WorldWideScience

Sample records for irc gmsec cfe

  1. Reducing Development and Operations Costs using NASA's "GMSEC" Systems Architecture

    Science.gov (United States)

    Smith, Dan; Bristow, John; Crouse, Patrick

    2007-01-01

    This viewgraph presentation reviews the role of Goddard Mission Services Evolution Center (GMSEC) in reducing development and operation costs in handling the massive data from NASA missions. The goals of GMSEC systems architecture development are to (1) Simplify integration and development, (2)Facilitate technology infusion over time, (3) Support evolving operational concepts, and (4) All for mix of heritage, COTS and new components. First 3 missions (i.e., Tropical Rainforest Measuring Mission (TRMM), Small Explorer (SMEX) missions - SWAS, TRACE, SAMPEX, and ST5 3-Satellite Constellation System) each selected a different telemetry and command system. These results show that GMSEC's message-bus component-based framework architecture is well proven and provides significant benefits over traditional flight and ground data system designs. The missions benefit through increased set of product options, enhanced automation, lower cost and new mission-enabling operations concept options .

  2. Ground System Architectures Workshop GMSEC SERVICES SUITE (GSS): an Agile Development Story

    Science.gov (United States)

    Ly, Vuong

    2017-01-01

    The GMSEC (Goddard Mission Services Evolution Center) Services Suite (GSS) is a collection of tools and software services along with a robust customizable web-based portal that enables the user to capture, monitor, report, and analyze system-wide GMSEC data. Given our plug-and-play architecture and the needs for rapid system development, we opted to follow the Scrum Agile Methodology for software development. Being one of the first few projects to implement the Agile methodology at NASA GSFC, in this presentation we will present our approaches, tools, successes, and challenges in implementing this methodology. The GMSEC architecture provides a scalable, extensible ground and flight system for existing and future missions. GMSEC comes with a robust Application Programming Interface (GMSEC API) and a core set of Java-based GMSEC components that facilitate the development of a GMSEC-based ground system. Over the past few years, we have seen an upbeat in the number of customers who are moving from a native desktop application environment to a web based environment particularly for data monitoring and analysis. We also see a need to provide separation of the business logic from the GUI display for our Java-based components and also to consolidate all the GUI displays into one interface. This combination of separation and consolidation brings immediate value to a GMSEC-based ground system through increased ease of data access via a uniform interface, built-in security measures, centralized configuration management, and ease of feature extensibility.

  3. An Auto-Configuration System for the GMSEC Architecture and API

    Science.gov (United States)

    Moholt, Joseph; Mayorga, Arturo

    2007-01-01

    A viewgraph presentation on an automated configuration concept for The Goddard Mission Services Evolution Center (GMSEC) architecture and Application Program Interface (API) is shown. The topics include: 1) The Goddard Mission Services Evolution Center (GMSEC); 2) Automated Configuration Concept; 3) Implementation Approach; and 4) Key Components and Benefits.

  4. Dicty_cDB: CFE262 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE262 (Link to dictyBase) - - - Contig-U16368-1 CFE262P (Link... to Original site) CFE262F 652 CFE262Z 401 CFE262P 1053 - - Show CFE262 Library CF (Link to library) Clone ID CFE262 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Original site URL http://dict...HRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIINGHPTCIRGDGYL...VNEHGKCRCVPHRPPPRPPVDQCRNQHCPHGYSC RVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQICGSVN CGPGYICTIING

  5. Higher physics for CFE with answers

    CERN Document Server

    Chambers, Paul; Moore, Ian

    2013-01-01

    The only new textbook appropriate for all new Higher Physics syllabus requirements from 2012 onwards Higher Physics for CfE provides complete coverage of the latest SQA syllabus for the Revised Higher (for examination 2012 onwards), and is also tailored specifically to the extended requirements, teaching approaches and syllabus outlines detailed in the Higher revisions for Curriculum for Excellence. Each section of the book matches a unit of the CfE syllabus; each chapter corresponds to a content area. The text is composed of three units: Our Dynamic Universe, Particles and Waves, and Electric

  6. How to pass higher French for CFE

    CERN Document Server

    Angus, Douglas

    2015-01-01

    Get your best grade with this guide to Higher French for CfE. We are working with SQA to gain endorsement for this title. This book contains all the advice and support you need to revise successfully for your Higher (for CfE) exam. It combines an overview of the course syllabus with advice from a top expert on how to improve exam performance, so you have the best chance of success. - Refresh your knowledge with complete course notes - Prepare for the exam with top tips and hints on revision techniques - Get your best grade with advice on how to gain those vital extra marks

  7. Dicty_cDB: CFE213 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE213 (Link to dictyBase) - - - Contig-U16381-1 CFE213F (Link... to Original site) CFE213F 111 - - - - - - Show CFE213 Library CF (Link to library) Clone ID CFE213 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict... E Sequences producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dict...yostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 9e-24 3 X51892 |X51892.1 Dict

  8. Dicty_cDB: CFE853 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE853 (Link to dictyBase) - - - Contig-U16381-1 CFE853F (Link... to Original site) CFE853F 109 - - - - - - Show CFE853 Library CF (Link to library) Clone ID CFE853 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N X51892 |X51892.1 Dictyost...elium discoideum SP60 gene for spore coat protein. 80 6e-21 2 X52105 |X52105.1 Dictyostelium discoideum SP60

  9. Afrikaans-English code switching on internet relay chat (IRC)

    African Journals Online (AJOL)

    The data examined in this paper consist of logs of IRC interactions in public IRC channels on irc.sun.ac.za (the Stellenbosch University IRC server) and logs of interaction on local hubs in DC++ (a file-sharing application that allows for synchronous chatting). Southern African Linguistics and Applied Language Studies 2008, ...

  10. Restrictions on running IRC (Internet Relay Chat) at CERN

    CERN Multimedia

    2005-01-01

    Due to the large number of computer security incidents at CERN where intruders have used IRC (Internet Relay Chat) software to control computers, IRC connections will be blocked in the CERN firewall from 1st February 2005. Personal use of IRC software is not permitted at CERN. Further details of the restrictions on both personal and professional use of IRC are documented at http://cern.ch/security/IRC.

  11. Higher English language skills for CFE

    CERN Document Server

    Firth, Mary M; Mitchell, John

    2015-01-01

    A brand new edition of a bestselling title, updated for the newest Higher English (for CfE) syllabus. We are working with SQA to secure endorsement for this title. This book provides you with the support and advice you will need to succeed in Higher English. By studying literary techniques and with top experts guiding you through and explaining how to use these skills, you will be helped to understand why questions are framed in a particular way and how to answer them in a manner that ensures the highest possible grade. - Become more secure in your knowledge of the English language. - Learn ho

  12. International astronomical remote present observation on IRC.

    Science.gov (United States)

    Ji, Kaifan; Cao, Wenda; Song, Qian

    On March 6 - 7, 1997, an international astronomical remote present observation (RPO) was made on Internet Relay Chat (IRC) for the first time. Seven groups in four countries, China, United States, Canada and Great Britain, used the 1 meter telescope of Yunnan observatory together by the way of remote present observation. Within minutes, images were "On-line" by FTP, and every one was able to get them by anonymous ftp and discuss them on IRC from different widely separated sites.

  13. Dicty_cDB: CFE801 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE801 (Link to dictyBase) - - - Contig-U12894-1 CFE801Z (Link... to Original site) - - CFE801Z 690 - - - - Show CFE801 Library CF (Link to library) Clone ID CFE801 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12894-1 Original site URL http://dict...6e1 5', mRNA sequence. 36 5.4 2 CK426247 |CK426247.1 AUF_IpTes_24_l09 Testis cDNA library Ict...A26838 )prestalk protein precursor - slime mold (Dictyoste... 66 9e-10 AC117072_6

  14. The CFE Treaty and changed conditions in Europe

    Energy Technology Data Exchange (ETDEWEB)

    Allentuck, J.

    1994-08-01

    The Treaty on Conventional Forces in Europe (CFE) was signed in November 1990 by sixteen nations, members of the North Atlantic Treaty Organization (NATO), and six nations, members of the Warsaw Treaty Organization (WTO). It was resigned to prevent a major surprise attack in Europe by the conventional forces of one Treaty Organization against those of the other and was the first major arms control treaty to address conventional weapons. This paper focuses on how CFE adapted to changes in the military-political situation in Europe which occurred after 1990 and failed to adapt to others. Suggestions are offered on how it might be changed to make it more relevant under these changed conditions.

  15. IRC -10414: a bow-shock-producing red supergiant star

    Science.gov (United States)

    Gvaramadze, V. V.; Menten, K. M.; Kniazev, A. Y.; Langer, N.; Mackey, J.; Kraus, A.; Meyer, D. M.-A.; Kamiński, T.

    2014-01-01

    Most runaway OB stars, like the majority of massive stars residing in their parent clusters, go through the red supergiant (RSG) phase during their lifetimes. Nonetheless, although many dozens of massive runaways were found to be associated with bow shocks, only two RSG bow-shock-producing stars, Betelgeuse and μ Cep, are known to date. In this paper, we report the discovery of an arc-like nebula around the late M-type star IRC -10414 using the SuperCOSMOS H-alpha Survey. Our spectroscopic follow-up of IRC -10414 with the Southern African Large Telescope (SALT) showed that it is a M7 supergiant, which supports previous claims on the RSG nature of this star based on observations of its maser emission. This was reinforced by our new radio- and (sub)millimetre-wavelength molecular line observations made with the Atacama Pathfinder Experiment 12-m telescope and the Effelsberg 100-m radio telescope, respectively. The SALT spectrum of the nebula indicates that its emission is the result of shock excitation. This finding along with the arc-like shape of the nebula and an estimate of the space velocity of IRC -10414 (≈70 ± 20 km s-1) imply the bow shock interpretation for the nebula. Thus, IRC -10414 represents the third case of a bow-shock-producing RSG and the first one with a bow shock visible at optical wavelengths. We discuss the smooth appearance of the bow shocks around IRC -10414 and Betelgeuse and propose that one of the necessary conditions for stability of bow shocks generated by RSGs is the ionization of the stellar wind. Possible ionization sources of the wind of IRC -10414 are proposed and discussed.

  16. THE ASTROSPHERE OF THE ASYMPTOTIC GIANT BRANCH STAR IRC+10216

    International Nuclear Information System (INIS)

    Sahai, Raghvendra; Chronopoulos, Christopher K.

    2010-01-01

    We have discovered a very extended shock structure (i.e., with a diameter of about 24') surrounding the well-known carbon star IRC+10216 in ultraviolet images taken with the Galaxy Evolution Explorer satellite. We conclude that this structure results from the interaction of IRC+10216's molecular wind with the interstellar medium (ISM), as it moves through the latter. All important structural features expected from theoretical models of such interactions are identified: the termination shock, the astrosheath, the astropause, the bow shock, and an astrotail (with vortices). The extent of the astropause provides new lower limits to the envelope age (69,000 years) and mass (1.4 M sun , for a mass-loss rate of 2 x 10 -5 M sun yr -1 ). From the termination-shock standoff distance, we find that IRC+10216 is moving at a speed of about ∼>91 km s -1 (1 cm -3 /n ISM ) 1/2 through the surrounding ISM.

  17. THE MORPHOLOGY OF IRC+10420's CIRCUMSTELLAR EJECTA

    International Nuclear Information System (INIS)

    Tiffany, Chelsea; Humphreys, Roberta M.; Jones, Terry J.; Davidson, Kris

    2010-01-01

    Images of the circumstellar ejecta associated with the post-red supergiant IRC+10420 show a complex ejecta with visual evidence for episodic mass loss. In this paper, we describe the transverse motions of numerous knots, arcs, and condensations in the inner ejecta measured from second epoch Hubble Space Telescope/WFPC2 images. When combined with the radial motions for several of the features, the total space motion and direction of the outflows show that they were ejected at different times, in different directions, and presumably from separate regions on the surface of the star. These discrete structures in the ejecta are kinematically distinct from the general expansion of the nebula and their motions are dominated by their transverse velocities. They are apparently all moving within a few degrees of the plane of the sky. We are thus viewing IRC+10420 nearly pole-on and looking nearly directly down onto its equatorial plane. We also discuss the role of surface activity and magnetic fields on IRC+10420's recent mass-loss history.

  18. Analysis and use of OLAP tools in the corporative information system of CFE; Analisis y empleo de herramientas OLAP en el sistema de informacion corporativa de la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Jacome G, Norma E; Argotte R, Liliana P; Mejia L, Manuel [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2003-07-01

    The commercial tools Oracle Express and Oracle the Discoverer are presented, applied and compared. Both of them were applied in the context of the Data Storage that Comision Federal de Electricidad (CFE) develops, denominated Corporative Information System (SICORP) that involves the handling of large volumes of historical and present information. By the importance and the relevance that at the moment the subject of data storage has, the experiences that are described in the article are very useful for future developments. [Spanish] Se presentan, aplican y comparan las herramientas comerciales Oracle Express y Oracle Discoverer. Ambas fueron aplicadas en el contexto del Almacen de Datos que la Comision Federal de Electricidad (CFE) desarrolla, denominado Sistema de Informacion Corporativa (Sicorp), que involucra el manejo de grandes volumenes de informacion historica y actual. Por la importancia y el auge que actualmente tiene el tema de almacenes de datos, las experiencias que se describen en el articulo son de gran utilidad para futuros desarrollos.

  19. CN and HCN in the infrared spectrum of IRC + 10216

    Science.gov (United States)

    Wiedemann, G. R.; Deming, D.; Jennings, D. E.; Hinkle, Kenneth H.; Keady, John J.

    1991-01-01

    The abundance of HCN in the inner circumstellar shell of IRC + 10216 has been remeasured using the 12-micron nu2 band. The 12-micron lines are less saturated than HCN 3-micron lines previously detected in the spectrum of IRC + 10216. The observed 12-micron HCN line is formed in the circumstellar shell from about 4 to 12 R sub * in accord with a photospheric origin for HCN. The derived HCN abundance in the 4 to 12 R sub* region is 4 x 10 exp-5 and the column density is 7 x 10 exp 18/sq cm. The 5-micron CN vibration-rotation fundamental band was detected for the first time in an astronomical source. Using four CN lines, the CN column density was determined to be 2.6 x 10 exp 15/sq cm and the rotational temperature to be 8 +/-2 K. The peal radial abundance is 1 x 10 exp -5. The values for the temperature and abundance are in good agreement with microwave results and with the formation of CN from the photolysis of HCN.

  20. C@Fe 3 O 4 /NTA-Ni magnetic nanospheres purify histidine-tagged ...

    African Journals Online (AJOL)

    This study reports synthesis of Ni-nitrilotriacetic acid (Ni-NTA) modified carbon nanospheres containing magnetic Fe3O4 particles (C@Fe3O4), which can act as a general tool to separate and purify histidine-tagged fetidin. In this experiment, C nanospheres are prepared from glucose using the hydrothermal process, ...

  1. The AKARI IRC asteroid flux catalogue: updated diameters and albedos

    Science.gov (United States)

    Alí-Lagoa, V.; Müller, T. G.; Usui, F.; Hasegawa, S.

    2018-05-01

    The AKARI IRC all-sky survey provided more than twenty thousand thermal infrared observations of over five thousand asteroids. Diameters and albedos were obtained by fitting an empirically calibrated version of the standard thermal model to these data. After the publication of the flux catalogue in October 2016, our aim here is to present the AKARI IRC all-sky survey data and discuss valuable scientific applications in the field of small body physical properties studies. As an example, we update the catalogue of asteroid diameters and albedos based on AKARI using the near-Earth asteroid thermal model (NEATM). We fit the NEATM to derive asteroid diameters and, whenever possible, infrared beaming parameters. We fit groups of observations taken for the same object at different epochs of the survey separately, so we compute more than one diameter for approximately half of the catalogue. We obtained a total of 8097 diameters and albedos for 5170 asteroids, and we fitted the beaming parameter for almost two thousand of them. When it was not possible to fit the beaming parameter, we used a straight line fit to our sample's beaming parameter-versus-phase angle plot to set the default value for each fit individually instead of using a single average value. Our diameters agree with stellar-occultation-based diameters well within the accuracy expected for the model. They also match the previous AKARI-based catalogue at phase angles lower than 50°, but we find a systematic deviation at higher phase angles, at which near-Earth and Mars-crossing asteroids were observed. The AKARI IRC All-sky survey is an essential source of information about asteroids, especially the large ones, since, it provides observations at different observation geometries, rotational coverages and aspect angles. For example, by comparing in more detail a few asteroids for which dimensions were derived from occultations, we discuss how the multiple observations per object may already provide three

  2. Modified IRC bench-scale arc melter for waste processing

    International Nuclear Information System (INIS)

    Eddy, T.L.; Sears, J.W.; Grandy, J.D.; Kong, P.C.; Watkins, A.D.

    1994-03-01

    This report describes the INEL Research Center (IRC) arc melter facility and its recent modifications. The arc melter can now be used to study volatilization of toxic and high vapor pressure metals and the effects of reducing and oxidizing (redox) states in the melt. The modifications include adding an auger feeder, a gas flow control and monitoring system, an offgas sampling and exhaust system, and a baghouse filter system, as well as improving the electrode drive, slag sampling system, temperature measurement and video monitoring and recording methods, and oxidation lance. In addition to the volatilization and redox studies, the arc melter facility has been used to produce a variety of glass/ceramic waste forms for property evaluation. Waste forms can be produced on a daily basis. Some of the melts performed are described to illustrate the melter's operating characteristics

  3. IRC working on design tool to predict lighting effects

    Energy Technology Data Exchange (ETDEWEB)

    Koruluk, W.

    1996-01-01

    A three-year research project by the National Research Council`s Institute for Research in Construction (IRC) to assess how office workers react to different lighting conditions, was announced. A new facility, the first of its kind in Canada, was designed and constructed to simulate and examine all aspects of the indoor environment. The study will involve creating nine different lighting conditions to ascertain the relationship between the various lighting characteristics and people`s actual performance and satisfaction with lighting in the space. The objective is to determine whether reduced energy consumption, hence declining lighting conditions, affect job performance. It is hypothesized that significant losses in job performance, absenteeism, staff turnover or lost customers would far outweigh any savings in energy consumption.

  4. IRC on your dime? What you really need to know about Internet relay chat

    Energy Technology Data Exchange (ETDEWEB)

    ERayome, J.; Romig, S., LLNL

    1998-05-22

    The purpose of this paper is to describe recent trends CIAC has encountered while working with sites that have been compromised. Frequently, the intruders set up and run Internet Relay Chat (IRC) to exchange information and to show off their success at having compromised a site. Invariably, this protocol consumes bandwidth, uses CPU cycles and is a source of embarrassment for the site. This paper focuses on these negative aspects of IRC and concedes that one can cite numerous examples where IRC is used in a positive manner.

  5. System Aprend-e for the management of learning objects of support to the CFE operation; Sistema Aprend-e para la gestion de objetos de aprendizaje de apoyo a la operacion de la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Argotte Ramos, Liliana Paz; Rodriguez Ortiz; Guillermo [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Paredes Rivera, Jaime Israel [Comision Federal de Electricidad (CFE) (Mexico)

    2009-07-01

    In this article the system Aprend-e is described as an application of the technology of Learning Objects (LO) integrated to the qualification of the Comision Federal de Electricidad (CFE) personnel, company of the electrical sector in Mexico, as well as to promote the self-training based on LO. An introduction to standard SCORM and the proposed additions by the CFE to the goal-data is included. [Spanish] En este articulo se describe el sistema Aprend-e, como una aplicacion de la tecnologia de Objetos de Aprendizaje (OA) integrada a la capacitacion del personal de la Comision Federal de Electricidad (CFE), empresa del sector electrico en Mexico, asi como para promover el autoaprendizaje basado en OA. Se incluye una introduccion al estandar SCORM y las adiciones propuestas por la CFE a los metadatos.

  6. Advance of activities report of the contract CFE-PLV/166/90. Second four-monthly; Reporte de avance de actividades del contrato CFE-PLV/166/90. Segundo cuatrimestre

    Energy Technology Data Exchange (ETDEWEB)

    Perusquia C, R.; Alonso V, G.; Hernandez M, J.L.; Montes T, J.L. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1992-09-15

    In this report a relationship of finished activities of the Global Program of Fuel Management inside the reactor carried out by the ININ under the contract ININ/CFE 1990-1991 (CFE-PLV/166/90) is presented. Those areas of activities are: 1. Nuclear Data Bank area. 2. Static Simulation of the Reactor area. 3. Reload Optimization area. 4. Analysis of Transitory Events of the Reactor area. (Author)

  7. Fe{sub 3}C/Fe nanoparticles with urea: Synthesis, structure and magnetic properties

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xiaobai [College of Chemistry, Jilin University, Changchun, 130012 (China); School of Chemical and Pharmaceutical Engineering, Jilin Institute of Chemical Technology, Jilin, 132022 (China); Zhang, Daguang [Department of Orthopaedic Surgery, the First Hospital of Jilin University, Changchun, 130021 China (China); Ren, Xiaozhen; Gao, Jiajia [College of Chemistry, Jilin University, Changchun, 130012 (China); Han, Yu [Department of Chemistry, College of Science, Yanbian University, Yanji, 133002 China (China); Chen, Xiaodong [College of Chemistry, Jilin University, Changchun, 130012 (China); Shi, Zhan [State Key Laboratory of Inorganic Synthesis and Preparative Chemistry, College of Chemistry, Jilin University, Changchun, 130012 (China); Yang, Hua [College of Chemistry, Jilin University, Changchun, 130012 (China)

    2016-12-15

    Fe{sub 3}C/Fe nanocomposites were synthesized by a sol–gel method. Using urea as carbon source and reduce agent in the reaction process. The CTAB works as the surfactant and the bromine contained in CTAB plays a catalytic role. Appropriate choices of the amount of urea and CTAB, reaction temperature and time are very important to obtain high-quality of products. Above 650 °C, the precursor gel turned into the nanocomposites composed of iron carbide and iron. Their structures and magnetic properties are characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM), and vibrating sample magnetometry (VSM). The possible formation mechanism of as-prepared nanostructures is discussed. - Highlights: • The Fe{sub 3}C/Fe composites were synthetized by sol–gel method. • Their structure, magnetic properties are researched by XRD, VSM and TEM. • The possible formation mechanisms of the composites is discussed.

  8. Adaptation of the Quality Indicator for Rehabilitative Care (QuIRC) for use in mental health supported accommodation services (QuIRC-SA).

    Science.gov (United States)

    Killaspy, Helen; White, Sarah; Dowling, Sarah; Krotofil, Joanna; McPherson, Peter; Sandhu, Sima; Arbuthnott, Maurice; Curtis, Sarah; Leavey, Gerard; Priebe, Stefan; Shepherd, Geoff; King, Michael

    2016-04-14

    No standardised tools for assessing the quality of specialist mental health supported accommodation services exist. To address this, we adapted the Quality Indicator for Rehabilitative care-QuIRC-that was originally developed to assess the quality of longer term inpatient and community based mental health facilities. The QuIRC, which is completed by the service manager and gives ratings of seven domains of care, has good psychometric properties. Focus groups with staff of the three main types of supported accommodation in the UK (residential care, supported housing and floating outreach services) were carried out to identify potential amendments to the QuIRC. Additional advice was gained from consultation with three expert panels, two of which comprised service users with lived experience of mental health and supported accommodation services. The amended QuIRC (QuIRC-SA) was piloted with a manager of each of the three service types. Item response variance, inter-rater reliability and internal consistency were assessed in a random sample of 52 services. Factorial structure and discriminant validity were assessed in a larger random sample of 87 services. The QuIRC-SA comprised 143 items of which only 18 items showed a narrow range of response and five items had poor inter-rater reliability. The tool showed good discriminant validity, with supported housing services generally scoring higher than the other two types of supported accommodation on most domains. Exploratory factor analysis showed that the QuIRC-SA items loaded onto the domains to which they had been allocated. The QuIRC-SA is the first standardised tool for quality assessment of specialist mental health supported accommodation services. Its psychometric properties mean that it has potential for use in research as well as audit and quality improvement programmes. A web based application is being developed to make it more accessible which will produce a printable report for the service manager about the

  9. Advance of activities report of the contract CFE-PLV/166/90. Second four-monthly

    International Nuclear Information System (INIS)

    Perusquia C, R.; Alonso V, G.; Hernandez M, J.L.; Montes T, J.L.

    1992-09-01

    In this report a relationship of finished activities of the Global Program of Fuel Management inside the reactor carried out by the ININ under the contract ININ/CFE 1990-1991 (CFE-PLV/166/90) is presented. Those areas of activities are: 1. Nuclear Data Bank area. 2. Static Simulation of the Reactor area. 3. Reload Optimization area. 4. Analysis of Transitory Events of the Reactor area. (Author)

  10. Carbon Chemistry in IRC+10216: Infrared Detection of Diacetylene

    Science.gov (United States)

    Fonfría, J. P.; Agúndez, M.; Cernicharo, J.; Richter, M. J.; Lacy, J. H.

    2018-01-01

    We present the detection of C4H2 for first time in the envelope of the C-rich AGB star IRC+10216, based on high spectral resolution mid-infrared observations carried out with the Texas Echelon-cross-Echelle Spectrograph mounted on the Infrared Telescope Facility. The obtained spectrum contains 24 narrow absorption features above the detection limit, identified as lines of the ro-vibrational C4H2 band {ν }6+{ν }8({σ }u+). The analysis of these lines through a ro-vibrational diagram indicates that the column density of C4H2 is (2.4 ± 1.5) × 1016 cm‑2. Diacetylene is distributed in two excitation populations accounting for 20% and 80% of the total column density and with rotational temperatures of 47 ± 7 and 420 ± 120 K, respectively. This two-folded rotational temperature suggests that the absorbing gas is located beyond ≃0.″4 ≃ 20 R ⋆ from the star, with a noticeable cold contribution outwards from ≃10″ ≃ 500 R ⋆. This outer shell matches up with the place where cyanoacetylenes and carbon chains are known to form due to the action of the Galactic dissociating radiation field on the neutral gas coming from the inner layers of the envelope.

  11. The formation of carbon chain molecules in IRC + 10216

    International Nuclear Information System (INIS)

    Howe, D.A.; Millar, T.J.

    1990-01-01

    This paper considers the formation of carbon-chain molecules, including C 2n H, C n S, HC 2n+1 N (n = 1-3) and SiC n (n = 1-4), in the outflowing envelope of the late-type carbon star IRC + 10216. The results suggest that the organo-sulphur species C 2 S and C 3 S can be formed in ion-molecule reactions involving acetylene ions and parent CS and SiS molecules. In addition to ion-molecule processes, neutral-neutral reactions can play a significant role in the formation of hydrocarbons and cyanopolyynes with up to six heavy atoms and in the formation of SiC 4 , and suggest that SiC 3 might be observable. However, the short time-scales available in the outflow are such that the observed abundances of the cyanopolyynes larger than HC 5 N cannot be reproduced using the parent molecules and abundances adopted here. (author)

  12. UNVEILING THE DUST NUCLEATION ZONE OF IRC+10216 WITH ALMA

    International Nuclear Information System (INIS)

    Cernicharo, J.; Daniel, F.; Goicoechea, J. R.; Castro-Carrizo, A.; Guélin, M.; Agundez, M.; Marcelino, N.; Joblin, C.

    2013-01-01

    We report the detection in IRC+10216 of lines of HNC J = 3 – 2 pertaining to nine excited vibrational states with energies up to ∼5300 K. The spectrum, observed with ALMA, also shows a surprising large number of narrow, unidentified lines that arise in the vicinity of the star. The HNC data are interpreted through a 1D-spherical non-local radiative transfer model, coupled to a chemical model that includes chemistry at thermochemical equilibrium for the innermost regions and reaction kinetics for the external envelope. Although unresolved by the current early ALMA data, the radius inferred for the emitting region is ∼0.''06 (i.e., ≅ 3 stellar radii), similar to the size of the dusty clumps reported by IR studies of the innermost region (r < 0.''3). The derived abundance of HNC relative to H 2 is 10 –8 < χ(HNC) <10 –6 , and drops quickly where the gas density decreases and the gas chemistry is dominated by reaction kinetics. Merging HNC data with that of molecular species present throughout the inner envelope, such as vibrationally excited HCN, SiS, CS, or SiO, should allow us to characterize the physical and chemical conditions in the dust formation zone

  13. UNVEILING THE DUST NUCLEATION ZONE OF IRC+10216 WITH ALMA

    Energy Technology Data Exchange (ETDEWEB)

    Cernicharo, J.; Daniel, F.; Goicoechea, J. R. [Departamento de Astrofísica, Centro de Astrobiología, CSIC-INTA, Ctra. de Torrejón a Ajalvir km 4, E-28850 Madrid (Spain); Castro-Carrizo, A.; Guélin, M. [Institut de Radioastronomie Millimétrique, 300 rue de la Piscine, F-38406, Saint Martin dHères (France); Agundez, M. [Univ. Bordeaux, LAB, UMR 5804, F-33270, Floirac (France); Marcelino, N. [NRAO, 520 Edgemont Road, Charlottesville, VA 22902 (United States); Joblin, C. [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France)

    2013-12-01

    We report the detection in IRC+10216 of lines of HNC J = 3 – 2 pertaining to nine excited vibrational states with energies up to ∼5300 K. The spectrum, observed with ALMA, also shows a surprising large number of narrow, unidentified lines that arise in the vicinity of the star. The HNC data are interpreted through a 1D-spherical non-local radiative transfer model, coupled to a chemical model that includes chemistry at thermochemical equilibrium for the innermost regions and reaction kinetics for the external envelope. Although unresolved by the current early ALMA data, the radius inferred for the emitting region is ∼0.''06 (i.e., ≅ 3 stellar radii), similar to the size of the dusty clumps reported by IR studies of the innermost region (r < 0.''3). The derived abundance of HNC relative to H{sub 2} is 10{sup –8} < χ(HNC) <10{sup –6}, and drops quickly where the gas density decreases and the gas chemistry is dominated by reaction kinetics. Merging HNC data with that of molecular species present throughout the inner envelope, such as vibrationally excited HCN, SiS, CS, or SiO, should allow us to characterize the physical and chemical conditions in the dust formation zone.

  14. Experiences on energy saving in Comision Federal Electricidad (CFE) buildings; Experiencias de ahorro de energia en edificios de la Comision Federal de Electricidad (CFE)

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez Velasco, Jorge E [Comision Federal de Electricidad (CFE) (Mexico)

    2005-07-01

    This document describes the developed saving projects in buildings and generating power stations in 2004 by the Comision Federal de Electricidad (CFE). The projects considered are: buildings of the oficinas nacionales, Divisions of distribution office buildings, office buildings of production regions, construction deputy manager's office building, buildings of transmission and transformation, generating power stations, investments and savings of the projects in oficinas nacionales, divisions of distribution and construction subdivision buildings. From these projects the ones concluded in the 2004 were: Distribution Divisions, Gulf-Center Division, Center-West Distribution Division. The developing projects of 2005: oficinas nacionales, distribution divisions, Construction Subdivision, Generating Power Stations, Transmission Areas and office buildings. And finally, the projects concluded in the 2005 are the distribution divisions, the construction subdivision, the generating power stations, the office buildings, the minisplit units and their advantages with respect to the air conditioning window units. [Spanish] Este documento describe los proyectos de ahorro desarrollados en inmuebles y centrales generadoras en el ano 2004 por la Comision Federal de Electricidad (CFE), los proyectos tratados son: inmuebles de oficinas nacionales, inmuebles de divisiones de distribucion, inmuebles de regiones de produccion, inmuebles de la subdireccion de construccion, inmuebles de transmision y transformacion, centrales generadoras, inversiones y ahorros de los proyectos en inmuebles de oficinas nacionales y divisiones de distribucion y subdireccion de construccion. De dichos proyectos se tiene que los proyectos concluidos en el 2004 fueron: Divisiones de Distribucion, Division Golfo Centro, Division de Distribucion Centro Occidente. Los proyectos en desarrollo del 2005: oficinas nacionales, divisiones de distribucion, Subdireccion de Construccion, Centrales Generadoras, Areas de

  15. Experiences on energy saving in Comision Federal Electricidad (CFE) buildings; Experiencias de ahorro de energia en edificios de la Comision Federal de Electricidad (CFE)

    Energy Technology Data Exchange (ETDEWEB)

    Alvarez Velasco, Jorge E. [Comision Federal de Electricidad (CFE) (Mexico)

    2005-07-01

    This document describes the developed saving projects in buildings and generating power stations in 2004 by the Comision Federal de Electricidad (CFE). The projects considered are: buildings of the oficinas nacionales, Divisions of distribution office buildings, office buildings of production regions, construction deputy manager's office building, buildings of transmission and transformation, generating power stations, investments and savings of the projects in oficinas nacionales, divisions of distribution and construction subdivision buildings. From these projects the ones concluded in the 2004 were: Distribution Divisions, Gulf-Center Division, Center-West Distribution Division. The developing projects of 2005: oficinas nacionales, distribution divisions, Construction Subdivision, Generating Power Stations, Transmission Areas and office buildings. And finally, the projects concluded in the 2005 are the distribution divisions, the construction subdivision, the generating power stations, the office buildings, the minisplit units and their advantages with respect to the air conditioning window units. [Spanish] Este documento describe los proyectos de ahorro desarrollados en inmuebles y centrales generadoras en el ano 2004 por la Comision Federal de Electricidad (CFE), los proyectos tratados son: inmuebles de oficinas nacionales, inmuebles de divisiones de distribucion, inmuebles de regiones de produccion, inmuebles de la subdireccion de construccion, inmuebles de transmision y transformacion, centrales generadoras, inversiones y ahorros de los proyectos en inmuebles de oficinas nacionales y divisiones de distribucion y subdireccion de construccion. De dichos proyectos se tiene que los proyectos concluidos en el 2004 fueron: Divisiones de Distribucion, Division Golfo Centro, Division de Distribucion Centro Occidente. Los proyectos en desarrollo del 2005: oficinas nacionales, divisiones de distribucion, Subdireccion de Construccion, Centrales Generadoras, Areas

  16. Conventional arms control negotiations in Europe (CFE, March 1989-April 1990)

    International Nuclear Information System (INIS)

    Buerstedde, L.

