is also based on nationality, and in establishing political party was using substantially approach and there is also that use formalistic approach. In the reform era elections, political Islam has failed, in which Islamic parties do not receive optimal support from voters Islam. The failure of Islamic parties in election of reform era is caused of factor among Muslims has been change the orientation of political views. Islamic parties in the reform era stuck in a political myth quantity, and Islamic parties are also fragmented and fractured in to small forces.
Selfish third parties act as peacemakers by transforming conflicts and promoting cooperation.
Halevy, Nir; Halali, Eliran
2015-06-02
The tremendous costs of conflict have made humans resourceful not only at warfare but also at peacemaking. Although third parties have acted as peacemakers since the dawn of history, little is known about voluntary, informal third-party intervention in conflict. Here we introduce the Peacemaker Game, a novel experimental paradigm, to model and study the interdependence between disputants and third parties in conflict. In the game, two disputants choose whether to cooperate or compete and a third party chooses whether or not to intervene in the conflict. Intervention introduces side payments that transform the game disputants are playing; it also introduces risk for the third party by making it vulnerable to disputants' choices. Six experiments revealed three robust effects: (i) The mere possibility of third-party intervention significantly increases cooperation in interpersonal and intergroup conflicts; (ii) reducing the risk to third parties dramatically increases intervention rates, to everyone's benefit; and (iii) disputants' cooperation rates are consistently higher than third parties' intervention rates. These findings explain why, how, and when self-interested third parties facilitate peaceful conflict resolution.
Directory of Open Access Journals (Sweden)
Brittany A Goods
Full Text Available Immune checkpoint inhibitors targeting programmed cell death protein 1 (PD-1 have been highly successful in the treatment of cancer. While PD-1 expression has been widely investigated, its role in CD4+ effector T cells in the setting of health and cancer remains unclear, particularly in the setting of glioblastoma multiforme (GBM, the most aggressive and common form of brain cancer. We examined the functional and molecular features of PD-1+CD4+CD25-CD127+Foxp3-effector cells in healthy subjects and in patients with GBM. In healthy subjects, we found that PD-1+CD4+ effector cells are dysfunctional: they do not proliferate but can secrete large quantities of IFNγ. Strikingly, blocking antibodies against PD-1 did not rescue proliferation. RNA-sequencing revealed features of exhaustion in PD-1+ CD4 effectors. In the context of GBM, tumors were enriched in PD-1+ CD4+ effectors that were similarly dysfunctional and unable to proliferate. Furthermore, we found enrichment of PD-1+TIM-3+ CD4+ effectors in tumors, suggesting that co-blockade of PD-1 and TIM-3 in GBM may be therapeutically beneficial. RNA-sequencing of blood and tumors from GBM patients revealed distinct differences between CD4+ effectors from both compartments with enrichment in multiple gene sets from tumor infiltrating PD-1-CD4+ effectors cells. Enrichment of these gene sets in tumor suggests a more metabolically active cell state with signaling through other co-receptors. PD-1 expression on CD4 cells identifies a dysfunctional subset refractory to rescue with PD-1 blocking antibodies, suggesting that the influence of immune checkpoint inhibitors may involve recovery of function in the PD-1-CD4+ T cell compartment. Additionally, co-blockade of PD-1 and TIM-3 in GBM may be therapeutically beneficial.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Definitions. 811.102 Section 811... URBAN DEVELOPMENT (SECTION 8 HOUSING ASSISTANCE PROGRAMS, SECTION 202 DIRECT LOAN PROGRAM, SECTION 202... PROGRAM) TAX EXEMPTION OF OBLIGATIONS OF PUBLIC HOUSING AGENCIES AND RELATED AMENDMENTS § 811.102...
42 CFR 93.102 - Applicability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Applicability. 93.102 Section 93.102 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...
Mauritania: an authoritarian regime and the reconfiguration of the party system
Directory of Open Access Journals (Sweden)
Raquel Ojeda García
2015-05-01
Full Text Available This investigation raises the question of whether Mauritania should be considered an authoritarian regime. The explanatory variable used is not the only factor, but in Mauritania’s case it is one that has been given little attention. It is an analysis of the party system and its level of institutionalisation through five indicators: the social rooting of the parties; personalism and the profile of the leader; the level of volatility; the calling and participation of the opposition parties in the boycott of the elections and the ultimate acceptance by those parties of their results. It starts from the premise that representative democracy is built on a party political structure and draws conclusions about the low level of institutionalisation of the party system and the authoritarianism of the Mauritanian regime.
42 CFR 102.74 - Disapproval of benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Disapproval of benefits. 102.74 Section 102.74 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES VACCINES SMALLPOX COMPENSATION PROGRAM Secretarial Determinations § 102.74 Disapproval of benefits. (a) If the Secretary...
Dynamics diffusion behaviors of Pd small clusters on a Pd(1 1 1) surface
International Nuclear Information System (INIS)
Liu, Fusheng; Hu, Wangyu; Deng, Huiqiu; He, Rensheng; Yang, Xiyuan; Lu, Kuilin; Deng, Lei; Luo, Wenhua
2010-01-01
Using molecular dynamics, nudged elastic band and modified analytic embedded atom methods, the self-diffusion dynamics properties of palladium atomic clusters up to seven atoms on the Pd (1 1 1) surface have been studied at temperatures ranging from 300 to 1000 K. The simulation time varies from 20 to 75 ns according to the cluster sizes and the temperature ranges. The heptamer and trimer are more stable than the other neighboring clusters. The diffusion coefficients of the clusters are derived from the mean square displacement of the cluster's mass-center, and the diffusion prefactors D 0 and activation energies E a are derived from the Arrhenius relation. The activation energy of the clusters increases with the increasing atom number in the clusters, especially for Pd 6 to Pd 7 . The analysis of trajectories shows the noncompact clusters diffuse by the local diffusion mechanism but the compact clusters diffuse mainly by the whole gliding mechanism, and some static energy barriers of the diffusion modes are calculated. From Pd 2 to Pd 6 , the prefactors are in the range of the standard value 10 −3 cm 2 s −1 , and the prefactor of Pd 7 cluster is 2 orders of magnitude greater than that of the single Pd adatom because of a large number of nonequivalent diffusion processes. The heptamer can be the nucleus in the room temperature range according to nucleation theory
Enhancement in anomalous Hall resistivity of Co/Pd multilayer and CoPd alloy by Ga+ ion irradiation
Guo, Zaibing
2014-02-01
In this paper, we report the effect of Ga+ ion irradiation on anomalous Hall effect (AHE) and longitudinal resistivity (ρxx) in [Co(3 Å)/Pd(5 Å)]80 multilayer and Co 42Pd58 alloy. 4- and 2-fold increases in anomalous Hall resistivity (ρAH) in the Co/Pd multilayer and CoPd alloy have been observed after irradiations at doses of 2.4 × 1015 and 3.3×10 15 ions/cm2, respectively. Skew scattering and side jump contributions to AHE have been analyzed based on the scaling relationship ρAH = aρxx + bρ2xx. For the Co/Pd multilayer, AHE is mainly affected by ion irradiation-induced interface diffusion and defects. For the CoPd alloy, the increase in doses above 1.5 × 1015 ions/cm2 induces a sign change in skew scattering, followed by the skew scattering contribution to AHE overwhelming the side jump contribution, this phenomenon should be attributed to irradiation-induced defects and modifications in chemical ordering. © Copyright EPLA, 2014.
Developing Product Lines with 3rd-party components
De Jonge, M.
2007-01-01
The trends toward product line development and toward adopting more 3rd-party software are hard to combine. The reason is that productlines demand fine control over the software (e.g., for diversity management), while 3rd-party software (almost by definition) provides only little or no control. A
Machado, Isidro; López-Guerrero, Jose Antonio; Scotlandi, Katia; Picci, Piero; Llombart-Bosch, Antonio
2018-05-01
Ewing's sarcoma family of tumors (ESFT) are aggressive neoplasms with scant tumor-infiltrating lymphocytes. We analyzed the immunohistochemical (IHC) expression of PD-L1 and PD-1 and their prognostic significance in clinically localized neoplasms in a cohort of 370 ESFT. Slides prepared from tissue microarrays were stained for PD-L1, PD-1, and CD8. Membranous/cytoplasmic staining over 5% of tumor cells was regarded as positive for PD-L1 and PD-1. Prognostic analysis was done considering only clinically localized tumors (n = 217). PD-L1 expression was present in 19% of ESFT, while PD-1 was expressed in 26%. Forty-eight percent of tumors were negative and 12% were positive for both PD-L1 and PD-1. Metastatic tumors displayed higher expression of PD-L1 (p < 0.0001). Histological subtypes were not correlated with PD-L1 or PD-1 positivity. ESFT with elevated proliferation index (Ki-67) were associated with higher PD-L1 expression (p = 0.049). Regarding prognosis, no significant association was found between PD-L1 expression and progression-free survival (PFS) or overall survival (OS), whereas lack of PD-1 expression in tumor cells was correlated with both poor PFS (p = 0.02) and poor OS (p = 0.004). Tumor-infiltrating CD8(+) T lymphocytes were observed in 15.4% of ESFT with informative results (347 tumors). No correlation was found between tumor-infiltrating CD8(+) T lymphocytes and ESFT histological subtypes, tumor location, or PD-1 and PD-L1 expression, nor with PFS (p = 0.473) or OS (p = 0.087). PD-L1 expression was not significantly related to prognosis. PD-1 was expressed in 26% of ESFT tumor cells and may have prognostic and therapeutic implications. CD8 expression in tumor-infiltrating lymphocytes was not related to prognosis.
Peoples Democratic Party in the Fourth Republic of Nigeria
Directory of Open Access Journals (Sweden)
Aliyu Mukhtar Katsina
2016-06-01
Full Text Available Their nature and functions make political parties central to democratic governance especially in the new democracies of Africa that face the challenge of building strong and enduring democratic institutions. It is accepted that the existing trend in most of these democracies of one big party dominating the political space weakens democracy and undermines its prospects for consolidation. Big parties—usually the ruling ones—exhibit tendencies such as absence of internal democracy that are antithetical to democratic governance. While observations such as these are incontestable, there is little understanding into the nature, character, ideology, and internal structure of big parties generally. In this article, I attempt to address this concern. Specifically, I examine the nature, structure, and ideology of the Peoples Democratic Party (PDP, Nigeria’s ruling party at the federal level with considerable strength at local level between 1999 and 2015. Relying on data obtained from multiple sources, I investigate the process of its formation, the nature of its ideology, internal organization, its electoral strength, and how absence of internal democracy contributed significantly to its defeat in 2015 general elections.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Definitions. 102.127 Section 102.127 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Ex Parte Communications... parte communication means an oral or written communication not on the public record with respect to...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Definitions. 185.102 Section 185.102 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES..., or accounting or bookkeeping entry made: (a) With respect to a claim or to obtain the approval or...
41 CFR 109-27.102-1 - Applicability.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-1 Applicability. Replenishment of inventories of... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Applicability. 109-27.102-1 Section 109-27.102-1 Public Contracts and Property Management Federal Property Management...
41 CFR 109-27.102-51 - Policy.
2010-07-01
...-INVENTORY MANAGEMENT 27.1-Stock Replenishment § 109-27.102-51 Policy. Systems contracting for supply... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Policy. 109-27.102-51 Section 109-27.102-51 Public Contracts and Property Management Federal Property Management Regulations...
7 CFR 3560.102 - Housing project management.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Housing project management. 3560.102 Section 3560.102... § 3560.102 Housing project management. (a) General. Borrowers hold final responsibility for housing project management and must ensure that operations comply with the terms of all loan or grant documents...
29 CFR 102.104 - Withdrawal of petition.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Withdrawal of petition. 102.104 Section 102.104 Labor... Orders and Advisory Opinions Regarding Board Jurisdiction § 102.104 Withdrawal of petition. The petitioner may withdraw his petition at any time prior to issuance of the Board's advisory opinion. ...