    1992-01-01

    This paper reports that for those of us who labored in the salt mines of arms control talks on Mutual and Balanced Force Reductions (MBFR), it is truly an invigorating experience to have been reincarnated as conventional arms controllers at the Negotiations on Conventional Armed Forces in Europe (CFE), in session in Vienna since March 1989, against the background of the breathtaking and unprecedented changes sweeping across Eastern Europe. The negotiations have made remarkable progress, proceeding to a point where a treaty drastically cutting the level of conventional armaments in Europe is not just a possibility but actually in prospect

  17. Toward an Analytic Framework of Interdisciplinary Reasoning and Communication (IRC) Processes in Science

    Science.gov (United States)

    Shen, Ji; Sung, Shannon; Zhang, Dongmei

    2015-11-01

    Students need to think and work across disciplinary boundaries in the twenty-first century. However, it is unclear what interdisciplinary thinking means and how to analyze interdisciplinary interactions in teamwork. In this paper, drawing on multiple theoretical perspectives and empirical analysis of discourse contents, we formulate a theoretical framework that helps analyze interdisciplinary reasoning and communication (IRC) processes in interdisciplinary collaboration. Specifically, we propose four interrelated IRC processes-integration, translation, transfer, and transformation, and develop a corresponding analytic framework. We apply the framework to analyze two meetings of a project that aims to develop interdisciplinary science assessment items. The results illustrate that the framework can help interpret the interdisciplinary meeting dynamics and patterns. Our coding process and results also suggest that these IRC processes can be further examined in terms of interconnected sub-processes. We also discuss the implications of using the framework in conceptualizing, practicing, and researching interdisciplinary learning and teaching in science education.

  18. An Efficient Rank Adaptation Algorithm for Cellular MIMO Systems with IRC Receivers

    DEFF Research Database (Denmark)

    Mahmood, Nurul Huda; Berardinelli, Gilberto; Tavares, Fernando Menezes Leitão

    2014-01-01

    Multiple transmit and receive antennas introduce additional degrees of freedom, which can be used to increase the number of spatial channels between a transmitter-receiver pair. Alternately, the additional degrees of freedom can be used to improve the interference resilience property with the help...... algorithm based on an estimate of the mean signal-to-interference-plus-noise ratio (SINR) at an IRC receiver; wherein, we use results from random matrix theory to derive the expression for the mean post-IRC SINR in the presence of interferers with unequal powers. The performance of the proposed algorithm...

  19. Smashing the Stovepipe: Leveraging the GMSEC Open Architecture and Advanced IT Automation to Rapidly Prototype, Develop and Deploy Next-Generation Multi-Mission Ground Systems

    Science.gov (United States)

    Swenson, Paul

    2017-01-01

    Satellite/Payload Ground Systems - Typically highly-customized to a specific mission's use cases - Utilize hundreds (or thousands!) of specialized point-to-point interfaces for data flows / file transfers Documentation and tracking of these complex interfaces requires extensive time to develop and extremely high staffing costs Implementation and testing of these interfaces are even more cost-prohibitive, and documentation often lags behind implementation resulting in inconsistencies down the road With expanding threat vectors, IT Security, Information Assurance and Operational Security have become key Ground System architecture drivers New Federal security-related directives are generated on a daily basis, imposing new requirements on current / existing ground systems - These mandated activities and data calls typically carry little or no additional funding for implementation As a result, Ground System Sustaining Engineering groups and Information Technology staff continually struggle to keep up with the rolling tide of security Advancing security concerns and shrinking budgets are pushing these large stove-piped ground systems to begin sharing resources - I.e. Operational / SysAdmin staff, IT security baselines, architecture decisions or even networks / hosting infrastructure Refactoring these existing ground systems into multi-mission assets proves extremely challenging due to what is typically very tight coupling between legacy components As a result, many "Multi-Mission" ops. environments end up simply sharing compute resources and networks due to the difficulty of refactoring into true multi-mission systems Utilizing continuous integration / rapid system deployment technologies in conjunction with an open architecture messaging approach allows System Engineers and Architects to worry less about the low-level details of interfaces between components and configuration of systems GMSEC messaging is inherently designed to support multi-mission requirements, and

  20. Comparative Analysis of Doppler Guided Hemorrhoidal Artery Ligation (DG-HAL) & Infrared Coagulation (IRC) in Management of Hemorrhoids.

    Science.gov (United States)

    Ahmad, Arshad; Kant, Rama; Gupta, Avneet

    2013-08-01

    Both Doppler-guided hemorrhoidal artery ligation (DG-HAL) and infrared coagulation (IRC) are well-established techniques in the management of hemorrhoids. The aim of the study is to compare the clinical outcomes of DG-HAL and IRC in the patients with grade 1 and 2 hemorrhoids. A total of 296 patients were registered for the study, but 51 patients were lost in follow-up; hence, finally 245 patients were included in the analysis. Patients were randomized into two groups (mean age, 42 years; range, 19-60 years). Group A (n = 116) was treated with DG-HAL and group B (n = 129) was treated with IRC. Patients were examined at 1 week, 1 month, and 6 months after the procedure. Mean time taken for HAL was 21 min and for IRC, 12 min. The cost of the DG-HAL procedure was 1,440 rupees ($31.53) and that of IRC was 376 rupees ($8). The mean duration of hospital stay after HAL was 6 h and after IRC, 2 h. Control of symptoms with HAL was 96 %, whereas with IRC, 81 %. Postoperative complication rate for HAL was 2 %, whereas for IRC, 13 %. Requirement of repeat procedure with HAL was 9 % and with IRC, 28 %. Both the procedures are minimally invasive, associated with minimal discomfort, and suitable for day care surgery. IRC requires lesser procedure time, lesser postoperative hospital stay, and has lower procedure cost, whereas DG-HAL is more effective in controlling symptoms of hemorrhoids, has lower post operative complication rate, and has lesser requirement of repeat procedure.

  1. Core-free rolled actuators for Braille displays using P(VDF-TrFE-CFE)

    Science.gov (United States)

    Levard, Thomas; Diglio, Paul J.; Lu, Sheng-Guo; Rahn, Christopher D.; Zhang, Q. M.

    2012-01-01

    Refreshable Braille displays require many small diameter actuators to move the pins. The electrostrictive P(VDF-TrFE-CFE) terpolymer can provide the high strain and actuation force under modest electric fields that are required for this application. In this paper, we develop core-free tubular actuators and integrate them into a 3 × 2 Braille cell. The terpolymer films are solution cast, stretched to 6 μm thick, electroded, laminated into a bilayer, rolled into a 2 mm diameter tube, bonded, and provided with top and bottom contacts. Experimental testing of 17 actuators demonstrates significant strains (up to 4%) and blocking forces (1 N) at moderate electric fields (100 MV m-1). A novel Braille cell is designed and fabricated using six of these actuators.

  2. Core-free rolled actuators for Braille displays using P(VDF–TrFE–CFE)

    International Nuclear Information System (INIS)

    Levard, Thomas; Diglio, Paul J; Rahn, Christopher D; Lu, Sheng-Guo; Zhang, Q M

    2012-01-01

    Refreshable Braille displays require many small diameter actuators to move the pins. The electrostrictive P(VDF–TrFE–CFE) terpolymer can provide the high strain and actuation force under modest electric fields that are required for this application. In this paper, we develop core-free tubular actuators and integrate them into a 3 × 2 Braille cell. The terpolymer films are solution cast, stretched to 6 μm thick, electroded, laminated into a bilayer, rolled into a 2 mm diameter tube, bonded, and provided with top and bottom contacts. Experimental testing of 17 actuators demonstrates significant strains (up to 4%) and blocking forces (1 N) at moderate electric fields (100 MV m −1 ). A novel Braille cell is designed and fabricated using six of these actuators. (fast track communication)

  3. CFE-DOE agreement for the study of Mexican geothermal fields

    International Nuclear Information System (INIS)

    Le Bert, G.

    1990-01-01

    The Commission Federal de Electricidad (CFE) is the public utility in Mexico in charge of electric energy service, as well as harnessing geothermal resources. An agreement of mutual benefit to achieve a thorough understanding of the nature of geothermal reservoirs was signed on April 17, 1986 with the United State Department of Energy (DOE). The major objective of this agreement was to investigate how geothermal resources can best be explored and exploited. The duration of the agreement was for 3 years, but as happens in many long-term research programs, new topics and problems appear. Thus an extension of 5 years was foreseen. A brief discussion on the results of the main tasks is presented in this paper, as well as of the new tasks and scopes for the 5-year extension of the agreement

  4. THE PECULIAR DISTRIBUTION OF CH{sub 3}CN IN IRC +10216 SEEN BY ALMA

    Energy Technology Data Exchange (ETDEWEB)

    Agúndez, M.; Cernicharo, J.; Quintana-Lacaci, G.; Prieto, L. Velilla [Instituto de Ciencia de Materiales de Madrid, CSIC, C/Sor Juana Inés de la Cruz 3, E-28049 Cantoblanco (Spain); Castro-Carrizo, A.; Guélin, M. [Institut de Radioastronomie Millimétrique, 300 rue de la Piscine, F-38406 St. Martin d’Héres (France); Marcelino, N. [INAF, Istituto di Radioastronomia, via Gobetti 101, I-40129 Bologna (Italy)

    2015-12-01

    IRC +10216 is a circumstellar envelope around a carbon-rich evolved star which contains a large variety of molecules. According to interferometric observations, molecules are distributed either concentrated around the central star or as a hollow shell with a radius of ∼15″. We present ALMA Cycle 0 band 6 observations of the J = 14 – 13 rotational transition of CH{sub 3}CN in IRC +10216, obtained with an angular resolution of 0.″76 × 0.″61. The bulk of the emission is distributed as a hollow shell located at just ∼2″ from the star, with a void of emission in the central region up to a radius of ∼1″. This spatial distribution is markedly different from those found to date in this source for other molecules. Our analysis indicates that methyl cyanide is not formed in either the stellar photosphere or far in the outer envelope, but at radial distances as short as 1″–2″, reaching a maximum abundance of ∼0.02 molecules cm{sup −3} at 2″ from the star. Standard chemical models of IRC +10216 predict that the bulk of CH{sub 3}CN molecules should be present at a radius of ∼15″ where other species such as polyyne radicals and cyanopolyynes are observed, with an additional inner component within 1″ from the star. The non-uniform structure of the circumstellar envelope and grain surface processes are discussed as possible causes of the peculiar distribution of methyl cyanide in IRC +10216.

  5. Double-stranded DNA-dependent ATPase Irc3p is directly involved in mitochondrial genome maintenance.

    Science.gov (United States)

    Sedman, Tiina; Gaidutšik, Ilja; Villemson, Karin; Hou, YingJian; Sedman, Juhan

    2014-12-01

    Nucleic acid-dependent ATPases are involved in nearly all aspects of DNA and RNA metabolism. Previous studies have described a number of mitochondrial helicases. However, double-stranded DNA-dependent ATPases, including translocases or enzymes remodeling DNA-protein complexes, have not been identified in mitochondria of the yeast Saccharomyces cerevisae. Here, we demonstrate that Irc3p is a mitochondrial double-stranded DNA-dependent ATPase of the Superfamily II. In contrast to the other mitochondrial Superfamily II enzymes Mss116p, Suv3p and Mrh4p, which are RNA helicases, Irc3p has a direct role in mitochondrial DNA (mtDNA) maintenance. Specific Irc3p-dependent mtDNA metabolic intermediates can be detected, including high levels of double-stranded DNA breaks that accumulate in irc3Δ mutants. irc3Δ-related topology changes in rho- mtDNA can be reversed by the deletion of mitochondrial RNA polymerase RPO41, suggesting that Irc3p counterbalances adverse effects of transcription on mitochondrial genome stability. © The Author(s) 2014. Published by Oxford University Press on behalf of Nucleic Acids Research.

  6. Distribution electric system simulator to support decision-making for CFE (Federal Electric Commission) Distribution Control Centers; Simulador del Sistema Electrico de Distribucion para apoyo en la toma de decisiones en Centros de Control de Distribucion de la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa Reza, Alfredo; Quintero Reyes, Agustin; Garcia Mendoza, Raul; Calleros Torres, Tito Manuel [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Borjas Diaz, Jesus Fidel; Sierra Rodriguez, Benjamin; Torres Abrego, Rafael [Comision Federal de Electricidad (Mexico)

    2011-07-01

    This article presents the physical, logical and functional architecture designed to integrate the Electric Distribution System (EDS) simulator developed for the CFE and the electric energy Distribution Control Centers in Mexico. The objective of the EDS simulator is to integrate engineering distribution functions (power flow, short circuit, optimal reconfiguration and reliability, among others) and an expert system (Case-based Reasoning) to aid the process of information analysis, decision-making and the capacity-building of the CFE's Regional and Zonal Distribution Control Centers. The EDS simulator has been installed, updated and is operational in the Tampico Zone and the Gulf Division Distribution Center, as an established product that continually evolves along with the actual operating dynamics. [Spanish] Se presenta la arquitectura fisica, logica y funcional disenada para integrar el simulador del Sistema Electrico de Distribucion (SED) desarrollado para la Comision Federal de Electricidad (CFE) y los Centros de Control de Distribucion de energia electrica en Mexico. El objetivo del simulador del SED es integrar funciones de ingenieria de distribucion (flujo de potencia, corto circuito, reconfiguracion optima, confiabilidad, entre otras) y un sistema experto (Razonamiento Basado en Casos) para apoyar el proceso de analisis de informacion, la toma de decisiones y la capacitacion en los Centros de Control de Distribucion Zonales y Regionales de CFE. El Simulador del SED se encuentra instalado, actualizado y en operacion en la Zona Tampico y en la Division de Distribucion Golfo Centro como un producto consolidado y en constante evolucion a la par de la dinamica operativa real.

  7. Study on labelling methods of 125I-RC-160 and its biodistribution in animals

    International Nuclear Information System (INIS)

    Wang Jing; Wang Xiqing; Wang Liangang; Li Fujun; Deng Jinglan

    2002-01-01

    A method for the iodination of peptide RC-160 with high efficiency was developed. RC-160 was iodinated with N-bromosuccinimide (NBS) as oxidant, the conventional chloramine T (Ch-T) method was used as control. The labelling condition of NBS method was optimized and radiolabelled conjugate 125 I-RC-160 was assessed as follows: no further purification was needed, the measured labelling yield of 125 I-RC-160 was 92% and the specific activity was 1.95 x 10 12 Bq/m mol. The yield increased as the amount of NBS increased. The optimal ratio of RC-160 (μg): 125 I (MBq): NBS(μg) was 3:7.4:1. For Ch-T method, the labelling yield is 56% and specific activity was 0.65 x 10 12 Bq/m mol; but after purification by SepPak-C 18 , the labelling yield may reach as high as 92%. 1h after injection, radioactivity in blood decreased by 87.2%. No obvious concentration of 125 I-RC-160 in thyroid or kidney was observed

  8. On the stability of bow shocks generated by red supergiants: the case of IRC -10414

    Science.gov (United States)

    Meyer, D. M.-A.; Gvaramadze, V. V.; Langer, N.; Mackey, J.; Boumis, P.; Mohamed, S.

    2014-03-01

    In this Letter, we explore the hypothesis that the smooth appearance of bow shocks around some red supergiants (RSGs) might be caused by the ionization of their winds by external sources of radiation. Our numerical simulations of the bow shock generated by IRC -10414 (the first-ever RSG with an optically detected bow shock) show that the ionization of the wind results in its acceleration by a factor of 2, which reduces the difference between the wind and space velocities of the star and makes the contact discontinuity of the bow shock stable for a range of stellar space velocities and mass-loss rates. Our best-fitting model reproduces the overall shape and surface brightness of the observed bow shock and suggests that the space velocity and mass-loss rate of IRC -10414 are ≈50 km s-1 and ≈10-6 M⊙ yr-1, respectively, and that the number density of the local interstellar medium is ≈3 cm-3. It also shows that the bow shock emission comes mainly from the shocked stellar wind. This naturally explains the enhanced nitrogen abundance in the line-emitting material, derived from the spectroscopy of the bow shock. We found that photoionized bow shocks are ≈15-50 times brighter in optical line emission than their neutral counterparts, from which we conclude that the bow shock of IRC -10414 must be photoionized.

  9. Mitsubishi latest coal fired USC boiler technology (CFE Pacifico 700 MW)

    Energy Technology Data Exchange (ETDEWEB)

    Hashimoto, T.; Sakamoto, K. [Mitsubishi Heavy Industries, Ltd., Nagasaki (Japan). Power Systems; Fujitab, M. [Mitsubishi Heavy Industries, Ltd., Yokohama (Japan). Power Systems

    2013-07-01

    Mitsubishi Heavy Industries, Ltd. (MHI) has successfully completed commissioning work for CFE (Comision Federal de Electricidad) Pacifico 700 MW coal-fired unit in March 2010 which is the first supercritical unit in Latin America. This supercritical boiler was designed with state of the art technologies such as low NOx burners, high fineness pulverizers, advanced vertical furnace wall technology and so on. Especially the advanced vertical furnace wall technology with some improvements is a key technology to realize swift load changes such as 5% load per minute ramping rate with assuring dynamic characteristics. Recently the requirement of the high efficiency and the swift load changes for the power boilers has been increased so that even a coal-fired unit needs flexible operation characteristics for balancing variety of power sources. One of the challenges for the swift load change is to keep the furnace wall metal temperature low during the load change, which the advanced vertical furnace wall could realize. The report describes the features of the unit and commissioning result including load swing test results in details.

  10. PREFACE: Asia-Pacific Interdisciplinary Research Conference 2011 (AP-IRC 2011)

    Science.gov (United States)

    Sandhu, Adarsh; Okada, Hiroshi; Maekawa, Toru; Okano, Ken

    2012-03-01

    AP-IRC Logo Scientists, engineers, entrepreneurs and policymakers gather at the first truly interdisciplinary conference held in Asia-Pacific http://www.apirc.jp/ The inaugural Asia-Pacific Interdisciplinary Research Conference 2011 (AP-IRC 2011) was held at Toyohashi University of Technology (Toyohashi Tech) on 17-18 November 2011. The conference is a forum for enhancing mutual understanding between scientists, engineers, policymakers and experts from a wide spectrum of pure and applied sciences, to resolve the daunting global issues facing mankind. The conference attracted approximately 300 participants including delegates from France, Germany, India, Indonesia, Korea, Malaysia, Russia, Sweden, United Kingdom, USA and Vietnam. AP-IRC 2011 was chaired by Dr Yoshiyuki Sakaki, President of Toyohashi Tech, who opened the proceedings by stressing the importance of an interdisciplinary approach to research, to resolve global scientific and technical issues. Recalling his own experience as the leader of Japan's efforts in the Human Genome Project, Sakaki also encouraged participants to make an effort to try to understand the sometimes difficult concepts and terminology of other areas of research. The presentations at AP-IRC 2011 were divided into three focus sessions: innovative mechano-magneto-electronic systems, life sciences, and green science and technology. A total of 174 papers were presented over the two-day conference including eight by invited speakers. Highlights of AP-IRC 2011 included a first-hand account of the damage caused by the massive earthquake in March 2011 to experimental facilities at Tohoku University by Masayoshi Esashi; the fascinating world of bees and the inborn numerical competence of humans and animals by Hans J Gross; research on robots and cognition-enabled technical systems at Technische Universität München by Sandra Hirche; the history of events leading to the invention of the world's strongest NdFeB permanent magnet by Masato Sagawa

  11. Thermal limits validation of gamma thermometer power adaption in CFE Laguna Verde 2 reactor core

    Energy Technology Data Exchange (ETDEWEB)

    Cuevas V, G.; Banfield, J. [GE-Hitachi Nuclear Energy Americas LLC, Global Nuclear Fuel, Americas LLC, 3901 Castle Hayne Road, Wilmingtonm, North Carolina (United States); Avila N, A., E-mail: Gabriel.Cuevas-Vivas@ge.com [Comision Federal de Electricidad, Central Nucleoelectrica Laguna Verde, Carretera Cardel-Nautla Km 42.5, Alto Lucero, Veracruz (Mexico)

    2016-09-15

    This paper presents the status of GEH work on Gamma Thermometer (GT) validation using the signals of the instruments installed in the Laguna Verde Unit 2 reactor core. The long-standing technical collaboration between Comision Federal de Electricidad (CFE), Global Nuclear Fuel - Americas LLC (GNF) and GE-Hitachi Nuclear Energy Americas LLC (GEH) is moving forward with solid steps to a final implementation of GTs in a nuclear reactor core. Each GT is integrated into a slightly modified Local Power Range Monitor (LPRM) assembly. Six instrumentation strings are equipped with two gamma field detectors for a total of twenty-four bundles whose calculated powers are adapted to the instrumentation readings in addition to their use as calibration instruments for LPRMs. Since November 2007, the six GT instrumentation strings have been operable with almost no degradation by the strong neutron and gamma fluxes in the Laguna Verde Unit 2 reactor core. In this paper, the thermal limits, Critical Power Ratio (CPR) and maximum Linear Heat Generation Rate (LHGR), of bundles directly monitored by either Traverse In-core Probes (TIPs) or GTs are used to establish validation results that confirm the viability of TIP system replacement with automatic fixed in-core probes (AFIPs, GTs, in a Boiling Water Reactor. The new GNF steady-state reactor core simulator AETNA02 is used to obtain power and exposure distribution. Using this code with an updated methodology for GT power adaption, a reduced value of the GT interpolation uncertainty is obtained that is fed into the LHGR calculation. This new method achieves margin recovery for the adapted thermal limits for use in the Economic Simplified Boiling Water Reactor (ESBWR) or any other BWR in the future that employs a GT based AFIP system for local power measurements. (Author)

  12. Thermal limits validation of gamma thermometer power adaption in CFE Laguna Verde 2 reactor core

    International Nuclear Information System (INIS)

    Cuevas V, G.; Banfield, J.; Avila N, A.

    2016-09-01

    This paper presents the status of GEH work on Gamma Thermometer (GT) validation using the signals of the instruments installed in the Laguna Verde Unit 2 reactor core. The long-standing technical collaboration between Comision Federal de Electricidad (CFE), Global Nuclear Fuel - Americas LLC (GNF) and GE-Hitachi Nuclear Energy Americas LLC (GEH) is moving forward with solid steps to a final implementation of GTs in a nuclear reactor core. Each GT is integrated into a slightly modified Local Power Range Monitor (LPRM) assembly. Six instrumentation strings are equipped with two gamma field detectors for a total of twenty-four bundles whose calculated powers are adapted to the instrumentation readings in addition to their use as calibration instruments for LPRMs. Since November 2007, the six GT instrumentation strings have been operable with almost no degradation by the strong neutron and gamma fluxes in the Laguna Verde Unit 2 reactor core. In this paper, the thermal limits, Critical Power Ratio (CPR) and maximum Linear Heat Generation Rate (LHGR), of bundles directly monitored by either Traverse In-core Probes (TIPs) or GTs are used to establish validation results that confirm the viability of TIP system replacement with automatic fixed in-core probes (AFIPs, GTs, in a Boiling Water Reactor. The new GNF steady-state reactor core simulator AETNA02 is used to obtain power and exposure distribution. Using this code with an updated methodology for GT power adaption, a reduced value of the GT interpolation uncertainty is obtained that is fed into the LHGR calculation. This new method achieves margin recovery for the adapted thermal limits for use in the Economic Simplified Boiling Water Reactor (ESBWR) or any other BWR in the future that employs a GT based AFIP system for local power measurements. (Author)

  13. VizieR Online Data Catalog: AKARI IRC asteroid sample diameters & albedos (Ali-Lagoa+, 2018)

    Science.gov (United States)

    Ali-Lagoa, V.; Mueller, T. G.; Usui, F.; Hasegawa, S.

    2017-11-01

    Table 1 contains the best-fitting values of size and beaming parameter and corresponding visible geometric albedos for the full AKARI IRC sample. We fitted the near-Earth asteroid thermal model (NEATM) of Harris (1998Icar..131..291H) to the AKARI IRC thermal infrared data (Murakami et al., 2007PASJ...59S.369M, Onaka et al., 2007PASJ...59S.401O, Ishihara et al., 2010A&A...514A...1I, Cat. II/297, Usui et al., 2011PASJ...63.1117U, Cat. J/PASJ/63/1117, Takita et al., 2012PASJ...64..126T, Hasegawa et al., 2013PASJ...65...34H, Cat. J/PASJ/65/34). The NEATM implementation is described in Ali-Lagoa and Delbo' (2017A&A...603A..55A, cat. J/A+A/603/A55). Minimum relative errors of 10, 15, and 20 percent are given for size, beaming parameter and albedo in those cases where the beaming parameter could be fitted. Otherwise, a default value of the beaming parameter is assumed based on Eq. 1 in the article, and the minimum relative errors in size and albedo increase to 20 and 40 percent (see the discussions in Mainzer et al., 2011ApJ...736..100M, Ali-Lagoa et al., 2016A&A...591A..14A, Cat. J/A+A/591/A14). We also provide the asteroid absolute magnitudes and G12 slope parameters retrieved from Oszkiewicz et al. (2012), the number of observations used in each IRC band (S9W and L18W), plus the heliocentric and geocentric distances and phase angle (r, Delta, alpha) based on the ephemerides taken from the MIRIADE service (http://vo.imcce.fr/webservices/miriade/?ephemph). (1 data file).

  14. IDENTIFICATION OF KCN IN IRC+10216: EVIDENCE FOR SELECTIVE CYANIDE CHEMISTRY

    International Nuclear Information System (INIS)

    Pulliam, R. L.; Ziurys, L. M.; Savage, C.; Agundez, M.; Cernicharo, J.; Guelin, M.

    2010-01-01

    A new interstellar molecule, KCN, has been identified toward the circumstellar envelope of the carbon-rich asymptotic giant branch star, IRC+10216-the fifth metal cyanide species to be detected in space. Fourteen rotational transitions of this T-shaped, asymmetric top were searched for in the frequency range of 83-250 GHz using the Arizona Radio Observatory (ARO) 12 m Kitt Peak antenna, the IRAM 30 m telescope, and the ARO Submillimeter Telescope. Distinct lines were measured for 10 of these transitions, including the K a = 1 and 2 asymmetry components of the J = 11 → 10 and J = 10 → 9 transitions, i.e., the K-ladder structure distinct to an asymmetric top. These data are some of the most sensitive astronomical spectra at λ ∼ 1 and 3 mm obtained to date, with 3σ noise levels ∼0.3 mK, made possible by new ALMA technology. The line profiles from the ARO and IRAM telescopes are consistent with a shell-like distribution for KCN with r outer ∼ 15'', but with an inner shell radius that extends into warmer gas. The column density for KCN in IRC+10216 was found to be N tot ∼ 1.0 x 10 12 cm -2 with a rotational temperature of T rot ∼ 53 K. The fractional abundance was calculated to be f(KCN/H 2 ) ∼ 6 x 10 -10 , comparable to that of KCl. The presence of KCN in IRC+10216, along with MgNC, MgCN, NaCN, and AlNC, suggests that cyanide/isocyanide species are the most common metal-containing molecules in carbon-rich circumstellar gas.

  15. Modeling the light-travel-time effect on the far-infrared size of IRC +10216

    Science.gov (United States)

    Wright, Edward L.; Baganoff, Frederick K.

    1995-01-01

    Models of the far-infrared emission from the large circumstellar dust envelope surrounding the carbon star IRC +10216 are used to assess the importance of the light-travel-time effect (LTTE) on the observed size of the source. The central star is a long-period variable with an average period of 644 +/- 17 days and a peak-to-peak amplitude of two magnituds, so a large light-travel-time effect is seen at 1 min radius. An attempt is made to use the LTTE to reconcile the discrepancy between the observations of Fazio et al. and Lester et al. regarding the far-infrared source size. This discrepancy is reviewed in light of recent, high-spatial-resolution observations at 11 microns by Danchi et al. We conclude that IRC +10216 has been resolved on the arcminute scale by Fazio et al. Convolution of the model intensity profile at 61 microns with the 60 sec x 90 sec Gaussian beam of Fazio et al. yields an observed source size full width at half maximum (FWHM) that ranges from approximately 67 sec to 75 sec depending on the phase of the star and the assumed distance to the source. Using a simple r(exp -2) dust distribution and the 106 deg phase of the Fazio et al. observations, the LTTE model reaches a peak size of 74.3 sec at a distance of 300 pc. This agrees favorably with the 78 sec x 6 sec size measured by Fazio et al. Finally, a method is outlined for using the LTTE as a distance indicator to IRC +10216 and other stars with extended mass outflows.

  16. On the impact of receiver imperfections on the MMSE-IRC receiver performance in 5G networks

    DEFF Research Database (Denmark)

    Tavares, Fernando Menezes Leitão; Berardinelli, Gilberto; Mahmood, Nurul Huda

    2014-01-01

    The usage of Minimum Mean Square Error - Interference Rejection Combining (MMSE-IRC) receivers is expected to be a significant performance booster in the ultra-dense deployment of small cells envisioned by an upcoming 5th generation (5G) Radio Access Technology (RAT). However, hardware limitation...... simulation results confirm that a realistic MMSE-IRC receiver can achieve throughput gains close to ideal, provided a reasonably high resolution Analog-to-Digital Converter (ADC) as well as a supportive radio frame format design are used....

  17. Si-BEARING MOLECULES TOWARD IRC+10216: ALMA UNVEILS THE MOLECULAR ENVELOPE OF CWLeo

    International Nuclear Information System (INIS)

    Prieto, L. Velilla; Cernicharo, J.; Quintana-Lacaci, G.; Agúndez, M.; Castro-Carrizo, A.; Guélin, M.; Fonfría, J. P.; Marcelino, N.; Zúñiga, J.; Requena, A.; Bastida, A.; Lique, F.

    2015-01-01

    We report the detection of SiS rotational lines in high-vibrational states as well as SiO and SiC 2 lines in their ground vibrational state toward IRC+10216 during the Atacama Large Millimeter Array Cycle 0. The spatial distribution of these molecules shows compact emission for SiS and a more extended emission for SiO and SiC 2 and also proves the existence of an increase in the SiC 2 emission at the outer shells of the circumstellar envelope (CSE). We analyze the excitation conditions of the vibrationally excited SiS using the population diagram technique, and we use a large velocity gradient model to compare with the observations. We found moderate discrepancies between the observations and the models that could be explained if SiS lines detected are optically thick. Additionally, the line profiles of the detected rotational lines in the high-energy vibrational states show a decreasing linewidth with increasing energy levels. This may be evidence that these lines could be excited only in the inner shells, i.e., the densest and hottest, of the CSE of IRC+10216

  18. Discovery of methyl silane and confirmation of silyl cyanide in IRC +10216

    Science.gov (United States)

    Cernicharo, J.; Agúndez, M.; Velilla Prieto, L.; Guélin, M.; Pardo, J. R.; Kahane, C.; Marka, C.; Kramer, C.; Navarro, S.; Quintana-Lacaci, G.; Fonfría, J. P.; Marcelino, N.; Tercero, B.; Moreno, E.; Massalkhi, S.; Santander-García, M.; McCarthy, M. C.; Gottlieb, C. A.; Alonso, J. L.

    2017-10-01

    We report the discovery in space of methyl silane, CH3SiH3, from observations of ten rotational transitions between 80 and 350 GHz (Ju from 4 to 16) with the IRAM 30 m radio telescope. The molecule was observed in the envelope of the C-star IRC +10216. The observed profiles and our models for the expected emission of methyl silane suggest that the it is formed in the inner zones of the circumstellar envelope, 1-40 R∗, with an abundance of (0.5-1) × 10-8 relative to H2. We also observed several rotational transitions of silyl cyanide (SiH3CN), confirming its presence in IRC +10216 in particular, and in space in general. Our models indicate that silyl cyanide is also formed in the inner regions of the envelope, around 20 R∗, with an abundance relative to H2 of 6 × 10-10. The possible formation mechanisms of both species are discussed. We also searched for related chemical species but only upper limits could be obtained. This work was based on observations carried out with the IRAM 30-m telescope. IRAM is supported by INSU/CNRS (France), MPG (Germany), and IGN (Spain).

  19. First multivendor scheme in CFE to protection of 400 kV transmission line, using optical TC's, digital relays and bus IEC 61850-9-2; Primer esquema multivendedor en CFE para proteccion de linea de transmision de 400 kV, utilizando TC's opticos, relevadores digitales y bus IEC 61850-9-2

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Colon, V.R; Rasgado, J.P [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Lara C, H; Melendez, C; Juarez, N [Subdireccion de Transmision, Comision Federal de Electricidad (Mexico)

    2013-03-15

    This paper presents the details of design, installation and putting into service in the Comision Federal de Electricidad (CFE), of the first multi-vendor scheme that exists in the world, for the protection of a 400kV transmission line, which uses optical current transformers and digital relays IEC 61850-9-2. This system arises as a pilot project of the Subdireccion de Transmision of the CFE with the Instituto de Investigaciones Electricas (IIE). To ensure success in the implementation of the protection scheme, CFE joined a team coordinated by the Instituto de Investigaciones Electricas (IIE)involving nine international companies and a university. Pilot protection scheme is in operation under continuous monitoring, in one of the transmission lines of CFE that interconnect Manuel Moreno Torres with El Juile substations. The construction features, the challenges that were overcome and the first results obtained in operation are presented below. [Spanish] Este articulo presenta los detalles del diseno, instalacion y puesta en servicio en la Comision Federal de Electricidad (CFE) del primer esquema multivendedor que existe en el mundo, para la proteccion de una linea de transmision de 400kV, que utiliza transformadores de corriente opticos y relevadores digitales IEC 61850-9-2. Este sistema surge como un proyecto piloto de la Subdireccion de Transmision de la CFE con el Instituto de Investigaciones Electricas (IIE). Para asegurar el exito en la implementacion del esquema de proteccion, la CFE integro un equipo de trabajo coordinado por el Instituto de Investigaciones Electricas (IIE) en el que participaron 9 empresas internacionales y una universidad. El esquema de proteccion piloto, se encuentra en operacion bajo monitoreo continuo, en una de las lineas de transmision de la CFE que interconecta las subestaciones de Manuel Moreno Torres y El Juile. Las caracteristicas de construccion, los retos que fueron vencidos y los primeros resultados obtenidos en su operacion se

  20. The Arizona Radio Observatory 1 mm Spectral Survey of IRC (plus)10216 and VY Canis Majoris (215-285 GHz)

    Science.gov (United States)

    Tenenbaum, E. D.; Dodd, J. L.; Milam, S. N.; Woolf, N. J.; Ziurys, L. M.

    2010-01-01

    A low noise (1(sigma) rms approx. 3 mK) 1. nun spectral survey (214.5-285.5 GHz) of the oxygen-rich supergiant VY Canis Majoris and the carbon-rich asymptotic giant branch star IRC +10216 has been conducted using the Arizona Radio Observatory's 10 m Submillimeter Telescope. Here the complete data set is presented. This study, carried out with a new ALMA-type receiver, marks the first continuous band scan of an O-rich circumstellar envelope, and the most sensitive survey to date of IRC +10216. In VY CMa, 130 distinct molecular lines were detected, 14 of which cannot be identified; in IRC +10216, 717 lines were observed, with 126 features remaining unidentified. In the 1 mm bands of VY CMa and IRC +10216, emission is present from 18 and 32 different chemical compounds, respectively, with 10 species common to both sources. Many narrow emission lines were observed in both circumstellar shells, arising from vibrationally excited molecules and from refractory-containing species. Line profiles in VY CMa also exhibit a variety of different shapes, caused by the complex, asymmetric outflow of this object. The survey highlights the fact that C-rich and O-rich circumstellar envelopes are chemically interesting, and both are sources of new interstellar molecules. The high number of unidentified lines and the unreliable, rest frequencies for known species such as NaCN indicate the need for additional laboratory spectroscopy studies.

  1. The Arizona Radio Observatory 1 mm Spectral Survey of IRC +10216 and VY Canis Majoris (215-285 GHz)

    Science.gov (United States)

    Tenenbaum, E. D.; Dodd, J. L.; Milam, S. N.; Woolf, N. J.; Ziurys, L. M.

    2010-10-01

    A low noise (1σ rms ~ 3 mK) 1 mm spectral survey (214.5-285.5 GHz) of the oxygen-rich supergiant VY Canis Majoris and the carbon-rich asymptotic giant branch star IRC +10216 has been conducted using the Arizona Radio Observatory's 10 m Submillimeter Telescope. Here the complete data set is presented. This study, carried out with a new ALMA-type receiver, marks the first continuous band scan of an O-rich circumstellar envelope, and the most sensitive survey to date of IRC +10216. In VY CMa, 130 distinct molecular lines were detected, 14 of which cannot be identified; in IRC +10216, 717 lines were observed, with 126 features remaining unidentified. In the 1 mm bands of VY CMa and IRC +10216, emission is present from 18 and 32 different chemical compounds, respectively, with 10 species common to both sources. Many narrow emission lines were observed in both circumstellar shells, arising from vibrationally excited molecules and from refractory-containing species. Line profiles in VY CMa also exhibit a variety of different shapes, caused by the complex, asymmetric outflow of this object. The survey highlights the fact that C-rich and O-rich circumstellar envelopes are chemically interesting, and both are sources of new interstellar molecules. The high number of unidentified lines and the unreliable rest frequencies for known species such as NaCN indicate the need for additional laboratory spectroscopy studies.

  2. THE ARIZONA RADIO OBSERVATORY 1 mm SPECTRAL SURVEY OF IRC +10216 AND VY CANIS MAJORIS (215-285 GHz)

    International Nuclear Information System (INIS)

    Tenenbaum, E. D.; Dodd, J. L.; Woolf, N. J.; Ziurys, L. M.; Milam, S. N.

    2010-01-01

    A low noise (1σ rms ∼ 3 mK) 1 mm spectral survey (214.5-285.5 GHz) of the oxygen-rich supergiant VY Canis Majoris and the carbon-rich asymptotic giant branch star IRC +10216 has been conducted using the Arizona Radio Observatory's 10 m Submillimeter Telescope. Here the complete data set is presented. This study, carried out with a new ALMA-type receiver, marks the first continuous band scan of an O-rich circumstellar envelope, and the most sensitive survey to date of IRC +10216. In VY CMa, 130 distinct molecular lines were detected, 14 of which cannot be identified; in IRC +10216, 717 lines were observed, with 126 features remaining unidentified. In the 1 mm bands of VY CMa and IRC +10216, emission is present from 18 and 32 different chemical compounds, respectively, with 10 species common to both sources. Many narrow emission lines were observed in both circumstellar shells, arising from vibrationally excited molecules and from refractory-containing species. Line profiles in VY CMa also exhibit a variety of different shapes, caused by the complex, asymmetric outflow of this object. The survey highlights the fact that C-rich and O-rich circumstellar envelopes are chemically interesting, and both are sources of new interstellar molecules. The high number of unidentified lines and the unreliable rest frequencies for known species such as NaCN indicate the need for additional laboratory spectroscopy studies.

  3. MAPPING THE LINEARLY POLARIZED SPECTRAL LINE EMISSION AROUND THE EVOLVED STAR IRC+10216

    Energy Technology Data Exchange (ETDEWEB)

    Girart, J. M. [Institut de Ciencies de l' Espai, (CSIC-IEEC), Campus UAB, Facultat de Ciencies, C5p 2, 08193 Bellaterra, Catalunya (Spain); Patel, N. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Vlemmings, W. H. T. [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE-439 92 Onsala (Sweden); Rao, Ramprasad, E-mail: girart@ice.cat [Submillimeter Array, Academia Sinica Institute of Astronomy and Astrophysics, 645 N. Aohoku Place, Hilo, HI 96720 (United States)

    2012-05-20

    We present spectro-polarimetric observations of several molecular lines obtained with the Submillimeter Array toward the carbon-rich asymptotic giant branch star IRC+10216. We have detected and mapped the linear polarization of the CO 3-2, SiS 19-18, and CS 7-6 lines. The polarization arises at a distance of {approx_equal} 450 AU from the star and is blueshifted with respect to the Stokes I. The SiS 19-18 polarization pattern appears to be consistent with a locally radial magnetic field configuration. However, the CO 3-2 and CS 7-6 line polarization suggests an overall complex magnetic field morphology within the envelope. This work demonstrates the feasibility of using spectro-polarimetric observations to carry out tomographic imaging of the magnetic field in circumstellar envelopes.

  4. Benchmarking of the advanced hygrothermal model-hygIRC with mid scale experiments

    Energy Technology Data Exchange (ETDEWEB)

    Maref, W.; Lacasse, M.; Kumaran, K.; Swinton, M.C. [National Research Council of Canada, Ottawa, ON (Canada). Inst. for Research in Construction

    2002-07-01

    An experimental study has been conducted to benchmark an advanced hygrothermal model entitled hygIRC which can be used to estimate the drying response of oriented strand board (OSB) used in timber-frame construction. Three specimens of OSB boards were immersed in water for 5 days and then allowed to stabilise in a sealed tank. A comparison of results from the computer model simulations to those obtained from experimental tests and laboratory measurements showed good agreement in terms of the shape of the drying curve and time taken to reach equilibrium moisture content. In general, it was determined that the drying process is controlled by the vapour permeability of the membrane. The higher the vapour permeability, the faster the rate of drying in a given condition. 11 refs., 1 tab., 9 figs.

  5. A Search for Phosphine in Circumstellar Envelopes: PH3 in IRC +10216 and CRL 2688?

    Science.gov (United States)

    Tenenbaum, E. D.; Ziurys, L. M.

    2008-06-01

    We present the results of a search for the JK = 10→ 00 transition of PH3 (phosphine) at 267 GHz toward several circumstellar envelopes using the Arizona Radio Observatory 10 m Submillimeter Telescope (SMT). In the carbon-rich shells of IRC +10216 and CRL 2688, we have detected emission lines exactly at the PH3 frequency. Toward the oxygen-rich supergiant VY Canis Majoris, only an upper limit was obtained, while in the evolved carbon-rich proto-planetary nebula CRL 618, the transition is contaminated by vibrationally excited HC3N (ν7 = 4). The line shape in IRC +10216 appears to consist of two distinct components: a flat-topped profile with a width of ~28 km s-1, as is typical for this source, and a narrower feature approximately 4 km s-1 wide. The narrow component likely arises from the inner envelope (r < 8R*) where the gas has not reached the terminal expansion velocity, or it is nonthermal emission. Based on the broader component, the abundance of PH3 with respect to H2 is estimated to be 5 × 10-8 in a region with a radius of r < 150R*. If the narrower component is thermal, it implies a phosphine abundance of ~5 × 10-7 close to the stellar photosphere (r < 8R*). In CRL 2688, the PH3 abundance is less constrained, with plausible values ranging from 3 × 10-8 to 4 × 10-7, assuming a spherical distribution. Phosphine appears to be present in large concentrations in the inner envelope of C-rich AGB stars, and thus may function as a parent molecule for other phosphorus species.

  6. Separation of holmium (III) from aqueous chloride medium by Amberlite IRC748

    International Nuclear Information System (INIS)

    Vijayalakshmi, R.; Anitha, M.; Singh, D.K.; Chakravartty, J.K.

    2016-01-01

    High purity holmium finds applications in nuclear reactors as control rod, rare earth based magnetic alloys, lasers, medical applications, etc. Holmium belongs to the heavier group of rare earths and its content is very less (<0.5%) in Monazite mineral, hence its recovery from various potential sources becomes essential. Ion exchange technique is a well known method for effective separation, purification, recovery, and concentration of metal ions from lean aqueous solutions. It has also been widely used for separation and purification of rare earths. In the present investigation application of Amberlite IRC748, a chelating type of resin containing iminodiacetic acid functional group for separation of Ho(III) was explored. The effects of various parameters such as pH, contact time, weight of resin, initial metal concentration and temperature on the adsorption characteristics of Ho(III) were investigated in detail. The loading of Ho(III) ion onto resin increased with increasing the initial concentration. The adsorption was strongly dependent on pH of the medium with enhanced adsorption as the pH turned from 1 to 4. In the batch system, the Amberlite IRC748 resin exhibited the highest Ho(III) ion uptake as 180 mg/g at 298 K, at an initial pH value of 4. The adsorption data gave good fit with Langmuir isotherm which was better than the Freundlich curve. The thermodynamic parameters such as ΔH, ΔS and ΔG were evaluated from the temperature variation data. Negative value of ΔH (-11.5 kJ/mole), indicated that the adsorption of Ho(III) ion onto Amberlite resin was exothermic in nature. ΔS was found to be 5.52 J/mole/K. Kinetic study indicated that the adsorption data fitted the pseudo second order kinetic equation. (author)

  7. Students' Constitutional Right to a Sound Basic Education: New York State's Unfinished Agenda. Part 1. A Roadmap to Constitutional Compliance Ten Years after "CFE v. State"

    Science.gov (United States)

    Rebell, Michael A.; Wolff, Jessica R.

    2016-01-01

    Ten years have passed since New York's highest court ruled in the landmark school-funding and educational-rights case, "Campaign for Fiscal Equity (CFE) v. State of New York," that the state was violating students' constitutional right to the "opportunity for a sound basic education" and ordered significant reforms of the…

  8. Condition based maintenance of a 20 kV-PE/XLPE-insulated cable network using the IRC-Analysis; Zustandsorientierte Instandhaltung eines polymerisolierten 20-kV-Kabelnetzes mit der IRC-Analyse. Moderne Diagnostik reduziert Stoerungsrate

    Energy Technology Data Exchange (ETDEWEB)

    Hoff, G.; Kranz, H.G. [BUGH Wuppertal (Germany). Labs. fuer Hochspannungstechnik; Beigert, M.; Petzold, F. [Seba Dynatronic Mess- und Ortungstechnik GmbH, Baunach (Germany); Kneissl, C. [Bereich Konzeption und Messtechnik, Lech Elektrizitaetswerke AG, Augsburg (Germany)

    2001-10-22

    For a preventive maintenance of a polymer insulated cable network a destruction free estimation of the status of the buried PE/XLPE-cables is needed. This contribution presents a condition based maintenance concept which is based on the IRC-Analysis. With this concept a major German utility was able to reduce the amount of failures in a part of the 20kV-cable network. The general tendency of increasing faults was broken. (orig.) [German] Die praeventive Instandhaltung in polymerisolierten Kabelnetzen setzt eine zerstoerungsfreie Zustandbestimmung von gelegten PE/VPE-isolierten Kabeln voraus. Die-Verfasser beschreiben ein zustandsorientiertes Wartungskonzept auf Basis der IRC-Analyse, mit dem es gelungen ist, in einem Teil des 20-kV-Kabelnetzes eines Energieversorgers die in der Vergangenheit stetig steigende Stoerungsrate drastisch zu reduzieren. (orig.)

  9. The IRC7 gene encodes cysteine desulphydrase activity and confers on yeast the ability to grow on cysteine as a nitrogen source.

    Science.gov (United States)

    Santiago, Margarita; Gardner, Richard C

    2015-07-01

    Although cysteine desulphydrase activity has been purified and characterized from Saccharomyces cerevisiae, the gene encoding this activity in vivo has never been defined. We show that the full-length IRC7 gene, encoded by the YFR055W open reading frame, encodes a protein with cysteine desulphydrase activity. Irc7p purified to homogeneity is able to utilize l-cysteine as a substrate, producing pyruvate and hydrogen sulphide as products of the reaction. Purified Irc7p also utilized l-cystine and some other cysteine conjugates, but not l-cystathionine or l-methionine, as substrates. We further show that, in vivo, the IRC7 gene is both necessary and sufficient for yeast to grow on l-cysteine as a nitrogen source, and that overexpression of the gene results in increased H2 S production. Strains overexpressing IRC7 are also hypersensitive to a toxic analogue, S-ethyl-l-cysteine. While IRC7 has been identified as playing a critical role in converting cysteine conjugates to volatile thiols that are important in wine aroma, its biological role in yeast cells is likely to involve regulation of cysteine and redox homeostasis. Copyright © 2015 John Wiley & Sons, Ltd.

  10. Control system modernization of a turbo-gas unit of CFE in the Comarca Lagunera; Modernizacion del sistema de control de una unidad turbogas de la CFE en la Comarca Lagunera

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez P, Marino; De Lara J, Salvador; Hernandez Muniz, Alfredo [Industria SIGRAMA, Cuernavaca, Morelos (Mexico); Garcia Cabello, Raymundo [Comision Federal de Electricidad (Mexico)

    2004-07-01

    At the present time, the turbo-gas units (TGU) make an important contribution in the development and growth of the national power sector, since this type of units pertaining to the Comision Federal de Electricidad (CFE) contributes with the 6.23% of the national production, that is to say, 2600 MW approx. The turbo-gas units are aero-derivative gas turbines used for power generation, pumping and compression. Generally, they are used to support urgent requests in the demand of electricity or, for the permanent supply of electrical energy in isolated zones. In addition, they are used to quickly get into and get out of operation, which requires high availability, trustworthiness and flexibility. In this sense, and with the intention of improving the operation of the TGUs, the Gerencia de Control e Instrumentation (GCI) (Management of Control and Instrumentation) of the Instituto de Investigaciones Electricas (IIE), has developed a control technology for this type of units, able to replace the original control systems of units with even 30 years of continuous operation or to be installed in new units. [Spanish] En la actualidad, las unidades de turbogas (UTG) tienen una importante contribucion en el desarrollo y crecimiento del sector energetico nacional, pues este tipo de unidades pertenecientes a la Comision Federal de Electricidad (CFE) aportan el 6.23% de la produccion nacional, es decir, 2600 MW aproximadamente. Las unidades turbogas son turbinas de gas aeroderivativas empleadas para la generacion electrica, bombeo y compresion. Por lo general, son utilizadas para apoyar solicitudes urgentes en la demanda de electricidad o bien, para el suministro permanente de energia electrica en zonas aisladas. Ademas, se usan para entrar y salir rapidamente en operacion, lo que requiere alta disponibilidad, confiabilidad y flexibilidad. En este sentido, y con la intencion de mejorar las UTG, la Gerencia de Control e Instrumentacion (GCI) del Instituto de Investigaciones

  11. COMPARATIVE SPECTRA OF OXYGEN-RICH VERSUS CARBON-RICH CIRCUMSTELLAR SHELLS: VY CANIS MAJORIS AND IRC +10216 AT 215-285 GHz

    International Nuclear Information System (INIS)

    Tenenbaum, E. D.; Dodd, J. L.; Woolf, N. J.; Ziurys, L. M.; Milam, S. N.

    2010-01-01

    A sensitive (1σ rms at 1 MHz resolution ∼3 mK) 1 mm spectral line survey (214.5-285.5 GHz) of VY Canis Majoris (VY CMa) and IRC +10216 has been conducted to compare the chemistries of oxygen- and carbon-rich circumstellar envelopes. This study was carried out using the Submillimeter Telescope of the Arizona Radio Observatory with a new Atacama Large Millimeter Array type receiver. This survey is the first to chemically characterize an O-rich circumstellar shell at millimeter wavelengths. In VY CMa, 128 emission features were detected arising from 18 different molecules; and in IRC +10216, 720 lines were observed, assigned to 32 different species. The 1 mm spectrum of VY CMa is dominated by SO 2 and SiS; in IRC +10216, C 4 H and SiC 2 are the most recurrent species. Ten molecules were common to both sources: CO, SiS, SiO, CS, CN, HCN, HNC, NaCl, PN, and HCO + . Sulfur plays an important role in VY CMa, but saturated/unsaturated carbon dominates the molecular content of IRC +10216, producing CH 2 NH, for example. Although the molecular complexity of IRC +10216 is greater, VY CMa supports a unique 'inorganic' chemistry leading to the oxides PO, AlO, and AlOH. Only diatomic and triatomic compounds were observed in VY CMa, while species with four or more atoms are common in IRC +10216, reflecting carbon's ability to form multiple strong bonds, unlike oxygen. In VY CMa, a new water maser (v 2 = 2) has been found, as well as vibrationally excited NaCl. Toward IRC +10216, vibrationally excited CCH was detected for the first time.

  12. Comparative Spectra of Oxygen-rich Versus Carbon-rich Circumstellar Shells: VY Canis Majoris and IRC +10216 at 215-285 GHz

    Science.gov (United States)

    Tenenbaum, E. D.; Dodd, J. L.; Milam, S. N.; Woolf, N. J.; Ziurys, L. M.

    2010-09-01

    A sensitive (1σ rms at 1 MHz resolution ~3 mK) 1 mm spectral line survey (214.5-285.5 GHz) of VY Canis Majoris (VY CMa) and IRC +10216 has been conducted to compare the chemistries of oxygen- and carbon-rich circumstellar envelopes. This study was carried out using the Submillimeter Telescope of the Arizona Radio Observatory with a new Atacama Large Millimeter Array type receiver. This survey is the first to chemically characterize an O-rich circumstellar shell at millimeter wavelengths. In VY CMa, 128 emission features were detected arising from 18 different molecules; and in IRC +10216, 720 lines were observed, assigned to 32 different species. The 1 mm spectrum of VY CMa is dominated by SO2 and SiS; in IRC +10216, C4H and SiC2 are the most recurrent species. Ten molecules were common to both sources: CO, SiS, SiO, CS, CN, HCN, HNC, NaCl, PN, and HCO+. Sulfur plays an important role in VY CMa, but saturated/unsaturated carbon dominates the molecular content of IRC +10216, producing CH2NH, for example. Although the molecular complexity of IRC +10216 is greater, VY CMa supports a unique "inorganic" chemistry leading to the oxides PO, AlO, and AlOH. Only diatomic and triatomic compounds were observed in VY CMa, while species with four or more atoms are common in IRC +10216, reflecting carbon's ability to form multiple strong bonds, unlike oxygen. In VY CMa, a new water maser (v 2 = 2) has been found, as well as vibrationally excited NaCl. Toward IRC +10216, vibrationally excited CCH was detected for the first time.

  13. Comparative Spectra of Oxygen-Rich Versus Carbon-Rich Circumstellar Shells: VY Canis Majoris and IRC(plus)10216 at 215-285 GHz

    Science.gov (United States)

    Tenebaum, E. D.; Dodd, J. L.; Milam, S. N.; Woolf, N. J.; Ziurys, L. M.

    2010-01-01

    A sensitive (1sigma rms at 1 MHz resolution approx.3 mK) 1 mm spectral line survey (214.5-285.5 GHz) of VY Canis Majoris (VY CMa) and IRC +10216 has been conducted to compare the chemistries of oxygen- and carbon-rich circumstellar envelopes. This study was carried out using the Submillimeter Telescope of the Arizona Radio Observatory with a new Atacama Large Millimeter Array type receiver. This survey is the first to chemically characterize an O-rich circumstellar shell at millimeter wavelengths. In VY CMa, 128 emission features were detected arising from 18 different molecules; and in IRC +10216, 720 lines were observed, assigned to 32 different species. The 1 mm spectrum of VY CMa is dominated by SO, and SiS; in IRC +10216, C4H and SiC2 are the most recurrent species. Ten molecules were common to both sources: CO, SiS, SiO, CS, CN, HCN, HNC, NaCl, PN, and HCO(+). Sulfur plays an important role in VY CMa, but saturated/ unsaturated carbon dominates the molecular content of IRC +102.16, producing CH2NH, for example. Although the molecular complexity of IRC +10216 is greater, VY CMa supports a unique "inorganic" chemistry leading to the oxides PO, AlO, and AlOH. Only diatomic and triatomic compounds were observed in VY CMa, while species with four or more atoms are common in IRC +10216, reflecting carbon's ability to form multiple strong bonds, unlike oxygen. In VY CMa, a new water maser (v2 = 2) has been found, as well as vibrationally excited NaCl. Toward IRC +10216, vibrationally excited CCH was detected for the first time.

  14. Achieving the interfacial polarization on C/Fe3C heterojunction structures for highly efficient lightweight microwave absorption.

    Science.gov (United States)

    Zhang, Yanan; Liu, Wei; Quan, Bin; Ji, Guangbin; Ma, Jianna; Li, Daoran; Meng, Wei

    2017-12-15

    Design of dielectric/magnetic heterostructure and multiple interfaces is a challenge for the microwave absorption. Thus, in this study, a novel C/Fe 3 C nanocomposites have been fabricated by annealing the precursors obtained by the facile chemical blowing of polyvinyl pyrrolidone (PVP) and Fe(NO 3 ) 3 ·9H 2 O. By changing the content of Fe(NO 3 ) 3 ·9H 2 O, the honeycomb-like structure with scads of pores and electromagnetic parameters could be successfully tailored. When the addition of Fe(NO 3 ) 3 ·9H 2 O is ranging from 1 to 2g, honeycomb-structured nanocomposites possess high performance microwave absorption when mixed with 90wt% paraffin. The minimal reflection loss is -37.4dB at 13.6GHz and effective bandwidth can reach to 5.6GHz when the thickness is 2.0mm, indicating its great potential in microwave absorbing field. Its outstanding microwave performance is tightly related to the porous structure and substantial interface such as carbon/air and carbon/Fe 3 C, which are in favor of the impedance matching and interfacial polarization. Thus, our study may provide a good reference for the facile synthesis of light-weight carbon-based nanocomposites with effective interfacial polarization. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. Environmental Assessment for Central Power and Light Company`s proposed Military Highway-CFE tie 138/69-kV transmission line project Brownsville, Cameron County, Texas

    Energy Technology Data Exchange (ETDEWEB)

    1992-04-01

    Central Power and Light Company (CPL) intends to upgrade its existing transmission line ties with the Commision Federal de Electricidad (CFE) system in Mexico. CPL currently has a single 69-kilovolt (kV) transmission line in the Brownsville area which connects CPL`s system with the system of CFE. This existing line runs between the Brownsville Switching Station, located on Laredo Road in Brownsville, Cameron County, Texas, and an existing CFE 69-kV line at the Rusteberg Bend of the Rio Grande in Cameron County. Under current conditions of need, the existing 69-kV line does not possess sufficient capability to engage in appropriate power exchanges. Therefore, CPL is proposing to build a new line to link up with CFE. This proposed line would be a double-circuit line, which would (1) continue (on a slightly relocated route) the existing 69-kV tie from CPL`s Brownsville Switching Station to CFE`s facilities, and (2) add a 138-kV tie from the Military Highway Substation, located on Military Highway (US Highway 281), to CFE`s facilities. The proposed 138/69-kV line, which will be constructed and operated by CPL, will be built primarily on steel single-pole structures within an average 60-foot (ft) wide right-of-way (ROW). It will be approximately 6900--9200 ft (1.3--1.7 miles) in length, depending on the alternative route constructed.

  16. Basic semantic architecture of interoperability for the intelligent distribution in the CFE electrical system; Arquitectura base de interoperabilidad semantica para el sistema electrico de distribucion inteligente en la CFE

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa Reza, Alfredo; Garcia Mendoza, Raul; Borja Diaz, Jesus Fidel; Sierra Rodriguez, Benjamin [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2010-07-01

    The physical and logical architecture of the interoperability platform defined for the distribution management systems (DMS), of the Distribution Subdivision of Comision Federal de Electricidad (CFE) in Mexico is presented. The adopted architecture includes the definition of a technological platform to manage the exchange of information between systems and applications, sustained in the Model of Common Information (CIM), established in norms IEC61968 and IEC 61970. The architecture based on SSOA (Semantic Services Oriented Architecture), on EIB (Enterprise Integration Bus) and on GID (Generic Interface Definition) is presented, as well as the sequence to obtain the interoperability of systems related to the Distribution Management of the of electrical energy in Mexico. Of equal way it is described the process to establish a Semantic Model of the Electrical System of Distribution (SED) and the creation of instances CIM/XML, oriented to the interoperability of the information systems in the DMS scope, by means of the interchange of messages conformed and validated according to the structure obtained and agreed to the rules established by Model CIM. In this way, the messages and the information interchanged among systems, assure the compatibility and correct interpretation in an independent way to the developer, mark or manufacturer of the system source and destiny. The primary target is to establish the infrastructure semantic base of interoperability, cradle in standards that sustain the strategic definition of an Electrical System of Intelligent Distribution (SEDI) in Mexico. [Spanish] Se presenta la arquitectura fisica y logica de la plataforma de interoperabilidad definida para los sistemas de gestion de la distribucion (DMS por sus siglas en ingles), de la Subdireccion de Distribucion de la Comision Federal de Electricidad (CFE) en Mexico. La arquitectura adoptada incluye la definicion de una plataforma tecnologica para gestionar el intercambio de informacion

  17. High Spectral Resolution SOFIA/EXES Observations of C2H2 toward Orion IRc2

    Science.gov (United States)

    Rangwala, Naseem; Colgan, Sean W. J.; Le Gal, Romane; Acharyya, Kinsuk; Huang, Xinchuan; Lee, Timothy J.; Herbst, Eric; deWitt, Curtis; Richter, Matt; Boogert, Adwin; McKelvey, Mark

    2018-03-01

    We present high spectral resolution observations from 12.96 to 13.33 microns toward Orion IRc2 using the mid-infrared spectrograph, Echelon-Cross-Echelle Spectrograph (EXES), at Stratospheric Observatory for Infrared Astronomy (SOFIA). These observations probe the physical and chemical conditions of the Orion hot core, which is sampled by a bright, compact, mid-infrared background continuum source in the region, IRc2. All 10 of the rovibrational C2H2 transitions expected in our spectral coverage are detected with high signal-to-noise ratios (S/Ns), yielding continuous coverage of the R-branch lines from J = 9–8 to J = 18–17, including both ortho and para species. Eight of these rovibrational transitions are newly reported detections. The isotopologue, 13CCH2, is clearly detected with a high S/N. This enabled a direct measurement of the 12C/13C isotopic ratio for the Orion hot core of 14 ± 1 and an estimated maximum value of 21. We also detected several HCN rovibrational lines. The ortho and para C2H2 ladders are clearly separate, and tracing two different temperatures, 226 K and 164 K, respectively, with a non-equilibrium ortho to para ratio (OPR) of 1.7 ± 0.1. Additionally, the ortho and para V LSR values differ by about 1.8 ± 0.2 km s‑1, while the mean line widths differ by 0.7 ± 0.2 km s‑1, suggesting that these species are not uniformly mixed along the line of sight to IRc2. We propose that the abnormally low C2H2 OPR could be a remnant from an earlier, colder phase, before the density enhancement (now the hot core) was impacted by shocks generated from an explosive event 500 years ago.

  18. Recent nuclear technology advances of GE-H and GNF in partnership with CFE's Laguna Verde 2

    International Nuclear Information System (INIS)

    Cuevas V, G.; Iwamoto, T.; Banfield, J.; Calleros M, G.

    2015-09-01

    This paper is presented based on work stemming from the long-standing technical partnership between Comision Federal de Electricidad (CFE) and Global Nuclear Fuel - Americas LLC (GNF), and this paper's purpose is to provide valuable information for the nuclear industry. First, a one-to-one comparison of measurements from Gamma Thermometers (G Ts) installed in Laguna Verde 2 (LV-2) core against axially corresponding Traverse In-core Probe (Tip) measurements is remarkably close. This longest running G T plant validation for the Economic Simplified Boiling Water Reactor (ESBWR) power monitoring devices is also proving that the devices have the potential to simplify power measurements in Boiling Water Reactors (BWRs). Second, code validation results show remarkable reduction of radial power uncertainty with respect to current technology when new GNF codes for three-dimensional core simulations are compared to Tip power measurements. The LV-2 core is of paramount importance for BWR data analysis since the core has been loaded from the start of operation with different GNF fuel bundle types, fuel management has been designed with GNF codes and on-line core monitoring has been performed with GNF's 3-Dimensional Monicore system. This validation is also reliable since gamma Tips are used for local power measurements rather than thermal neutron Tips, which are more sensitive to local turbulence and positional changes. A nuclear/thermal-hydraulic core simulation of GNF fuel is undertaken from the beginning of operation of LV-2 (cycle 1) through the range of different power scenarios including low power, original licensed thermal power, power up rate and extended power up rate. Results confirm the conclusions from previous validations in different BWRs and support GNF efforts for licensing the new generation of nuclear engineering codes. (Author)

  19. Recent nuclear technology advances of GE-H and GNF in partnership with CFE's Laguna Verde 2

    Energy Technology Data Exchange (ETDEWEB)

    Cuevas V, G.; Iwamoto, T.; Banfield, J. [GE-Hitachi Nuclear Energy Americas LLC, Global Nuclear Fuel - Americas LLC, 3901 Castle Hayne Road, Wilmington, 28401 North Carolina (United States); Calleros M, G., E-mail: Gabriel.Cuevas-Vivas@age.com [Comision Federal de Electricidad, Central Nucleoelectrica de Laguna Verde, Carretera Veracruz-Nautla Km 42.5, Alto Lucero, Veracruz (Mexico)

    2015-09-15

    This paper is presented based on work stemming from the long-standing technical partnership between Comision Federal de Electricidad (CFE) and Global Nuclear Fuel - Americas LLC (GNF), and this paper's purpose is to provide valuable information for the nuclear industry. First, a one-to-one comparison of measurements from Gamma Thermometers (G Ts) installed in Laguna Verde 2 (LV-2) core against axially corresponding Traverse In-core Probe (Tip) measurements is remarkably close. This longest running G T plant validation for the Economic Simplified Boiling Water Reactor (ESBWR) power monitoring devices is also proving that the devices have the potential to simplify power measurements in Boiling Water Reactors (BWRs). Second, code validation results show remarkable reduction of radial power uncertainty with respect to current technology when new GNF codes for three-dimensional core simulations are compared to Tip power measurements. The LV-2 core is of paramount importance for BWR data analysis since the core has been loaded from the start of operation with different GNF fuel bundle types, fuel management has been designed with GNF codes and on-line core monitoring has been performed with GNF's 3-Dimensional Monicore system. This validation is also reliable since gamma Tips are used for local power measurements rather than thermal neutron Tips, which are more sensitive to local turbulence and positional changes. A nuclear/thermal-hydraulic core simulation of GNF fuel is undertaken from the beginning of operation of LV-2 (cycle 1) through the range of different power scenarios including low power, original licensed thermal power, power up rate and extended power up rate. Results confirm the conclusions from previous validations in different BWRs and support GNF efforts for licensing the new generation of nuclear engineering codes. (Author)

  20. Mid-Infrared Interferometry on Spectral Lines. II. Continuum (Dust) Emission Around IRC +10216 and VY Canis Majoris

    Science.gov (United States)

    Monnier, J. D.; Danchi, W. C.; Hale, D. S.; Lipman, E. A.; Tuthill, P. G.; Townes, C. H.

    2000-11-01

    The University of California Berkeley Infrared Spatial Interferometer has measured the mid-infrared visibilities of the carbon star IRC +10216 and the red supergiant VY CMa. The dust shells around these sources have been previously shown to be time variable, and these new data are used to probe the evolution of the dust shells on a decade timescale, complementing contemporaneous studies at other wavelengths. Self-consistent, spherically symmetric models at maximum and minimum light both show the inner radius of the IRC +10216 dust shell to be much larger (150 mas) than expected from the dust-condensation temperature, implying that dust production has slowed or stopped in recent years. Apparently, dust does not form every pulsational cycle (638 days), and these mid-infrared results are consistent with recent near-infrared imaging, which indicates little or no new dust production in the last 3 yr. Spherically symmetric models failed to fit recent VY CMa data, implying that emission from the inner dust shell is highly asymmetric and/or time variable.

  1. Mid-Infrared Interferometry on Spectral Lines. III. Ammonia and Silane around IRC +10216 and VY Canis Majoris

    Science.gov (United States)

    Monnier, J. D.; Danchi, W. C.; Hale, D. S.; Tuthill, P. G.; Townes, C. H.

    2000-11-01

    Using the University of California Berkeley Infrared Spatial Interferometer with a radio frequency (RF) filter bank, the first interferometric observations of mid-infrared molecular absorption features of ammonia (NH3) and silane (SiH4) with very high spectral resolution (λ/Δλ~105) were made. Under the assumptions of spherical symmetry and uniform outflow, these new data permitted the molecular stratification around carbon star IRC +10216 and red supergiant VY CMa to be investigated. For IRC +10216, both ammonia and silane were found to form in the dusty outflow significantly beyond both the dust formation and gas acceleration zones. Specifically, ammonia was found to form before silane in a region of decaying gas turbulence (>~20R*), while the silane is produced in a region of relatively smooth gas flow much farther from the star (>~80R*). The depletion of gas-phase SiS onto grains soon after dust formation may fuel silane-producing reactions on the grain surfaces. For VY CMa, a combination of interferometric and spectral observations suggest that NH3 is forming near the termination of the gas acceleration phase in a region of high gas turbulence (~40R*).

  2. IRC +10 216 in 3D: morphology of a TP-AGB star envelope

    Science.gov (United States)

    Guélin, M.; Patel, N. A.; Bremer, M.; Cernicharo, J.; Castro-Carrizo, A.; Pety, J.; Fonfría, J. P.; Agúndez, M.; Santander-García, M.; Quintana-Lacaci, G.; Velilla Prieto, L.; Blundell, R.; Thaddeus, P.