29 CFR 784.102 - General legislative history.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false General legislative history. 784.102 Section 784.102 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF GENERAL... Aquatic Products Legislative History of Exemptions § 784.102 General legislative history. (a) As orginally...
41 CFR 101-27.102-2 - Guidelines.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Guidelines. 101-27.102-2 Section 101-27.102-2 Public Contracts and Property Management Federal Property Management Regulations... Replenishment § 101-27.102-2 Guidelines. Guidelines for implementing the EOQ principle of stock replenishment...
Schoop, Julius; Balk, T. John
2014-04-01
Thin films of nanoporous palladium (np-Pd) were produced from binary palladium-nickel (Pd-Ni) precursor alloys. A suitable precursor alloy and a method of dealloying to yield optimum nanoporosity (average pore/ligament size of 7 nm) were developed by studying the effects of various processing parameters on final microstructure. To obtain crack-free np-Pd, a 100 nm thin film of 20 at. pct Pd (80 at. pct Ni) can be dealloyed for ~5 hours in a 1 M solution of sulfuric acid, with oleic acid and oleylamine added as surfactants. Both shorter and longer dealloying times, as well as heating, inhibit the formation of crack-free np-Pd. Stress measurements at different stages of dealloying revealed that the necessary dealloying time is determined by the diffusion-controlled corrosion reaction occurring within the thin film during dealloying. Strong interaction between hydrogen and np-Pd was reflected in the stress evolution during dealloying. A mechanism is proposed for the formation of a Ni-rich dense top layer that results from H-induced swelling during initial dealloying and permits the development of defect-free np-Pd beneath, by limiting the speed of dealloying.
Secure Two-Party Computation with Low Communication
DEFF Research Database (Denmark)
Damgård, Ivan Bjerre; Kölker, Jonas; Faust, Sebastian
2012-01-01
We propose a 2-party UC-secure protocol that can compute any function securely. The protocol requires only two messages, communication that is poly-logarithmic in the size of the circuit description of the function, and the workload for one of the parties is also only poly-logarithmic in the size...... on the knowledge of exponent in an RSA group, and build succinct zero-knowledge arguments in the CRS model....
Asynchronous Multi-Party Computation with Quadratic Communication
DEFF Research Database (Denmark)
Hirt, Martin; Nielsen, Jesper Buus; Przydatek, Bartosz
2008-01-01
We present an efficient protocol for secure multi-party computation in the asynchronous model with optimal resilience. For n parties, up to t < n/3 of them being corrupted, and security parameter κ, a circuit with c gates can be securely computed with communication complexity O(cn^2k) bits, which...... circuit randomization due to Beaver (Crypto’91), and an abstraction of certificates, which can be of independent interest....
Directory of Open Access Journals (Sweden)
Naoya Maekawa
Full Text Available Programmed death 1 (PD-1, an immunoinhibitory receptor, and programmed death ligand 1 (PD-L1, its ligand, together induce the "exhausted" status in antigen-specific lymphocytes and are thus involved in the immune evasion of tumor cells. In this study, canine PD-1 and PD-L1 were molecularly characterized, and their potential as therapeutic targets for canine tumors was discussed. The canine PD-1 and PD-L1 genes were conserved among canine breeds. Based on the sequence information obtained, the recombinant canine PD-1 and PD-L1 proteins were constructed; they were confirmed to bind each other. Antibovine PD-L1 monoclonal antibody effectively blocked the binding of recombinant PD-1 with PD-L1-expressing cells in a dose-dependent manner. Canine melanoma, mastocytoma, renal cell carcinoma, and other types of tumors examined expressed PD-L1, whereas some did not. Interestingly, anti-PD-L1 antibody treatment enhanced IFN-γ production from tumor-infiltrating cells. These results showed that the canine PD-1/PD-L1 pathway is also associated with T-cell exhaustion in canine tumors and that its blockade with antibody could be a new therapeutic strategy for canine tumors. Further investigations are needed to confirm the ability of anti-PD-L1 antibody to reactivate canine antitumor immunity in vivo, and its therapeutic potential has to be further discussed.
Birtas Atesoglu, Elif; Tarkun, Pinar; Demirsoy, Esra Terzi; Geduk, Ayfer; Mehtap, Ozgur; Batman, Adnan; Kaya, Fatih; Cekmen, Mustafa Baki; Gulbas, Zafer; Hacıhanefioglu, Abdullah
2016-04-01
Immune thrombocytopenia (ITP) is an autoimmune disease characterized by dysregulation of T cells. Programmed death (PD) 1 and programmed death 1 ligand 1 (PD-L1) are cosignaling molecules, and the major role of the PD-1 pathway is the inhibition of self-reactive T cells and to protect against autoimmune diseases. We measured levels of serum soluble PD 1 (sPD-1) and serum soluble PD-L1 (sPD-L1) in 67 patients with ITP (24 newly diagnosed ITP [ndITP], 43 chronic ITP [cITP]) and 21 healthy controls (HCs). We determined decreased serum sPD-1 levels both in patients with ndITP and in patients with cITP when compared to HC. Moreover, there was a positive correlation between sPD-1 levels and platelet counts. The sPD-L1 levels were decreased in patients with ndITP when compared to patients with cITP. This is the first study investigating PD-1 signaling pathway in ITP. Decreased sPD-1 levels may have a role in ITP pathogenesis as without the inhibitory regulation of PD-1, sustained activation of T cells may cause inflammatory responses which is the case in ITP. © The Author(s) 2014.
Moral emotions as determinants of third-party punishment
Directory of Open Access Journals (Sweden)
Rob M. A. Nelissen
2009-12-01
Full Text Available Third-party punishment has recently received attention as an explanation for human altruism. Feelings of anger in response to norm violations are assumed to motivate third-party sanctions, yet there is only sparse and indirect support for this idea. We investigated the impact of both anger and guilt feelings on third-party sanctions. In two studies both emotions were independently manipulated. Results show that anger and guilt independently constitute sufficient but not necessary causes of punishment. Low levels of punishment are observed only when neither emotion is elicited. We discuss the implications of these findings for the functions of altruistic sanctions.
Energy Technology Data Exchange (ETDEWEB)
Bouriant, M [Commissariat a l' Energie Atomique, Grenoble (France). Centre d' Etudes Nucleaires
1967-12-01
The production of high purity stable or radioactive isotopes ({>=} 99.99 per cent) using electromagnetic separation require for equipment having a high resolving power. Besides, and in order to collect rare or short half-life isotopes, the efficiency of the ion-source must be high ({eta} > 5 to 10 per cent). With this in view, the source built operates at high temperatures (2500-3000 C) and makes use of ionisation by electronic bombardment or of thermo-ionisation. A summary is given in the first part of this work on the essential characteristics of the isotope separator ion Sources; a diagram of the principle of the source built is then given together with its characteristics. In the second part are given the values of the resolving power and of the efficiency of the Grenoble isotope separator fitted with such a source. The resolving power measured at 10 per cent of the peak height is of the order of 200. At the first magnetic stage the efficiency is between 1 and 26 per cent for a range of elements evaporating between 200 and 3000 C. Thus equipped, the separator has for example given, at the first stage, 10 mg of {sup 180}Hf at (99.69 {+-} 0.1) per cent corresponding to an enrichment coefficient of 580; recently 2 mg of {sup 150}Nd at (99.996 {+-} 0.002) per cent corresponding to an enrichment coefficient of 4.2 x 10{sup 5} has been obtained at the second stage. (author) [French] La production d'isotopes stables ou radioactifs de haute purete isotopique ({>=} 99.99 pour cent), par separation electromagnetique, exige des appareils de haut pouvoir de resolution. En outre, et en vue de collecter des isotopes de tres faible abondance ou de periode tres courte, le rendement des sources d'ions doit etre eleve ({eta} > 5 a 10 pour cent). Dans ce but, la source realisee fonctionne a haute temperature (2500-3000 C) et utilise l'ionisation par bombardement electronique, ou la thermoionisation. Dans la premiere partie de ce travail, on resume d'abord les caracteristiques
Epov, Vladimir N
2011-08-07
A novel approach is suggested to investigate the mechanisms of chemical complexation reactions based on the results of Fujii with co-workers; they have experimentally observed that several metals and metalloids demonstrate mass-independent isotope fractionation during the reactions with the DC18C6 crown ether using solvent-solvent extraction. In this manuscript, the isotope fractionation caused by the magnetic isotope effect is used to understand the mechanisms of chemical exchange reactions. Due to the rule that reactions are allowed for certain electron spin states, and forbidden for others, magnetic isotopes show chemical anomalies during these reactions. Mass-independent fractionation is suggested to take place due to the hyperfine interaction of the nuclear spin with the electron spin of the intermediate product. Moreover, the sign of the mass-independent fractionation is found to be dependent on the element and its species, which is also explained by the magnetic isotope effect. For example, highly negative mass-independent isotope fractionation of magnetic isotopes was observed for reactions of DC18C6 with SnCl(2) species and with several Ru(III) chloro-species, and highly positive for reactions of this ether with TeCl(6)(2-), and with several Cd(II) and Pd(II) species. The atomic radius of an element is also a critical parameter for the reaction with crown ether, particularly the element ions with [Kr]4d(n)5s(m) electron shell fits the best with the DC18C6 crown ring. It is demonstrated that the magnetic isotope effect in combination with the theory of orbital hybridization can help to understand the mechanism of complexation reactions. The suggested approach is also applied to explain previously published mass-independent fractionation of Hg isotopes in other types of chemical exchange reactions. This journal is © the Owner Societies 2011
29 CFR 102.116 - Signature of orders.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Signature of orders. 102.116 Section 102.116 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Certification and Signature of Documents § 102.116 Signature of orders. The executive secretary or the associate executive...
28 CFR 34.102 - Peer review procedures.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Peer review procedures. 34.102 Section 34.102 Judicial Administration DEPARTMENT OF JUSTICE OJJDP COMPETITION AND PEER REVIEW PROCEDURES Peer Review § 34.102 Peer review procedures. The OJJDP peer review process is contained in an OJJDP “Peer...
42 CFR 413.102 - Compensation of owners.
2010-10-01
...) Definitions—(1) Compensation. Compensation means the total benefit received by the owner for the services he... 42 Public Health 2 2010-10-01 2010-10-01 false Compensation of owners. 413.102 Section 413.102... § 413.102 Compensation of owners. (a) Principle. A reasonable allowance of compensation for services of...
29 CFR 102.138 - Definition of meeting.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Definition of meeting. 102.138 Section 102.138 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.138 Definition of meeting. For purposes of this subpart, meeting shall mean the deliberations of...
Atomic Structure of Au−Pd Bimetallic Alloyed Nanoparticles
Ding, Yong
2010-09-08
Using a two-step seed-mediated growth method, we synthesized bimetallic nanoparticles (NPs) having a gold octahedron core and a palladium epitaxial shell with controlled Pd-shell thickness. The mismatch-release mechanism between the Au core and Pd shell of the NPs was systematically investigated by high-resolution transmission electron microscopy. In the NPs coated with a single atomic layer of Pd, the strain between the surface Pd layer and the Au core is released by Shockley partial dislocations (SPDs) accompanied by the formation of stacking faults. For NPs coated with more Pd (>2 nm), the stacking faults still exist, but no SPDs are found. This may be due to the diffusion of Au atoms into the Pd shell layers to eliminate the SPDs. At the same time, a long-range ordered L11 AuPd alloy phase has been identified in the interface area, supporting the assumption of the diffusion of Au into Pd to release the interface mismatch. With increasing numbers of Pd shell layers, the shape of the Au-Pd NP changes, step by step, from truncated-octahedral to cubic. After the bimetallic NPs were annealed at 523 K for 10 min, the SPDs at the surface of the NPs coated with a single atomic layer of Pd disappeared due to diffusion of the Au atoms into the surface layer, while the stacking faults and the L11 Au-Pd alloyed structure remained. When the annealing temperature was increased to 800 K, electron diffraction patterns and diffraction contrast images revealed that the NPs became a uniform Au-Pd alloy, and most of the stacking faults disappeared as a result of the annealing. Even so, some clues still support the existence of the L11 phase, which suggests that the L11 phase is a stable, long-range ordered structure in Au-Pd bimetallic NPs. © 2010 American Chemical Society.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Docket. 102.27 Section 102.27 Foreign Relations... other than the Director of the Office of Aviation and summaries of oral communications prepared in...) All comments submitted under this subpart and placed in the docket, are available for public...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Application. 17.102 Section 17.102 Money and Finance: Treasury Office of the Secretary of the Treasury ENFORCEMENT OF NONDISCRIMINATION ON... Application. This part applies to all programs or activities conducted by the agency, except for programs or...