    2018-02-01

    During their late pulsating phase, AGB stars expel most of their mass in the form of massive dusty envelopes, an event that largely controls the composition of interstellar matter. The envelopes, however, are distant and opaque to visible and NIR radiation: their structure remains poorly known and the mass-loss process poorly understood. Millimeter-wave interferometry, which combines the advantages of longer wavelength, high angular resolution and very high spectral resolution is the optimal investigative tool for this purpose. Mm waves pass through dust with almost no attenuation. Their spectrum is rich in molecular lines and hosts the fundamental lines of the ubiquitous CO molecule, allowing a tomographic reconstruction of the envelope structure. The circumstellar envelope IRC +10 216 and its central star, the C-rich TP-AGB star closest to the Sun, are the best objects for such an investigation. Two years ago, we reported the first detailed study of the CO(2-1) line emission in that envelope, made with the IRAM 30-m telescope. It revealed a series of dense gas shells, expanding at a uniform radial velocity. The limited resolution of the telescope (HPBW 11″) did not allow us to resolve the shell structure. We now report much higher angular resolution observations of CO(2-1), CO(1-0), CN(2-1) and C4H(24-23) made with the SMA, PdB and ALMA interferometers (with synthesized half-power beamwidths of 3″, 1″ and 0.3″, respectively). Although the envelope appears much more intricate at high resolution than with an 11″ beam, its prevailing structure remains a pattern of thin, nearly concentric shells. The average separation between the brightest CO shells is 16″ in the outer envelope, where it appears remarkably constant. Closer to the star (system with a period of 700 yr and a near face-on elliptical orbit. The companion fly-by triggers enhanced episodes of mass loss near periastron. The densification of the shell pattern observed in the central part of the

  3. Higher English for CFE

    CERN Document Server

    Bridges, Ann; Mitchell, John

    2015-01-01

    A brand new edition of the former Higher English: Close Reading , completely revised and updated for the new Higher element (Reading for Understanding, Analysis and Evaluation) - worth 30% of marks in the final exam!. We are working with SQA to secure endorsement for this title. Written by two highly experienced authors this book shows you how to practice for the Reading for Understanding, Analysis and Evaluation section of the new Higher English exam. This book introduces the terms and concepts that lie behind success and offers guidance on the interpretation of questions and targeting answer

  4. Herschel/HIFI Observations of IRC+10216: Water Vapor in the Inner Envelope of a Carbon-rich Asymptotic Giant Branch Star

    NARCIS (Netherlands)

    Neufeld, D. A.; González-Alfonso, E.; Melnick, G.; Szczerba, R.; Schmidt, M.; Decin, L.; de Koter, A.; Schöier, F. L.; Cernicharo, J.

    2011-01-01

    We report the results of observations of 10 rotational transitions of water vapor toward the carbon-rich asymptotic giant branch (AGB) star IRC+10216 (CW Leonis), carried out with Herschel's HIFI instrument. Each transition was securely detected by means of observations using the dual beam switch

  5. Distribution of iron during full loading of amberlite IRC-72 resin with uranium from nitrate solutions at 300C

    International Nuclear Information System (INIS)

    Shaffer, J.H.; Greene, C.W.

    1979-01-01

    The integrity of resin-based fuel kernels used in the fabrication of fuel elements for a high-temperature gas-cooled reactor will depend, in part, on the concentration of iron incorporated in the resin particles during their loading with uranium. Consequently, assessment of chemical specifications for iron as an impurity in uranyl nitrate solution should be based on its distribution during the resin loading operation. For this purpose, the behavior of iron, as an impurity in uranyl nitrate solutions, was investigated under equilibrium conditions at 30 0 C during full loading of Amberlite IRC-72 cation exchange reaction were derived from calculations based on complex coordination of ferric ion with the resin over the nitrate ion concentration range of approx. 0.5 to 2 N

  6. The Influence of Volume, Temperature and Flow Rate on the of Separation Ru from IRC-50 Amberlite Resin

    International Nuclear Information System (INIS)

    Murdani Sumarsono; Djoko Widodo

    2002-01-01

    It was studied Ru elution of IRC-50 amberlite resin for separating, Ru of resin bonding. The resin bonding was ion exchange result of spent fuel uranyl nitrate. In this experiment, the eluent was used 6 N HNO 3 solution the adsorption of Ru was 20 ppm and then it was eluted with 6 N HNO 3 eluent. The objective of this experiment was to determine the operation condition of elution proses that was based on the value of Ru release from its bonding as much as possible. Based on the experiment, the relative good condition were resin volume = 205 ml, elution temperature = 85 o C and the flow rate of eluent = 2 ml 6 N HNO 3 / minute and Ru as result was 93 %. (author)

  7. Stator current harmonics evolution by neural network method based on CFE/SS algorithm for ACEC generator of Rey Power Plant

    International Nuclear Information System (INIS)

    Soleymani, S.; Ranjbar, A.M.; Mirabedini, H.

    2001-01-01

    One method for on-line fault diagnosis in synchronous generator is stator current harmonics analysis. Then artificial neural network is considered in this paper in order to evaluate stator current harmonics in different loads. Training set of artificial neural network is made ready by generator modeling, finite element method and state space model. Many points from generator capability curve are used in order to complete this set. Artificial neural network which is used in this paper is a percept ron network with a single hidden layer, Eight hidden neurons and back propagation algorithm. Results are indicated that the trained artificial neural network can identify stator current harmonics for arbitrary load from the capability curve. The error is less than 10% in comparison with values obtained directly from the CFE-SS algorithm. The rating parameters of modeled generator are 43950 (kV A), 11(KV), 3000 (rpm), 50 (H Z), (P F=0.8)

  8. HERSCHEL /HIFI OBSERVATIONS OF IRC+10216: WATER VAPOR IN THE INNER ENVELOPE OF A CARBON-RICH ASYMPTOTIC GIANT BRANCH STAR

    International Nuclear Information System (INIS)

    Neufeld, David A.; Gonzalez-Alfonso, Eduardo; Melnick, Gary J.; Szczerba, Ryszard; Schmidt, Miroslaw; Decin, Leen; De Koter, Alex; Schoeier, Fredrik; Cernicharo, Jose

    2011-01-01

    We report the results of observations of 10 rotational transitions of water vapor toward the carbon-rich asymptotic giant branch (AGB) star IRC+10216 (CW Leonis), carried out with Herschel's HIFI instrument. Each transition was securely detected by means of observations using the dual beam switch mode of HIFI. The measured line ratios imply that water vapor is present in the inner outflow at small distances (≤few x 10 14 cm) from the star, confirming recent results reported by Decin et al. from observations with Herschel's PACS and SPIRE instruments. This finding definitively rules out the hypothesis that the observed water results from the vaporization of small icy objects in circular orbits. The origin of water within the dense C-rich envelope of IRC+10216 remains poorly understood. We derive upper limits on the H 17 2 O/H 16 2 O and H 18 2 O/H 16 2 O isotopic abundance ratios of ∼5 x 10 -3 (3σ), providing additional constraints on models for the origin of the water vapor in IRC+10216.

  9. Development of an Electrochemical-Based Aspartate Aminotransferase Nanoparticle Ir-C Biosensor for Screening of Liver Diseases

    Directory of Open Access Journals (Sweden)

    Chung-Chiun Liu

    2012-05-01

    Full Text Available Aspartate aminotransaminase (AST is a hepatocelluar enzyme released into the bloodstream when hepatic cells are damaged, resulting in elevated blood levels of AST. A single use, disposable biosensor prototype, composed of catalytic iridium nano-particles dispersed on carbon paste, was developed to detect enzymatically-produced H2O2 in AST-mediated reactions. This biosensor is capable of measuring AST levels in a phosphate buffer and undiluted human serum over the concentration range of 0 to 0.89 μg/mL AST concentration (corresponding to 0–250 UL−1 specific activity. The biosensor operates at relatively low oxidation potential (+0.3 volt (V versus the printed Ag/AgCl, minimizing any potential chemical interference in human serum. The measurements of AST in human serum using the biosensor compared well with those measured by standard hospital spectrophotometric assays. This Ir-C biosensor may be useful for AST measurements in the clinical environment.

  10. Probing Hypergiant Mass Loss with Adaptive Optics Imaging and Polarimetry in the Infrared: MMT-Pol and LMIRCam Observations of IRC +10420 and VY Canis Majoris

    Science.gov (United States)

    Shenoy, Dinesh P.; Jones, Terry J.; Packham, Chris; Lopez-Rodriguez, Enrique

    2015-07-01

    We present 2-5 μm adaptive optics (AO) imaging and polarimetry of the famous hypergiant stars IRC +10420 and VY Canis Majoris. The imaging polarimetry of IRC +10420 with MMT-Pol at 2.2 μ {m} resolves nebular emission with intrinsic polarization of 30%, with a high surface brightness indicating optically thick scattering. The relatively uniform distribution of this polarized emission both radially and azimuthally around the star confirms previous studies that place the scattering dust largely in the plane of the sky. Using constraints on scattered light consistent with the polarimetry at 2.2 μ {m}, extrapolation to wavelengths in the 3-5 μm band predicts a scattered light component significantly below the nebular flux that is observed in our Large Binocular Telescope/LMIRCam 3-5 μm AO imaging. Under the assumption this excess emission is thermal, we find a color temperature of ˜500 K is required, well in excess of the emissivity-modified equilibrium temperature for typical astrophysical dust. The nebular features of VY CMa are found to be highly polarized (up to 60%) at 1.3 μm, again with optically thick scattering required to reproduce the observed surface brightness. This star’s peculiar nebular feature dubbed the “Southwest Clump” is clearly detected in the 3.1 μm polarimetry as well, which, unlike IRC +10420, is consistent with scattered light alone. The high intrinsic polarizations of both hypergiants’ nebulae are compatible with optically thick scattering for typical dust around evolved dusty stars, where the depolarizing effect of multiple scatters is mitigated by the grains’ low albedos. Observations reported here were obtained at the MMT Observatory, a joint facility of the Smithsonian Institution and the University of Arizona.

  11. SEARCHING FOR COOL DUST IN THE MID-TO-FAR INFRARED: THE MASS-LOSS HISTORIES OF THE HYPERGIANTS μ Cep, VY CMa, IRC+10420, AND ρ Cas

    Energy Technology Data Exchange (ETDEWEB)

    Shenoy, Dinesh; Humphreys, Roberta M.; Jones, Terry J.; Gehrz, Robert D. [Minnesota Institute for Astrophysics, School of Physics and Astronomy, University of Minnesota, 116 Church Street, SE, Minneapolis, MN 55455 (United States); Marengo, Massimo [Department of Physics, Iowa State University, Ames, IA 50011 (United States); Helton, L. Andrew [USRA-SOFIA Science Center, NASA Ames Research Center, Moffett Field, CA 94035 (United States); Hoffmann, William F.; Skemer, Andrew J.; Hinz, Philip M., E-mail: shenoy@astro.umn.edu [Department of Astronomy/Steward Observatory, University of Arizona, 933N. Cherry Avenue, Tucson, AZ 85721 (United States)

    2016-03-15

    We present mid- and far-IR imaging of four famous hypergiant stars: the red supergiants μ Cep and VY CMa, and the warm hypergiants IRC +10420 and ρ Cas. Our 11–37 μm SOFIA/FORCAST imaging probes cool dust not detected in visual and near-IR imaging studies. Adaptive optics 8–12 μm imaging of μ Cep and IRC +10420 with MMT/MIRAC reveals extended envelopes that are the likely sources of these stars’ strong silicate emission features. We find μ Cep’s mass-loss rate to have declined by about a factor of five over a 13,000 year history, ranging from 5 × 10{sup −6} down to ∼1× 10{sup −6} M{sub ⊙} yr{sup −1}. The morphology of VY CMa indicates a cooler dust component coincident with the highly asymmetric reflection nebulae seen in the visual and near-IR. The lack of cold dust at greater distances around VY CMa indicates that its mass-loss history is limited to the last ∼1200 years, with an average rate of 6 × 10{sup −4} M{sub ⊙} yr{sup −1}. We find two distinct periods in the mass-loss history of IRC +10420 with a high rate of 2 × 10{sup −3} M{sub ⊙} yr{sup −1} until approximately 2000 years ago, followed by an order of magnitude decrease in the recent past. We interpret this change as evidence of its evolution beyond the RSG stage. Our new infrared photometry of ρ Cas is consistent with emission from the expanding dust shell ejected in its 1946 eruption, with no evidence of newer dust formation from its more recent events.

  12. Effect of plasma spraying parameter on wear resistance of NiCrBSiCFe plasma coatings on austenitic stainless steel at elevated temperatures at various loads

    International Nuclear Information System (INIS)

    Parthasarathi, N.L.; Duraiselvam, Muthukannan; Borah, Utpal

    2012-01-01

    Highlights: ► Effect of plasma spraying parameters, especially the stand-off distance. ► Effect of microstructure and applied load on coating in sliding wear. ► The reason for maximum wear rate at 250 °C and the minimum wear at 350 °C were explained. ► The worn debris were characterised by SEM analysis and correlated with wear rate. -- Abstract: The dry sliding wear tests were carried out on AISI 316 austenitic stainless steel (ASS) plasma coated with NiCrBSiCFe alloy powder under two set of plasma spraying parameters (PSP-1 and PSP-2). EN 8 medium carbon steel was used as a counterface material. The tests were carried out at loads of 20 N and 40 N with a constant sliding velocity of 1 m/s at room temperature (35°), 150 °C, 250 °C and 350 °C. Metallographic characterisation was carried out by optical microscope (OM), scanning electron microscope (SEM) and X-ray diffraction (XRD). Between the two plasma parameters tested, stand-off distance of 125 mm was found to be more suitable for producing uniform lamellar microstructure with fewer amounts of pores which shows better wear resistance. The wear rate at 250 °C was comparatively more due to the material softening and adhesion by intermolecular bonding. The worn debris collected during sliding at 350 °C turn into oxides which further behaves like a protective and lubricative film eliminating the chances of severe material loss. SEM was used to characterise the worn track and debris to identity the wear mechanism.

  13. A Study of Hypergiant Mass Loss in the Near-To-Mid Infrared: VY CMa, IRC +10420, mu Cep and rho Cas

    Science.gov (United States)

    Shenoy, Dinesh Prabhakar

    2016-01-01

    Stars of initial mass greater than 9 M_sun become red supergiants (RSGs), a short-lived stage during which they experience mass-loss that strongly influences their post-RSG evolution and end state. The highest luminosity RSGs, referred to here as hypergiants, experience episodic mass-loss whose mechanism remains poorly understood and motivates observations to help constrain it. This thesis studies mass loss from hypergiant stars with near-to-mid infrared imaging over a range of angular scales. The recent mass-loss history of the extreme red supergiant VY Canis Majoris and the warm hypergiant star IRC +10420 are studied at the sub-arcsecond scale with adaptive optics imaging and imaging polarimetry from 1 - 5 micron using LMIRCam on the Large Binocular Telescope (LBT) and MMT-Pol at the MMT Observatory. The nebular features of VY CMa are found to be highly polarized at 1.3 and 3.1 micron, with optically thick scattering required to reproduce the observed surface brightness. The flux of VY CMa's peculiar ``Southwest Clump'' is demonstrated to be due almost entirely to optically thick scattering, with little thermal emission, and with a lower limit mass of 5E-03 M_sun in this single feature. The imaging polarimetry of IRC +10420 at 2.2 micron resolves nebular emission with intrinsic polarization of 30%, with a high surface brightness indicating optically thick scattering largely in the plane of the sky. Using the polarimetry to constrain the scattered light emission, it is shown that the nebula's the emission is mostly thermal with a color temperature well above that for typical astrophysical dust. To probe further into hypergiants' history of mass-loss, mid-IR imaging with MMT/ MIRAC and SOFIA/FORCAST is used to study VY CMa, IRC +10420 and two additional hypergiants: the RSG mu Cep and the warm hypergiant rho Cas. Using DUSTY 1-D radiative transfer models, mu Cep's mass-loss rate is found to have declined by about a factor of 5 over a 13,000 history, ranging from 5E

  14. AKARI/IRC source catalogues and source counts for the IRAC Dark Field, ELAIS North and the AKARI Deep Field South

    Science.gov (United States)

    Davidge, H.; Serjeant, S.; Pearson, C.; Matsuhara, H.; Wada, T.; Dryer, B.; Barrufet, L.

    2017-12-01

    We present the first detailed analysis of three extragalactic fields (IRAC Dark Field, ELAIS-N1, ADF-S) observed by the infrared satellite, AKARI, using an optimized data analysis toolkit specifically for the processing of extragalactic point sources. The InfaRed Camera (IRC) on AKARI complements the Spitzer Space Telescope via its comprehensive coverage between 8-24 μm filling the gap between the Spitzer/IRAC and MIPS instruments. Source counts in the AKARI bands at 3.2, 4.1, 7, 11, 15 and 18 μm are presented. At near-infrared wavelengths, our source counts are consistent with counts made in other AKARI fields and in general with Spitzer/IRAC (except at 3.2 μm where our counts lie above). In the mid-infrared (11 - 18 μm), we find our counts are consistent with both previous surveys by AKARI and the Spitzer peak-up imaging survey with the InfraRed Spectrograph (IRS). Using our counts to constrain contemporary evolutionary models, we find that although the models and counts are in agreement at mid-infrared wavelengths there are inconsistencies at wavelengths shortward of 7 μm, suggesting either a problem with stellar subtraction or indicating the need for refinement of the stellar population models. We have also investigated the AKARI/IRC filters, and find an active galactic nucleus selection criteria out to z < 2 on the basis of AKARI 4.1, 11, 15 and 18 μm colours.

  15. Three-phase shots and monopolar reclose in the core network of 400 kV of the Area de Control Occidental of CFE and Its normal probability of occurrence; Disparos trifasicos y de recierre monopolar en la red troncal de 400 kV del area de control occidental, CFE, y su probabilidad normal de ocurrencia

    Energy Technology Data Exchange (ETDEWEB)

    Narvaez Perez, Camilo; Garcia Conejo, Dante Aristoteles [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)]. E-mail: camilo.narvaez@cfe.gob.mx; camilo.narvaez@univa.mx; Ramirez Peredo, Patricia [Universidad de Guadalajara, Guadalajara, Jalisco (Mexico)]. E-mail: patyrape@hotmail.com; Blanco Gomez, Cesar Eduardo [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)

    2013-03-15

    The growing power demand of users, who make loads of power systems, causes the components of such systems operating near its operating limits. And the transmission line, being the most common component in these, requires a thorough analysis in regard to the probability of three-phase shots and monopolars reclosing, considering thunderstorms, the demand system time, the flows circulating in lines, maintenance on other lines and other imponderantes. This research analyzes the normal probability of occurrence of shots in the 400 kV core network of the Area de Control Occidental, CFE and its impact on studies conducted prior to the maintenance. We intend to use the methodology in the Comision Federal de Electricidad and results can be validated with data from previous years, based on a pseudo shots forecast in a given period. [Spanish] La creciente demanda de energia electrica de los usuarios que componen las cargas de los sistemas electricos de potencia, provoca que los componentes de dichos sistemas funcionen cerca de sus limites operativos. Y la linea de transmision, al ser el componente mas comun en estos, requiere de un analisis minucioso en lo que respecta a la probabilidad de disparos trifasicos y recierres monopolares, considerando tormentas electricas, la demanda horaria del sistema, los flujos que circulan en las lineas, los mantenimientos en las demas lineas y demas imponderantes. En esta investigacion se analiza la probabilidad normal de ocurrencia de disparos en la red troncal de 400 kV del Area de Control Occidental y su impacto en los estudios que se realizan previos a los mantenimientos. Se pretende utilizar la metodologia en la Comision Federal de Electricidad, y los resultados pueden ser validados con datos de los anos anteriores, ya que se hace un pseudo pronostico de disparos en un periodo dado.

  16. DISCOVERY OF TIME VARIATION OF THE INTENSITY OF MOLECULAR LINES IN IRC+10216 IN THE SUBMILLIMETER AND FAR-INFRARED DOMAINS

    Energy Technology Data Exchange (ETDEWEB)

    Cernicharo, J.; Quintana-Lacaci, G.; Agúndez, M.; Velilla-Prieto, L. [Group of Molecular Astrophysics, ICMM, CSIC, C/Sor Juana Inés de La Cruz N3, E-28049 Madrid (Spain); Teyssier, D.; García-Lario, P. [ESA, ESAC, P.O. Box 78, Villanueva de la Cañada, E-28691 Madrid (Spain); Daniel, F. [Univ. Grenoble Alpes, IPAG, F-38000 Grenoble (France); Decin, L. [Instituut voor Sterrenkunde, Katholieke Universiteit Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Guélin, M. [Institut de Radioastronomie Millimétrique, 300 rue de la Piscine, F-38406 St-Martin d' Hères (France); Encrenaz, P. [LERMA, Observatoire de Paris, 61 Av. de l' Observatoire, F-75014 Paris (France); De Beck, E. [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE 439 92 Onsala (Sweden); Barlow, M. J. [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom); Groenewegen, M. A. T. [Koninklijke Sterrenwacht van België, Ringlaan 3, B-1180 Brussels (Belgium); Neufeld, D. [Department of Physics and Astronomy, Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218 (United States); Pearson, J. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States)

    2014-11-20

    We report on the discovery of strong intensity variations in the high rotational lines of abundant molecular species toward the archetypical circumstellar envelope of IRC+10216. The observations have been carried out with the Heterodyne Instrument for the Far-Infrared (HIFI) instrument on board Herschel and with the IRAM30 m telescope. They cover several observing periods spreading over three years. The line intensity variations for molecules produced in the external layers of the envelope most likely result from time variations in the infrared pumping rates. We analyze the main implications this discovery has on the interpretation of molecular line emission in the envelopes of Mira-type stars. Radiative transfer calculations must take into account both the time variability of infrared pumping and the possible variation of the dust and gas temperatures with stellar phase in order to reproduce the observation of molecular lines at different epochs. The effect of gas temperature variations with stellar phase could be particularly important for lines produced in the innermost regions of the envelope. Each layer of the circumstellar envelope sees the stellar light radiation with a different lag time (phase). Our results show that this effect must be included in the models. The submillimeter and far infrared lines of asymptotic giant branch stars can no longer be considered as safe intensity calibrators.

  17. Removal of Ca(II) and Mg(II) from potassium chromate solution on Amberlite IRC 748 synthetic resin by ion exchange

    International Nuclear Information System (INIS)

    Yu Zhihui; Qi Tao; Qu Jingkui; Wang Lina; Chu Jinglong

    2009-01-01

    Experimental measurements have been made on the batch ion exchange of Ca(II) and Mg(II) from potassium chromate solution using cation exchanger of Amberlite IRC 748 as K + form. The ion exchange behavior of two alkaline-earth metals on the resin, depending on contact time, pH, temperature and resin dosage was studied. The adsorption isotherms were described by means of the Langmuir and Freundlich isotherms. For Ca(II) ion, the Langmuir model represented the adsorption process better than the Freundlich model. The maximum ion exchange capacity was found to be 47.21 mg g -1 for Ca(II) and 27.70 mg g -1 for Mg(II). The kinetic data were tested using Lagergren-first-order and pseudo-second-order kinetic models. Kinetic data correlated well with the pseudo-second-order kinetic model, indicating that the chemical adsorption was the rate-limiting step. Various thermodynamic parameters such as Gibbs free energy (ΔG o ), enthalpy (ΔH o ) and entropy (ΔS o ) were also calculated. These parameters showed that the ion exchange of Ca(II) and Mg(II) from potassium chromate solution was feasible, spontaneous and endothermic process in nature. The activation energy of ion-exchange (E a ) was determined as 12.34 kJ mol -1 for Ca(II) and 9.865 kJ mol -1 for Mg(II) according to the Arrhenius equation.

  18. HERSCHEL/HIFI SEARCH FOR H{sub 2}{sup 17}O AND H{sub 2}{sup 18}O IN IRC+10216: CONSTRAINTS ON MODELS FOR THE ORIGIN OF WATER VAPOR

    Energy Technology Data Exchange (ETDEWEB)

    Neufeld, David A. [Department of Physics and Astronomy, Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218 (United States); Tolls, Volker; Melnick, Gary J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Agundez, Marcelino [LAB, Universite de Bordeaux, UMR 5804, F-33270 Floirac (France); Gonzalez-Alfonso, Eduardo [Universidad de Alcala de Henares, Departamento de Fisica y Matematicas, Campus Universitario, E-28871 Alcala de Henares, Madrid (Spain); Decin, Leen [Instituut voor Sterrenkunde, Katholieke Universiteit Leuven, Celestijnenlaan 200D, 3001 Leuven (Belgium); Daniel, Fabien; Cernicharo, Jose [Departamento de Astrofisica, Centro de Astrobiologia, CSIC-INTA, Ctra. de Torrejon a Ajalvir km 4, E-28850 Madrid (Spain); Schmidt, Miroslaw; Szczerba, Ryszard [Nicolaus Copernicus Astronomical Center, Polish Academy of Sciences, Rabianska 8, 87-100 Torun (Poland)

    2013-04-10

    We report the results of a sensitive search for the minor isotopologues of water, H{sub 2}{sup 17}O and H{sub 2}{sup 18}O, toward the carbon-rich asymptotic giant branch star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H{sub 2}{sup 17}O and H{sub 2}{sup 18}O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H{sub 2}{sup 17}O/H{sub 2}{sup 16}O abundance ratio. Given the isotopic {sup 17}O/{sup 16}O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H{sub 2}{sup 17}O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H{sub 2}O production. In the context of the clumpy photodissociation model proposed previously for the origin of water in IRC+10216, our limit implies that {sup 12}C{sup 16}O (not {sup 13}C{sup 16}O or SiO) must be the dominant source of {sup 16}O for H{sub 2}O production, and that the effects of self-shielding can only have reduced the {sup 12}C{sup 16}O photodissociation rate by at most a factor {approx}2.

  19. Dicty_cDB: CFE631 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XXXXXCAATAATTCAANANAAATCATCAGTTTTAGTATCAACAGTTATATTTTTT ATAGGNTTATTTANGTGGNCATTAATTGAANANATTTTACATANATTTGNAT...CATCAGTTTTAGTATCAACAGTTATATTTTTT ATAGGNTTATTTANGTGGNCATTAATTGAANANATTTTACATANATTTGNATTTCATTTG GANACATCATCANA

  20. Dicty_cDB: CFE259 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *fqstssrcfl*ndcrei*fnk r*nr*ilw*isrisr*--- ---**r*ryscssrl*ekcql*kppfkpngkisaanasqisdgasavllvsgrlvkklgl kprarivtctvvgsdpeymllgpipatik...aleksgltkdqidlyeineafasvvlgwkke lnidldkinpnggaiahghplgatgcilmtkmvnelersnkkyalqtmcig

  1. Dicty_cDB: CFE102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yslnvqldpivyqvkakepststf*vlkksfqilklts*pkvkkf hsqfh*nhtlihhllmmvihtiqlafhfkdsiemn...ivyqvkakepststf*vlkksfqilklts*pkvkkf hsqfh*nhtlihhllmmvihtiqlafhfkdsiemn Frame C: neknniifnsttciiiw*n*itfiye

  2. Dicty_cDB: CFE281 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KICPQWPARNHATAL RAGTVSFYLSPKMTSDAPADPSQDVFFQNSIHSSPFGN--- ---CLSSKGKRTLNINILGLKEIISKYSSXPLNQR*knstlnfirtix*fiiy**w*fiq yn*rstskxsiem...tlnfirtix*fiiy**w*fiq yn*rstskxsiemnsspxnsxwl Homology vs CSM-cDNA Score E Sequen

  3. Signals of Speech Communication in Writing on IRC and ICQ

    OpenAIRE

    Ivas, Ivan; Žaja, Lana

    2003-01-01

    New technologies may, and for the most part do, change human communication and in the long run human society. Computer communication is no exception in this respect. Persons communicating by computer try to make the most of its advantages, trying at the same time to overcome its constraints to the highest possible degree. One of the drawbacks of communicating by computer is the physical absence of the interlocutor and the actual communication setting, and thus of an enormous...

  4. Comision Federal de Electricdad (CFE)`s corporate pilot data store; Desarrollo piloto del almacen de datos corporativos de la Comision Federal de Electricidad (CFE)

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez Sustaeta, Jorge; Rodriguez Ortiz, Guillermo; Jacome Grajales, Norma Elena; Perez Ramirez, Miguel [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1999-12-31

    The objective of a data store is to permit the access to organizational or corporate data, to offer congruent data, to permit the separation or combination of data from the enterprise`s different points of view, to supply tools for interrogating, to analyze and present information quickly and to feed the re-engineering criteria of the enterprise. In this paper a project is described with two main objectives: first, to develop a pilot version of the corporate data store, considering data coming from diverse operational systems in the electric generation process, such as: SISTERMO (managing indexes of thermoelectric power generation), SISHIDRO (managing indexes for hydroelectric generation) and CB (fuel costs); and second, train its personnel in the development of methodologies and techniques of data storing, in order to prepare them to achieve the project with their own resources [Espanol] Los objetivos de un almacen de datos son permitir el acceso a datos organizacionales o corporativos, brindar datos congruentes, permitir separar o combinar datos desde los diversos puntos de vista de la empresa, proporcionar herramientas para interrogar, analizar y presentar informacion agilmente y alimentar los criterios de reingenieria de la empresa. En este articulo se describe un proyecto con dos objetivos principales: primero, desarrollar una version piloto del almacen de datos corporativos, considerando datos provenientes de diversos sistemas operacionales en el proceso de generacion de energia electrica, tales como: SISTERMO (indices de gestion de generacion termoelectrica), SISHIDRO (indices de gestion de generacion hidroelectrica) y CB (costos de combustible); y segundo, capacitar a su personal en las metodologias y tecnicas de desarrollo de almacenes de datos, con el fin de prepararlos para la consecucion del proyecto con sus propios recursos

  5. Comision Federal de Electricdad (CFE)`s corporate pilot data store; Desarrollo piloto del almacen de datos corporativos de la Comision Federal de Electricidad (CFE)

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez Sustaeta, Jorge; Rodriguez Ortiz, Guillermo; Jacome Grajales, Norma Elena; Perez Ramirez, Miguel [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1998-12-31

    The objective of a data store is to permit the access to organizational or corporate data, to offer congruent data, to permit the separation or combination of data from the enterprise`s different points of view, to supply tools for interrogating, to analyze and present information quickly and to feed the re-engineering criteria of the enterprise. In this paper a project is described with two main objectives: first, to develop a pilot version of the corporate data store, considering data coming from diverse operational systems in the electric generation process, such as: SISTERMO (managing indexes of thermoelectric power generation), SISHIDRO (managing indexes for hydroelectric generation) and CB (fuel costs); and second, train its personnel in the development of methodologies and techniques of data storing, in order to prepare them to achieve the project with their own resources [Espanol] Los objetivos de un almacen de datos son permitir el acceso a datos organizacionales o corporativos, brindar datos congruentes, permitir separar o combinar datos desde los diversos puntos de vista de la empresa, proporcionar herramientas para interrogar, analizar y presentar informacion agilmente y alimentar los criterios de reingenieria de la empresa. En este articulo se describe un proyecto con dos objetivos principales: primero, desarrollar una version piloto del almacen de datos corporativos, considerando datos provenientes de diversos sistemas operacionales en el proceso de generacion de energia electrica, tales como: SISTERMO (indices de gestion de generacion termoelectrica), SISHIDRO (indices de gestion de generacion hidroelectrica) y CB (costos de combustible); y segundo, capacitar a su personal en las metodologias y tecnicas de desarrollo de almacenes de datos, con el fin de prepararlos para la consecucion del proyecto con sus propios recursos

  6. Feasibility of the operation CFE`s conventional power plants for industrial cogeneration; Factibilidad de operar las centrales termoelectricas convencionales de la CFE para cogeneracion industrial

    Energy Technology Data Exchange (ETDEWEB)

    Buendia Dominguez, Eduardo H.; Acosta Torres, Rosa Aracely [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1997-12-31

    An analysis is made on how cogeneration could help to maximize the power plant performance since thanks to cogeneration this type of power plants could utilize a part of the waste energy to be supplied to other processes. Also mention is made of the utilization of computer programs to help the design and the realization of functioning tests of this type of power plants. An economic evaluation is presented on the feasibility of operating this type of power plants as cogeneration units and it is concluded that the operation of fossil power plants in the cogeneration mode is not affected by the site where the power plant is located [Espanol] Se analiza como la cogeneracion podria ayudar a maximizar el rendimiento de las centrales termoelectricas ya que gracias a la cogeneracion este tipo de centrales podrian utilizar una parte de la energia desechada para suministrarla a otros procesos. Tambien se menciona la utilizacion de programas de computo para auxiliar en el diseno o realizacion de pruebas de funcionamiento sobre este tipo de plantas. Se presenta una evaluacion economica sobre la factibilidad de operar este tipo de plantas como unidades de cogeneracion y se concluye en que la operacion de centrales termoelectricas en modo de cogeneracion no se ve afectado por el sitio donde se encuentra la central

  7. Feasibility of the operation CFE`s conventional power plants for industrial cogeneration; Factibilidad de operar las centrales termoelectricas convencionales de la CFE para cogeneracion industrial

    Energy Technology Data Exchange (ETDEWEB)

    Buendia Dominguez, Eduardo H; Acosta Torres, Rosa Aracely [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1998-12-31

    An analysis is made on how cogeneration could help to maximize the power plant performance since thanks to cogeneration this type of power plants could utilize a part of the waste energy to be supplied to other processes. Also mention is made of the utilization of computer programs to help the design and the realization of functioning tests of this type of power plants. An economic evaluation is presented on the feasibility of operating this type of power plants as cogeneration units and it is concluded that the operation of fossil power plants in the cogeneration mode is not affected by the site where the power plant is located [Espanol] Se analiza como la cogeneracion podria ayudar a maximizar el rendimiento de las centrales termoelectricas ya que gracias a la cogeneracion este tipo de centrales podrian utilizar una parte de la energia desechada para suministrarla a otros procesos. Tambien se menciona la utilizacion de programas de computo para auxiliar en el diseno o realizacion de pruebas de funcionamiento sobre este tipo de plantas. Se presenta una evaluacion economica sobre la factibilidad de operar este tipo de plantas como unidades de cogeneracion y se concluye en que la operacion de centrales termoelectricas en modo de cogeneracion no se ve afectado por el sitio donde se encuentra la central

  8. EL CLIMA ORGANIZACIONAL EN UNA EMPRESA DE CLASE MUNDIAL (CFE ZONA CENTRO OCCIDENTE DE MEXICO)

    OpenAIRE

    Valenzo Jimenez, Marco Alberto; Martinez Arroyo, Jaime Apolinar; Pedraza Rendonrroyo, Oscar Hugo

    2010-01-01

    This present study is a field investigation conducted by the Department of Economic and Administrative Research Technological of Instituto Tecnolуgico de Morelia (ITM) and the Institute of Economic and Business Research (ININNE) belonging to the Universidad Michoacana de San Nicolбs de Hidalgo, designed to determine the organizational environment of the parastatal responsible for the generation, transmission, distribution and marketing of electricity in Mexico, called Comisiуn Federal d...

  9. Electron microscopic study of spontaneous and experimentally induced leukemia in IRC mice

    International Nuclear Information System (INIS)

    Hiraki, S.; Ranadive, K.J.; Dmochowski, L.