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Examples. 248.102 Section 248... AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.102 Examples. The examples in this subpart are not exclusive. The examples in this subpart provide guidance concerning the rules' application...
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Authority. 901.102 Section... REGULATIONS SYSTEM Purpose, Authority, Issuance 901.102 Authority. The DEAR and amendments thereto are issued... the authority of section 644 of the Department of Energy Organization Act (42 U.S.C. 7254), section...
International Nuclear Information System (INIS)
Belyavenko, V.S.; Borozenets, G.P.; Vishnevskij, I.N.; Zheltonozhskij, V.A.
1986-01-01
103 Pd decay in different chemical states has been investigated. The change of the partial half-life period equal to 0.67±0.15% has been detected. The γ-spectrum has been measured to a high precision. The new data have been obtained on population probabilities of 103 Rh excited states and the total energy of decay for 103 Pd has been determined to a high precision (543.0±0.8). The values of log ft have been determined
Shi, Danfeng; Zhou, Shuangyan; Liu, Xuewei; Zhao, Chenxi; Liu, Huanxiang; Yao, Xiaojun
2018-03-01
The inhibitors blocking the interaction between programmed cell death protein 1(PD-1) and programmed death-ligand 1(PD-L1) can activate the immune response of T cell and eliminate cancer cells. The crystallographic studies have provided structural insights of the interactive interfaces between PD-L1 and its protein ligands. However, the hotspot residues on PD-L1 as well as structural and energetic basis for different protein ligands still need to be further investigated. Molecular modeling methods including molecular dynamics simulation, per-residue free energy decomposition, virtual alanine scanning mutagenesis and residue-residue contact analysis were used to qualitatively and quantitatively analyze the interactions between PD-L1 and different protein ligands. The results of virtual alanine scanning mutagenesis suggest that Y56, Q66, M115, D122, Y123, R125 are the hotspot residues on PD-L1. The residue-residue contact analysis further shows that PD-1 interacts with PD-L1 mainly by F and G strands while monoclonal antibodies like avelumab and BMS-936559 mainly interact with PD-L1 by CDR2 and CDR3 loops of the heavy chain. A structurally similar β-hairpin peptide with 13 or 14 residues was extracted from each protein ligand and these β-hairpin peptides were found tightly binding to the putative hotspot residues on PD-L1. This study recognizes the hotspot residues on PD-L1 and uncovers the common structural and energetic basis of different protein ligands binding to PD-L1. These results will be valuable for the design of small molecule or peptide inhibitors targeting on PD-L1. Copyright © 2017 Elsevier B.V. All rights reserved.
Nationalism, territory and extremism in party politics
DEFF Research Database (Denmark)
Bourne, Angela
In the paper I address the empirical puzzle arising from different responses by political authorities in Spain and the UK to the existence of political parties integrated in the terrorist groups Euskadi Ta Askatasuna (ETA, Basque Homeland and Freedom) and the Irish Republican Army. More specifica......In the paper I address the empirical puzzle arising from different responses by political authorities in Spain and the UK to the existence of political parties integrated in the terrorist groups Euskadi Ta Askatasuna (ETA, Basque Homeland and Freedom) and the Irish Republican Army. More...... for realization of free speech rights and representation is also emphasized, and where proscription is seen as inimical to resolution of conflict underpinning violence. In the context of party competition, a winning coalition is required for one discourse to predominate. However, I also argued that both ideas...
29 CFR 1650.102 - Delegation of authority.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Delegation of authority. 1650.102 Section 1650.102 Labor... for the Collection of Debts by Salary Offset § 1650.102 Delegation of authority. The Chair delegated to the Chief Human Capital Officer the authority to collect debts owed by current EEOC employees, and...
10 CFR 611.102 - Eligible project costs.
2010-01-01
... Accounting Principles and these costs may be considered by DOE in determining the Borrower's contribution to... 10 Energy 4 2010-01-01 2010-01-01 false Eligible project costs. 611.102 Section 611.102 Energy... PROGRAM Direct Loan Program § 611.102 Eligible project costs. (a) Eligible costs are: (1) Those costs that...
International Nuclear Information System (INIS)
Nath, Ravinder; Yue Ning; Roa, Eduardo
2002-01-01
A newly designed encapsulated 103 Pd source has been introduced (BrachySeed trade mark sign -Pd-103, also named Model Pd-1, manufactured by DRAXIMAGE Inc. and distributed by Cytogen Corp.) for interstitial brachytherapy to provide more isotropic dose distributions. In this work, the dosimetric characteristics of the 103 Pd source were measured with micro LiF TLD chips and dosimetry parameters were characterized based upon the American Association of Physicists in Medicine (AAPM) Task Group No. 43 formalism. The dose rate constant of the sources was determined to be 0.66±0.05 cGy h-1 U-1. The radial dose function was measured and was found to be similar to that of the Theragenics Model 200 103 Pd source. The anisotropy constant for the Model Pd-1 source was determined to be 1.03
Energy Technology Data Exchange (ETDEWEB)
Asanova, Tatyana I., E-mail: nti@niic.nsc.ru; Asanov, Igor P. [Nikolaev Institute of Inorganic Chemistry SB RAS (Russian Federation); Kim, Min-Gyu [Pohang University of Science and Technology, Beamline Research Division (Korea, Republic of); Gerasimov, Evgeny Yu. [Boreskov Institute of Catalysis SB RAS (Russian Federation); Zadesenets, Andrey V.; Plyusnin, Pavel E.; Korenev, Sergey V. [Nikolaev Institute of Inorganic Chemistry SB RAS (Russian Federation)
2013-10-15
The formation mechanism of Pd-Ir nanoparticles during thermal decomposition of double complex salt [Pd(NH{sub 3}){sub 4}][IrCl{sub 6}] has been studied by in situ X-ray absorption (XAFS) and photoelectron (XPS) spectroscopies. The changes in the structure of the Pd and Ir closest to the surroundings and chemical states of Pd, Ir, Cl, and N atoms were traced in the range from room temperature to 420 Degree-Sign C in inert atmosphere. It was established that the thermal decomposition process is carried out in 5 steps. The Pd-Ir nanoparticles are formed in pyramidal/rounded Pd-rich (10-200 nm) and dendrite Ir-rich (10-50 nm) solid solutions. A d charge depletion at Ir site and a gain at Pd, as well as the intra-atomic charge redistribution between the outer d and s and p electrons of both Ir and Pd in Pd-Ir nanoparticles, were found to occur.Graphical Abstract.
International Nuclear Information System (INIS)
Lapolli, Andre Luis
2006-01-01
Systematic behavior of magnetic hyperfine field (B hf ) in the intermetallic compounds Gd(Ni,Pd,Cu)In Tb(Ni,Pd)In, Dy(Ni,Pd)In and Ho(Ni,Pd)In was studied by Perturbed Gamma-Gamma Angular Correlation spectroscopy. The measurements of B hf were carried out at the rare earth atom and in sites using the nuclear probes 140 Ce and 11 '1Cd respectively. The variation of hyperfine field with temperature, in most cases, follows the Brillouin function predicted from the molecular field theory. The hyperfine field values at rare earth atom sites obtained from 140 Ce probe as well as at in sites obtained from 111 Cd probe for each series of compounds were extrapolated to zero Kelvin B hf (T=0) from these curves. These values were compared with the values of the literature for other compounds containing the same rare earth element and all of them show a linear relationship with the ordering temperature. This indicates that the main contribution to B hf comes from the conduction electron polarization (CEP) through Fermi contact interaction and the principal mechanism of magnetic interaction in these compounds can be described by the RKKY type interaction. The values of B hf (T=0) for each family of intermetallic compounds RNiIn and RPdIn when plotted as a function of 4f spin projection of rare earth element also shows a linear relationship. Exceptions are the results for the compounds RNiIn obtained with 111 Cd probe where a small deviation from linearity is observed. The results of the measurements carried out with the 111 Cd probe were also analyzed to obtain the hyperfine parameters of the quadrupole interaction as a function of temperature for RPdln and GdNiIn compounds. The results show that for the compound GdPdIn there might be some Gd-In disorder at high temperature. (author)
DEFF Research Database (Denmark)
Borch, Troels H; Donia, Marco; Andersen, Mads H
2015-01-01
Physiologically, the programmed death 1 (PD-1) pathway is involved in limiting the killing of bystander cells during an infection and controlling autoimmunity. However, cancers exploit this system to avoid immune killing, and PD-1 ligand 1 and 2 (PD-L1 and PD-L2) expression on tumor cells, as wel...... Food and Drug Administration (FDA) for the treatment of metastatic melanoma. As already shown with nivolumab and ipilimumab, the combination of PD-1 pathway blockade with other anticancer agents holds promise in the form of additive synergistic anticancer effects....
International Nuclear Information System (INIS)
Tosti, S.; Bettinali, L.; Violante, V.; Basile, A.; Chiappetta, M.; Criscuoli, A.; Drioli, E.; Rizzelo, C.
1998-01-01
A mathematical model of a catalytic membrane reactor (CMR) for the water gas shift reaction has been carried out. Based on the model, a new closed loop process for the tritium removal system for the ITER test module of helium cooled pebble bed blanket concept has been studied. A CMR is the main equipment of the proposed process. The main advantages of the closed loop process are related to the absence of secondary wastes, low tritium inventories, moderate operating temperatures and pressures, low dilution of the stream to be processed by isotopic separation. As permeating membranes in the CMR ultra-thin metallic membranes of Pd and PdAg (50-70 μm thick) have been studied. A ceramic porous tube, containing the catalyst in the lumen, has been put in the metallic tube to obtain the CMR for the water gas shifting. Experimental tests, carried out both on ultra-thin membranes and CMRs for the water gas shift reaction, confirmed the behavior studied by the theoretical model and showed a long live of the membrane. (authors)
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Policy. 0.102 Section 0.102 Money and Finance: Treasury Office of the Secretary of the Treasury DEPARTMENT OF THE TREASURY EMPLOYEE RULES OF... is not limited to: (1) Reassignment of work duties; (2) Disqualification from a particular assignment...
Dicty_cDB: Contig-U13954-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 281 e-109 EU080331_1( EU080331 |pid:none) Phytophthora cuyabensis isolate PD... 294 e-109 EU079512_1( EU0795...D_0... 273 e-102 EU080357_1( EU080357 |pid:none) Phytophthora cuyabensis isolate PD... 271 e-102 CP000090_28
Recent tendency of Nuclear Third Party Legislation
International Nuclear Information System (INIS)
Gohara, Fumiaki
1988-01-01
Nuclear accidents in Three Mile Island and Chernobyl have a great influence on Nuclear Third Party Legislation of many countries. Nuclear Third Party Law of Japan is due to expire as at 31st, December, 1989, under the recent circumstances in which threre exist pros and cons to nuclear installations among people. This report describes the outline of Japanese Nuclear Law compared with foreign ones and the prospect of its revision. (author)
Immigration politics Italian style: the paradoxical behaviour of mainstream and populist parties.