    1974-01-01

    Spontaneous, serially transplanted, and experimentally induced leukemias of ICRC mice were studied by electron microscopy in an attempt to detect the presence of virus particles, if any, and to observe the influence of chemical and hormonal treatment on the presence of these virus particles. The first series of experiments included spontaneous, serially transplanted, and radiation-induced leukemia. The paucity of type C virus particles was quite conspicuous in spontaneous leukemia. Serially transplanted and radiation-accelerated leukemic lesions showed the presence of some type C and intracisternal type A particles. Found in two of these leukemic lesions (thymus and lymphosarcoma), in addition to type C virus particles, were budding and some mature type B virus particles, and numerous intracytoplasmic type A particles. ''Viropexis'' of type B virus particles has been observed in the lymphosarcoma and in a leukemic thymus gland. The second series of experiments included leukemia induced in ovariectomized ICRC mice with 20-methylcholanthrene (MCA), pituitary transplants, and ovarian hormones (estradiol and estradiol-progesterone). In ovariectomized ICRC mice, leukemic lesions induced by MCA or pituitary transplants, or by MCA and pituitary transplants, showed type C virus particles and, in most cases, intracisternal type A particles. In leukemia induced in ovariectomized ICRC mice by MCA and estradiol, numerous intracytoplasmic type A particles were observed but no type C virus particles

  10. Evaluating the experiences with an Information and Referral Center (IRC) following a large air crash disaster.

    NARCIS (Netherlands)

    Brake, H. te; Dückers, M.L.; Drogendijk, A.N.

    2017-01-01

    Study/Objective: To evaluate the use of, and experiences with a ‘one-stop-shop’ website for information and referral for bereaved people following an air crash disaster. Background: On July 17, 2014 the disaster of Flight MH17 (Malaysia Airlines) took place above Eastern Ukraine. None of the 298

  11. Synthesis and characterization of magnetic poly(divinyl benzene)/Fe3O4, C/Fe3O4/Fe, and C/Fe onionlike fullerene micrometer-sized particles with a narrow size distribution.

    Science.gov (United States)

    Snovski, Ron; Grinblat, Judith; Margel, Shlomo

    2011-09-06

    Magnetic poly(divinyl benzene)/Fe(3)O(4) microspheres with a narrow size distribution were produced by entrapping the iron pentacarbonyl precursor within the pores of uniform porous poly(divinyl benzene) microspheres prepared in our laboratory, followed by the decomposition in a sealed cell of the entrapped Fe(CO)(5) particles at 300 °C under an inert atmosphere. Magnetic onionlike fullerene microspheres with a narrow size distribution were produced by annealing the obtained PDVB/Fe(3)O(4) particles at 500, 600, 800, and 1100 °C, respectively, under an inert atmosphere. The formation of carbon graphitic layers at low temperatures such as 500 °C is unique and probably obtained because of the presence of the magnetic iron nanoparticles. The annealing temperature allowed control of the composition, size, size distribution, crystallinity, porosity, and magnetic properties of the produced magnetic microspheres. © 2011 American Chemical Society

  12. The Center for Excellence in Disaster Management and Humanitarian Assistance (CFE-DMHA): An Assessment of Roles and Missions

    Science.gov (United States)

    2016-01-01

    components include facilities and services (e.g., classroom conditions and food and beverage ), instructor quality (e.g., presenters set a positive...Stephanie Pezard, David E. Thaler, Beth Grill, Ariel Klein, Sean Robson The Center for Excellence in Disaster Management and Humanitarian...has to play in humanitarian assis- tance and disaster relief, congressional legislation established the Center for Excellence in Disaster Management

  13. Fabricating Ir/C Nanofiber Networks as Free-Standing Air Cathodes for Rechargeable Li-CO2 Batteries.

    Science.gov (United States)

    Wang, Chengyi; Zhang, Qinming; Zhang, Xin; Wang, Xin-Gai; Xie, Zhaojun; Zhou, Zhen

    2018-06-07

    Li-CO 2 batteries are promising energy storage systems by utilizing CO 2 at the same time, though there are still some critical barriers before its practical applications such as high charging overpotential and poor cycling stability. In this work, iridium/carbon nanofibers (Ir/CNFs) are prepared via electrospinning and subsequent heat treatment, and are used as cathode catalysts for rechargeable Li-CO 2 batteries. Benefitting from the unique porous network structure and the high activity of ultrasmall Ir nanoparticles, Ir/CNFs exhibit excellent CO 2 reduction and evolution activities. The Li-CO 2 batteries present extremely large discharge capacity, high coulombic efficiency, and long cycling life. Moreover, free-standing Ir/CNF films are used directly as air cathodes to assemble Li-CO 2 batteries, which show high energy density and ultralong operation time, demonstrating great potential for practical applications. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Dealing with the state, the market and NGOs : the impact of institutions on the constitution and performance of Community Forest Enterprises (CFE) in the lowlands of Bolivia

    NARCIS (Netherlands)

    Benneker, C.E.B.

    2008-01-01

    The overall objective of this research was to determine whether and how the institutional environment
    influences the establishment and performance of Community Forest Enterprises (CFEs) in Bolivia.
    This study defines CFEs as organizations that: (1) manage collectively owned forests in

  15. Yolk-Shelled C@Fe3 O4 Nanoboxes as Efficient Sulfur Hosts for High-Performance Lithium-Sulfur Batteries.

    Science.gov (United States)

    He, Jiarui; Luo, Liu; Chen, Yuanfu; Manthiram, Arumugam

    2017-09-01

    Owing to the high theoretical specific capacity (1675 mA h g -1 ) and low cost, lithium-sulfur (Li-S) batteries offer advantages for next-generation energy storage. However, the polysulfide dissolution and low electronic conductivity of sulfur cathodes limit the practical application of Li-S batteries. To address such issues, well-designed yolk-shelled carbon@Fe 3 O 4 (YSC@Fe 3 O 4 ) nanoboxes as highly efficient sulfur hosts for Li-S batteries are reported here. With both physical entrapment by carbon shells and strong chemical interaction with Fe 3 O 4 cores, this unique architecture immobilizes the active material and inhibits diffusion of the polysulfide intermediates. Moreover, due to their high conductivity, the carbon shells and the polar Fe 3 O 4 cores facilitate fast electron/ion transport and promote continuous reactivation of the active material during the charge/discharge process, resulting in improved electrochemical utilization and reversibility. With these merits, the S/YSC@Fe 3 O 4 cathodes support high sulfur content (80 wt%) and loading (5.5 mg cm -2 ) and deliver high specific capacity, excellent rate capacity, and long cycling stability. This work provides a new perspective to design a carbon/metal-oxide-based yolk-shelled framework as a high sulfur-loading host for advanced Li-S batteries with superior electrochemical properties. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  16. Electro-economic, environmental and social consequences in the efficient abatement of a hydroelectric plant (C. H. Santa Rosa, CFE-ACO); Consecuencias electro-economicas, ambientales y sociales del abatimiento eficiente de una central hidroelectrica (C. H. Santa Rosa, CFE-ACO)

    Energy Technology Data Exchange (ETDEWEB)

    Narvaez Perez, Camilo; Garcia Conejo, Dante Aristoteles [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)]. E-mail: camilo.narvaez@cfe.gob.mx; camilo.narvaez@univa.mx; Narvaez Perez, Claudia Universidad de Guadalajara, Zapopan, Jalisco [Mexico]). E-mail: claudia_narvaez@hotmail.com; Blanco Gomez, Cesar Eduardo [Comision Federal de Electricidad, Centro Nacional de Control de Energia, Area de Control Occidental, Zapopan, Jalisco (Mexico)

    2013-03-15

    Renewable energy systems, like hydroelectric generation system gives electric energy, in reliable economic, it takes care with environment, and growths the society, if the hydroelectric dam is suitably drained in non rainy season, if we consider, flow rate in its river, rain, thunderstorms and floods, dam's size, load shape per day, generators capacity unit and the flow in turbines, generating units maintenance and other necessities like irrigation crops in farms. In this research we propose a new methodology about hydroelectric dam drained in non rainy season. But in rainy season, you can consider this methodology with few changes and you would obtain satisfactory results. The methodology is used since 2010 in the Area de Control Occidental in the Comision Federal de Electricidad with results compared with data from previous years, in which different methodologies were applied. [Spanish] Los sistemas de energias renovables, como los complejos hidroelectricos impactan de manera electrica, economica, ambiental y social, siempre y cuando se realice adecuadamente el abatimiento de la presa en el estiaje, considerando, el aporte del cauce, las lluvias aun siendo escasas, el tamano del embalse, la demanda horaria de la carga abastecida, el tamano de los generadores y su gasto turbinado, los mantenimientos de las unidades, las necesidades hidraulicas aguas abajo y demas imponderantes. En esta investigacion se propone una metodologia de abatimiento de presas de centrales hidroelectricas en estiaje. Y para tiempo de lluvias se aplica la metodologia con variantes pequenas y con resultados satisfactorios. La metodologia es utilizada desde el 2010 en el Area de Control Occidental de la Comision Federal de Electricidad, con resultados comparados con los datos de los anos anteriores, en los cuales se aplicaron metodologias diversas.

  17. IrC2/Bf - A yeast and Borrelia responsive component of the complement system from the hard tick Ixodes ricinus

    Czech Academy of Sciences Publication Activity Database

    Urbanová, V.; Hajdušek, O.; Šíma, R.; Franta, Z.; Hönig Mondeková, Helena; Grunclová, L.; Bartošová-Sojková, P.; Jalovecká, M.; Kopáček, P.

    2018-01-01

    Roč. 76, FEB 2018 (2018), s. 86-94 ISSN 0145-305X Institutional support: RVO:61388971 Keywords : Borrelia * C3-complement convertase * Factor B Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.218, year: 2016

  18. The development of the Quality Indicator for Rehabilitative Care (QuIRC) : a measure of best practice for facilities for people with longer term mental health problems

    NARCIS (Netherlands)

    Killaspy, Helen; White, Sarah; Wright, Christine; Taylor, Tatiana L.; Turton, Penny; Schuetzwohl, Matthias; Schuster, Mirjam; Cervilla, Jorge A.; Brangier, Paulette; Raboch, Jiri; Kalisova, Lucie; Onchev, Georgi; Alexiev, Spiridon; Mezzina, Roberto; Ridente, Pina; Wiersma, Durk; Visser, Ellen; Kiejna, Andrzej; Adamowski, Tomasz; Ploumpidis, Dimitri; Gonidakis, Fragiskos; Caldas-de-Almeida, Jose; Cardoso, Graca; King, Michael B.

    2011-01-01

    Background: Despite the progress over recent decades in developing community mental health services internationally, many people still receive treatment and care in institutional settings. Those most likely to reside longest in these facilities have the most complex mental health problems and are at

  19. The development of the Quality Indicator for Rehabilitative Care (QuIRC: a measure of best practice for facilities for people with longer term mental health problems

    Directory of Open Access Journals (Sweden)

    Visser Ellen

    2011-03-01

    Full Text Available Abstract Background Despite the progress over recent decades in developing community mental health services internationally, many people still receive treatment and care in institutional settings. Those most likely to reside longest in these facilities have the most complex mental health problems and are at most risk of potential abuses of care and exploitation. This study aimed to develop an international, standardised toolkit to assess the quality of care in longer term hospital and community based mental health units, including the degree to which human rights, social inclusion and autonomy are promoted. Method The domains of care included in the toolkit were identified from a systematic literature review, international expert Delphi exercise, and review of care standards in ten European countries. The draft toolkit comprised 154 questions for unit managers. Inter-rater reliability was tested in 202 units across ten countries at different stages of deinstitutionalisation and development of community mental health services. Exploratory factor analysis was used to corroborate the allocation of items to domains. Feedback from those using the toolkit was collected about its usefulness and ease of completion. Results The toolkit had excellent inter-rater reliability and few items with narrow spread of response. Unit managers found the content highly relevant and were able to complete it in around 90 minutes. Minimal refinement was required and the final version comprised 145 questions assessing seven domains of care. Conclusions Triangulation of qualitative and quantitative evidence directed the development of a robust and comprehensive international quality assessment toolkit for units in highly variable socioeconomic and political contexts.

  20. DISCOVERY OF SiCSi IN IRC+10216: A MISSING LINK BETWEEN GAS AND DUST CARRIERS OF Si–C BONDS

    Energy Technology Data Exchange (ETDEWEB)

    Cernicharo, J.; Agúndez, M.; Prieto, L. Velilla; Quintana-Lacaci, G. [Group of Molecular Astrophysics, ICMM, CSIC, C/Sor Juana Inés de La Cruz N3, E-28049, Madrid (Spain); McCarthy, M. C.; Gottlieb, C. A.; Drumel, M. A. Martin-; Patel, N. A.; Reilly, N. J.; Young, K. H. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138, and School of Engineering and Applied Sciences, Harvard University, Cambridge, MA 02138 (United States); Baraban, J. H. [Department of Chemistry and Biochemistry, University of Colorado, Boulder, CO 80309 (United States); Changala, P. B. [JILA, National Institute of Standards and Technology and University of Colorado, and Department of Physics, University of Colorado, Boulder, CO 80309 (United States); Guélin, M. [Institut de Radioastronomie Millimétrique, 300 rue de la Piscine, F-38406 St-Martin d’Hères (France); Kahane, C. [Universit Grenoble Alpes, IPAG, F-38000 Grenoble (France); CNRS, IPAG, F-38000 Grenoble (France); Stanton, J. F. [Institute for Theoretical Chemistry, Department of Chemistry, The University of Texas at Austin, Austin, TX 78712 (United States); Thorwirth, S. [I. Physikalisches Institut, Universität zu Köln, Zülpicher Str. 77, D-50937 Köln (Germany)

    2015-06-10

    We report the discovery in space of a disilicon species, SiCSi, from observations between 80 and 350 GHz with the IRAM 30 m radio telescope. Owing to the close coordination between laboratory experiments and astrophysics, 112 lines have now been detected in the carbon-rich star CW Leo. The derived frequencies yield improved rotational and centrifugal distortion constants up to sixth order. From the line profiles and interferometric maps with the Submillimeter Array, the bulk of the SiCSi emission arises from a region of 6″ in radius. The derived abundance is comparable to that of SiC{sub 2}. As expected from chemical equilibrium calculations, SiCSi and SiC{sub 2} are the most abundant species harboring a Si−C bond in the dust formation zone and certainly both play a key role in the formation of SiC dust grains.

  1. Using Publish-Subscribe Messaging for System Status and Automation

    Science.gov (United States)

    Smith, Danford S.

    2015-01-01

    The NASA Goddard Mission Services Evolution Center (GMSEC) system is a message-based plug-and-play open system architecture used in many of NASA mission operations centers. This presentation will focus on the use of GMSEC standard messages to report and analyze the status of a system and enable the automation of the system's components. In GMSEC systems, each component reports its status using a keep-alive message and also publishes status and activities as log messages. In addition, the components can accept functional directive messages from the GMSEC message bus. Over the past several years, development teams have found ways to utilize these messages to create innovative display pages and increasingly sophisticated approaches to automation. This presentation will show the flexibility and value of the message-based approach to system awareness and automation.

  2. Conceptual Design and Analysis of Service Oriented Architecture (SOA) for Command and Control of Space Assets

    Science.gov (United States)

    2010-12-01

    organizational inertia (26) play a role here: o Distorted Perception  Myopia – According to organizational theory, the simplest source of induced myopia is... reality . Also complicating the presentation of these functions as services are the associated stringent performance requirements. These services...Reference Architecture Factsheet. GMSEC Home. [Online] March 2004. http://gmsec.gsfc.nasa.gov/factSheets/GMSECarch.ppt. 16. Virtual Mission Operations

  3. 77 FR 65747 - Self-Regulatory Organizations; CBOE Futures Exchange, LLC; Notice of Filing and Immediate...

    Science.gov (United States)

    2012-10-30

    ... money passes, CFE Rule 618 relating to accommodation trading, and CFE Rule 619 relating to front-running... orders for different accounts with common beneficial ownership that are entered with the intent to negate... Law. CFE Rule 619 regarding front running is proposed to provide that no Trading Privilege Holder nor...

  4. Construct Validity evidence for the Intercultural Readiness Check against the Multicultural Personality Questionnaire.

    NARCIS (Netherlands)

    Van der Zee, KI; Brinkmann, U

    The psychometric qualities of the intercultural readiness check (IRC) were evaluated against an existing instrument for multicultural effectiveness: the Multicultural Personality Questionnaire (MPQ). The IRC has scales for intercultural sensitivity, intercultural communication, intercultural

  5. Construct validity evidence for the intercultural readiness check against the multicultural personality questionnaire

    NARCIS (Netherlands)

    Van der Zee, K.I.; Brinkmann, Ursula

    The psychometric qualities of the intercultural readiness check (IRC) were evaluated against an existing instrument for multicultural effectiveness: the Multicultural Personality Questionnaire (MPQ). The IRC has scales for intercultural sensitivity, intercultural communication, intercultural

  6. Complejidad molecular en envolturas de estrellas evolucionadas: estudio detallado de la emisión molecular de los objetos IK Tau, OH231.8 + 4,2 e IRC + 10216

    OpenAIRE

    Velilla Prieto, Luis

    2017-01-01

    Las estrellas evolucionadas cuyas masas durante la secuencia principal estaban comprendidas aproximadamente entre 1 y 8 masas solares, como lo será nuestro Sol dentro de aproximadamente 4500 millones de años, son las principales responsables del enriquecimiento del medio interestelar. En la fase llamada rama asintótica de las gigantes, estas estrellas crean una envoltura a su alrededor que se forma debido a intensos procesos de pérdida de masa. Dichas envolturas están compuestas principalment...

  7. "Aprende a cuidar a tus riñones y ellos cuidaran de ti". Programa de educación para la salud dirigido a pacientes con Insuficiencia Renal Crónica (IRC)

    OpenAIRE

    Niso Andrade, Rebeca

    2016-01-01

    La Enfermedad renal crónica (ERC) es una enfermedad crónica que avanza progresivamente. Según la tasa de filtrado glomerular (TFG), se pueden diferenciar 5 estadios dentro de la enfermedad. En el estadio 5, ya es demasiado tarde para trabajar desde la prevención, ya que la TFG, y con ella la función renal, ha disminuido tanto que la supervivencia de los pacientes entra en juego y es necesario iniciar una terapia renal sustitutiva, diálisis o trasplante renal. Los estadios 3 y 4...

  8. Efficient rate control scheme using modified inter-layer dependency ...

    Indian Academy of Sciences (India)

    The IRC from the prior art is modified to achieve better rate control per layer by recursive updates for mean absolute difference values of eachbasic unit. Proposed modified inter-layer dependency shows improvement in the PSNR for enhancement layers while the updated IRC enforces better IRC for all the layers.

  9. Impact of stepwise ablation on the biatrial substrate in patients with persistent atrial fibrillation and heart failure.

    Science.gov (United States)

    Jones, David G; Haldar, Shouvik K; Jarman, Julian W E; Johar, Sofian; Hussain, Wajid; Markides, Vias; Wong, Tom

    2013-08-01

    Ablation of persistent atrial fibrillation can be challenging, often involving not only pulmonary vein isolation (PVI) but also additional linear lesions and ablation of complex fractionated electrograms (CFE). We examined the impact of stepwise ablation on a human model of advanced atrial substrate of persistent atrial fibrillation in heart failure. In 30 patients with persistent atrial fibrillation and left ventricular ejection fraction ≤35%, high-density CFE maps were recorded biatrially at baseline, in the left atrium (LA) after PVI and linear lesions (roof and mitral isthmus), and biatrially after LA CFE ablation. Surface area of CFE (mean cycle length ≤120 ms) remote to PVI and linear lesions, defined as CFE area, was reduced after PVI (18.3±12.03 to 10.2±7.1 cm(2); Patrial CFE area was reduced by LA ablation, from 25.9±14.1 to 12.9±11.8 cm(2) (Patrial CFE area. Reduction of CFE area at sites remote from ablation would suggest either regression of the advanced atrial substrate or that these CFE were functional phenomena. Nevertheless, in an advanced atrial fibrillation substrate, linear lesions after PVI diminished the target area for CFE ablation, and complete lesions resulted in a favorable clinical outcome.

  10. Antiobesogenic and Antiatherosclerotic Properties of Caralluma fimbriata Extract

    Directory of Open Access Journals (Sweden)

    Soundararajan Kamalakkannan

    2010-01-01

    Full Text Available There is evidence that the principles present in the widely consumed Indian food plant C. fimbriata extract (CFE suppress appetite, and provide antiobesogenic and metabolic benefits. The Diet-Induced Obesity (DIO rat model was used to investigate CFE's anorexigenic effects. Rats were randomly divided into three groups: (i untreated control (C, (ii control for cafeteria diet (CA, and (iii cafeteria diet fed + CFE treated. Rats in the test group received cafeteria diet and CFE from day one onwards. CFE was administered by gavage at three doses (25, 50, 100 mg/Kg BW per day for 90 days. The antiobesogenic effects of CFE were evaluated by monitoring changes in feed intake, body weight, serum lipid and hormonal (leptin profiles, fat pads, and liver weight. Antiatherosclerotic effects were measured by histology. CFE induced significant and dose-dependent inhibition of food intake, with dose-related prevention of gains in body weight, liver weight, and fat pad mass. Alterations in serum lipid profiles associated with weight gain were similarly inhibited, as were the typical increases in serum leptin levels. These data substantiate CFE's reported anorexigenic effects. CFE treatment also conferred protection against atherogenesis. We conclude that CFE possesses antiobesogenic and antiatherosclerotic properties.

  11. Study of carbide-forming element interlayers for diamond nucleation and growth on silicon and WC-Co substrates

    International Nuclear Information System (INIS)

    Tang, Y.; Li, Y.S.; Yang, Q.; Hirose, A.

    2010-01-01

    Diamond nucleation and growth on several typical carbide-forming elements (CFE) (Ti, Cr and W) coated Si and WC-Co substrates were studied. The ion beam sputtered CFE interlayers show an amorphous/nanocrystalline microstructure. The diamond formed on the CFE coated substrates shows higher nucleation density and rate and finer grain structure than on uncoated substrates. Consequently, nanocrystalline diamond thin films can be formed on the CFE coated substrates under conventional microcrystalline diamond growth conditions. Among the three tested CFE interlayers, diamond has the highest nucleation density and rate on W layer and the lowest on Ti layer. The diamond nucleation density and rate on CFE coated WC-Co are much higher than those on widely used metal nitride coated WC-Co.

  12. Highly conductive and flexible color filter electrode using multilayer film structure

    Science.gov (United States)

    Han, Jun Hee; Kim, Dong-Young; Kim, Dohong; Choi, Kyung Cheol

    2016-07-01

    In this paper, a high performance flexible component that serves as a color filter and an electrode simultaneously is suggested. The suggested highly conductive and flexible color filter electrode (CFE) has a multilayer film structure composed of silver (Ag) and tungsten trioxide (WO3). The CFE maintained its color filtering capability even when the films were bent on a polyethylene terephthalate (PET) film. Low sheet resistance of the CFE was obtained using WO3 as a bridge layer that connects two Ag layers electrically. The sheet resistance was less than 2 Ω/sq. and it was negligibly changed after bending the film, confirming the flexibility of the CFE. The CFE can be easily fabricated using a thermal evaporator and is easily patterned by photolithography or a shadow mask. The proposed CFE has enormous potential for applications involving optical devices including large area devices and flexible devices.

  13. Atmospheric electric discharges and grounding systems; Descargas atmosfericas y sistemas de conexion a tierra

    Energy Technology Data Exchange (ETDEWEB)

    Rivas, Elena [ed.] [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    1999-07-01

    In this article the work made by the Institute of Investigaciones Electricas (IIE), in the area of atmospheric electric discharges and grounding connections at Comision Federal de Electricidad (CFE) is presented. The work consisted of the revision of the procedures for the design of transmission lines and substations of CFE from which high indexes of interruptions are reported, from this, a program was defined that allowed to improve the existing designs in CFE. [Spanish] En este articulo se presenta el trabajo realizado por el Instituto de Investigaciones Electricas (IIE), en el area de descargas atmosfericas y conexiones a tierra en Comision Federal de Electricidad (CFE). El trabajo consistio en la revision de los procedimientos de diseno de las areas de transmision y subestaciones de la CFE para los que se reportan altos indices de salidas, a partir de esto se definio un programa que permitio mejorar los disenos existentes en la CFE.

  14. Foliar Application of Extract from an Azalomycin-Producing Streptomyces malaysiensis Strain MJM1968 Suppresses Yam Anthracnose Caused by Colletotrichum gloeosporioides.

    Science.gov (United States)

    Arunachalam Palaniyandi, Sasikumar; Yang, Seung Hwan; Suh, Joo-Woh

    2016-06-28

    Yam anthracnose caused by Colletotrichum gloeosporioides (C.g) is the most devastating disease of yam (Dioscorea sp.). In the present study, we evaluated the culture filtrate extract (CFE) of azalomycin-producing Streptomyces malaysiensis strain MJM1968 for the control of yam anthracnose. MJM1968 showed strong antagonistic activity against C.g in vitro. Furthermore, the MJM1968 CFE was tested for inhibition of spore germination in C.g, where it completely inhibited spore germination at a concentration of 50 μg/ml. To assess the in planta efficacy of the CFE and spores of MJM1968 against C.g, a detached leaf bioassay was conducted, which showed both the treatments suppressed anthracnose development on detached yam leaves. Furthermore, a greenhouse study was conducted to evaluate the CFE from MJM1968 as a fungicide for the control of yam anthracnose. The CFE non-treated plants showed a disease severity of >92% after 90 days of artificial inoculation with C.g, whereas the disease severity of CFE-treated and benomyl-treated yam plants was reduced to 26% and 15%, respectively, after 90 days. Analysis of the yam tubers from the CFE-treated and non-treated groups showed that tubers from the CFE-treated plants were larger than that of non-treated plants, which produced abnormal smaller tubers typical of anthracnose. This study demonstrated the utility of the CFE from S. malaysiensis strain MJM1968 as a biofungicide for the control of yam anthracnose.

  15. Analog implementation of an integral resonant control scheme

    International Nuclear Information System (INIS)

    Pereira, E; Moheimani, S O R; Aphale, S S

    2008-01-01

    Integral resonant control (IRC) has been introduced as a high performance controller design methodology for flexible structures with collocated actuator–sensor pairs. IRC has a simple structure and is capable of achieving significant damping, over several modes, while guaranteeing closed-loop stability of the system in the presence of unmodeled out-of-bandwidth dynamics. IRC can be an ideal controller for various industrial damping applications, if packaged in a simple easy-to-implement electronic module. This work proposes an analog implementation of the IRC scheme using a single Op-Amp circuit. The objective is to show that with simple analog realization of the modified IRC scheme, it is possible to damp a large number of vibration modes. A brief discussion about the modeling, circuit considerations, implementation and experimental results is presented in order to validate the usefulness and practicality of the proposed analog IRC implementation. (technical note)

  16. Transforming Our SMEX Organization by Way of Innovation, Standardization, and Automation

    Science.gov (United States)

    Madden, Maureen; Crouse, Pat; Carry, Everett; Esposito, timothy; Parker, Jeffrey; Bradley, David

    2006-01-01

    NASA's Small Explorer (SMEX) Flight Operations Team (FOT) is currently tackling the challenge of supporting ground operations for several satellites that have surpassed their designed lifetime and have a dwindling budget. At Goddard Space Flight Center (GSFC), these missions are presently being reengineered into a fleet-oriented ground system. When complete, this ground system will provide command and control of four SMEX missions, and will demonstrate fleet automation and control concepts as a pathfinder for additional mission integrations. A goal of this reengineering effort is to demonstrate new ground-system technologies that show promise of supporting longer mission lifecycles and simplifying component integration. In pursuit of this goal, the SMEX organization has had to examine standardization, innovation, and automation. A core technology being demonstrated in this effort is the GSFC Mission Services Evolution Center (GMSEC) architecture. The GMSEC architecture focuses on providing standard interfaces for ground system applications to promote application interoperability. Building around commercial Message Oriented Middleware and providing a common messaging standard allows GMSEC to provide the capabilities necessary to support integration of new software components into existing missions and increase the level of interaction within the system. For SMS, GMSEC has become the technology platform to transform flight operations with the innovation and automation necessary to reduce operational costs. The automation technologies supported in SMEX are built upon capabilities provided by the GMSEC architecture that allows the FOT to further reduce the involvement of the console, operator. Initially, SMEX is automating only routine operations, such as safety and health monitoring, basic commanding, and system recovery. The operational concepts being developed here will reduce the need for staffed passes and are a necessity for future fleet management. As this

  17. Technique of Substantiating Requirements for the Vision Systems of Industrial Robotic Complexes

    Directory of Open Access Journals (Sweden)

    V. Ya. Kolyuchkin

    2015-01-01

    Full Text Available In references, there is a lack of approaches to describe the justified technical requirements for the vision systems (VS of industrial robotics complexes (IRC. Therefore, an objective of the work is to develop a technique that allows substantiating requirements for the main quality indicators of VS, functioning as a part of the IRC.The proposed technique uses a model representation of VS, which, as a part of the IRC information system, sorts the objects in the work area, as well as measures their linear and angular coordinates. To solve the problem of statement there is a proposal to define the target function of a designed IRC as a dependence of the IRC indicator efficiency on the VS quality indicators. The paper proposes to use, as an indicator of the IRC efficiency, the probability of a lack of fault products when manufacturing. Based on the functions the VS perform as a part of the IRC information system, the accepted indicators of VS quality are as follows: a probability of the proper recognition of objects in the working IRC area, and confidential probabilities of measuring linear and angular orientation coordinates of objects with the specified values of permissible error. Specific values of these errors depend on the orientation errors of working bodies of manipulators that are a part of the IRC. The paper presents mathematical expressions that determine the functional dependence of the probability of a lack of fault products when manufacturing on the VS quality indicators and the probability of failures of IRC technological equipment.The offered technique for substantiating engineering requirements for the VS of IRC has novelty. The results obtained in this work can be useful for professionals involved in IRC VS development, and, in particular, in development of VS algorithms and software.

  18. Problems of Assessment in Religious and Moral Education: The Scottish Case

    Science.gov (United States)

    Grant, Lynne; Matemba, Yonah H.

    2013-01-01

    This article is concerned with assessment issues in Religious and Moral Education (RME) offered in Scottish non-denominational schools. The analysis of the findings in this article is weighed against the framework of the new "3-18" Scottish curriculum called "Curriculum for Excellence" (CfE). CfE was introduced in primary…

  19. The Development of Scotland's Curriculum for Excellence: Amnesia and Deja Vu

    Science.gov (United States)

    Priestley, Mark; Humes, Walter

    2010-01-01

    Scotland's new "Curriculum for Excellence" (CfE) has been widely acknowledged as the most significant educational development in a generation, with the potential to transform learning and teaching in Scottish schools. In common with recent developments elsewhere, CfE seeks to re-engage teachers with processes of curriculum development,…

  20. The inspirations with a radioactive intercomparison on a wine sample

    International Nuclear Information System (INIS)

    Su Qiong

    1993-12-01

    The methods used and results in a radioactive intercomparison on a wine sample are reported, which was organized by WHO-IRC in May, 1992. In order to analyse and compare the results obtained by all laboratories from WHO-IRC report (IRC NOTE No.41, 1993) are given. A re-measured new result about nuclide 40 K in the sample is also reported which coincides quite well with the result reported to IRC in a deviation of less than +-1%. And the problems concerning 'reference values' and standard sources etc. are also discussed

  1. Autonomous Closed-Loop Tasking, Acquisition, Processing, and Evaluation for Situational Awareness Feedback

    Science.gov (United States)

    Frye, Stuart; Mandl, Dan; Cappelaere, Pat

    2016-01-01

    This presentation describes the closed loop satellite autonomy methods used to connect users and the assets on Earth Orbiter- 1 (EO-1) and similar satellites. The base layer is a distributed architecture based on Goddard Mission Services Evolution Concept (GMSEC) thus each asset still under independent control. Situational awareness is provided by a middleware layer through common Application Programmer Interface (API) to GMSEC components developed at GSFC. Users setup their own tasking requests, receive views into immediate past acquisitions in their area of interest, and into future feasibilities for acquisition across all assets. Automated notifications via pubsub feeds are returned to users containing published links to image footprints, algorithm results, and full data sets. Theme-based algorithms are available on-demand for processing.

  2. Architectural Analysis of Systems Based on the Publisher-Subscriber Style

    Science.gov (United States)

    Ganesun, Dharmalingam; Lindvall, Mikael; Ruley, Lamont; Wiegand, Robert; Ly, Vuong; Tsui, Tina

    2010-01-01

    Architectural styles impose constraints on both the topology and the interaction behavior of involved parties. In this paper, we propose an approach for analyzing implemented systems based on the publisher-subscriber architectural style. From the style definition, we derive a set of reusable questions and show that some of them can be answered statically whereas others are best answered using dynamic analysis. The paper explains how the results of static analysis can be used to orchestrate dynamic analysis. The proposed method was successfully applied on the NASA's Goddard Mission Services Evolution Center (GMSEC) software product line. The results show that the GMSEC has a) a novel reusable vendor-independent middleware abstraction layer that allows the NASA's missions to configure the middleware of interest without changing the publishers' or subscribers' source code, and b) some high priority bugs due to behavioral discrepancies, which were eluded during testing and code reviews, among different implementations of the same APIs for different vendors.

  3. Lessons Learned from Engineering a Multi-Mission Satellite Operations Center

    Science.gov (United States)

    Madden, Maureen; Cary, Everett, Jr.; Esposito, Timothy; Parker, Jeffrey; Bradley, David

    2006-01-01

    NASA's Small Explorers (SMEX) satellites have surpassed their designed science-lifetimes and their flight operations teams are now facing the challenge of continuing operations with reduced funding. At present, these missions are being re-engineered into a fleet-oriented ground system at Goddard Space Flight Center (GSFC). When completed, this ground system will provide command and control of four SMEX missions and will demonstrate fleet automation and control concepts. As a path-finder for future mission consolidation efforts, this ground system will also demonstrate new ground-based technologies that show promise of supporting longer mission lifecycles and simplifying component integration. One of the core technologies being demonstrated in the SMEX Mission Operations Center is the GSFC Mission Services Evolution Center (GMSEC) architecture. The GMSEC architecture uses commercial Message Oriented Middleware with a common messaging standard to realize a higher level of component interoperability, allowing for interchangeable components in ground systems. Moreover, automation technologies utilizing the GMSEC architecture are being evaluated and implemented to provide extended lights-out operations. This mode of operation will provide routine monitoring and control of the heterogeneous spacecraft fleet. The operational concepts being developed will reduce the need for staffed contacts and is seen as a necessity for fleet management. This paper will describe the experiences of the integration team throughout the re-enginering effort of the SMEX ground system. Additionally, lessons learned will be presented based on the team's experiences with integrating multiple missions into a fleet-automated ground system.

  4. 76 FR 59719 - Notice of Regulatory Waiver Requests Granted for the Second Quarter of Calendar Year 2011

    Science.gov (United States)

    2011-09-27

    ... advance HUD program goals to develop viable, quality communities. The County erroneously conducted an... federal taxation under IRC Sec. 501(a). FHA has received several requests from nonprofit instrumentalities of government, whose income is excluded from federal taxation pursuant to IRC section 115, seeking...

  5. Quality of Longer Term Mental Health Facilities in Europe : Validation of the Quality Indicator for Rehabilitative Care against Service Users' Views

    NARCIS (Netherlands)

    Killaspy, Helen; White, Sarah; Wright, Christine; Taylor, Tatiana L.; Turton, Penny; Kallert, Thomas; Schuster, Mirjam; Cervilla, Jorge A.; Brangier, Paulette; Raboch, Jiri; Kalisova, Lucie; Onchev, Georgi; Alexiev, Spiridon; Mezzina, Roberto; Ridente, Pina; Wiersma, Durk; Visser, Ellen; Kiejna, Andrzej; Piotrowski, Patryk; Ploumpidis, Dimitris; Gonidakis, Fragiskos; Caldas-de-Almeida, Jose Miguel; Cardoso, Graca; King, Michael

    2012-01-01

    Background: The Quality Indicator for Rehabilitative Care (QuIRC) is a staff rated, international toolkit that assesses care in longer term hospital and community based mental health facilities. The QuIRC was developed from review of the international literature, an international Delphi exercise

  6. First Things First: Internet Relay Chat Openings.

    Science.gov (United States)

    Rintel, E. Sean; Mulholland, Joan; Pittam, Jeffery

    2001-01-01

    Argues that Internet Relay Chat (IRC) research needs to systematically address links between interaction structures, technological mediation and the instantiation and development of interpersonal relationships. Finds that openings that occur directly following user's entries into public IRC channels are often ambiguous, can disrupt relationship…

  7. Dissociated neural basis of two behavioral hallmarks of holistic face processing: The whole-part effect and composite-face effect.

    Science.gov (United States)

    Li, Jin; Huang, Lijie; Song, Yiying; Liu, Jia

    2017-07-28

    It has been long proposed that our extraordinary face recognition ability stems from holistic face processing. Two widely-used behavioral hallmarks of holistic face processing are the whole-part effect (WPE) and composite-face effect (CFE). However, it remains unknown whether these two effects reflect similar or different aspects of holistic face processing. Here we investigated this question by examining whether the WPE and CFE involved shared or distinct neural substrates in a large sample of participants (N=200). We found that the WPE and CFE showed hemispheric dissociation in the fusiform face area (FFA), that is, the WPE was correlated with face selectivity in the left FFA, while the CFE was correlated with face selectivity in the right FFA. Further, the correlation between the WPE and face selectivity was largely driven by the FFA response to faces, whereas the association between the CFE and face selectivity resulted from suppressed response to objects in the right FFA. Finally, we also observed dissociated correlation patterns of the WPE and CFE in other face-selective regions and across the whole brain. These results suggest that the WPE and CFE may reflect different aspects of holistic face processing, which shed new light on the behavioral dissociations of these two effects demonstrated in literature. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Impacto da insuficiência renal crônica na eficácia de stents farmacológicos: estudo de seguimento de longo prazo

    Directory of Open Access Journals (Sweden)

    Vitor Osório Gomes

    2011-05-01

    Full Text Available FUNDAMENTO: Pacientes com Insuficiência Renal Crônica (IRC submetidos à angioplastia coronária apresentam maiores taxas de revascularização da lesão alvo (RLA e mortalidade. Os stents farmacológicos (SF estão associados com taxas menores de reestenose, quando comparados aos stents não farmacológicos (SNF, embora em pacientes com IRC os dados da eficácia e segurança do SF sejam limitados. OBJETIVO: Buscamos avaliar a segurança e eficácia dos SF em pacientes com IRC significante, quando comparados a pacientes com função renal normal em um registro da "vida real". MÉTODOS: 504 pacientes submetidos à intervenção coronariana percutânea com SF em dois centros foram incluídos. Os desfechos foram estratificados baseados na presença de IRC, definida como taxa de filtração glomerular basal < 60 ml/min/1,73 m². RESULTADOS: O acompanhamento médio foi de 22,7 meses. A IRC estava presente em 165 pacientes (32,7%. Pacientes com IRC eram mais velhos, tinham mais hipertensão e diabete. Pacientes com IRC apresentaram maior incidência de morte (12,3% vs 2,4%, p < 0,001 e infarto do miocárdio (IM (7,4% vs 3,3%, p = 0,04, quando comparados aos pacientes sem IRC. Taxas de RLA foram similares entre os grupos (4.8% vs 5.6%, p = 0,7, pacientes com e sem IRC, respectivamente. Preditores independentes de morte foram a IRC (HR 6,93; 2,4 - 19,5, p < 0,001, tabagismo atual (HR 3,66; 1,20 - 11,10, p = 0,02 e diabete (HR 2,66; 1,3 - 6,60, p = 0,045. CONCLUSÃO: Neste registro, a intervenção coronariana com SF em pacientes com IRC foi associada com RLA similar comparada aos pacientes sem IRC, demonstrando a eficácia dos FS na prevenção da reestenose intra-stent nessa população de pacientes. A IRC foi relacionada a um aumento significativo das taxas de IM e mortalidade.

  9. Reproductive biology of Corymbia citriodora subsp. variegata and ...

    African Journals Online (AJOL)

    Reproductive biology of Corymbia citriodora subsp. variegata and effective pollination across its native range in Queensland, Australia. CFE Bacles, J Brooks, DJ Lee, PM Schenk, AJ Lowe, A Kremer ...

  10. Interacting effects of sunlight, agriculturally derived dissolved organic matter and reactive oxygen species on fecal indicator bacteria growth dynamics

    Science.gov (United States)

    Bacterial survival in agriculturally impacted surface waters is dependent on resource availability and also on potential resource transformations, mediated by biotic and abiotic processes. In this study, we focused on the effect of sunlight irradiated cattle fecal extract (CFE) a...

  11. Quality of longer term mental health facilities in Europe: validation of the quality indicator for rehabilitative care against service users' views.

    Directory of Open Access Journals (Sweden)

    Helen Killaspy

    Full Text Available BACKGROUND: The Quality Indicator for Rehabilitative Care (QuIRC is a staff rated, international toolkit that assesses care in longer term hospital and community based mental health facilities. The QuIRC was developed from review of the international literature, an international Delphi exercise with over 400 service users, practitioners, carers and advocates from ten European countries at different stages of deinstitutionalisation, and review of the care standards in these countries. It can be completed in under an hour by the facility manager and has robust content validity, acceptability and inter-rater reliability. In this study, we investigated the internal validity of the QuIRC. Our aim was to identify the QuIRC domains of care that independently predicted better service user experiences of care. METHOD: At least 20 units providing longer term care for adults with severe mental illness were recruited in each of ten European countries. Service users completed standardised measures of their experiences of care, quality of life, autonomy and the unit's therapeutic milieu. Unit managers completed the QuIRC. Multilevel modelling allowed analysis of associations between service user ratings as dependent variables with unit QuIRC domain ratings as independent variables. RESULTS: 1750/2495 (70% users and the managers of 213 units from across ten European countries participated. QuIRC ratings were positively associated with service users' autonomy and experiences of care. Associations between QuIRC ratings and service users' ratings of their quality of life and the unit's therapeutic milieu were explained by service user characteristics (age, diagnosis and functioning. A hypothetical 10% increase in QuIRC rating resulted in a clinically meaningful improvement in autonomy. CONCLUSIONS: Ratings of the quality of longer term mental health facilities made by service managers were positively associated with service users' autonomy and experiences of care

  12. Quality of longer term mental health facilities in Europe: validation of the quality indicator for rehabilitative care against service users' views.

    Science.gov (United States)

    Killaspy, Helen; White, Sarah; Wright, Christine; Taylor, Tatiana L; Turton, Penny; Kallert, Thomas; Schuster, Mirjam; Cervilla, Jorge A; Brangier, Paulette; Raboch, Jiri; Kalisova, Lucie; Onchev, Georgi; Alexiev, Spiridon; Mezzina, Roberto; Ridente, Pina; Wiersma, Durk; Visser, Ellen; Kiejna, Andrzej; Piotrowski, Patryk; Ploumpidis, Dimitris; Gonidakis, Fragiskos; Caldas-de-Almeida, José Miguel; Cardoso, Graça; King, Michael

    2012-01-01

    The Quality Indicator for Rehabilitative Care (QuIRC) is a staff rated, international toolkit that assesses care in longer term hospital and community based mental health facilities. The QuIRC was developed from review of the international literature, an international Delphi exercise with over 400 service users, practitioners, carers and advocates from ten European countries at different stages of deinstitutionalisation, and review of the care standards in these countries. It can be completed in under an hour by the facility manager and has robust content validity, acceptability and inter-rater reliability. In this study, we investigated the internal validity of the QuIRC. Our aim was to identify the QuIRC domains of care that independently predicted better service user experiences of care. At least 20 units providing longer term care for adults with severe mental illness were recruited in each of ten European countries. Service users completed standardised measures of their experiences of care, quality of life, autonomy and the unit's therapeutic milieu. Unit managers completed the QuIRC. Multilevel modelling allowed analysis of associations between service user ratings as dependent variables with unit QuIRC domain ratings as independent variables. 1750/2495 (70%) users and the managers of 213 units from across ten European countries participated. QuIRC ratings were positively associated with service users' autonomy and experiences of care. Associations between QuIRC ratings and service users' ratings of their quality of life and the unit's therapeutic milieu were explained by service user characteristics (age, diagnosis and functioning). A hypothetical 10% increase in QuIRC rating resulted in a clinically meaningful improvement in autonomy. Ratings of the quality of longer term mental health facilities made by service managers were positively associated with service users' autonomy and experiences of care. Interventions that improve quality of care in these

  13. Northern Division. Distribution Zone. Juarez.; Division norte. Zona de distribucion. Juarez

    Energy Technology Data Exchange (ETDEWEB)

    Mendoza, J. M. [Comision Federal de Electricidad (CFE) (Mexico)

    2005-07-01

    The public service law of electrical energy, its regulation and the manual of services to the public in the matter of electrical energy govern the sale of electrical energy. The Secretaria de Hacienda y Credito Publico altogether with the participation of the Secretarias of Energia, de Comercio y Fomento Industrial, and to the proposal of the Comision Federal de Electricidad (CFE), fixes the tariffs, their adjustment or restructuring. The CFE mission is to satisfy the electrical energy necessities and expectations of the clients, through a profitable and competitive organization, guaranteeing the integral development of its collaborators. Its product, electrical energy, is received from other areas within the CFE. The electrical tariffs simultaneously fulfill three functions: financial, economical and social. [Spanish] La venta de energia electrica se rige por la ley del servicio publico de energia electrica, su reglamento, el manual de servicios al publico en materia de energia electrica. La Secretaria de Hacienda y Credito Publico con la participacion de las Secretarias de Energia, de Comercio y Fomento Industrial, y a propuesta de la Comision Federal de Electricidad (CFE), fija las tarifas, su ajuste o reestructuracion. La mision de CFE es satisfacer las necesidades y expectativas de energia electrica de los clientes, a traves de una organizacion rentable y competitiva, garantizando el desarrollo integral de sus colaboradores. Su producto, la energia electrica, la reciben de otras areas dentro de la CFE. Las tarifas electricas cumplen simultaneamente tres funciones: financiera, economica y social.

  14. Near-infrared imaging polarimetry of bipolar nebulae: Pt. 1

    International Nuclear Information System (INIS)

    Minchin, N.R.; Hough, J.H.; McCall, A.; Burton, M.G.; McCaughrean, M.J.; Aspin, C.; Bailey, J.A.; Axon, D.J.; Sato, Shuji

    1991-01-01

    New high-spatial-resolution polarization images of the BN-KL region of OMC-1 from 1.25-3.6 μm are presented. At the longer wavelengths these show a centro-symmetric polarization vector pattern, centred mainly on IRc2, and high degrees of polarization across the nebula, confirming that the diffuse nebulosity is dominated by the scattering of radiation, mainly from IRc2. Degrees of polarization, position angles and magnitudes are given for the observable IRc sources. These are discussed. (author)

  15. Development of a prototype of a Master Central Unit (MCU) for the automation of Distribution Control Centers; Desarrollo de un prototipo de Unidad Central Maestra (UCM) para la automatizacion de Centros de Control de Distribucion

    Energy Technology Data Exchange (ETDEWEB)

    Uribe Blanco, Carlos Eduardo; Mata Almanza, Rafael; Picasso Blanquel, Cuitlahuac [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2011-07-01

    For the purpose of contributing to the strategic plan and to the improvement of productivity and competitiveness levels, the Federal Electric Commission (CFE, Spanish acronym) is making a significant investment in human resources and materials to modernize electric energy supply systems, including monitoring, protection and automatic control for operating all the elements of the electrical process, from generating plants to transmission lines, distribution systems and commercial applications. With this modernization, the CFE is also creating the infrastructure for the interoperability and interconnectivity of the above systems, in such a way to enable it to broaden, continue and complement the functional integration of the linked institutional systems of the latest generation. The total integration of the systems will allow the CFE to move toward Intelligent Electric Networks. Therefore, the CFE requested help from the Electric Research Institute (IIE, Spanish acronym) to develop part of the infrastructure to modernize the automation of distribution. This consists of the development of a prototype of the supervision and control system, using interoperable open technology owned by the CFE which enables using the functions of a SCADA system (Supervisory Control And Data Acquisition) to supervise and control electric distribution networks. [Spanish] Con el proposito de contribuir al plan estrategico y mejoramiento de los niveles de productividad y competitividad, la Comision Federal de Electricidad (CFE) esta invirtiendo fuertemente en recursos humanos y materiales para la modernizacion de los sistemas de suministro de energia electrica, incluyendo el monitoreo, proteccion y control automatico para la operacion de todos los elementos del proceso electrico, desde los centros de generacion hasta las lineas de transmision, los sistemas de distribucion y las aplicaciones de comercializacion. Con dicha modernizacion, la CFE tambien esta generando la infraestructura para la

  16. Invisible in Thailand: documenting the need for protection

    Directory of Open Access Journals (Sweden)

    Margaret Green

    2008-04-01

    Full Text Available The International Rescue Committee (IRC has conducted asurvey to document the experiences of Burmese people livingin border areas of Thailand and assess the degree to whichthey merit international protection as refugees.

  17. Cooperation for Interference Management: A GDoF Perspective

    KAUST Repository

    Gherekhloo, Soheil; Chaaban, Anas; Sezgin, Aydin

    2016-01-01

    The impact of cooperation on interference management is investigated by studying an elemental wireless network, the so-called symmetric interference relay channel (IRC), from a generalized degrees of freedom (GDoF) perspective. This is motivated

  18. 78 FR 18725 - Homeless Emergency Assistance and Rapid Transition to Housing: Rural Housing Stability Assistance...

    Science.gov (United States)

    2013-03-27

    ..., weekdays at the above address. Due to security measures at the HUD Headquarters building, an advance... Internal Revenue Code (IRC) of 1986 (26 U.S.C. 501(c)), that is exempt from taxation under subtitle A of...

  19. 76 FR 73017 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-11-28

    ... Contribucion Federal Sobre El Trabajo Por Cuenta Propia-Puerto Rico; and Anejo H-PR. Forms: 1040-SS, 1040-PR...-employment tax under IRC chapter 2 of Subtitle A, and provide credit to the taxpayer's social security...

  20. Experimental Evaluation of Interference Rejection Combining for 5G small cells,

    DEFF Research Database (Denmark)

    Assefa, Dereje; Berardinelli, Gilberto; Tavares, Fernando Menezes Leitão

    2015-01-01

    The Interference Rejection Combining (IRC) receiver can significantly boost the network throughput in scenarios characterized by dense uncoordinated deployment of small cells, as targeted by future 5th generation (5G) radio access technology. This paper presents an experimental study...

  1. PER 2009(1)

    African Journals Online (AJOL)

    Dr Tanya du Plessis

    of involvement of a public authority in guardianship procedures.31. Although ... definition of adoptability applies for national as well as international purposes. Therefore ...... irc.org; Lammerant 2005 Rev Droit Univ Sherbrooke 349. Based on ...

  2. 27 CFR 479.51 - Fraudulent return.

    Science.gov (United States)

    2010-04-01

    ... EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND CERTAIN... assessed with respect to the same underpayment (section 6653, I.R.C.). Application of State Laws ...

  3. Enhancement of centrifugal compressor stable operation using an internal recirculation channel

    Directory of Open Access Journals (Sweden)

    Růžička M.

    2016-12-01

    Full Text Available Centrifugal compressors with a high pressure ratio are widely used in small aircraft turbine engines and turbocharges. At high rotational speeds they have a narrow stable operating region and the commonly used impellers with back swept blades are not able to ensure requested stability. In order to achieve a wider stable operating region, some other anti-surge measures can be used such as an Internal Recirculation Channel (IRC located in the inlet area of the compressor impeller. This paper analyses the influence of various IRC inlet slot geometries on air flow parameters. The flow velocity profiles downstream of the IRC outlet slot are evaluated and the influence of various channel configurations on compressor performance map is shown. Results from experiments as well as CFD simulations enable us to analyse the airflow in IRC and find out its most suitable geometry.

  4. Predictive analysis and mapping of indoor radon concentrations in a complex environment using kernel estimation: An application to Switzerland

    Energy Technology Data Exchange (ETDEWEB)

    Kropat, Georg, E-mail: georg.kropat@chuv.ch [Institute of Radiation Physics, Lausanne University Hospital, Rue du Grand-Pré 1, 1007 Lausanne (Switzerland); Bochud, Francois [Institute of Radiation Physics, Lausanne University Hospital, Rue du Grand-Pré 1, 1007 Lausanne (Switzerland); Jaboyedoff, Michel [Faculty of Geosciences and Environment, University of Lausanne, GEOPOLIS — 3793, 1015 Lausanne (Switzerland); Laedermann, Jean-Pascal [Institute of Radiation Physics, Lausanne University Hospital, Rue du Grand-Pré 1, 1007 Lausanne (Switzerland); Murith, Christophe; Palacios, Martha [Swiss Federal Office of Public Health, Schwarzenburgstrasse 165, 3003 Berne (Switzerland); Baechler, Sébastien [Institute of Radiation Physics, Lausanne University Hospital, Rue du Grand-Pré 1, 1007 Lausanne (Switzerland); Swiss Federal Office of Public Health, Schwarzenburgstrasse 165, 3003 Berne (Switzerland)

    2015-02-01

    Purpose: The aim of this study was to develop models based on kernel regression and probability estimation in order to predict and map IRC in Switzerland by taking into account all of the following: architectural factors, spatial relationships between the measurements, as well as geological information. Methods: We looked at about 240 000 IRC measurements carried out in about 150 000 houses. As predictor variables we included: building type, foundation type, year of construction, detector type, geographical coordinates, altitude, temperature and lithology into the kernel estimation models. We developed predictive maps as well as a map of the local probability to exceed 300 Bq/m{sup 3}. Additionally, we developed a map of a confidence index in order to estimate the reliability of the probability map. Results: Our models were able to explain 28% of the variations of IRC data. All variables added information to the model. The model estimation revealed a bandwidth for each variable, making it possible to characterize the influence of each variable on the IRC estimation. Furthermore, we assessed the mapping characteristics of kernel estimation overall as well as by municipality. Overall, our model reproduces spatial IRC patterns which were already obtained earlier. On the municipal level, we could show that our model accounts well for IRC trends within municipal boundaries. Finally, we found that different building characteristics result in different IRC maps. Maps corresponding to detached houses with concrete foundations indicate systematically smaller IRC than maps corresponding to farms with earth foundation. Conclusions: IRC mapping based on kernel estimation is a powerful tool to predict and analyze IRC on a large-scale as well as on a local level. This approach enables to develop tailor-made maps for different architectural elements and measurement conditions and to account at the same time for geological information and spatial relations between IRC measurements

  5. An optimal painless treatment for early hemorrhoids; our experience in Government Medical College and Hospital

    Science.gov (United States)

    Singal, R; Gupta, S; Dalal, AK; Dalal, U; Attri, AK

    2013-01-01

    Objective - To evaluate the efficacy of Infrared Coagulation Therapy (IRC) for hemorrhoids. IRC is a painless, safe and successful procedure. Place and duration of study - Department of Surgery, Government Medical College and Hospital, Sector-32, Chandigarh, India, from August 2006 to October 2008. The choice of procedure depends on the patient's symptoms, the extent of the hemorrhoidal disease, and the experience of the surgeon along with the availability of the techniques/instruments. Materials and methods - This is a prospective study done from August 2006 to October 2008. Total number of 155 patients was included in the study. Infrared Coagulation Therapy (IRC) was performed through a special designed proctoscope. Patients excluded were with coagulopathy disorders, fissure in ano, and anal ulcers. Results - It is an outpatient Department (OPD), non-surgical, ambulatory, painless and bloodless procedure, without any hospital stay. Early recovery and minimal recurrence of hemorrhoids were noted without any morbidity or mortality. We have studied 155 patients, treated with IRC on OPD basis. Surgery was required in few patients in whom IRC failed or was contraindicated. Out of the total 155 patients, 127 came for follow up. After the 1st sitting of IRC therapy: out of 127; 43 patients got a total relief, mass shrinkage was of > 75% in 57 cases and 75% relief in 15 cases and >50 % relief in 11 patients. In the 3rd sitting out of 26/84 cases: 13 cases got a total relief and 13 cases refused to take the third sitting; however, in 7 cases the hemorrhoidal mass shrank up to 50% after the two sittings. These 14 were operated as there was no relief from bleeding after giving two sittings of IRC. Our opinion is that, in the above 14 cases, the patient might have not followed the instructions properly for dietary habits. Conclusion - IRC is a safe, simple and effective procedure for early hemorrhoids without any complications. IRC is nowadays the world’s leading office

  6. Automation Framework for Flight Dynamics Products Generation

    Science.gov (United States)

    Wiegand, Robert E.; Esposito, Timothy C.; Watson, John S.; Jun, Linda; Shoan, Wendy; Matusow, Carla

    2010-01-01

    XFDS provides an easily adaptable automation platform. To date it has been used to support flight dynamics operations. It coordinates the execution of other applications such as Satellite TookKit, FreeFlyer, MATLAB, and Perl code. It provides a mechanism for passing messages among a collection of XFDS processes, and allows sending and receiving of GMSEC messages. A unified and consistent graphical user interface (GUI) is used for the various tools. Its automation configuration is stored in text files, and can be edited either directly or using the GUI.

  7. Architectural Analysis of Dynamically Reconfigurable Systems

    Science.gov (United States)

    Lindvall, Mikael; Godfrey, Sally; Ackermann, Chris; Ray, Arnab; Yonkwa, Lyly

    2010-01-01

    oTpics include: the problem (increased flexibility of architectural styles decrease analyzability, behavior emerges and varies depending on the configuration, does the resulting system run according to the intended design, and architectural decisions can impede or facilitate testing); top down approach to architecture analysis, detection of defects and deviations, and architecture and its testability; currently targeted projects GMSEC and CFS; analyzing software architectures; analyzing runtime events; actual architecture recognition; GMPUB in Dynamic SAVE; sample output from new approach; taking message timing delays into account; CFS examples of architecture and testability; some recommendations for improved testablity; and CFS examples of abstract interfaces and testability; CFS example of opening some internal details.

  8. Thriving in the Information Age: Why Marine Corps Commanders Must Maximize Their Existing Information Related Capabilities

    Science.gov (United States)

    2016-04-20

    skills within a business that make it more valuable or competitive, https://dictionary.cambridge.org/us/dictionary/ english /skill. Examples of knowledge ...is a lack of standardization – from the tactical to the strategic level – with integrating and employing IRCs and these SMEs. This along with other...organization strategic goals and objectives, and/or a lack of senior leader advocacy. Practical approaches such as the IRCs Integration Continuum acts as a

  9. Distributed Framework for Dynamic Telescope and Instrument Control

    Science.gov (United States)

    Ames, Troy J.; Case, Lynne

    2002-01-01

    Traditionally, instrument command and control systems have been developed specifically for a single instrument. Such solutions are frequently expensive and are inflexible to support the next instrument development effort. NASA Goddard Space Flight Center is developing an extensible framework, known as Instrument Remote Control (IRC) that applies to any kind of instrument that can be controlled by a computer. IRC combines the platform independent processing capabilities of Java with the power of the Extensible Markup Language (XML). A key aspect of the architecture is software that is driven by an instrument description, written using the Instrument Markup Language (IML). IML is an XML dialect used to describe graphical user interfaces to control and monitor the instrument, command sets and command formats, data streams, communication mechanisms, and data processing algorithms. The IRC framework provides the ability to communicate to components anywhere on a network using the JXTA protocol for dynamic discovery of distributed components. JXTA (see httD://www.jxta.org,) is a generalized protocol that allows any devices connected by a network to communicate in a peer-to-peer manner. IRC uses JXTA to advertise a device's IML and discover devices of interest on the network. Devices can join or leave the network and thus join or leave the instrument control environment of IRC. Currently, several astronomical instruments are working with the IRC development team to develop custom components for IRC to control their instruments. These instruments include: High resolution Airborne Wideband Camera (HAWC), a first light instrument for the Stratospheric Observatory for Infrared Astronomy (SOFIA); Submillimeter And Far Infrared Experiment (SAFIRE), a Principal Investigator instrument for SOFIA; and Fabry-Perot Interferometer Bolometer Research Experiment (FIBRE), a prototype of the SAFIRE instrument, used at the Caltech Submillimeter Observatory (CSO). Most recently, we have

  10. Regeneration of cervical reserve cell-like cells from human induced pluripotent stem cells (iPSCs): A new approach to finding targets for cervical cancer stem cell treatment.

    Science.gov (United States)

    Sato, Masakazu; Kawana, Kei; Adachi, Katsuyuki; Fujimoto, Asaha; Yoshida, Mitsuyo; Nakamura, Hiroe; Nishida, Haruka; Inoue, Tomoko; Taguchi, Ayumi; Ogishima, Juri; Eguchi, Satoko; Yamashita, Aki; Tomio, Kensuke; Wada-Hiraike, Osamu; Oda, Katsutoshi; Nagamatsu, Takeshi; Osuga, Yutaka; Fujii, Tomoyuki

    2017-06-20

    Cervical reserve cells are epithelial progenitor cells that are pathologically evident as the origin of cervical cancer. Thus, investigating the characteristics of cervical reserve cells could yield insight into the features of cervical cancer stem cells (CSCs). In this study, we established a method for the regeneration of cervical reserve cell-like properties from human induced pluripotent stem cells (iPSCs) and named these cells induced reserve cell-like cells (iRCs). Approximately 70% of iRCs were positive for the reserve cell markers p63, CK5 and CK8. iRCs also expressed the SC junction markers CK7, AGR2, CD63, MMP7 and GDA. While iRCs expressed neither ERα nor ERβ, they expressed CA125. These data indicated that iRCs possessed characteristics of cervical epithelial progenitor cells. iRCs secreted higher levels of several inflammatory cytokines such as macrophage migration inhibitory factor (MIF), soluble intercellular adhesion molecule 1 (sICAM-1) and C-X-C motif ligand 10 (CXCL-10) compared with normal cervical epithelial cells. iRCs also expressed human leukocyte antigen-G (HLA-G), which is an important cell-surface antigen for immune tolerance and carcinogenesis. Together with the fact that cervical CSCs can originate from reserve cells, our data suggested that iRCs were potent immune modulators that might favor cervical cancer cell survival. In conclusion, by generating reserve cell-like properties from iPSCs, we provide a new approach that may yield new insight into cervical cancer stem cells and help find new oncogenic targets.

  11. Cervical auscultation in the diagnosis of oropharyngeal aspiration in children: a study protocol for a randomised controlled trial.

    Science.gov (United States)

    Frakking, Thuy T; Chang, Anne B; O'Grady, Kerry-Ann F; Walker-Smith, Katie; Weir, Kelly A

    2013-11-07

    Oropharyngeal aspiration (OPA) can lead to recurrent respiratory illnesses and chronic lung disease in children. Current clinical feeding evaluations performed by speech pathologists have poor reliability in detecting OPA when compared to radiological procedures such as the modified barium swallow (MBS). Improved ability to diagnose OPA accurately via clinical evaluation potentially reduces reliance on expensive, less readily available radiological procedures. Our study investigates the utility of adding cervical auscultation (CA), a technique of listening to swallowing sounds, in improving the diagnostic accuracy of a clinical evaluation for the detection of OPA. We plan an open, unblinded, randomised controlled trial at a paediatric tertiary teaching hospital. Two hundred and sixteen children fulfilling the inclusion criteria will be randomised to one of the two clinical assessment techniques for the clinical detection of OPA: (1) clinical feeding evaluation only (CFE) group or (2) clinical feeding evaluation with cervical auscultation (CFE + CA) group. All children will then undergo an MBS to determine radiologically assessed OPA. The primary outcome is the presence or absence of OPA, as determined on MBS using the Penetration-Aspiration Scale. Our main objective is to determine the sensitivity, specificity, negative and positive predictive values of 'CFE + CA' versus 'CFE' only compared to MBS-identified OPA. Early detection and appropriate management of OPA is important to prevent chronic pulmonary disease and poor growth in children. As the reliability of CFE to detect OPA is low, a technique that can improve the diagnostic accuracy of the CFE will help minimise consequences to the paediatric respiratory system. Cervical auscultation is a technique that has previously been documented as a clinical adjunct to the CFE; however, no published RCTs addressing the reliability of this technique in children exist. Our study will be the first to establish the utility

  12. Broadcast of four HD videos with LED ceiling lighting: optical-wireless MAC

    Science.gov (United States)

    Bouchet, Olivier; Porcon, Pascal; Gueutier, Eric

    2011-09-01

    The European project "hOME Gigabit Access Network" (OMEGA) targeted various wireless and wired solutions for 1 Gbit/s connectivity in Home Area Networks (HANs). One objective was to evaluate the suitability of optical wireless technologies in two spectral regions: visible light (visible-light communications - VLC) and near infrared (infrared communications - IRC). Several demonstrators have been built, all of them largely relying on overthe- shelf components. The demonstrators included a "wide-area" VLC broadcast link based on LED ceiling lighting and a laser-based high-data-rate "wide-area" IRC prototype. In this paper we discuss an adapted optical-wireless media-access-control (OWMAC) sublayer, which was developed and implemented during the project. It is suitable for both IRC and VLC. The VLC prototype is based on DMT signal processing and provides broadcasting at { 100 Mbit/s over an area of approximately 5 m2. The IRC prototype provides {300 Mbit/s half-duplex communication over an area of approximately 30 m2. The IRC mesh network, composed of one base station and two terminals, is based on OOK modulation, multi-sector transceivers, and an ultra-fast sector switch. After a brief discussion about the design of the optical-wireless data link layer and the optical-wireless switch (OWS) card, we address the card development and implementation. We also present applications for the VLC and IRC prototypes and measurement results regarding the MAC layer.

  13. Use of item response curves of the Force and Motion Conceptual Evaluation to compare Japanese and American students' views on force and motion

    Science.gov (United States)

    Ishimoto, Michi; Davenport, Glen; Wittmann, Michael C.

    2017-12-01

    Student views of force and motion reflect the personal experiences and physics education of the student. With a different language, culture, and educational system, we expect that Japanese students' views on force and motion might be different from those of American students. The Force and Motion Conceptual Evaluation (FMCE) is an instrument used to probe student views on force and motion. It was designed using research on American students, and, as such, the items might function differently for Japanese students. Preliminary results from a translated version indicated that Japanese students had similar misconceptions as those of American students. In this study, we used item response curves (IRCs) to make more detailed item-by-item comparisons. IRCs show the functioning of individual items across all levels of performance by plotting the proportion of each response as a function of the total score. Most of the IRCs showed very similar patterns on both correct and incorrect responses; however, a few of the plots indicate differences between the populations. The similar patterns indicate that students tend to interact with FMCE items similarly, despite differences in culture, language, and education. We speculate about the possible causes for the differences in some of the IRCs. This report is intended to show how IRCs can be used as a part of the validation process when making comparisons across languages and nationalities. Differences in IRCs can help to pinpoint artifacts of translation, contextual effects because of differences in culture, and perhaps intrinsic differences in student understanding of Newtonian motion.

  14. Use of item response curves of the Force and Motion Conceptual Evaluation to compare Japanese and American students’ views on force and motion

    Directory of Open Access Journals (Sweden)

    Michi Ishimoto

    2017-11-01

    Full Text Available Student views of force and motion reflect the personal experiences and physics education of the student. With a different language, culture, and educational system, we expect that Japanese students’ views on force and motion might be different from those of American students. The Force and Motion Conceptual Evaluation (FMCE is an instrument used to probe student views on force and motion. It was designed using research on American students, and, as such, the items might function differently for Japanese students. Preliminary results from a translated version indicated that Japanese students had similar misconceptions as those of American students. In this study, we used item response curves (IRCs to make more detailed item-by-item comparisons. IRCs show the functioning of individual items across all levels of performance by plotting the proportion of each response as a function of the total score. Most of the IRCs showed very similar patterns on both correct and incorrect responses; however, a few of the plots indicate differences between the populations. The similar patterns indicate that students tend to interact with FMCE items similarly, despite differences in culture, language, and education. We speculate about the possible causes for the differences in some of the IRCs. This report is intended to show how IRCs can be used as a part of the validation process when making comparisons across languages and nationalities. Differences in IRCs can help to pinpoint artifacts of translation, contextual effects because of differences in culture, and perhaps intrinsic differences in student understanding of Newtonian motion.

  15. Income tax credits and incentives available for producing energy from biomass

    International Nuclear Information System (INIS)

    Sanderson, G.A.