Perlmutter, T
1996-01-01
This article explores the role of electoral politics in managing immigration as a policy option in Italy. Italy was late in passing its first comprehensive immigration legislation (1990). A small, liberal party waged a campaign against the proposed immigration law. A party known for right-wing posturing did not mobilize against the law. These political postures were not anticipated by conventional wisdom. Conventional wisdom suggests that immigration should not be an electoral issue and that consensus solutions should be sought. It is argued that the Italian response supports the view that in a fragmented, multi-party system, minor parties will be more likely to mobilize. Two mass media studies were used as the basis for this article's analysis. The studies provide detailed evidence on party willingness to publicly discuss immigration and the ways the issues are framed. The Italian case illustrates the tendency for mainstream, pro-system parties to politicize the issue and extremist, anti-system parties to depoliticize it. The DC and PCI, as mass parties, behaved traditionally and supported moderately open immigration policies, but in closed forums. The minor parties had a stake in shifting electoral support, so the PSI took an outspoken stand and the PARI publicized its exclusion from the policy-making process and its support for more restrictive policies. It was the constituencies and the leadership structure that facilitated these strategies. The author differs from Betz's party analysis by arguing that party ideology may not be a useful guide for predicting stands on immigration, and that it is difficult to generalize about immigration.
42 CFR 102.73 - Approval of benefits.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Approval of benefits. 102.73 Section 102.73 Public... PROGRAM Secretarial Determinations § 102.73 Approval of benefits. When the Secretary has determined that benefits will be paid to a requester and has calculated the type and amount of such benefits, he will...
Tracing the territorial dynamics of party fragmentation in Mexico (1991-2015
Directory of Open Access Journals (Sweden)
Willibald SONNLEITNER
2017-06-01
Full Text Available Over the past decades, Mexican politics evolved from a closed, corporative and hegemonic-party authoritarianism, towards a more plural and competitive multi-party system. In the nineties, three relevant parties structured electoral politics. But this system soon fragmented and reached an average of 5.6 effective parties in 2015. What causes and drives political and partisan fragmentation in Mexico? Which have been the main temporal and territorial dynamics? How did they reshape Mexico’s electoral geography?
Oǧuz, Ismail-Can; Mineva, Tzonka; Guesmi, Hazar
2018-01-01
The reactivity of various Pd ensembles on the Au—Pd(100) alloy catalyst toward CO oxidation was investigated by using density functional theory (DFT). This study was prompted by the search for efficient catalysts operating at low temperature for the CO oxidation reaction that is of primary environmental importance. To this aim, we considered Pd modified Au(100) surfaces including Pd monomers, Pd dimers, second neighboring Pd atoms, and Pd chains in a comparative study of the minimum energy reaction pathways. The effect of dispersion interactions was included in the calculations of the O2 dissociation reaction pathway by using the DFT-D3 scheme. The addition of the dispersion interaction strongly improves the adsorption ability of O2 on the Au—Pd surface but does not affect the activation energy barriers of the Transitions States (TSs). As for O2 to dissociate, it is imperative that the TS has lower activation energy than the O2 desorption energy. DFT-D3 is found to favor, in some cases, O2 dissociation on configurations being identified from uncorrected DFT calculations as inactive. This is the case of the second neighboring Pd configuration for which uncorrected DFT predicts positive Gibbs free energy (ΔG) of the O2 adsorption, therefore an endergonic reaction. With the addition of D3 correction, ΔG becomes negative that reveals a spontaneous O2 adsorption. Among the investigated Au—Pd (100) ensembles, the Pd chain dissociates most easily O2 and highly stabilizes the dissociated O atoms; however, it has an inferior reactivity toward CO oxidation and CO2 formation. Indeed, CO strongly adsorbs on the palladium bridge sites and therefore poisoning the surface Pd chain. By contrast, the second neighboring Pd configuration that shows somewhat lower ability to dissociate O2 turns out to be more reactive in the CO2 formation step. These results evidence the complex effect of Pd ensembles on the CO oxidation reaction. Associative CO oxidation proceeds with high
FORMATION OF THE ENTITY'S ACCOUNTING POLICIES WITH REGARD TO RELATED PARTIES
Directory of Open Access Journals (Sweden)
B. Zasadnyi
2015-10-01
Full Text Available The article solved the problem concerning the development and practical application of accounting policies with regards to related parties. One element of the company’s accounting policies is to establish the principles of classification of related parties and their list considering materiality relations. In addition, the company must determine its related entities for the purposes of transfer pricing. Based the criteria definition and classification of related parties, proposed that the significance of the impact of one party to another based on the content of operations, their volume, the results and how such operations significantly affect the financial, investment and commercial activities. Only an analysis of all the factors together contribute to reliable estimates list of related parties. The critical analysis are made of methods for determining transfer prices for transactions, designed piece order of accounting policies, which reflected information about related parties.
Directory of Open Access Journals (Sweden)
Maria Kahn
Full Text Available A large gap for the support of point-of-care testing is the availability of reagents to support quality control (QC of diagnostic assays along the supply chain from the manufacturer to the end user. While reagents and systems exist to support QC of laboratory screening tests for glucose-6-phosphate dehydrogenase (G6PD deficiency, they are not configured appropriately to support point-of-care testing. The feasibility of using lyophilized recombinant human G6PD as a QC reagent in novel point-of-care tests for G6PD deficiency is demonstrated.Human recombinant G6PD (r-G6PD was expressed in Escherichia coli and purified. Aliquots were stored at -80°C. Prior to lyophilization, aliquots were thawed, and three concentrations of r-G6PD (representing normal, intermediate, and deficient clinical G6PD levels were prepared and mixed with a protective formulation, which protects the enzyme activity against degradation from denaturation during the lyophilization process. Following lyophilization, individual single-use tubes of lyophilized r-G6PD were placed in individual packs with desiccants and stored at five temperatures for one year. An enzyme assay for G6PD activity was used to ascertain the stability of r-G6PD activity while stored at different temperatures.Lyophilized r-G6PD is stable and can be used as a control indicator. Results presented here show that G6PD activity is stable for at least 365 days when stored at -80°C, 4°C, 30°C, and 45°C. When stored at 55°C, enzyme activity was found to be stable only through day 28.Lyophilized r-G6PD enzyme is stable and can be used as a control for point-of-care tests for G6PD deficiency.
DEFF Research Database (Denmark)
Grünberg, Nis
society through its legacy as a socialist work unit (danwei). Using Polanyi’s concept of embeddedness, the paper reveals how SOEs are split into two tiers each tasked with the respective objectives of economic development and political stability, and thus as Party-state organizations are used to flexibly...
New Swiss legislation on nuclear third party liability
International Nuclear Information System (INIS)
Fischer, U.
1981-10-01
Following a description of the Paris Convention and Brussels Supplementary Convention system for nuclear third party liability and that prevailing until now in Switzerland, the paper reviews the new Swiss nuclear third party liability Bill prepared after a popular consultation. The new provisions are analysed and in particular, that providing for unlimited liability. (NEA) [fr
Directory of Open Access Journals (Sweden)
Andreas Ufen
2009-07-01
Full Text Available The Indonesian parliamentary elections in April 2009 have been characterized as peaceful, free, and fair. All in all, the young democracy has been stabilized. The PD (Partai Demokrat, Democratic Party, the electoral vehicle of President Susilo Bambang Yudhoyono, won with 20.8%. It is mostly secular parties, that is the PD, Golkar (Partai Golongan Karya, Party of Functional Groups and the PDI-P (Partai Demokrasi Indonesia – Perjuangan, Indonesian Democratic Party – Struggle, which now dominate the party system. Support for the Islamic parties has dwindled; only the Islamist PKS (Partai Keadilan Sejahtera, Prosperous Justice Party was able to gain slightly. The rapid rise of the PD and two smaller new parties is testimony to the fluidity of the party system. The results corroborate a trend of a weakening of socio-political "streams" (aliran. This development is due to the increasing personalization and commercialization of politics and the impact of mass media. Moreover, electoral reforms (the introduction of an "open list" seem to have strengthened local politicians vis-à-vis party headquarters in Jakarta. Die indonesischen Parlamentswahlen vom April 2009 verliefen weitgehend friedlich und wurden von Beobachtern als im Wesentlichen "frei und fair" eingestuft. Insgesamt ist die junge Demokratie weiter stabilisiert worden. Mit 20,8% der Stimmen ist die PD (Partai Demokrat, Democratic Party von Präsident Susilo Bambang Yudhoyono als Siegerin aus den Wahlen hervorgegangen. Die großen, tendenziell säkularistisch orientierten Parteien, Golkar (Partai Golongan Karya, Party of Functional Groups und PDI-P (Partai Demokrasi Indonesia – Perjuangan, Indonesian Democratic Party – Struggle, haben ebenso wie die kleineren islamischen Parteien deutlich an Stimmen eingebüßt, während die mit großen Hoffnungen angetretene islamistische PKS (Partai Keadilan Sejahtera, Prosperous Justice Party nur leichte Stimmengewinne verbuchen konnte. Der schnelle
2010-04-01
... display panel of a food for which a common or usual name regulation is established is too small to... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Petitions. 102.19 Section 102.19 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...
Interfacial processes in the Pd/a-Ge:H system
Edelman, F.; Cytermann, C.; Brener, R.; Eizenberg, M.; Weil, R.; Beyer, W.
1993-06-01
The kinetics of phase transformation has been studied in a two-layer structure of Pd/a-Ge:H after vacuum annealing at temperatures from 180 to 500°C. The a-Ge:H was deposited at 250°C on both c-Si and cleaved NaCl substrates in an RF glow discharge from a GeH 4/H 2 mixture. It was found that, similarly to the Pd/c-Ge and the Pd/a-Ge (e-gun deposited) systems, in the case of 0.15-0.2 μm Pd/0.6-1.0 μm a-Ge:H interfacial germanides formed first through the production of Pd 2Ge (plus a small amount of PdGe), and then PdGe was produced. The growth of both compounds was found to be diffusion-controlled. The nonreacted a-Ge:H layer beneath the germanide overlayer crystallized at 400-500°C. A reverse sequence of germanides formation was revealed in the case of 50 nm Pd/30 nm a-Ge:H, studied by in situ heat treatment in the TEM utilizing non-supported samples. The first germanide detected was PdGe and then, as a result of PdGe and Ge reaction or the PdGe decomposition, Pd 2Ge formed. The temperature dependence of the incubation time before the first ˜ 10 nm PdGe grains formed, followed an Arrhenius curve with an activation energy of 1.45 eV.
Directory of Open Access Journals (Sweden)
Peng-Fei Wang
2017-10-01
Full Text Available Background: Treatment of cancers with programmed cell death protein 1 (PD-1 pathway inhibitors can lead to immune-related adverse events (irAEs, which could be serious and even fetal. Therefore, clinicians should be aware of the characteristics of irAEs associated with the use of such drugs.Methods: The MEDLINE, EMBASE, and Cochrane databases were searched to find potential studies using the following strategies: anti-PD-1/PD-L1 treatment; irAEs; and cancer. R© package Meta was used to pool incidence.Results: Forty-six studies representing 12,808 oncologic patients treated with anti-PD-1/PD-L1 agents were included in the meta-analysis. The anti-PD-1/PD-L1 agents included nivolumab, pembrolizumab, atezolizumab, durvalumab, avelumab, and BMS-936559. The tumor types were melanomas, Hodgkin lymphomas, urothelial carcinomas, breast cancers, non-small cell lung cancers, renal cell carcinomas (RCC, colorectal cancers, and others. We described irAEs according to organ systems, namely, the skin (pruritus, rash, maculopapular rash, vitiligo, and dermatitis, endocrine system (hypothyroidism, hyperthyroidism, hypophysitis, thyroiditis, and adrenal insufficiency, digestive system (colitis, diarrhea, pancreatitis, and increased AST/ALT/bilirubin, respiratory system (pneumonitis, lung infiltration, and interstitial lung disease, and urinary system (increased creatinine, nephritis, and renal failure. In patients treated with the PD-1 signaling inhibitors, the overall incidence of irAEs was 26.82% (95% CI, 21.73–32.61; I2, 92.80 in any grade and 6.10% (95% CI, 4.85–7.64; I2, 52.00 in severe grade, respectively. The development of irAEs was unrelated to the dose of anti-PD-1/PD-L1 agents. The incidence of particular irAEs varied when different cancers were treated with different drugs. The incidence of death due to irAEs was around 0.17%.Conclusion: The occurrence of irAEs was organ-specific and related to drug and tumor types.