    1993-01-01

    In the 1970's the US became interested in the development of energy from biomass and other alternative sources. While this interest was stimulated primarily by the oil embargoes of the 1970's, the need for environmentally friendly alternative fuels was also enhanced by the Clean Water Act and the Clean Air Act, two prominent pieces of environmental legislation. As a result, Congress created several tax benefits and subsidies for the production of energy for biomass. Congress enacted biomass energy incentives in 1978 with the creation of excise tax exemptions for alcohol fuels, in 1980 with the enactment of the IRC section 29 nonconventional fuel credit provisions and the IRC section 40 alcohol fuel credits, and recently with the addition of favorable biomass energy provisions as part of the Comprehensive National energy Policy Act of 1992. This article focuses on the following specific tax credits, tax benefits and subsidies for biomass energy: (1) IRC section 29 credit for producing gas from biomass, (2) IRC section 45 credit for producing electricity from biomass, (3) Incentive payments for electricity produced from biomass, (4) Excise tax exemptions for alcohol fuels, (5) IRC section 40 alcohol fuels credits, and (6) IRC section 179A special deduction for alcohol fuels property

  16. Djulis (Chenopodium formosanum Koidz. Water Extract and Its Bioactive Components Ameliorate Dermal Damage in UVB-Irradiated Skin Models

    Directory of Open Access Journals (Sweden)

    Yong-Han Hong

    2016-01-01

    Full Text Available Dermal photoaging is a condition of skin suffering inappropriate ultraviolet (UV exposure and exerts inflammation, tissue alterations, redness, swelling, and uncomfortable feelings. Djulis (Chenopodium formosanum Koidz. is a cereal food and its antioxidant and pigment constituents may provide skin protection from photoaging, but it still lacks proved experiments. In this study, protective effects of djulis extract (CFE on UVB-irradiated skin were explored. The results showed that HaCaT cells with 150 μg/mL CFE treatment had higher survival and less production of interleukin- (IL- 6, matrix metalloprotease- (MMP- 1, and reactive oxygen species (ROS in UVB-irradiated conditions. Subsequently, in animal studies, mice supplemented with CFE (100 mg/kg BW were under UVB irradiation and had thinner epidermis and lower IL-6 levels in skin layer. These data demonstrate that bioactive compounds possessing the potency of antiphotoaging exist in CFE. Following that, we found rutin and chlorogenic acid (10–100 μM could significantly increase cell viability and decrease the production of IL-6 in UVB models. Additionally, djulis pigment-betanin has no effect of increasing cell viability in this study. Our findings suggest CFE can protect skin against UV-induced damage and this protection is mainly from contributions of rutin and chlorogenic acid.

  17. Influence of the Hybrid Combination of Multiwalled Carbon Nanotubes and Graphene Oxide on Interlaminar Mechanical Properties of Carbon Fiber/Epoxy Laminates

    Science.gov (United States)

    Rodríguez-González, J. A.; Rubio-González, C.; Jiménez-Mora, M.; Ramos-Galicia, L.; Velasco-Santos, C.

    2017-10-01

    An effective strategy to improve the mode I and mode II interlaminar fracture toughness (G IC and G IIC ) of unidirectional carbon fiber/epoxy (CF/E) laminates using a hybrid combination of multiwalled carbon nanotubes (MWCNTs) and graphene oxide (GO) is reported. Double cantilever beam (DCB) and end notched flexure (ENF) tests were conducted to evaluate the G IC and G IIC of the CF/E laminates fabricated with sprayed MWCNTs, GO and MWCNTs/GO hybrid. Scanning electron microscopy was employed to observe the fracture surfaces of tested DCB and ENF specimens. Experimental results showed the positive effect on the G IC and G IIC by 17% and 14% improvements on CF/E laminates with 0.25 wt.% MWCNTs/GO hybrid content compared to the neat CF/E. Also, the interlaminar shear strength value was increased for MWCNTs/GO-CF/E laminates. A synergetic effect between MWCNTs and GO resulted in improved interlaminar mechanical properties of CF/E laminates made by prepregs.

  18. Carbon Fiber Ultramicrodic Electrode Electrodeposited with Over-Oxidized Polypyrrole for Amperometric Detection of Vesicular Exocytosis from Pheochromocytoma Cell

    Directory of Open Access Journals (Sweden)

    Li Wang

    2015-01-01

    Full Text Available Vesicular exocytosis is ubiquitous, but it is difficult to detect within the cells’ communication mechanism. For this purpose, a 2 µm ultramicrodic carbon fiber electrode was fabricated in this work based on electrodeposition with over-oxidized polypyrrole nanoparticle (PPyox-CFE, which was applied successfully for real-time monitoring of quantal exocytosis from individual pheochromocytoma (PC12 cells. PPyox-CFE was evaluated by dopamine (DA solutions through cyclic voltammetry and amperometry electrochemical methods, and results revealed that PPyox-CFE improved the detection limit of DA. In particular, the sensitivity of DA was improved to 24.55 µA·µM−1·µm−2 using the PPyox-CFE. The ultramicrodic electrode combined with the patch-clamp system was used to detect vesicular exocytosis of DA from individual PC12 cells with 60 mM K+ stimulation. A total of 287 spikes released from 7 PC12 cells were statistically analyzed. The current amplitude (Imax and the released charge (Q of the amperometric spikes from the DA release by a stimulated PC12 cell is 45.1 ± 12.5 pA and 0.18 ± 0.04 pC, respectively. Furthermore, on average ~562,000 molecules were released in each vesicular exocytosis. PPyox-CFE, with its capability of detecting vesicular exocytosis, has potential application in neuron communication research.

  19. Cerebral fat embolism: Use of MR spectroscopy for accurate diagnosis

    Directory of Open Access Journals (Sweden)

    Laxmi Kokatnur

    2015-01-01

    Full Text Available Cerebral fat embolism (CFE is an uncommon but serious complication following orthopedic procedures. It usually presents with altered mental status, and can be a part of fat embolism syndrome (FES if associated with cutaneous and respiratory manifestations. Because of the presence of other common factors affecting the mental status, particularly in the postoperative period, the diagnosis of CFE can be challenging. Magnetic resonance imaging (MRI of brain typically shows multiple lesions distributed predominantly in the subcortical region, which appear as hyperintense lesions on T2 and diffusion weighted images. Although the location offers a clue, the MRI findings are not specific for CFE. Watershed infarcts, hypoxic encephalopathy, disseminated infections, demyelinating disorders, diffuse axonal injury can also show similar changes on MRI of brain. The presence of fat in these hyperintense lesions, identified by MR spectroscopy as raised lipid peaks will help in accurate diagnosis of CFE. Normal brain tissue or conditions producing similar MRI changes will not show any lipid peak on MR spectroscopy. We present a case of CFE initially misdiagnosed as brain stem stroke based on clinical presentation and cranial computed tomography (CT scan, and later, MR spectroscopy elucidated the accurate diagnosis.

  20. The Protective Effects of the Supercritical-Carbon Dioxide Fluid Extract of Chrysanthemum indicum against Lipopolysaccharide-Induced Acute Lung Injury in Mice via Modulating Toll-Like Receptor 4 Signaling Pathway

    Directory of Open Access Journals (Sweden)

    Xiao-Li Wu

    2014-01-01

    Full Text Available The supercritical-carbon dioxide fluid extract of Chrysanthemum indicum Linné. (CFE has been demonstrated to be effective in suppressing inflammation. The aim of this study is to investigate the preventive action and underlying mechanisms of CFE on acute lung injury (ALI induced by lipopolysaccharide (LPS in mice. ALI was induced by intratracheal instillation of LPS into lung, and dexamethasone was used as a positive control. Results revealed that pretreatment with CFE abated LPS-induced lung histopathologic changes, reduced the wet/dry ratio and proinflammatory cytokines productions (TNF-α, IL-1β, and IL-6, inhibited inflammatory cells migrations and protein leakages, suppressed the levels of MPO and MDA, and upregulated the abilities of antioxidative enzymes (SOD, CAT, and GPx. Furthermore, the pretreatment with CFE downregulated the activations of NF-κB and the expressions of TLR4/MyD88. These results suggested that CFE exerted potential protective effects against LPS-induced ALI in mice and was a potential therapeutic drug for ALI. Its mechanisms were at least partially associated with the modulations of TLR4 signaling pathways.

  1. Improved predictive mapping of indoor radon concentrations using ensemble regression trees based on automatic clustering of geological units

    International Nuclear Information System (INIS)

    Kropat, Georg; Bochud, Francois; Jaboyedoff, Michel; Laedermann, Jean-Pascal; Murith, Christophe; Palacios, Martha; Baechler, Sébastien

    2015-01-01

    Purpose: According to estimations around 230 people die as a result of radon exposure in Switzerland. This public health concern makes reliable indoor radon prediction and mapping methods necessary in order to improve risk communication to the public. The aim of this study was to develop an automated method to classify lithological units according to their radon characteristics and to develop mapping and predictive tools in order to improve local radon prediction. Method: About 240 000 indoor radon concentration (IRC) measurements in about 150 000 buildings were available for our analysis. The automated classification of lithological units was based on k-medoids clustering via pair-wise Kolmogorov distances between IRC distributions of lithological units. For IRC mapping and prediction we used random forests and Bayesian additive regression trees (BART). Results: The automated classification groups lithological units well in terms of their IRC characteristics. Especially the IRC differences in metamorphic rocks like gneiss are well revealed by this method. The maps produced by random forests soundly represent the regional difference of IRCs in Switzerland and improve the spatial detail compared to existing approaches. We could explain 33% of the variations in IRC data with random forests. Additionally, the influence of a variable evaluated by random forests shows that building characteristics are less important predictors for IRCs than spatial/geological influences. BART could explain 29% of IRC variability and produced maps that indicate the prediction uncertainty. Conclusion: Ensemble regression trees are a powerful tool to model and understand the multidimensional influences on IRCs. Automatic clustering of lithological units complements this method by facilitating the interpretation of radon properties of rock types. This study provides an important element for radon risk communication. Future approaches should consider taking into account further variables

  2. Design and validation of standardized clinical and functional remission criteria in schizophrenia

    Science.gov (United States)

    Mosolov, Sergey N; Potapov, Andrey V; Ushakov, Uriy V; Shafarenko, Aleksey A; Kostyukova, Anastasiya B

    2014-01-01

    Background International Remission Criteria (IRC) for schizophrenia were developed recently by a group of internationally known experts. The IRC detect only 10%–30% of cases and do not cover the diversity of forms and social functioning. Our aim was to design a more applicable tool and validate its use – the Standardized Clinical and Functional Remission Criteria (SCFRC). Methods We used a 6-month follow-up study of 203 outpatients from two Moscow centers and another further sample of stable patients from a 1-year controlled trial of atypical versus typical medication. Diagnosis was confirmed by International Classification of Diseases Version 10 (ICD10) criteria and the Mini-International Neuropsychiatric Interview (MINI). Patients were assessed by the Positive and Negative Syndrome Scale, including intensity threshold, and further classified using the Russian domestic remission criteria and the level of social and personal functioning, according to the Personal and Social Performance Scale (PSP). The SCFRC were formulated and were validated by a data reanalysis on the first population sample and on a second independent sample (104 patients) and in an open-label prospective randomized 12-month comparative study of risperidone long-acting injectable (RLAI) versus olanzapine. Results Only 64 of the 203 outpatients (31.5%) initially met the IRC, and 53 patients (26.1%) met the IRC after 6 months, without a change in treatment. Patients who were in remission had episodic and progressive deficit (39.6%), or remittent (15%) paranoid schizophrenia, or schizoaffective disorder (17%). In addition, 105 patients of 139 (51.7%), who did not meet symptomatic IRC, remained stable within the period. Reanalysis of data revealed that 65.5% of the patients met the SCFRC. In the controlled trial, 70% of patients in the RLAI group met the SCFRC and only 19% the IRC. In the routine treatment group, 55.9% met the SCFRC and only 5.7% the IRC. Results of the further independent

  3. Increasing the Operational Value of Event Messages

    Science.gov (United States)

    Li, Zhenping; Savkli, Cetin; Smith, Dan

    2003-01-01

    Assessing the health of a space mission has traditionally been performed using telemetry analysis tools. Parameter values are compared to known operational limits and are plotted over various time periods. This presentation begins with the notion that there is an incredible amount of untapped information contained within the mission s event message logs. Through creative advancements in message handling tools, the event message logs can be used to better assess spacecraft and ground system status and to highlight and report on conditions not readily apparent when messages are evaluated one-at-a-time during a real-time pass. Work in this area is being funded as part of a larger NASA effort at the Goddard Space Flight Center to create component-based, middleware-based, standards-based general purpose ground system architecture referred to as GMSEC - the GSFC Mission Services Evolution Center. The new capabilities and operational concepts for event display, event data analyses and data mining are being developed by Lockheed Martin and the new subsystem has been named GREAT - the GMSEC Reusable Event Analysis Toolkit. Planned for use on existing and future missions, GREAT has the potential to increase operational efficiency in areas of problem detection and analysis, general status reporting, and real-time situational awareness.

  4. Pattern description and reliability parameters of six force-time related indices measured with plantar pressure measurements.

    Science.gov (United States)

    Deschamps, Kevin; Roosen, Philip; Bruyninckx, Herman; Desloovere, Kaat; Deleu, Paul-Andre; Matricali, Giovanni A; Peeraer, Louis; Staes, Filip

    2013-09-01

    Functional interpretation of plantar pressure measurements is commonly done through the use of ratios and indices which are preceded by the strategic combination of a subsampling method and selection of physical quantities. However, errors which may arise throughout the determination of these temporal indices/ratio calculations (T-IRC) have not been quantified. The purpose of the current study was therefore to estimate the reliability of T-IRC following semi-automatic total mapping (SATM). Using a repeated-measures design, two experienced therapists performed three subsampling sessions on three left and right pedobarographic footprints of ten healthy participants. Following the subsampling, six T-IRC were calculated: Rearfoot-Forefoot_fti, Rearfoot-Midfoot_fti, Forefoot medial/lateral_fti, First ray_fti, Metatarsal 1-Metatarsal 5_fti, Foot medial-lateral_fti. Patterns of the T-IRC were found to be consistent and in good agreement with corresponding knowledge from the literature. The inter-session errors of both therapists were similar in pattern and magnitude. The lowest peak inter-therapist error was found in the First ray_fti (6.5 a.u.) whereas the highest peak inter-therapist error was observed in the Forefoot medial/lateral_fti (27.0 a.u.) The magnitude of the inter-session and inter-therapist error varied over time, precluding the calculation of a simple numerical value for the error. The difference between both error parameters of all T-IRC was negligible which underscores the repeatability of the SATM protocol. The current study reports consistent patterns for six T-IRC and similar inter-session and inter-therapist error. The proposed SATM protocol and the T-IRC may therefore serve as basis for functional interpretation of footprint data. Copyright © 2013 Elsevier B.V. All rights reserved.

  5. The value of producing food, energy, and ecosystem services within an agro-ecosystem

    DEFF Research Database (Denmark)

    Porter, John Roy; Constanza, Robert; Sandhu, Harpinder

    2009-01-01

    Ecosystem Services within an Agro- Ecosystem Agricultural ecosystems produce food, fiber, and nonmarketed ecosystem services (ES). Agriculture also typically involves high negative external costs associated with, for example, fossil fuel use. We estimated, via fieldscale ecological monitoring...... and economic value-transfer methods, the market and nonmarket ES value of a combined food and energy (CFE) agro-ecosystem that simultaneously produces food, fodder, and bioenergy. Such novel CFE agro-ecosystems can provide a significantly increased net crop, energy, and nonmarketed ES compared...... with conventional agriculture, and require markedly less fossil-based inputs. Extrapolated to the European scale, the value of nonmarket ES from the CFE system exceeds current European farm subsidy payments. Such integrated food and bioenergy systems can thus provide environmental value for money for European Union...

  6. The Cibola flight experiment

    Energy Technology Data Exchange (ETDEWEB)

    Caffrey, Michael Paul [Los Alamos National Laboratory; Nelson, Anthony [Los Alamos National Laboratory; Salazar, Anthony [Los Alamos National Laboratory; Roussel - Dupre, Diane [Los Alamos National Laboratory; Katko, Kim [Los Alamos National Laboratory; Palmer, Joseph [ISE-3; Robinson, Scott [Los Alamos National Laboratory; Wirthlin, Michael [BRIGHAM YOUNG UNIV; Howes, William [BRIGHAM YOUNG UNIV; Richins, Daniel [BRIGHAM YOUNG UNIV

    2009-01-01

    The Cibola Flight Experiment (CFE) is an experimental small satellite carrying a reconfigurable processing instrument developed at the Los Alamos National Laboratory that demonstrates the feasibility of using FPGA-based high-performance computing for sensor processing in the space environment. The CFE satellite was launched on March 8, 2007 in low-earth orbit and has operated extremely well since its deployment. The nine Xilinx Virtex FPGAs used in the payload have been used for several high-throughput sensor processing applications and for single-event upset (SEU) monitoring and mitigation. This paper will describe the CFE system and summarize its operational results. In addition, this paper will describe the results from several SEU detection circuits that were performed on the spacecraft.

  7. Hypoxia is a key regulator of limbal epithelial stem cell growth and differentiation

    DEFF Research Database (Denmark)

    Bath, Chris; Yang, Sufang; Muttuvelu, Danson

    2013-01-01

    The aim of this study was to determine whether the growth and differentiation of limbal epithelial stem cell cultures could be controlled through manipulation of the oxygen tension. Limbal epithelial cells were isolated from corneoscleral disks, and cultured using either feeder cells in a growth......, progression through cell cycle, colony forming efficiency (CFE), and expression of stem cell (ABCG2 and p63α) and differentiation (CK3) markers was determined throughout the culture period of up to 18 days. Low oxygen levels favored a stem cell phenotype with a lower proliferative rate, high CFE......, and a relatively higher expression of ABCG2 and p63α, while higher levels of oxygen led not only to decreased CFE but also to increased proportion of differentiated cells positive for CK3. Hypoxic cultures may thus potentially improve stem cell grafts for cultured limbal epithelial transplantation (CLET)....

  8. Development of Constraint Force Equation Methodology for Application to Multi-Body Dynamics Including Launch Vehicle Stage Seperation

    Science.gov (United States)

    Pamadi, Bandu N.; Toniolo, Matthew D.; Tartabini, Paul V.; Roithmayr, Carlos M.; Albertson, Cindy W.; Karlgaard, Christopher D.

    2016-01-01

    The objective of this report is to develop and implement a physics based method for analysis and simulation of multi-body dynamics including launch vehicle stage separation. The constraint force equation (CFE) methodology discussed in this report provides such a framework for modeling constraint forces and moments acting at joints when the vehicles are still connected. Several stand-alone test cases involving various types of joints were developed to validate the CFE methodology. The results were compared with ADAMS(Registered Trademark) and Autolev, two different industry standard benchmark codes for multi-body dynamic analysis and simulations. However, these two codes are not designed for aerospace flight trajectory simulations. After this validation exercise, the CFE algorithm was implemented in Program to Optimize Simulated Trajectories II (POST2) to provide a capability to simulate end-to-end trajectories of launch vehicles including stage separation. The POST2/CFE methodology was applied to the STS-1 Space Shuttle solid rocket booster (SRB) separation and Hyper-X Research Vehicle (HXRV) separation from the Pegasus booster as a further test and validation for its application to launch vehicle stage separation problems. Finally, to demonstrate end-to-end simulation capability, POST2/CFE was applied to the ascent, orbit insertion, and booster return of a reusable two-stage-to-orbit (TSTO) vehicle concept. With these validation exercises, POST2/CFE software can be used for performing conceptual level end-to-end simulations, including launch vehicle stage separation, for problems similar to those discussed in this report.

  9. The Capillary Flow Experiments Aboard the International Space Station: Increments 9-15

    Science.gov (United States)

    Jenson, Ryan M.; Weislogel, Mark M.; Tavan, Noel T.; Chen, Yongkang; Semerjian, Ben; Bunnell, Charles T.; Collicott, Steven H.; Klatte, Jorg; dreyer, Michael E.

    2009-01-01

    This report provides a summary of the experimental, analytical, and numerical results of the Capillary Flow Experiment (CFE) performed aboard the International Space Station (ISS). The experiments were conducted in space beginning with Increment 9 through Increment 16, beginning August 2004 and ending December 2007. Both primary and extra science experiments were conducted during 19 operations performed by 7 astronauts including: M. Fincke, W. McArthur, J. Williams, S. Williams, M. Lopez-Alegria, C. Anderson, and P. Whitson. CFE consists of 6 approximately 1 to 2 kg handheld experiment units designed to investigate a selection of capillary phenomena of fundamental and applied importance, such as large length scale contact line dynamics (CFE-Contact Line), critical wetting in discontinuous structures (CFE-Vane Gap), and capillary flows and passive phase separations in complex containers (CFE-Interior Corner Flow). Highly quantitative video from the simply performed flight experiments provide data helpful in benchmarking numerical methods, confirming theoretical models, and guiding new model development. In an extensive executive summary, a brief history of the experiment is reviewed before introducing the science investigated. A selection of experimental results and comparisons with both analytic and numerical predictions is given. The subsequent chapters provide additional details of the experimental and analytical methods developed and employed. These include current presentations of the state of the data reduction which we anticipate will continue throughout the year and culminate in several more publications. An extensive appendix is used to provide support material such as an experiment history, dissemination items to date (CFE publication, etc.), detailed design drawings, and crew procedures. Despite the simple nature of the experiments and procedures, many of the experimental results may be practically employed to enhance the design of spacecraft engineering

  10. Antidiabetic effects of chamomile flowers extract in obese mice through transcriptional stimulation of nutrient sensors of the peroxisome proliferator-activated receptor (PPAR family.

    Directory of Open Access Journals (Sweden)

    Christopher Weidner

    Full Text Available Given the significant increases in the incidence of metabolic diseases, efficient strategies for preventing and treating of these common disorders are urgently needed. This includes the development of phytopharmaceutical products or functional foods to prevent or cure metabolic diseases. Plant extracts from edible biomaterial provide a potential resource of structurally diverse molecules that can synergistically interfere with complex disorders. In this study we describe the safe application of ethanolic chamomile (Matricaria recutita flowers extract (CFE for the treatment and prevention of type 2 diabetes and associated disorders. We show in vitro that this extract activates in particular nuclear receptor peroxisome proliferator-activated receptor gamma (PPARγ and its isotypes. In a cellular context, in human primary adipocytes CFE administration (300 µg/ml led to specific expression of target genes of PPARγ, whereas in human hepatocytes CFE-induced we detected expression changes of genes that were regulated by PPARα. In vivo treatment of insulin-resistant high-fat diet (HFD-fed C57BL/6 mice with CFE (200 mg/kg/d for 6 weeks considerably reduced insulin resistance, glucose intolerance, plasma triacylglycerol, non-esterified fatty acids (NEFA and LDL/VLDL cholesterol. Co-feeding of lean C57BL/6 mice a HFD with 200 mg/kg/d CFE for 20 weeks showed effective prevention of fatty liver formation and hepatic inflammation, indicating additionally hepatoprotective effects of the extract. Moreover, CFE treatment did not reveal side effects, which have otherwise been associated with strong synthetic PPAR-targeting molecules, such as weight gain, liver disorders, hemodilution or bone cell turnover. Taken together, modulation of PPARs and other factors by chamomile flowers extract has the potential to prevent or treat type 2 diabetes and related disorders.

  11. Considerations for increasing unit 1 spent fuel pool capacity at the Laguna Verde station

    International Nuclear Information System (INIS)

    Vera, A.

    1992-01-01

    To increase the spent fuel storage capacity at the Laguna Verde Station in a safe and economical manner and assure a continuous operation of the first Mexican Nuclear Plant, Comision Federal de Electricidad (CFE), the Nation's Utility, seeked alternatives considering the overall world situation, the safety and licensing aspects, as well as the economics and the extent of the nuclear program of Mexico. This paper describes the alternatives considered, their evaluation and how the decision taken by CFE in this field, provides the Laguna Verde Station with a maximum of 37 years storage capacity plus full core reserve

  12. Current situation of spent fuel management in the Laguna Verde Nuclear Power Plant, Veracruz, Mexico

    International Nuclear Information System (INIS)

    Moreno, C.V.

    1994-01-01

    The Comision Federal de Electricidad (CFE), owner and operator of the Laguna Verde nuclear power plant (2 x 654 MWe BWR), has twice decided to increase the storage capacity of the spent fuel pools of the reactors. The Comision Nacional de Seguridad Nuclear y Salvaguardias (CNSNS), the national nuclear regulatory authority, approved the increase by a factor of 2.66 in the storage capacity proposal by CFE in 1989. Each reactor spent fuel pool can now hold 614 t HM. The reracking was done at a cost of about US $13 per kg U, which will add only 0.042 mills per kWh to the fuel cycle cost. (author)

  13. “El trabajo de evaluar de los docentes en el marco de las políticas de inclusión educativa: la política de evaluación de los aprendizajes”

    OpenAIRE

    Szilak, Sonia Marcela

    2016-01-01

    En el marco de las denominadas políticas de inclusión educativa iniciadas a partir de la obligatoriedad del nivel secundario en 2006, el Consejo Federal de Educación (CFE), establece la revisión de los formatos escolares denominados “tradicionales”, entre los que se encuentran las prácticas evaluativas. La Resolución Nº 84/09 del CFE aprueba los “Lineamientos político-estratégicos de la educación secundaria obligatoria” y propone “revisar la evaluación desde una perspectiva que con...

  14. An inquiry on managers use of decision-making tools in the core front end of the innovation process

    DEFF Research Database (Denmark)

    Appio, Francesco P.; Achiche, Sofiane; McAloone, Tim C.

    2013-01-01

    This paper focuses on the Core Front End (CFE) activities of the innovation process to say, Opportunity Identification and Opportunity Analysis. In the CFE of innovation, several tools are used to facilitate and optimise decisions. To select them, managers of the product development team have...... is chosen and how those tools impact specific performance metrics. From the analyses and hypotheses testing performed, it clearly emerges that there is no link between being aware of basic requirements (inputs/outputs) to appropriately use a certain tool and dimensions such as tools’ effectiveness...

  15. CARBON-ENHANCED METAL-POOR STARS IN THE INNER AND OUTER HALO COMPONENTS OF THE MILKY WAY

    International Nuclear Information System (INIS)

    Carollo, Daniela; Norris, John E.; Freeman, Ken C.; Beers, Timothy C.; Lee, Young Sun; Kennedy, Catherine R.; Bovy, Jo; Sivarani, Thirupathi; Aoki, Wako

    2012-01-01

    Carbon-enhanced metal-poor (CEMP) stars in the halo components of the Milky Way are explored, based on accurate determinations of the carbon-to-iron ([C/Fe]) abundance ratios and kinematic quantities for over 30,000 calibration stars from the Sloan Digital Sky Survey. Using our present criterion that low-metallicity stars exhibiting [C/Fe] ratios ( c arbonicity ) in excess of [C/Fe] =+0.7 are considered CEMP stars, the global frequency of CEMP stars in the halo system for [Fe/H] 5 kpc, the CarDF exhibits a strong tail toward high values, up to [C/Fe] > +3.0. We also find a clear increase in the CEMP frequency with |Z|. For stars with –2.0 < [Fe/H] <–1.5, the frequency grows from 5% at |Z| ∼2 kpc to 10% at |Z| ∼10 kpc. For stars with [Fe/H] <–2.0, the frequency grows from 8% at |Z| ∼2 kpc to 25% at |Z| ∼10 kpc. For stars with –2.0 < [Fe/H] <–1.5, the mean carbonicity is ([C/Fe]) ∼+1.0 for 0 kpc < |Z| < 10 kpc, with little dependence on |Z|; for [Fe/H] <–2.0, ([C/Fe]) ∼+1.5, again roughly independent of |Z|. Based on a statistical separation of the halo components in velocity space, we find evidence for a significant contrast in the frequency of CEMP stars between the inner- and outer-halo components—the outer halo possesses roughly twice the fraction of CEMP stars as the inner halo. The carbonicity distribution also differs between the inner-halo and outer-halo components—the inner halo has a greater portion of stars with modest carbon enhancement ([C/Fe] ∼+0.5]); the outer halo has a greater portion of stars with large enhancements ([C/Fe] ∼+2.0), although considerable overlap still exists. We interpret these results as due to the possible presence of additional astrophysical sources of carbon production associated with outer-halo stars, beyond the asymptotic giant-branch source that may dominate for inner-halo stars, with implications for the progenitors of these populations.

  16. Características de las crisis epilépticas en niños con insuficiencia renal crónica terminal.

    Directory of Open Access Journals (Sweden)

    Alan Luis Juárez Belaúnde

    2008-01-01

    Full Text Available Las crisis epilépticas son complicaciones frecuentes en niños que padecen de Insuficiencia Renal Crónica Terminal (IRC-T. Objetivo: Describir la frecuencia y características de las crisis epilépticas en niños con IRC-T. Material y Métodos: Estudio retrospectivo, tipo serie de casos. Se incluyeron 24 pacientes menores de 14 años de ambos sexos con IRC-T que presentaron al menos un episodio de crisis epiléptica, atendidos en el Hospital Nacional Cayetano Heredia entre enero de 1998 y marzo de 2006. Resultados: La frecuencia encontrada de crisis epiléptica en esta población fue de 24/188 (12,7%; 18/24 (75% se encontraban en tratamiento dialítico crónico al momento de presentarse la primera crisis epiléptica; las glomerulopatías fueron la etiología más frecuente de la IRC-T; la mayoría de niños (41,6% presentaron crisis parciales, y el hallazgo tomográfico más frecuente fue la hemorragia intraparenquimal. Conclusiones: La frecuencia de crisis epilépticas en esta serie de niños con IRC-T es menor que la descrita en la literatura revisada. (Rev Med Hered 2008;19:1-4.

  17. Instrument Remote Control via the Astronomical Instrument Markup Language

    Science.gov (United States)

    Sall, Ken; Ames, Troy; Warsaw, Craig; Koons, Lisa; Shafer, Richard

    1998-01-01

    The Instrument Remote Control (IRC) project ongoing at NASA's Goddard Space Flight Center's (GSFC) Information Systems Center (ISC) supports NASA's mission by defining an adaptive intranet-based framework that provides robust interactive and distributed control and monitoring of remote instruments. An astronomical IRC architecture that combines the platform-independent processing capabilities of Java with the power of Extensible Markup Language (XML) to express hierarchical data in an equally platform-independent, as well as human readable manner, has been developed. This architecture is implemented using a variety of XML support tools and Application Programming Interfaces (API) written in Java. IRC will enable trusted astronomers from around the world to easily access infrared instruments (e.g., telescopes, cameras, and spectrometers) located in remote, inhospitable environments, such as the South Pole, a high Chilean mountaintop, or an airborne observatory aboard a Boeing 747. Using IRC's frameworks, an astronomer or other scientist can easily define the type of onboard instrument, control the instrument remotely, and return monitoring data all through the intranet. The Astronomical Instrument Markup Language (AIML) is the first implementation of the more general Instrument Markup Language (IML). The key aspects of our approach to instrument description and control applies to many domains, from medical instruments to machine assembly lines. The concepts behind AIML apply equally well to the description and control of instruments in general. IRC enables us to apply our techniques to several instruments, preferably from different observatories.

  18. How good is technetium-99m mercaptoacetyltriglycine indirect cystography?

    International Nuclear Information System (INIS)

    Sadeleer, C. de; Boe, V. de; Keuppens, F.; Desprechins, B.; Verboven, M.; Piepsz, A.

    1994-01-01

    The aim of the present study was to estimate the sensitivity of indirect radionuclide cystography (IRC) performed with technetium-99m mercaptoacetyltriglycine (MAG3), in comparison with the micturition cystourethrography (MCUG) and direct radionuclide cystography (DRC), for the diagnosis of vesicoureteric reflux. Two groups of patients were selected: group I comprised 40 children who underwent IRC during the acute phase of urinary tract infection and an MCUG 6 weeks later; group II comprised 42 (other) children with known reflux, who underwent IRC and DRC during follow-up. Taking as the reference the total number of refluxing kidneys detected by means of any cystographic technique, 99m Tc-MAG3 ICR missed two-thirds of the refluxing kidneys. Most of the small refluxes were missed, but so too were 50% of the major refluxes. Taking as the reference 99m Tc dimercaptosuccinic acid (DMSA) scintigraphy, MCUG detected 91% of the patients with DMSA abnormalities on at least one kidney, DRC detected 95%, and IRC detected 46% and 43% respectively, in groups I and II. The use of 99m Tc-MAG3 IRC as the sole technique for the detection of vesicoureteric reflux gives rise to an unacceptable number of false-negative results. (orig.)

  19. A quantum generalization of intrinsic reaction coordinate using path integral centroid coordinates

    International Nuclear Information System (INIS)

    Shiga, Motoyuki; Fujisaki, Hiroshi

    2012-01-01

    We propose a generalization of the intrinsic reaction coordinate (IRC) for quantum many-body systems described in terms of the mass-weighted ring polymer centroids in the imaginary-time path integral theory. This novel kind of reaction coordinate, which may be called the ''centroid IRC,'' corresponds to the minimum free energy path connecting reactant and product states with a least amount of reversible work applied to the center of masses of the quantum nuclei, i.e., the centroids. We provide a numerical procedure to obtain the centroid IRC based on first principles by combining ab initio path integral simulation with the string method. This approach is applied to NH 3 molecule and N 2 H 5 - ion as well as their deuterated isotopomers to study the importance of nuclear quantum effects in the intramolecular and intermolecular proton transfer reactions. We find that, in the intramolecular proton transfer (inversion) of NH 3 , the free energy barrier for the centroid variables decreases with an amount of about 20% compared to the classical one at the room temperature. In the intermolecular proton transfer of N 2 H 5 - , the centroid IRC is largely deviated from the ''classical'' IRC, and the free energy barrier is reduced by the quantum effects even more drastically.

  20. Joint Integration Office Independent Review Committee annual report, 1985

    International Nuclear Information System (INIS)

    1986-08-01

    Comprised of seven persons with extensive experience in the issues of nuclear waste, the Independent Review Committee (IRC) provides independent and objective review of Defense Transuranic Waste Program (DTWP) activities managed by the Joint Integration Office (JIO), formerly the Defense Transuranic Waste Lead Organization (TLO). The Committee is ensured a broad, interdisciplinary perspective since its membership includes representatives from the fields of nuclear engineering, nuclear waste transportation, industrial quality control, systems and environmental engineering and state and local government. The scope of IRC activities includes overall review of specific TLO plans, projects and activities, and technical review of particular research and development projects. The Committee makes specific suggestions and recommendations based upon expertise in the field of TRU Waste Management. The IRC operates as a consulting group, under an independent charter providing objective review of program activities. This report summarizes the 12 major topics reviewed by the committee during 1985

  1. GENESIS AND DEVELOPMENT OF A “NONPARTISAN” POLITICAL ACTOR: The Formation of the Jama’ah Islah Malaysia (JIM and its Roots in Western Europe

    Directory of Open Access Journals (Sweden)

    Sophie Lemiere

    2009-02-01

    Full Text Available This paper looks at the genesis and development of the Jama’ah Islah Malaysia (JIM, a modernist-reformist Islamist organisation that today has played a vital and visible role in the political landscape of Malaysian politics. Little is known about the early genesis of JIM, and how it began in the 1970s and 1980s as a student-based cadre organisation, created by Malaysian Muslim students studying abroad in Europe and North America. JIM’s roots therefore lie in the Islamic Representative Council (IRC that was a semi-underground student-cadre movement that was created outside Malaysia, and which aimed to bring about the Islamisation of Malaysian society through the process of social and political mobilisation. Working through the archives of JIM today and interviewing the foundermembers of JIM and the IRC, this paper is the first historical account of the formation and development of IRC and JIM to be published. 