Energy Technology Data Exchange (ETDEWEB)
Geraldes, Adriana Napoleao; Silva, Dionisio Furtunato da; Andrade e Silva, Leonardo Gondin de; Spinace, Estevam Vitorio; Oliveira Neto, Almir, E-mail: drinager@ig.com.br, E-mail: dfsilva@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Santos, Mauro Coelho dos [Universidade Federal do ABC (LEMN/CCNH/UFABC), Santo Andre, SP (Brazil)
2015-07-01
Environmental problems and the world growing demand for energy has mobilized the scientific community in finding of clean and renewable energy sources. In this context, fuel cells appear as appropriate technology for generating electricity through alcohols electro-oxidation. Multi Wall Carbon Nanotubes (MWCNT)-supported Pd and trimetallic PdAuSn (Pd:Au:Sn 50:10:40 atomic ratio) electrocatalysts were prepared using electron beam irradiation. The obtained materials were characterized by VC, Chronoamperometry, EDX, TEM and XRD. The catalytic activities of electrocatalysts toward ethanol electro-oxidation were evaluated in alkaline medium in a single alkaline direct ethanol fuel cell (ADEFC) in a range temperature 60 to 90 deg C. The best performances were obtained at 85 deg C: 33 mW.cm{sup -2} and 31 mW.cm{sup -2} for Pd/ MWCNT and PdAuSn/MWCNT electrocatalysts, respectively. X-ray diffractograms of electrocatalysts showed the presence of Pd-rich (fcc) and Au-rich (fcc) phases. Cyclic voltammetry and chronoamperometry experiments showed that PdAuSn/MWCNT electrocatalyst demonstrated similar activity toward ethanol electro-oxidation at room temperature, compared to electrocatalyst Pd/MWCNT. (author)
International Nuclear Information System (INIS)
Geraldes, Adriana Napoleao; Silva, Dionisio Furtunato da; Andrade e Silva, Leonardo Gondin de; Spinace, Estevam Vitorio; Oliveira Neto, Almir; Santos, Mauro Coelho dos
2015-01-01
Environmental problems and the world growing demand for energy has mobilized the scientific community in finding of clean and renewable energy sources. In this context, fuel cells appear as appropriate technology for generating electricity through alcohols electro-oxidation. Multi Wall Carbon Nanotubes (MWCNT)-supported Pd and trimetallic PdAuSn (Pd:Au:Sn 50:10:40 atomic ratio) electrocatalysts were prepared using electron beam irradiation. The obtained materials were characterized by VC, Chronoamperometry, EDX, TEM and XRD. The catalytic activities of electrocatalysts toward ethanol electro-oxidation were evaluated in alkaline medium in a single alkaline direct ethanol fuel cell (ADEFC) in a range temperature 60 to 90 deg C. The best performances were obtained at 85 deg C: 33 mW.cm -2 and 31 mW.cm -2 for Pd/ MWCNT and PdAuSn/MWCNT electrocatalysts, respectively. X-ray diffractograms of electrocatalysts showed the presence of Pd-rich (fcc) and Au-rich (fcc) phases. Cyclic voltammetry and chronoamperometry experiments showed that PdAuSn/MWCNT electrocatalyst demonstrated similar activity toward ethanol electro-oxidation at room temperature, compared to electrocatalyst Pd/MWCNT. (author)
Directory of Open Access Journals (Sweden)
Reynaldo Martínez Guerrero
2014-01-01
Full Text Available The effect of the preparation method of monometallic Pd and Pt and bimetallic Pd-Pt/Al2O3-TiO2 catalysts on the hydrodesulfurization (HDS of dibenzothiophene (DBT was investigated in this study. The synthesis was accomplished using three methods: (A impregnation, (B metal organic chemical vapor deposition (MOCVD, and (C impregnation-MOCVD. The bimetallic Pd-Pt catalyst prepared by the impregnation-MOCVD method was most active for the HDS of DBT compared to those prepared by the single impregnation or MOCVD method due to the synergetic effect between both noble metals. The greater selectivity toward biphenyl indicated that this bimetallic Pd-Pt catalyst preferentially removes sulfur via the direct desulfurization mechanism. However, the bimetallic Pd-Pt catalyst prepared using the single MOCVD method did not produce any cyclohexylbenzene, which is most likely associated with the hydrogenation/dehydrogenation sites.
Otjes, Simon Pieter
2012-01-01
This thesis studies, how, when and why established political parties imitate new political parties. It examines new party effects on both the policy positions of established parties and the attention established political parties spend on issues. It examines this effect in both the electoral and
Energy Technology Data Exchange (ETDEWEB)
Zhang, Tong; Lin, Lu [State Key Laboratory of Fine Chemicals, School of Chemical Engineering, Dalian University of Technology, Dalian, 116024 (China); Zhang, Xiongfu, E-mail: xfzhang@dlut.edu.cn [State Key Laboratory of Fine Chemicals, School of Chemical Engineering, Dalian University of Technology, Dalian, 116024 (China); Liu, Haiou; Yan, Xinjuan [State Key Laboratory of Fine Chemicals, School of Chemical Engineering, Dalian University of Technology, Dalian, 116024 (China); Liu, Zhang; Yeung, King Lun [Department of Chemical and Biomolecular Engineering, Hong Kong University of Science and Technology, Clear Water Bay, Kowloon, Hong Kong SAR (China)
2015-10-01
Graphical abstract: - Highlights: • Uniform-sized colloidal carbon spheres were synthesized from low-cost glucose. • Pd nanoparticles were loaded onto the carbon spheres via self-reduction method. • A layer of ZIF-8 shell was in situ grown over the Pd-loaded carbon spheres. • The ZIF-8@Pd-CCS showed leach-proof and aggregation-resistant properties of Pd. - Abstract: Aiming to enhance the stability of noble metal nanoparticles that are anchored on the surface of colloidal carbon spheres (CCSs), we designed and prepared a new kind of sandwich-structured ZIF-8@Pd-CCS microsphere. Typically, uniform CCSs were first synthesized by the aromatization and carbonization of glucose under hydrothermal conditions. Subsequently, noble metal nanoparticles, herein Pd nanoparticles, were attached to the surface of CCSs via self-reduction route, followed by in situ assembly of a thin layer of ZIF-8 over the Pd nanoparticles to form the sandwich-type ZIF-8@Pd-CCS microspheres. X-ray diffraction (XRD) patterns and Fourier transform infrared spectroscopy (FTIR) spectra confirmed the presence of crystalline ZIF-8, while TEM analysis revealed that the ZIF-8 shells were closely bound to the Pd-loaded CCSs. The shell thickness could be tuned by varying the ZIF-8 assembly cycles. Further, liquid-phase hydrogenation of 1-hexene as the probe reaction was carried out over the ZIF-8@Pd-CCS microspheres and results showed that the prepared microspheres exhibited excellent agglomeration-resistant and leach-proof properties for the Pd nanoparticles, thus leading to the good reusability of the ZIF-8@Pd-CCS microspheres.
Prodeus, Aaron; Abdul-Wahid, Aws; Fischer, Nicholas W; Huang, Eric H-B; Cydzik, Marzena; Gariépy, Jean
2015-04-28
Blocking the immunoinhibitory PD-1:PD-L1 pathway using monoclonal antibodies has led to dramatic clinical responses by reversing tumor immune evasion and provoking robust and durable antitumor responses. Anti-PD-1 antibodies have now been approved for the treatment of melanoma, and are being clinically tested in a number of other tumor types as both a monotherapy and as part of combination regimens. Here, we report the development of DNA aptamers as synthetic, nonimmunogenic antibody mimics, which bind specifically to the murine extracellular domain of PD-1 and block the PD-1:PD-L1 interaction. One such aptamer, MP7, functionally inhibits the PD-L1-mediated suppression of IL-2 secretion in primary T-cells. A PEGylated form of MP7 retains the ability to block the PD-1:PD-L1 interaction, and significantly suppresses the growth of PD-L1+ colon carcinoma cells in vivo with a potency equivalent to an antagonistic anti-PD-1 antibody. Importantly, the anti-PD-1 DNA aptamer treatment was not associated with off-target TLR-9-related immune responses. Due to the inherent advantages of aptamers including their lack of immunogenicity, low cost, long shelf life, and ease of synthesis, PD-1 antagonistic aptamers may represent an attractive alternative over antibody-based anti PD-1 therapeutics.
Directory of Open Access Journals (Sweden)
Aaron Prodeus
2015-01-01
Full Text Available Blocking the immunoinhibitory PD-1:PD-L1 pathway using monoclonal antibodies has led to dramatic clinical responses by reversing tumor immune evasion and provoking robust and durable antitumor responses. Anti-PD-1 antibodies have now been approved for the treatment of melanoma, and are being clinically tested in a number of other tumor types as both a monotherapy and as part of combination regimens. Here, we report the development of DNA aptamers as synthetic, nonimmunogenic antibody mimics, which bind specifically to the murine extracellular domain of PD-1 and block the PD-1:PD-L1 interaction. One such aptamer, MP7, functionally inhibits the PD-L1-mediated suppression of IL-2 secretion in primary T-cells. A PEGylated form of MP7 retains the ability to block the PD-1:PD-L1 interaction, and significantly suppresses the growth of PD-L1+ colon carcinoma cells in vivo with a potency equivalent to an antagonistic anti-PD-1 antibody. Importantly, the anti-PD-1 DNA aptamer treatment was not associated with off-target TLR-9-related immune responses. Due to the inherent advantages of aptamers including their lack of immunogenicity, low cost, long shelf life, and ease of synthesis, PD-1 antagonistic aptamers may represent an attractive alternative over antibody-based anti PD-1 therapeutics.
Manipulating Morality: Third-Party Intentions Alter Moral Judgments by Changing Causal Reasoning.
Phillips, Jonathan; Shaw, Alex
2015-08-01
The present studies investigate how the intentions of third parties influence judgments of moral responsibility for other agents who commit immoral acts. Using cases in which an agent acts under some situational constraint brought about by a third party, we ask whether the agent is blamed less for the immoral act when the third party intended for that act to occur. Study 1 demonstrates that third-party intentions do influence judgments of blame. Study 2 finds that third-party intentions only influence moral judgments when the agent's actions precisely match the third party's intention. Study 3 shows that this effect arises from changes in participants' causal perception that the third party was controlling the agent. Studies 4 and 5, respectively, show that the effect cannot be explained by changes in the distribution of blame or perceived differences in situational constraint faced by the agent. © 2014 Cognitive Science Society, Inc.
Growth of CuPd nanoalloys encapsulated in carbon-shell
Energy Technology Data Exchange (ETDEWEB)
Kang, H. Y.; Wang, H. P., E-mail: wanghp@mail.ncku.edu.tw [National Cheng Kung University, Department of Environmental Engineering (China)
2013-05-15
Preparation of nanostructured copper-palladium (CuPd) alloys is getting more attention because specific catalytic properties can be tuned by controlling their composition, size, and shape. Thus, a better understanding especially in the formation mechanism of the CuPd nanoalloys is of great importance in designing the catalysts. Growth of CuPd nanoalloys encapsulated in carbon-shell (CuPd-C) was, therefore, studied by in situ synchrotron small-angle X-ray scattering during temperature-programed carbonization (TPC) of the Cu{sup 2+}- and Pd{sup 2+}-{beta}-cyclodextrin complexes. A rapid reduction of Cu{sup 2+} and Pd{sup 2+} with nucleation is found at the temperatures of <423 K, followed by coalescence at 453-573 K. The well-dispersed CuPd nanoalloys having the sizes of 7.6-7.9 nm in diameter are encapsulated in carbon-shell of 1.4-1.8 nm in thickness. The refined extended X-ray absorption fine structure spectra indicate that the bond distances of the first-shell Cu-Pd are 2.61-2.64 A with the coordination numbers of 5.1-5.6. A homogeneous CuPd alloy at the Cu/Pd atomic ratio of 1 is observed. Note that at the high Cu/Pd ratio, Cu is enriched on the CuPd nanoalloy surfaces, attributable to the relatively low surface free energy of Cu.
Party policy position of Die Linke. A continuation of the PDS?
Coffé, H.R.; Plassa, R.
2010-01-01
In 2007, the German party Die Linke emerged as the result of the PDS (Party of Democratic Socialism; the successor of the Communist Party) merging with the WASG (Wahlalternative Arbeit und Soziale Gerechtigkeit; a break away left wing of the Social Democrats). This article compares the policy
Energy Technology Data Exchange (ETDEWEB)
Boulyga, Sergei F.; Prohaska, Thomas [University of Natural Resources and Applied Life Sciences, Department of Chemistry, Division of Analytical Chemistry-VIRIS Laboratory, Vienna (Austria)
2008-01-15
This paper presents the application of a multicollector inductively coupled plasma mass spectrometer (MC-ICP-MS) - a Nu Plasma HR - equipped with three ion-counting multipliers and coupled to a laser ablation system (LA) for the rapid and sensitive determination of the {sup 235}U/{sup 238}U, {sup 236}U/{sup 238}U, {sup 145}Nd/{sup 143}Nd, {sup 146}Nd/{sup 143}Nd, {sup 101}Ru/({sup 99}Ru+{sup 99}Tc) and {sup 102}Ru/({sup 99}Ru+{sup 99}Tc) isotope ratios in microsamples collected in the vicinity of Chernobyl. Microsamples with dimensions ranging from a hundred {mu}m to about 1 mm and with surface alpha activities of 3-38 mBq were first identified using nuclear track radiography. U, Nd and Ru isotope systems were then measured sequentially for the same microsample by LA-MC-ICP-MS. The application of a zoom ion optic for aligning the ion beams into the ion counters allows fast switching between different isotope systems, which enables all of the abovementioned isotope ratios to be measured for the same microsample within a total analysis time of 15-20 min (excluding MC-ICP-MS optimization and calibration). The {sup 101}Ru/({sup 99}Ru+{sup 99}Tc) and {sup 102}Ru/({sup 99}Ru+{sup 99}Tc) isotope ratios were measured for four microsamples and were found to be significantly lower than the natural ratios, indicating that the microsamples were contaminated with the corresponding fission products (Ru and Tc). A slight depletion in {sup 146}Nd of about 3-5% was observed in the contaminated samples, but the Nd isotopic ratios measured in the contaminated samples coincided with natural isotopic composition within the measurement uncertainty, as most of the Nd in the analyzed samples originates from the natural soil load of this element. The {sup 235}U/{sup 238}U and {sup 236}U/{sup 238}U isotope ratios were the most sensitive indicators of irradiated uranium. The present work yielded a significant variation in uranium isotope ratios in microsamples, in contrast with previously
Khanna, Swati; Thomas, Anish; Abate-Daga, Daniel; Zhang, Jingli; Morrow, Betsy; Steinberg, Seth M.; Orlandi, Augusto; Ferroni, Patrizia; Schlom, Jeffrey; Guadagni, Fiorella; Hassan, Raffit
2016-01-01
INTRODUCTION The functional aspects of programmed death 1 (PD-1) and PD ligand 1 (PD-L1) immune checkpoints in malignant mesothelioma have not been studied. METHODS Tumor samples from 65 patients with mesothelioma were evaluated for PD-L1 expression by immunohistochemistry and its prognostic significance. Malignant effusions from patients with pleural and peritoneal mesothelioma were evaluated for PD-1+ and PD-L1+ infiltrating lymphocytes and their role in inducing tumor cell PD-L1 expression. Antibody dependent cellular cytotoxicity (ADCC) of avelumab, a fully humanized IgG1 anti PD-L1 antibody towards primary mesothelioma cell lines was evaluated in presence of autologous and allogeneic NK cells. RESULTS Of 65 pleural and peritoneal mesothelioma tumors examined, 41 (63%) were PD-L1 positive, which was associated with slightly inferior overall survival compared to patients with PD-L1 negative tumors (median 23.0 vs. 33.3 months; p=0.35). The frequency of PD-L1 expression was similar in pleural and peritoneal mesothelioma patients with 62% and 64% of samples positive, respectively. Of nine mesothelioma effusion samples evaluated, the fraction of cells expressing PD-L1 ranged from 12 to 83%. Of 7 patients with paired malignant effusion and peripheral blood mononuclear cells (PBMC) samples, PD-L1 expression was significantly higher on CD3+ T cells present in malignant effusions as compared with PBMC (p=0.016). In addition, CD14+PD-1+ cells were elevated in malignant effusions compared with PBMC (p=0.031). The lymphocytes present in malignant effusions recognized autologous tumor cells and induced IFN-γ-mediated PD-L1 expression on the tumor cell surface. Of the three primary mesothelioma cell lines tested, two were susceptible to avelumab mediated ADCC in presence of autologous NK cells. CONCLUSION The majority of pleural as well as peritoneal mesothelioma express PD-L1. Malignant effusions in this disease are characterized by presence of tumor cells and CD3+ T
the doctrine of party autonomy in international commercial arbitration
African Journals Online (AJOL)
RAYAN_
provoke discussions in many fora on the applicability of party autonomy in international ... questions, this article analyses the principle of party autonomy. The ultimate aim of .... 12 Odoe, (n 1) 48; English Arbitration Act 1996 s 6. 13 Odoe ibid ...
20 CFR 655.102 - Special procedures.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Special procedures. 655.102 Section 655.102 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR TEMPORARY EMPLOYMENT OF... in force until modified by the Administrator. ...
Tang, Xiaolong; Li, Qingguo; Zhu, Yongqiang; Zheng, Donghui; Dai, Jingjing; Ni, Wenxuan; Wei, Jia; Xue, Yubao; Chen, Ke; Hou, Wei; Zhang, Chao; Feng, Xiaojun; Liang, Yong
2015-01-01
Tumors exploit immunoregulatory checkpoints to attenuate T cell responses as a means of circumventing immunologic rejection. By activating the inhibitory costimulatory pathway of Programmed Death 1 (PD1)/PDL1 which provides tumor cells an escape mechanism from immune surveillance, Programmed Death Ligand1 (PDL1)(+) tumors hamper activated tumor-specific T cell functions and render them functionally exhausted. To overcome the inhibitory costimulatory effects of PDL1 on the adoptively transferred T cells, we sought to convert PD1 to a T cell costimulatory receptor by exchanging its transmembrane and cytoplasmic tail with CD28 and 4-1BB signaling domains (PD1-CD28-4-1BB, PD1-ACR), anticipating the genetically modified effector T lymphocytes expressing PD1-ACR would exhibit enhanced functional attributes. And the results showed that PD1-ACR expressed T cells retained the ability to bind PDL1, resulting in T cell activation as evidenced by the elevated activity of phosphoinositide 3-kinase (PI3K)/protein kinase B (Akt), the augmentation of cytokine secretion and the increased proliferative capacity. Moreover, when systemically administered in the mouse model of glioblastoma metastases, PD1-ACR T cells localized at the area of U87 invasive tumor, which results in suppressed tumor growth and enhanced survival of mice with established U87 glioblastoma. Together, these data demonstrated that PD1-ACR has a high potential to serve as a novel strategy to overcome PDL1 mediated immunosuppression of T cells for cancer therapy.
The Finns Party: Euroscepticism, Euro Crisis, Populism and the Media
Directory of Open Access Journals (Sweden)
Juha Herkman
2017-03-01
Full Text Available In many European countries, populist right-wing parties have been most noticeable representatives of Euroscepticism. In Finland, the Finns Party (Perussuomalaiset has been a constant promoter of organisational Euroscepticism through its leader, Timo Soini. The party broke through in Finland’s ‘big bang elections’ of 2011, when the most debated issue was the European economic crisis, which was dominated by Eurosceptic Soini. Research concerning the relationship between the media, populism and Euroscepticism usually focus on national or European Parliament elections. This study analyses the media portrayal of the Eurosceptic Finns Party during times other than elections, focusing on the Finland’s overall Euro crisis press coverage in 2010–2012. The analysis shows that the populist Finns Party has been a minor player in that coverage, which was dominated by the Euro positive political and economic elites. Differences between newspapers indicate that journalistic routines and political context direct media coverage toward particular framings, even when the media proclaims itself politically independent and neutral.
The production of radionuclides for nuclear medicine from a compact, low-energy accelerator system.
Webster, William D; Parks, Geoffrey T; Titov, Dmitry; Beasley, Paul
2014-05-01
The field of nuclear medicine is reliant on radionuclides for medical imaging procedures and radioimmunotherapy (RIT). The recent shut-downs of key radionuclide producers have highlighted the fragility of the current radionuclide supply network, however. To ensure that nuclear medicine can continue to grow, adding new diagnostic and therapy options to healthcare, novel and reliable production methods are required. Siemens are developing a low-energy, high-current - up to 10 MeV and 1 mA respectively - accelerator. The capability of this low-cost, compact system for radionuclide production, for use in nuclear medicine procedures, has been considered. The production of three medically important radionuclides - (89)Zr, (64)Cu, and (103)Pd - has been considered, via the (89)Y(p,n), (64)Ni(p,n) and (103)Rh(p,n) reactions, respectively. Theoretical cross-sections were generated using TALYS and compared to experimental data available from EXFOR. Stopping power values generated by SRIM have been used, with the TALYS-generated excitation functions, to calculate potential yields and isotopic purity in different irradiation regimes. The TALYS excitation functions were found to have a good agreement with the experimental data available from the EXFOR database. It was found that both (89)Zr and (64)Cu could be produced with high isotopic purity (over 99%), with activity yields suitable for medical diagnostics and therapy, at a proton energy of 10MeV. At 10MeV, the irradiation of (103)Rh produced appreciable quantities of (102)Pd, reducing the isotopic purity. A reduction in beam energy to 9.5MeV increased the radioisotopic purity to 99% with only a small reduction in activity yield. This work demonstrates that the low-energy, compact accelerator system under development by Siemens would be capable of providing sufficient quantities of (89)Zr, (64)Cu, and (103)Pd for use in medical diagnostics and therapy. It is suggested that the system could be used to produce many other
Hien, Nguyen Thi; Kim, Guinyun; Kim, Kwangsoo; Do, Nguyen Van; Khue, Pham Duc; Thanh, Kim Tien; Shin, Sung-Gyun; Cho, Moo-Hyun
2018-06-01
The thermal neutron capture cross-section (σ0) and resonance integral (I0) of the 108Pd(n,γ)109Pd reaction have been measured relative to that of the monitor reaction 197Au(n,γ)198Au. The measurements were carried out using the neutron activation with the cadmium ratio method. Both the samples and monitors were irradiated with and without cadmium cover of 0.5 mm thickness. The induced activities of the reaction products were measured with a well calibrated HPGe γ-ray detector. In order to improve the accuracy of the results, the necessary corrections for the counting losses were made. The thermal neutron capture cross-section and resonance integral of the 108Pd(n,γ)109Pd reaction were determined to be σ0,Pd = 8.68 ± 0.41 barn and I0,Pd = 245.6 ± 24.8 barn, respectively. The obtained results are compared with literature values and discussed.
Trends in nuclear third party liability law
International Nuclear Information System (INIS)
Avossa, G.
1992-01-01
For some ten years now, nuclear third-party liability has been changing at an ever-faster pace, further accelerated by the Chernobyl catastrophe. Some of these changes are discussed in this article. A joint protocol drawn up by the International Atomic Energy Agency (IAEA) and the Nuclear Energy Agency (NEA) mutually extends the benefit of the special third-party liability system regarding nuclear damage instituted by virtue of previous Conventions and settles the conflicts of law likely to result from the simultaneous application of the two international instruments. Within the framework of the IAEA, a review procedure of the Convention of Vienna has been underway since 1989, in which the NEA has taken an integral part. At the outcome of the process underway, not only will the Convention of Vienna be revised, but so, indirectly but very rapidly, will the Conventions of Paris and Brussels. Ultimately, the entire field of nuclear third-party liability will be recast for decades to come. The texts under discussion are as yet nowhere near their final stage but two areas of consideration have already emerged, which will be discussed. Substantial modifications are made in nuclear third-party liability law. Secondly, the indemnification process for nuclear damage will be vastly modified, due to the subsidiary nature of government intervention and new obligations on operators to become members of a Nuclear Operator Pool. (author)
A novel quantum scheme for secure two-party distance computation
Peng, Zhen-wan; Shi, Run-hua; Zhong, Hong; Cui, Jie; Zhang, Shun
2017-12-01
Secure multiparty computational geometry is an essential field of secure multiparty computation, which computes a computation geometric problem without revealing any private information of each party. Secure two-party distance computation is a primitive of secure multiparty computational geometry, which computes the distance between two points without revealing each point's location information (i.e., coordinate). Secure two-party distance computation has potential applications with high secure requirements in military, business, engineering and so on. In this paper, we present a quantum solution to secure two-party distance computation by subtly using quantum private query. Compared to the classical related protocols, our quantum protocol can ensure higher security and better privacy protection because of the physical principle of quantum mechanics.
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHL102 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Or...iginal site) - - SHL102Z 634 - - - - Show SHL102 Library SH (Link to library) Clone ID SHL102 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11892-1 Original site URL http://dictycdb.b...TCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*...A FSTCRXKFDNQKIHDCDWIIQGPTTPSLCANCGKICTSKCTTNYCDRDCQTVDWQSDHKL ICGLKSFKDR*detpikn*ik*kkiklnnk Frame C: ---lk
Nam, Junghyun; Choo, Kim-Kwang Raymond; Paik, Juryon; Won, Dongho
2014-01-01
While a number of protocols for password-only authenticated key exchange (PAKE) in the 3-party setting have been proposed, it still remains a challenging task to prove the security of a 3-party PAKE protocol against insider dictionary attacks. To the best of our knowledge, there is no 3-party PAKE protocol that carries a formal proof, or even definition, of security against insider dictionary attacks. In this paper, we present the first 3-party PAKE protocol proven secure against both online and offline dictionary attacks as well as insider and outsider dictionary attacks. Our construct can be viewed as a protocol compiler that transforms any 2-party PAKE protocol into a 3-party PAKE protocol with 2 additional rounds of communication. We also present a simple and intuitive approach of formally modelling dictionary attacks in the password-only 3-party setting, which significantly reduces the complexity of proving the security of 3-party PAKE protocols against dictionary attacks. In addition, we investigate the security of the well-known 3-party PAKE protocol, called GPAKE, due to Abdalla et al. (2005, 2006), and demonstrate that the security of GPAKE against online dictionary attacks depends heavily on the composition of its two building blocks, namely a 2-party PAKE protocol and a 3-party key distribution protocol.
Ditrói, F; Tárkányi, F; Takács, S; Hermanne, A; Ignatyuk, A V
2017-10-01
Excitation functions were measured in the 31-49.2MeV energy range for the nat Pd(d,xn) 111,110m,106m,105,104g,103 Ag, nat Pd(d,x) 111m,109,101,100 Pd, nat Pd(d,x), 105,102m,102g,101m,101g,100,99m,99g Rh and nat Pd(d,x) 103,97 Ru nuclear reactions by using the stacked foil irradiation technique. The experimental results are compared with our previous results and with the theoretical predictions calculated with the ALICE-D, EMPIRE-D and TALYS (TENDL libraries) codes. Copyright © 2017 Elsevier Ltd. All rights reserved.
2010-07-01
... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Is the Fire Administration Authorization Act of 1992 (Public Law 102-522) relevant to fire protection engineering? 102-80.90 Section 102-80.90 Public Contracts and Property Management Federal Property Management Regulations System...
Butler, Rachael A; Sheridan, Janie L
2007-11-19
This study aimed to investigate patterns and context of use of BZP-party pills, function of use, and positive and negative effects experienced by a sample of New Zealand young people who had used the products. A qualitative study comprised of semi-structured interviews and group discussions. The sample included 58 young people aged 17-23 years who had used BZP-party pills in the previous 12 months. Young people were using these substances in a range of settings--primarily during weekend social occasions--particularly as part of the dance party culture. They were mostly used for their stimulant properties and to enhance socialisation, and were often taken in combination with other legal and illicit drugs. Young people had suffered a range of physical and emotional negative effects, although none of these was reported as being life-threatening or long-term. Many participants had reduced the frequency with which they used BZP-party pills due to adverse effects. Potentially risky behaviours identified included taking large doses, mixing BZP-party pills with alcohol and other substances, and driving whilst under the influence of BZP-party pills. Findings suggest that young people in this study were not suffering excessive or dangerous adverse effects. However, potentially risky use of these products raises the issue of the need for developing harm reduction interventions.
Energy Technology Data Exchange (ETDEWEB)
Hansen, E
2005-03-31
The objective of this task is to characterize and report specified physical properties and pH of simulant high level waste (HLW) melter feeds (MF) processed through the scaled melters at Vitreous State Laboratories (VSL). The HLW MF simulants characterized are VSL AZ102 straight hydroxide melter feed, VSL AZ102 straight hydroxide rheology adjusted melter feed, VSL AY102/C106 straight hydroxide melter feed, VSL AY102/C106 straight hydroxide rheology adjusted melter feed, and Savannah River National Laboratory (SRNL) AY102/C106 precipitated hydroxide processed sludge blended with glass former chemicals at VSL to make melter feed. The physical properties and pH were characterized using the methods stated in the Waste Treatment Plant (WTP) characterization procedure (Ref. 7).
Geometric, stability, and electronic properties of gold-doped Pd clusters (Pd{sub n}Au, n = 3~20)
Energy Technology Data Exchange (ETDEWEB)
Huan, Hao; Chen, Yan; Wang, Tao; Ye, Xiang, E-mail: yexiang@shnu.edu.cn [Shanghai Normal University, Department of Physics (China); Gu, Xiao, E-mail: gx@cqu.edu.cn [Chongqing University, Department of Applied Physics (China)
2016-11-15
The structure, stability, and electronic properties of Pd{sub n}Au (n = 3~20) clusters are studied by density functional theory. The results show that the clusters studied here prefer three-dimensional structures even with very small atom number. It is found that the binding energies of Pd{sub n}Au clusters are higher than the corresponding pure Pd{sub n} clusters with the same atom number. Most Pd{sub n}Au clusters studied here are magnetic with magnetic moments ranging from 1.0 to 7.0 μ{sub B.} The dissociation energies of Pd atoms are lower than the doped gold atom, that is the doped Au atom will increase the mother clusters stability and activity.
Jakobi, Anja P.
2011-01-01
Education has been featured prominently in recent election campaigns in different countries. This article explains this observation by the idea of a world culture and the global institutionalization of education. It compares party manifestors of 25 OECD countries from 1946 onward, analyzing how education developed in election campaigns over time…
Jewish problem in the Polish Communist Party
Directory of Open Access Journals (Sweden)
Cimek Henryk
2016-12-01
Full Text Available Jews accounted for approx. 8-10% of the population of the Second Republic and in the communist movement (Polish Communist Party and Polish Communist Youth Union the rate was approx, 30%, while in subsequent years it much fluctuated. The percentage of Jews was the highest in the authorities of the party and in the KZMP. This had a negative impact on the position of the KPP on many issues, especially in its relation to the Second Republic.
Synthesis of PdO/MCM-41 nanocomposites using trans-[PdCl2(PEt3)2] as the source of metal
International Nuclear Information System (INIS)
Hernandez-Pineda, Jessica; Rio, Jose Manuel del; Carreto, Enrique; Terres, Eduardo; Montoya, J. Asencion; Zuniga-Gonzalez, Maria de Jesus; Morgado, Jorge
2009-01-01
Three PdO/MCM-41 nanocomposites containing PdO species that are dispersed on an MCM-41 support have been prepared using trans-[PdCl 2 (PEt 3 ) 2 ] as the source of metal. Thermal gravimetric analysis of the decomposition of this complex in air reveals a remarkable mass loss of all nonmetallic elements centered at 300 deg. C. The materials were characterized with X-ray powder diffraction (XRPD), nitrogen sorption and TEM, which showed that the PdO nanoparticles were present inside the pores of MCM-41. XRPD analysis confirms formation of PdO (palladinite) nanocrystals, as the sole crystalline phase present in the nanocomposites.
THE THIRD PARTY CERTIFICATION SYSTEM FOR ORGANIC PRODUCTS
Directory of Open Access Journals (Sweden)
Adina-Roxana MUNTEANU
2015-12-01
Full Text Available In the context of an increasing organic trade worldwide, the organic standards and the certification of the organic practices are ever more important and relevant for both business and consumers. The certification by third parties of the organic operators is meant to ensure the application of an organic standard. However, the documented fraud cases are proof that the current system can undergo further improvement. The current paper gives an overview of the mechanisms of certification and inspection worldwide and discusses the issues raised by third party certification of the organic operators in the European context. Moreover, the paper reviews the major arguments for the effectiveness of the third party certification and also points to the improvement possibilities of the systems.
47 CFR 32.102 - Nonregulated investments.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Nonregulated investments. 32.102 Section 32.102 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES UNIFORM SYSTEM OF ACCOUNTS... investments. Nonregulated investments shall include the investment in nonregulated activities that are...
Liquid phase catalytic hydrodebromination of tetrabromobisphenol A on supported Pd catalysts
International Nuclear Information System (INIS)
Wu, Ke; Zheng, Mengjia; Han, Yuxiang; Xu, Zhaoyi; Zheng, Shourong
2016-01-01
Highlights: • Pd catalysts supported on TiO_2, CeO_2, Al_2O_3 and SiO_2 were prepared. • Deposition-precipitation method resulted in positively charged smaller Pd particle. • Complete debromination of tetrabromobisphenol A could be achieved on Pd/TiO_2. • Pd/TiO_2 prepared by the deposition-precipitation method was more active. - Abstract: Tetrabromobisphenol A (TBBPA) is a widely used brominated flame retardant and reductive debromination is an effective method for the abatement of TBBPA pollution. In this study, Pd catalysts supported on TiO_2, CeO_2, Al_2O_3 and SiO_2 were prepared by the impregnation (the resulting catalyst denoted as im-Pd/support), deposition-precipitation (the resulting catalyst denoted as dp-Pd/support), and photo-deposition (the resulting catalyst denoted as pd-Pd/support) methods. The catalysts were characterized by N_2 adsorption-desorption isotherm, X-ray diffraction, transmission electron microscopy, measurement of zeta potential, CO chemisorption, and X-ray photoelectron spectroscopy. The results showed that at an identical Pd loading amount (2.0 wt.%) Pd particle size in dp-Pd/TiO_2 was much smaller than those in im-Pd/TiO_2 and pd-Pd/TiO_2. Pd particle size of the dp-Pd/TiO_2 catalyst increased with Pd loading amount. Additionally, Pd particles in the dp-Pd/TiO_2 catalysts were positively charged due to the strong metal-support interaction, whereas the cationization effect was gradually attenuated with the increase of Pd loading amount. For the liquid phase catalytic hydrodebromination (HDB) of TBBPA, tri-bromobisphenol A (tri-BBPA), di-bromobisphenol A (di-BBPA), and mono-bromobisphenol A (mono-BBPA) were identified as the intermediate products, indicative of a stepwise debromination process. The catalytic HDB of TBBPA followed the Langmuir-Hinshelwood model, reflecting an adsorption enhanced catalysis mechanism. At an identical Pd loading amount, the Pd catalyst supported on TiO_2 exhibited a much higher catalytic activity
Synthesis of Au-Pd Nanoflowers Through Nanocluster Assembly
Energy Technology Data Exchange (ETDEWEB)
Xu, Jianguang [Duke University; Howe, Jane Y [ORNL; Chi, Miaofang [ORNL; Wilson, Adria [Duke University; Rathmall, Aaron [Duke University; Wiley, Benjamin J [ORNL
2011-01-01
Reduction of Pd ions by hydroquinone in the presence of gold nanoparticles and polyvinylpyrrolidone resulted in the formation of nanoflowers with a Au core and Pd petals. Addition of HCl to the synthesis halted the reduction by hydroquinone and enabled the acquisition of snapshots of the nanoflowers at different stages of growth. TEM images of the reaction after 10 s show that the nanoflower morphology resulted from the homogeneous nucleation of Pd clusters in solution and their subsequent attachment to gold seeds coated with a thin (0.8 {+-} 0.1 nm) shell of Pd. UV-visible spectra also indicate Pd clusters formed in the early stages of the reaction and disappeared as the nanoflowers grew. The speed at which this reaction can be halted is useful not only for producing a variety of bimetallic nanostructures with precisely controlled dimensions and morphologies but also for understanding the growth mechanism of these structures. The ability of the AuPd core-shell structure to catalyze the Suzuki coupling reaction of iodobenzene to phenylboronic acid was probed and compared against the activity of Pd nanocubes and thin-shelled AuPd core-shell nanoparticles. The results of this study suggest that Suzuki coupling was not affected by the surface structure or subsurface composition of the nanoparticles, but instead was primarily catalyzed by molecular Pd species that leached from the nanostructures.
Synthesis and Catalytic Properties of Au Pd Nanoflowers
Energy Technology Data Exchange (ETDEWEB)
Xu, Jianguang [Department of Chemistry, Duke University; Wilson, Adria [Duke University; Howe, Jane Y [ORNL; Chi, Miaofang [ORNL; Wiley, Benjamin J [Duke University
2011-01-01
Reduction of Pd ions by hydroquinone in the presence of gold nanoparticles and polyvinylpyrrolidone resulted in the formation of nanoflowers with a Au core and Pd petals. Addition of HCl to the synthesis halted the reduction by hydroquinone and enabled the acquisition of snapshots of the nanoflowers at different stages of growth. TEM images of the reaction after 10 s show that the nanoflower morphology resulted from the homogeneous nucleation of Pd clusters in solution and their subsequent attachment to gold seeds coated with a thin (0.8 0.1 nm) shell of Pd. UV visible spectra also indicate Pd clusters formed in the early stages of the reaction and disappeared as the nanoflowers grew. The speed at which this reaction can be halted is useful not only for producing a variety of bimetallic nanostructures with precisely controlled dimensions and morphologies but also for understanding the growth mechanism of these structures. The ability of the AuPd core shell structure to catalyze the Suzuki coupling reaction of iodobenzene to phenylboronic acid was probed and compared against the activity of Pd nanocubes and thin-shelled AuPd core shell nanoparticles. The results of this study suggest that Suzuki coupling was not affected by the surface structure or subsurface composition of the nanoparticles, but instead was primarily catalyzed by molecular Pd species that leached from the nanostructures.
Synthesis and catalytic properties of Au-Pd nanoflowers.
Xu, Jianguang; Wilson, Adria R; Rathmell, Aaron R; Howe, Jane; Chi, Miaofang; Wiley, Benjamin J
2011-08-23
Reduction of Pd ions by hydroquinone in the presence of gold nanoparticles and polyvinylpyrrolidone resulted in the formation of nanoflowers with a Au core and Pd petals. Addition of HCl to the synthesis halted the reduction by hydroquinone and enabled the acquisition of snapshots of the nanoflowers at different stages of growth. TEM images of the reaction after 10 s show that the nanoflower morphology resulted from the homogeneous nucleation of Pd clusters in solution and their subsequent attachment to gold seeds coated with a thin (0.8 ± 0.1 nm) shell of Pd. UV-visible spectra also indicate Pd clusters formed in the early stages of the reaction and disappeared as the nanoflowers grew. The speed at which this reaction can be halted is useful not only for producing a variety of bimetallic nanostructures with precisely controlled dimensions and morphologies but also for understanding the growth mechanism of these structures. The ability of the AuPd core-shell structure to catalyze the Suzuki coupling reaction of iodobenzene to phenylboronic acid was probed and compared against the activity of Pd nanocubes and thin-shelled AuPd core-shell nanoparticles. The results of this study suggest that Suzuki coupling was not affected by the surface structure or subsurface composition of the nanoparticles, but instead was primarily catalyzed by molecular Pd species that leached from the nanostructures. © 2011 American Chemical Society
Energy Technology Data Exchange (ETDEWEB)
Hai, Yu; Kennedy, E.M.; Md Azhar, Uddin; Dlugogorski, B.Z. [Newcastle Univ., Process Safety and Environment Protection Group, School of Engineering, Callaghan, NSW (Australia)
2004-07-01
In the current study, we present the result of our investigation on the hydro-dehalogenation of halon 1211 with hydrogen over carbon supported Pd-Fe, Pd-Co and Pd-Ni bimetallic catalysts. In addition to dissociatively adsorbing hydrogen, Fe, Co and Ni themselves can facilitate cleavage of C-halogen bonds. The effect of the interaction of a second metal (Fe, Co and Ni) with Pd on the conversion of halon 1211 and selectivity to CH{sub 2}F{sub 2} for the catalytic hydro-dehalogenation of halon 1211 is discussed. Activated carbon is chosen as support in order to minimize the interaction of support with the metals. The obtained experimental results show that the introduction of Fe, Co and Ni to Pd catalysts has a significant influence on the catalytic hydro-dehalogenation of halon 1211, especially with respect to the selectivity to CH{sub 2}F{sub 2}. The presence of Fe increases the amount of halon 1211 adsorbed on the surface of catalysts and enhances the cleavage of C-halogen bonds in halon 1211, resulting in a higher halon 1211 conversion level and selectivity to hydrocarbons. Higher selectivity to CHBrF{sub 2} is ascribed to the secondary reaction: CF{sub 2} + HBr {yields} CHBrF{sub 2}. (authors)
Electric-field effects on magnetic anisotropy in Pd/Fe/Pd(0 0 1) surface
International Nuclear Information System (INIS)
Haraguchi, Shinya; Tsujikawa, Masahito; Gotou, Junpei; Oda, Tatsuki
2011-01-01
Electric-field (EF) effects have been studied on magnetic anisotropy in the metallic surfaces Pt/Fe/Pt(0 0 1) and Pd/Fe/Pd(0 0 1) by means of the first-principles electronic structure calculation which employs the generalized gradient approximation. The variation of anisotropy energy with respect to the EF is found to be opposite to each other. The modulus rate of the variation is larger by a few factors in the Pt substrate than in the Pd one. These results agree qualitatively well with the available experimental data. The electronic structures are presented and the origins in EF effects are discussed along a line of the second perturbative fashion.
Hydrogen Storage Performance in Pd/Graphene Nanocomposites.
Zhou, Chunyu; Szpunar, Jerzy A
2016-10-05
We have developed a Pd-graphene nanocomposite for hydrogen storage. The spherically shaped Pd nanoparticles of 5-45 nm in size are homogeneously distributed over the graphene matrix. This new hydrogen storage system has favorable features like desirable hydrogen storage capacity, ambient conditions of hydrogen uptake, and low temperature of hydrogen release. At a hydrogen charging pressure of 50 bar, the material could yield a gravimetric density of 6.7 wt % in the 1% Pd/graphene nanocomposite. As we increased the applied pressure to 60 bar, the hydrogen uptake capacity reached 8.67 wt % in the 1% Pd/graphene nanocomposite and 7.16 wt % in the 5% Pd/graphene nanocomposite. This system allows storage of hydrogen in amounts that exceed the capacity of the gravimetric target announced by the U.S. Department of Energy (DOE).
Ion beam mixing in Ag-Pd alloys
International Nuclear Information System (INIS)
Klatt, J.L.; Averback, R.S.; Peak, D.
1989-01-01
Ion beam mixing during 750 keV Kr + irradiation at 80 K was measured on a series of Ag-Pd alloys using Au marker atoms. The mixing in pure Ag was the greatest and it decreased monotonically with increasing Pd content, being a factor of 10 higher in pure Ag than in pure Pd. This large difference in mixing cannot be explained by the difference in cohesion energy between Ag and Pd in the thermodynamic model of ion beam mixing proposed by Johnson et al. [W. L. Johnson, Y. T. Cheng, M. Van Rossum, and M-A. Nicolet, Nucl. Instrum. Methods B 7/8, 657 (1985)]. An alternative model based on local melting in the cascade is shown to account for the ion beam mixing results in Ag and Pd
Khanna, Swati; Thomas, Anish; Abate-Daga, Daniel; Zhang, Jingli; Morrow, Betsy; Steinberg, Seth M; Orlandi, Augusto; Ferroni, Patrizia; Schlom, Jeffrey; Guadagni, Fiorella; Hassan, Raffit
2016-11-01
The functional aspects of programmed death 1 (PD-1) and PD ligand 1 (PD-L1) immune checkpoints in malignant mesothelioma have not been studied. Tumor samples from 65 patients with mesothelioma were evaluated for PD-L1 expression by immunohistochemistry, and its prognostic significance was examined. Malignant effusions from patients with pleural and peritoneal mesothelioma were evaluated for PD-1-positive and PD-L1-positive infiltrating lymphocytes and their role in inducing PD-L1 expression in tumor cells. Antibody-dependent cellular cytotoxicity (ADCC) of avelumab, a fully humanized immunoglobulin G1 anti PD-L1 antibody against primary mesothelioma cell lines, was evaluated in presence of autologous and allogeneic natural killer cells. Of 65 pleural and peritoneal mesothelioma tumors examined, 41 (63%) were PD-L1-positive, which was associated with slightly inferior overall survival compared to patients with PD-L1-negative tumors (median 23.0 versus 33.3 months, p = 0.35). The frequency of PD-L1 expression was similar in patients with pleural and peritoneal mesothelioma, with 62% and 64% of samples testing positive, respectively. In nine mesothelioma effusion samples evaluated, the fraction of cells expressing PD-L1 ranged from 12% to 83%. In seven patients with paired malignant effusion and peripheral blood mononuclear cell (PBMC) samples, PD-L1 expression was significantly higher on CD3-positive T cells present in malignant effusions as compared with PBMCs (p = 0.016). In addition, the numbers of CD14-positive PD-1-positive cells were increased in malignant effusions compared with PBMCs (p = 0.031). The lymphocytes present in malignant effusions recognized autologous tumor cells and induced interferon-γ-mediated PD-L1 expression on the tumor cell surface. Of the three primary mesothelioma cell lines tested, two were susceptible to avelumab-mediated ADCC in the presence of autologous natural killer cells. Most pleural as well as peritoneal mesotheliomas
Multi-party arbitration in international trade: problems and solutions
DEFF Research Database (Denmark)
Siig, Kristina
2007-01-01
Legal disputes regarding international trade frequently involve more than two parties. This leads to problems, as the preferred means of dispute resolution within international trade - arbitration - tends to be ill-equipped to handle such disputes. The topic of the paper is arbitration as a means...... of dispute resolution in a multy-party set-up. Both the possible legal bases and the problems encountered are considere. It is concluded that arbitration is still the only real option to the parties in international business disputes and that many of the shortcomings may be contered by skilful drafting...
Billing third party payers for pharmaceutical care services.
Poirier, S; Buffington, D E; Memoli, G A
1999-01-01
To describe the steps pharmacists must complete when seeking compensation from third party payers for pharmaceutical care services. Government publications; professional publications, including manuals and newsletters; authors' personal experience. Pharmacists in increasing numbers are meeting with success in getting reimbursed by third party payers for patient care activities. However, many pharmacists remain reluctant to seek compensation because they do not understand the steps involved. Preparatory steps include obtaining a provider/supplier number, procuring appropriate claim forms, developing data collection and documentation systems, establishing professional fees, creating a marketing plan, and developing an accounting system. To bill for specific patient care services, pharmacists need to collect the patient's insurance information, obtain a statement of medical necessity from the patient's physician, complete the appropriate claim form accurately, and submit the claim with supporting documentation to the insurer. Although many claims from pharmacists are rejected initially, pharmacists who work with third party payers to understand the reasons for denial of payment often receive compensation when claims are resubmitted. Pharmacists who follow these guidelines for billing third party payers for pharmaceutical care services should notice an increase in the number of paid claims.