  2. Propaganda and Philanthropy: The Institute Bento da Rocha Cabral, the Lisbon Site of Biochemistry (1925-1953).

    Science.gov (United States)

    Carneiro, Ana; Amaral, Isabel

    2015-05-01

    This paper focuses on the internal organization and dynamics of the Institute Bento da Rocha Cabral (IRC) in Lisbon, a privately-funded institution devoted to biomedical research, from the particular vantage point of its laboratory of biochemistry; in particular, the process through which the institution turned from medically-related to chemically-related research in the period spanning from 1925 to 1953. The history of the IRC raises interesting questions regarding the social politics of science as it materialized the desire of leading physicians of the Faculty of Medicine of Lisbon to create proper physical facilities for medically-related scientific research. We argue that the process which led to the creation of the IRC coincided with the gradual professional and political ascendance of physicians in Portuguese society initiated in the late nineteenth century, and is closely associated with Portuguese republicanism and the process of Lisbon becoming the scientific capital.

  3. Deep learning approach for the detection and quantification of intraretinal cystoid fluid in multivendor optical coherence tomography

    Science.gov (United States)

    Venhuizen, Freerk G.; van Ginneken, Bram; Liefers, Bart; van Asten, Freekje; Schreur, Vivian; Fauser, Sascha; Hoyng, Carel; Theelen, Thomas; Sánchez, Clara I.

    2018-01-01

    We developed a deep learning algorithm for the automatic segmentation and quantification of intraretinal cystoid fluid (IRC) in spectral domain optical coherence tomography (SD-OCT) volumes independent of the device used for acquisition. A cascade of neural networks was introduced to include prior information on the retinal anatomy, boosting performance significantly. The proposed algorithm approached human performance reaching an overall Dice coefficient of 0.754 ± 0.136 and an intraclass correlation coefficient of 0.936, for the task of IRC segmentation and quantification, respectively. The proposed method allows for fast quantitative IRC volume measurements that can be used to improve patient care, reduce costs, and allow fast and reliable analysis in large population studies. PMID:29675301

  4. Institute of Radiochemistry. Annual report 1992

    International Nuclear Information System (INIS)

    Bernhard, G.

    1993-05-01

    The Institute for Radiochemistry of the Research Center Rossendorf Inc. (FZR) started its work on 1 January 1992. As part of the FZR the Institute of Radiochemistry (IRC) is supported by the Free State of Saxony and the Federal Republic of Germany on the basis of equal shares. Furthermore the IRC has experienced helpful support in form of additional grants. This Annual Report summerizes the research activities achieved in the first year. Some papers result from research activities done in the different divisions of radiochemistry of the former Nuclear Research Centre Rossendorf. Problems of radioecology influence the present research programme and profile of this institute. The major goal of the IRC is fundamental and applied research on the field of the transport behaviour of radiochemical pollutants in the biosphere. Owing to the fact that Saxony and Thuringia are partly contaminated from previous uranium mining activities these investigations are of actual importance. (orig./BBR)

  5. Interest rates mapping

    Science.gov (United States)

    Kanevski, M.; Maignan, M.; Pozdnoukhov, A.; Timonin, V.

    2008-06-01

    The present study deals with the analysis and mapping of Swiss franc interest rates. Interest rates depend on time and maturity, defining term structure of the interest rate curves (IRC). In the present study IRC are considered in a two-dimensional feature space-time and maturity. Exploratory data analysis includes a variety of tools widely used in econophysics and geostatistics. Geostatistical models and machine learning algorithms (multilayer perceptron and Support Vector Machines) were applied to produce interest rate maps. IR maps can be used for the visualisation and pattern perception purposes, to develop and to explore economical hypotheses, to produce dynamic asset-liability simulations and for financial risk assessments. The feasibility of an application of interest rates mapping approach for the IRC forecasting is considered as well.

  6. Constraining Phosphorus Chemistry in Carbon- and Oxygen-Rich Circumstellar Envelopes: Observations of PN, HCP, and CP

    Science.gov (United States)

    Milam, S. N.; Halfen, D. T.; Tenenbaum, E. D.; Apponi, A. J.; Woolf, N. J.; Ziurys, L. M.

    2008-09-01

    Millimeter-wave observations of PN, CP, and HCP have been carried out toward circumstellar envelopes of evolved stars using the Arizona Radio Observatory (ARO). HCP and PN have been identified in the carbon-rich source CRL 2688 via observations at 1 mm using the Submillimeter Telescope (SMT) and 2-3 mm with the Kitt Peak 12 m. An identical set of measurements were carried out toward IRC +10216, as well as observations of CP at 1 mm. PN was also observed toward VY Canis Majoris (VY CMa), an oxygen-rich supergiant star. The PN and HCP line profiles in CRL 2688 and IRC +10216 are roughly flat topped, indicating unresolved, optically thin emission; CP, in contrast, has a distinct "U" shape in IRC +10216. Modeling of the line profiles suggests abundances, relative to H2, of f(PN) ~ (3-5) × 10-9 and f(HCP) ~ 2 × 10-7 in CRL 2688, about an order of magnitude higher than in IRC +10216. In VY CMa, f(PN) is ~4 × 10-8. The data in CRL 2688 and IRC +10216 are consistent with LTE formation of HCP and PN in the inner envelope, as predicted by theoretical calculations, with CP a photodissociation product at larger radii. The observed abundance of PN in VY CMa is a factor of 100 higher than LTE predictions. In IRC +10216, the chemistry of HCP/CP mimics that of HCN/CN and suggests an N2 abundance of f ~ 1 × 10-7. The chemistry of phosphorus appears active in both carbon- and oxygen-rich envelopes of evolved stars.

  7. Kontrol af konventionelle våben i Europa

    DEFF Research Database (Denmark)

    Hoffmann, Rune; Kierulf, John; Pradhan-Blach, Flemming

    Rapporten indledes med en historisk gennemgang af tilblivelsen og udviklingen af Traktat om Konventionelle Væbnede Styrker i Europa (CFE), som blev iværksat af NATO og det tidligere Warszawapagten i 1973. Traktaten fastsætter et loft for antallet af kampvogne, pansrede kampkøretøjer, artilleripje...

  8. EUCOLEUS BOEHMI INFECTION IN THE NASAL CONCHAE AND PARANASAL SINUSES OF RED FOX (VULPES VULPES) ON PRINCE EDWARD ISLAND, CANADA.

    Science.gov (United States)

    Lopez, Alfonso; Aburto, Enrique; Jones, Kathleen; Robbins, William; Conboy, Gary

    2016-04-28

    Eucoleus boehmi (Nematoda: Capillariidae) occurs in the nasal conchae and paranasal sinuses of wild and domestic canids. We surveyed the red fox ( Vulpes vulpes ) on Prince Edward Island, Canada, for E. boehmi infection and characterized the associated histopathology. Nasal capillarid infections were detected based on histologic examination of three coronal sections of the nasal cavity and by centrifugal flotation examination (CFE) of rectal feces. Capillarids were detected in histologic sections in 28 of 36 (78%) foxes; detection occurred most frequently in the caudal section (28 foxes) and least in the rostral section (10 foxes). Adult worm morphology was typical for capillarids (stichosome esophagus, bacillary bands, bipolar plugged eggs); E. boehmi eggs were specifically identified based on the characteristic pitted shell wall surface. Adult worms were detected in histologic sections in all 28 and E. boehmi eggs in 21 of the positive foxes. No eggs of Eucoleus aerophilus were observed in any of the sections. Affected foxes had an eosinophilic and lymphoplasmacytic rhinitis with goblet cell hyperplasia. Eggs of E. aerophilus were detected on CFE in 20 of 36 (56%) foxes; 19 of the histologically positive foxes were coinfected with E. aerophilus. Eggs of E. boehmi were detected on CFE in 26 of 36 (72%) foxes and were consistent in size and morphology with those described from wild canids, but they differed from those reported from cases of infection in dogs. Prevalence based on identification of eggs on histologic section or CFE indicated 27 of 36 (75%) red foxes examined were infected with E. boehmi.

  9. A carbon nanotube/polyvanillin composite film as an electrocatalyst for the electrochemical oxidation of nitrite and its application as a nitrite sensor

    Energy Technology Data Exchange (ETDEWEB)

    Zheng Dongyun [College of Chemistry and Molecular Science, Wuhan University, Wuhan 430072 (China); State Key Laboratory of Transducer Technology, Chinese Academy of Sciences (China); Hu Chengguo [College of Chemistry and Molecular Science, Wuhan University, Wuhan 430072 (China); State Key Laboratory of Transducer Technology, Chinese Academy of Sciences (China)], E-mail: cghu@whu.edu.cn; Peng Yanfen [College of Chemistry and Molecular Science, Wuhan University, Wuhan 430072 (China); State Key Laboratory of Transducer Technology, Chinese Academy of Sciences (China); Hu Shengshui [College of Chemistry and Molecular Science, Wuhan University, Wuhan 430072 (China); State Key Laboratory of Transducer Technology, Chinese Academy of Sciences (China)], E-mail: sshu@whu.edu.cn

    2009-08-30

    We report a simple method for the stable dispersion of multi-walled carbon nanotubes (MWNTs) in water by vanillin and controllable surface addition onto carbon fiber microelectrodes (CFE) via electropolymerization. We have characterized these polyvanillin-carbon nanotube (PVN-MWNT) composite films with techniques including scanning electron microscopy (SEM), infrared spectroscopy (IR) and voltammetry. These investigations showed that the films have a uniform porous nanostructure with a large surface area. This PVN-MWNT composite-modified CFE (PVN-MWNT/CFE) exhibited a sensitive response to the electrochemical oxidation of nitrite. Under optimal working conditions, the oxidation peak current of nitrite linearly increased with its concentration in the range of 0.2 {mu}M-3.1 mM, with the system exhibiting a lower detection limit of 50 nM (S/N = 3). We successfully applied the PVN-MWNT/CFE system to the determination of nitrite from lake water. The efficient recovery of nitrite indicated that this electrode was able to detect nitrite in real samples.

  10. Efficiency of carbon removal per added iron in ocean iron fertilization

    NARCIS (Netherlands)

    de Baar, Hein J. W.; Gerringa, Loes J. A.; Laan, Patrick; Timmermans, Klaas R.

    2008-01-01

    The major response to ocean iron fertilization is by large diatoms, which at Fe-replete ambient seawater show an optimum C:Fe elemental ratio of similar to 23 000 and a higher ratio of similar to 160 000 or more under Fe-limited conditions. The efficiency of CO2 drawdown during the several weeks of

  11. Procedure of generation of the ECP database for Laguna Verde

    International Nuclear Information System (INIS)

    Perusquia C, R.

    1992-09-01

    This procedure will be used by the personnel of the Discipline of Nuclear Analysis of the Reactor of CFE to execute PRESTO with the purpose of generating the base for the Estimate of the Position of critical bars during the start up (ECP Database). (Author)

  12. 75 FR 71158 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing of Proposed Rule Change Relating...

    Science.gov (United States)

    2010-11-22

    ...://www.cfe.cboe.com ), automated quotation systems, published or other public sources, or on-line [[Page... and last-sale information regarding the Shares will be disseminated through the facilities of the... Optimized Portfolio Value (``IOPV'') will be calculated. The IOPV is an indicator of the value of the VIX...

  13. New CNT/poly(brilliant green) and CNT/poly(3,4-ethylenedioxythiophene) based electrochemical enzyme biosensors.

    Science.gov (United States)

    Barsan, Madalina M; Pifferi, Valentina; Falciola, Luigi; Brett, Christopher M A

    2016-07-13

    A combination of the electroactive polymer poly(brilliant green) (PBG) or conducting polymer poly(3,4-ethylenedioxythiophene) (PEDOT) with carbon nanotubes to obtain CNT/PBG and CNT/PEDOT modified carbon film electrodes (CFE) has been investigated as a new biosensor platform, incorporating the enzymes glucose oxidase (GOx) as test enzyme, alcohol oxidase (AlcOx) or alcohol dehydrogenase (AlcDH). The sensing parameters were optimized for all biosensors based on CNT/PBG/CFE, CNT/PEDOT/CFE platforms. Under optimized conditions, both GOx biosensors exhibited very similar sensitivities, while in the case of AlcOx and AlcDH biosensors, AlcOx/CNT/PBG/CFE was found to give a higher sensitivity and lower detection limit. The influence of dissolved O2 on oxidase-biosensor performance was investigated and was shown to be different for each enzyme. Comparisons were made with similar reported biosensors, showing the advantages of the new biosensors, and excellent selectivity against potential interferents was successfully demonstrated. Finally, alcohol biosensors were successfully used for the determination of ethanol in alcoholic beverages. Copyright © 2016 Elsevier B.V. All rights reserved.

  14. Substation automation. Integration of applications of the SICLE; Automatizacion de subestaciones. Integracion de aplicaciones sobre el SICLE

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez, Gustavo; Vega, Miguel [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1997-12-31

    This paper presents the first applications developed by the Instituto de Investigaciones Electricas (IIE) on the infrastructure of the SICLE (Sistema de Informacion y Control Local de la Estacion) (Station Information and Local Control System), that Comision Federal de Electricidad (CFE) is now acquiring in order to automate its transmission substations. A computer infrastructure was obtained similar to the existing in the substation for the development of program testing at the IIE; the personnel of the same was trained; the applications in conjunction with the CFE specialists were defined; the agreed developments were made and installed at the Temascal II Substation. [Espanol] En el presente articulo se presentan las primeras aplicaciones desarrolladas por el Instituto de Investigaciones Electricas (IIE) sobre la infraestructura del SICLE (Sistema de Informacion y Control Local de Estacion) que esta adquiriendo la Comision Federal de Electricidad (CFE) a fin de automatizar sus subestaciones de transmision. Se obtuvo una infraestructura de computo similar a la existente en la subestacion para el desarrollo de prueba de programas en el IIE; se capacito al personal en la misma; se definieron las aplicaciones conjuntamente con los especialistas de la CFE; se hicieron los desarrollos acordados y se instalaron en la subestacion Temascal II.

  15. Fuzzy Decision Support for Tools Selection in the Core Front End Activities of New Product Development

    DEFF Research Database (Denmark)

    Achiche, S.; Appio, F.P.; McAloone, Tim C.

    2013-01-01

    models (FDSM) of the discovered relationships. The decision support focuses upon the estimated investment needed for the use of tools during the CFE. The generation of FDSMs is carried out automatically using a specialized genetic algorithm, applied to learning data obtained from five experienced...

  16. Substation automation. Integration of applications of the SICLE; Automatizacion de subestaciones. Integracion de aplicaciones sobre el SICLE

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez, Gustavo; Vega, Miguel [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1998-12-31

    This paper presents the first applications developed by the Instituto de Investigaciones Electricas (IIE) on the infrastructure of the SICLE (Sistema de Informacion y Control Local de la Estacion) (Station Information and Local Control System), that Comision Federal de Electricidad (CFE) is now acquiring in order to automate its transmission substations. A computer infrastructure was obtained similar to the existing in the substation for the development of program testing at the IIE; the personnel of the same was trained; the applications in conjunction with the CFE specialists were defined; the agreed developments were made and installed at the Temascal II Substation. [Espanol] En el presente articulo se presentan las primeras aplicaciones desarrolladas por el Instituto de Investigaciones Electricas (IIE) sobre la infraestructura del SICLE (Sistema de Informacion y Control Local de Estacion) que esta adquiriendo la Comision Federal de Electricidad (CFE) a fin de automatizar sus subestaciones de transmision. Se obtuvo una infraestructura de computo similar a la existente en la subestacion para el desarrollo de prueba de programas en el IIE; se capacito al personal en la misma; se definieron las aplicaciones conjuntamente con los especialistas de la CFE; se hicieron los desarrollos acordados y se instalaron en la subestacion Temascal II.

  17. Synthesis, characterization and adsorptive properties of carbon with iron nanoparticles and iron carbide for the removal of As(V) from water.

    Science.gov (United States)

    Gutierrez-Muñiz, O E; García-Rosales, G; Ordoñez-Regil, E; Olguin, M T; Cabral-Prieto, A

    2013-01-15

    This manuscript presents the synthesis of carbon modified with iron nanoparticles (CFe) and iron carbide (CarFe) from the pyrolyzed crown leaves of pineapple (Ananas comosus) treated with iron salts. The materials that were obtained were used for the removal of As(V) from aqueous media. The carbonaceous materials were characterized by Scanning Electron Microscopy (SEM), Transmission electron microscopy (TEM), X-ray diffraction (XRD), X-Ray Photoelectron Spectroscopy (XPS) and Mossbauer Spectroscopy. The specific area (BET), number site density and point of zero charge (pH(pzc)) were also determined. The kinetic parameters were obtained by fitting the experimental data to the pseudo-first-order and pseudo-second-order models. Different isotherm models were applied to describe the As(V) adsorption behavior. The kinetics of As(V) sorption by CFe and CarFe was well defined for the pseudo-second-order model (R(2) = 0.9994 and 0.999, respectively). The maximum As(V) uptake was 1.8 mg g(-1) for CFe and 1.4 mg g(-1) for CarFe. The results obtained indicated that both materials are equally useful for As(V) sorption. The As(V) experimental isotherm data were described by the Freundlich model for CFe and CarFe. Copyright © 2012 Elsevier Ltd. All rights reserved.

  18. 76 FR 22939 - Self-Regulatory Organizations; CBOE Futures Exchange, LLC; Notice of Filing and Immediate...

    Science.gov (United States)

    2011-04-25

    ... SECURITIES AND EXCHANGE COMMISSION [Release No. 34-64153; File No. SR-CFE-2011-002] Self-Regulatory Organizations; CBOE Futures Exchange, LLC; Notice of Filing and Immediate Effectiveness of a Proposed Rule Change Relating to Listing and Trading CBOE Gold ETF Volatility Index Security Futures...

  19. 76 FR 20779 - Self-Regulatory Organizations; The Options Clearing Corporation; Notice of Filing and Immediate...

    Science.gov (United States)

    2011-04-13

    ... Change To Provide Legal Certainty for the Trading of Futures on the CBOE Gold ETF Volatility Index April... CBOE Gold ETF Volatility Index (``GVZ Index''). II. Self-Regulatory Organization's Statement of the..., LLC (``CFE'') as an up-to-the-minute market estimate of the expected volatility of SPDR Gold Shares...

  20. 77 FR 29629 - El Paso Natural Gas Company; Notice of Intent To Prepare an Environmental Assessment for the...

    Science.gov (United States)

    2012-05-18

    ... conveys with it the right of eminent domain. Therefore, if easement negotiations fail to produce an... five new power plants proposed for construction by the Mexican Commission Federal de Electricidad (CFE... areas subject to ground disturbance (examples include construction right-of-way, contractor/pipe storage...

  1. Hole-transporting transistors and circuits based on the transparent inorganic semiconductor copper(I) thiocyanate (CuSCN) processed from solution at room temperature

    KAUST Repository

    Pattanasattayavong, Pichaya; Yaacobi-Gross, Nir; Zhao, Kui; Ndjawa, Guy Olivier Ngongang; Li, Jinhua; Yan, Feng; O'Regan, Brian C.; Amassian, Aram; Anthopoulos, Thomas D.

    2012-01-01

    ferroelectric polymeric dielectric P(VDF-TrFE-CFE), we demonstrate low-voltage transistors with hole mobilities on the order of 0.1 cm2 V-1 s-1. By integrating two CuSCN transistors, unipolar logic NOT gates are also demonstrated. Copyright © 2013 WILEY

  2. Procedure of generation of the ECP database for Laguna Verde; Procedimiento de generacion de base de datos ECP para Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Perusquia C, R [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1992-09-15

    This procedure will be used by the personnel of the Discipline of Nuclear Analysis of the Reactor of CFE to execute PRESTO with the purpose of generating the base for the Estimate of the Position of critical bars during the start up (ECP Database). (Author)

  3. 78 FR 3949 - Self-Regulatory Organizations; CBOE Futures Exchange, LLC; Notice of Filing and Immediate...

    Science.gov (United States)

    2013-01-17

    ... amounts vary depending on the nature of the underlying violative conduct. This is because CFE regards... requires that each TPH have at all times at least one employee or agent (``Responsible Trader'') designated... violative conduct. The Exchange also may aggregate similar violations generally if the conduct was...

  4. Towards high dynamic range extensions of HEVC: subjective evaluation of potential coding technologies

    Science.gov (United States)

    Hanhart, Philippe; Řeřábek, Martin; Ebrahimi, Touradj

    2015-09-01

    This paper reports the details and results of the subjective evaluations conducted at EPFL to evaluate the responses to the Call for Evidence (CfE) for High Dynamic Range (HDR) and Wide Color Gamut (WCG) Video Coding issued by Moving Picture Experts Group (MPEG). The CfE on HDR/WCG Video Coding aims to explore whether the coding efficiency and/or the functionality of the current version of HEVC standard can be signi_cantly improved for HDR and WCG content. In total, nine submissions, five for Category 1 and four for Category 3a, were compared to the HEVC Main 10 Profile based Anchor. More particularly, five HDR video contents, compressed at four bit rates by each proponent responding to the CfE, were used in the subjective evaluations. Further, the side-by-side presentation methodology was used for the subjective experiment to discriminate small differences between the Anchor and proponents. Subjective results shows that the proposals provide evidence that the coding efficiency can be improved in a statistically noticeable way over MPEG CfE Anchors in terms of perceived quality within the investigated content. The paper further benchmarks the selected objective metrics based on their correlations with the subjective ratings. It is shown that PSNR-DE1000, HDRVDP- 2, and PSNR-Lx can reliably detect visible differences between the proposed encoding solutions and current HEVC standard.

  5. On problem of quantization of infinitely reduced communications of the first type

    International Nuclear Information System (INIS)

    Galazhinskij, A.V.; Deriglazov, A.A.

    1996-01-01

    Explicitly covariant pattern of adding-on of infinity reducible fermion communications of the first type (IRC1) up to nonreducible ones is suggested in a Hamiltonian form for the class of theories (including D=10 super-strings and super-particles in a covariant formulation). A modified formulation obtained after the implementation of the pattern in the theory covering IRC1 only, contains non-reducible communications of the first type and non-reducible communications of the second type separated from them. 12 refs

  6. Análisis comparativo de las complicaciones quirúrgicas en un programa de donación renal en asistolia no controlada

    OpenAIRE

    Guerrero Ramos, Félix, Félix

    2015-01-01

    La insuficiencia renal crónica (IRC) es una enfermedad con una importante incidencia y prevalencia en nuestro país, que conlleva un marcado deterioro de la calidad de vida, una elevada morbimortalidad y una gran carga económica para el sistema sanitario. El tratamiento de dicha condición es la terapia renal sustitutiva, bien con diálisis o con trasplante renal. El mejor tratamiento para los pacientes con IRC terminal es el trasplante de riñón, con beneficios a largo plazo tanto en supervivenc...

  7. Increase in local protein concentration by field-inversion gel electrophoresis

    Directory of Open Access Journals (Sweden)

    Paulus Aran

    2007-09-01

    Full Text Available Abstract Background Proteins that migrate through cross-linked polyacrylamide gels (PAGs under the influence of a constant electric field experience negative factors, such as diffusion and non-specific trapping in the gel matrix. These negative factors reduce protein concentrations within a defined gel volume with increasing migration distance and, therefore, decrease protein separation efficiency. Enhancement of protein separation efficiency was investigated by implementing pulsed field-inversion gel electrophoresis (FIGE. Results Separation of model protein species and large protein complexes was compared between FIGE and constant field electrophoresis (CFE in different percentages of PAGs. Band intensities of proteins in FIGE with appropriate ratios of forward and backward pulse times were superior to CFE despite longer running times. These results revealed an increase in band intensity per defined gel volume. A biphasic protein relative mobility shift was observed in percentages of PAGs up to 14%. However, the effect of FIGE on protein separation was stochastic at higher PAG percentage. Rat liver lysates subjected to FIGE in the second-dimension separation of two-dimensional polyarcylamide gel electrophoresis (2D PAGE showed a 20% increase in the number of discernible spots compared with CFE. Nine common spots from both FIGE and CFE were selected for peptide sequencing by mass spectrometry (MS, which revealed higher final ion scores of all nine protein spots from FIGE. Native protein complexes ranging from 800 kDa to larger than 2000 kDa became apparent using FIGE compared with CFE. Conclusion The present investigation suggests that FIGE under appropriate conditions improves protein separation efficiency during PAGE as a result of increased local protein concentration. FIGE can be implemented with minimal additional instrumentation in any laboratory setting. Despite the tradeoff of longer running times, FIGE can be a powerful protein

  8. Voxel based morphometry of FLAIR MRI in children with intractable focal epilepsy: Implications for surgical intervention

    International Nuclear Information System (INIS)

    Riney, Catherine J.; Chong, William K.; Clark, Chris A.; Cross, J. Helen

    2012-01-01

    Purpose: Magnetic resonance imaging (MRI), in particular fluid-attenuated inversion-recovery (FLAIR), has transformed the delineation of structural brain pathology associated with focal epilepsy. However, to date there is no literature on voxel based morphometry (VBM) of FLAIR in children with epilepsy. The aim of this study was to explore the role of visual and VBM assessment of FLAIR in pre-operative investigation of children with intractable focal epilepsy. Methods: Children with intractable epilepsy due to focal cortical dysplasia (FCD) and children with intractable cryptogenic focal epilepsy (CFE) were investigated. FLAIR and T1-weighted MRI were acquired on a 1.5T MRI scanner (Siemens, Erlangen, Germany). VBM was performed using SPM5 (Wellcome Institute of Cognitive Neuroscience, London). Results: Eight children with FCD (M = 5, age 7.9–17.3 years) and 14 children with CFE (M = 8, 7.8–16.8 years) were enrolled. VBM of FLAIR detected 7/8 (88%) of FCD whilst VBM of T1-weighted MRI detected only 3/8 (38%) FCD. VBM of FLAIR detected abnormality in 4/14 children with CFE, in 2/14 (14%) the abnormality was concordant with other data on the epileptogenic zone and with visible abnormality on repeat visual inspection of MR data. VBM of T1-weighed MRI detected abnormality in 2/14 children with CFE, none of which correlated with visible abnormality. Discussion: This study highlights the important role that FLAIR imaging has in the pre-operative assessment of children with intractable epilepsy. VBM of FLAIR may provide important information allowing selection of children with intractable CFE who are likely to benefit from further neuroradiological or neurophysiological evaluation.

  9. Increase in local protein concentration by field-inversion gel electrophoresis.

    Science.gov (United States)

    Tsai, Henghang; Low, Teck Yew; Freeby, Steve; Paulus, Aran; Ramnarayanan, Kalpana; Cheng, Chung-Pui Paul; Leung, Hon-Chiu Eastwood

    2007-09-26

    Proteins that migrate through cross-linked polyacrylamide gels (PAGs) under the influence of a constant electric field experience negative factors, such as diffusion and non-specific trapping in the gel matrix. These negative factors reduce protein concentrations within a defined gel volume with increasing migration distance and, therefore, decrease protein separation efficiency. Enhancement of protein separation efficiency was investigated by implementing pulsed field-inversion gel electrophoresis (FIGE). Separation of model protein species and large protein complexes was compared between FIGE and constant field electrophoresis (CFE) in different percentages of PAGs. Band intensities of proteins in FIGE with appropriate ratios of forward and backward pulse times were superior to CFE despite longer running times. These results revealed an increase in band intensity per defined gel volume. A biphasic protein relative mobility shift was observed in percentages of PAGs up to 14%. However, the effect of FIGE on protein separation was stochastic at higher PAG percentage. Rat liver lysates subjected to FIGE in the second-dimension separation of two-dimensional polyarcylamide gel electrophoresis (2D PAGE) showed a 20% increase in the number of discernible spots compared with CFE. Nine common spots from both FIGE and CFE were selected for peptide sequencing by mass spectrometry (MS), which revealed higher final ion scores of all nine protein spots from FIGE. Native protein complexes ranging from 800 kDa to larger than 2000 kDa became apparent using FIGE compared with CFE. The present investigation suggests that FIGE under appropriate conditions improves protein separation efficiency during PAGE as a result of increased local protein concentration. FIGE can be implemented with minimal additional instrumentation in any laboratory setting. Despite the tradeoff of longer running times, FIGE can be a powerful protein separation tool.

  10. A Hybrid Mineral Battery: Energy Storage and Dissolution Behavior of CuFeS2 in a Fixed Bed Flow Cell.

    Science.gov (United States)

    Deen, Kashif Mairaj; Asselin, Edouard

    2018-05-09

    The development of a hybrid system capable of storing energy and the additional benefit of Cu extraction is discussed in this work. A fixed bed flow cell (FBFC) was used in which a composite negative electrode containing CuFeS 2 (80 wt %) and carbon black (20 wt %) in graphite felt was separated from a positive (graphite felt) electrode by a proton-exchange membrane. The anolyte (0.2 m H 2 SO 4 ) and catholyte (0.5 m Fe 2+ in 0.2 m H 2 SO 4 with or without 0.1 m Cu 2+ ) were circulated in the cell. The electrochemical activity of the Fe 2+ /Fe 3+ redox couple over graphite felt significantly improved after the addition of Cu 2+ in the catholyte. Ultimately, in the CuFeS 2 ∥Fe 2+ /Cu 2+ (CFeCu) FBFC system, the specific capacity increased continuously to 26.4 mAh g -1 in 500 galvanostatic charge-discharge (GCD) cycles, compared to the CuFeS 2 ∥Fe 2+ (CFe) system (13.9 mAh g -1 ). Interestingly, the specific discharge energy gradually increased to 3.6 Wh kg -1 in 500 GCD cycles for the CFeCu system compared to 3.29 Wh kg -1 for the CFe system in 150 cycles. In addition to energy storage, 10.75 % Cu was also extracted from the mineral, which is an important feature of the CFeCu system as it would allow Cu extraction and recovery through hydrometallurgical methods. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Virtualization - A Key Cost Saver in NASA Multi-Mission Ground System Architecture

    Science.gov (United States)

    Swenson, Paul; Kreisler, Stephen; Sager, Jennifer A.; Smith, Dan

    2014-01-01

    With science team budgets being slashed, and a lack of adequate facilities for science payload teams to operate their instruments, there is a strong need for innovative new ground systems that are able to provide necessary levels of capability processing power, system availability and redundancy while maintaining a small footprint in terms of physical space, power utilization and cooling.The ground system architecture being presented is based off of heritage from several other projects currently in development or operations at Goddard, but was designed and built specifically to meet the needs of the Science and Planetary Operations Control Center (SPOCC) as a low-cost payload command, control, planning and analysis operations center. However, this SPOCC architecture was designed to be generic enough to be re-used partially or in whole by other labs and missions (since its inception that has already happened in several cases!)The SPOCC architecture leverages a highly available VMware-based virtualization cluster with shared SAS Direct-Attached Storage (DAS) to provide an extremely high-performing, low-power-utilization and small-footprint compute environment that provides Virtual Machine resources shared among the various tenant missions in the SPOCC. The storage is also expandable, allowing future missions to chain up to 7 additional 2U chassis of storage at an extremely competitive cost if they require additional archive or virtual machine storage space.The software architecture provides a fully-redundant GMSEC-based message bus architecture based on the ActiveMQ middleware to track all health and safety status within the SPOCC ground system. All virtual machines utilize the GMSEC system agents to report system host health over the GMSEC bus, and spacecraft payload health is monitored using the Hammers Integrated Test and Operations System (ITOS) Galaxy Telemetry and Command (TC) system, which performs near-real-time limit checking and data processing on the

  12. Design of cryogenic heat exchangers for a superconducting magnet

    International Nuclear Information System (INIS)

    Chrusciel, W.A.; Tao, B.Y.; Ventura, S.A.

    1976-01-01

    Computer programs were written to design and simulate the behavior of three heat exchangers for cooling supercritical helium to approximately 4.3 0 K at 4 atm. Helium, at 1, 3, or 5 gm/sec, is cooled by passing it through 0.635-cm-diam copper tubing immersed in a liquid nitrogen bath, through a copper, concentric tube, counter-current heat exchanger, and then through 0.635-cm copper tubing immersed in a liquid helium bath. The helium then enters a superconducting test magnet and finally passes through the annulus of the countercurrent exchanger before venting to the atmosphere. Several acceptable designs are presented that meet design and space limitations

  13. Scalable Integrated Multi-Mission Support System Simulator Release 3.0

    Science.gov (United States)

    Kim, John; Velamuri, Sarma; Casey, Taylor; Bemann, Travis

    2012-01-01

    The Scalable Integrated Multi-mission Support System (SIMSS) is a tool that performs a variety of test activities related to spacecraft simulations and ground segment checks. SIMSS is a distributed, component-based, plug-and-play client-server system useful for performing real-time monitoring and communications testing. SIMSS runs on one or more workstations and is designed to be user-configurable or to use predefined configurations for routine operations. SIMSS consists of more than 100 modules that can be configured to create, receive, process, and/or transmit data. The SIMSS/GMSEC innovation is intended to provide missions with a low-cost solution for implementing their ground systems, as well as significantly reducing a mission s integration time and risk.

  14. An integrated leak detection system for the ALMR steam generator

    International Nuclear Information System (INIS)

    Dayal, Y.; Gaubatz, D.C.; Wong, K.K.; Greene, D.A.

    1995-01-01

    The steam generator (SG) of the Advanced Liquid Metal Reactor (ALMR) system serves as a heat exchanger between the shell side secondary loop hot liquid sodium and the tube side water/steam mixture. A leak in the tube will result in the injection of the higher pressure water/steam into the sodium and cause an exothermic sodium-water reaction. An initial small leak (less than 1 gm/sec) can escalate into an intermediate size leak in a relatively short time by self enlargement of the original flaw and by initiating leaks in neighboring tubes. If not stopped, complete rupture of one or more tubes can cause injection rates of thousands of gm/sec and result in the over pressurization of the secondary loop rupture disk and dumping of the sodium to relieve pressure. The down time associated with severe sodium-water reaction damage has great adverse economic consequence. An integrated leak detection system (ILDS) has been developed which utilizes both chemical and acoustic sensors for improved leak detection. The system provides SG leak status to the reactor operator and is reliable enough to trigger automatic control action to protect the SG. The ILDS chemical subsystem uses conventional in-sodium and cover gas hydrogen detectors and incorporates knowledge based effects due to process parameters for improved reliability. The ILDS acoustic subsystem uses an array of acoustic sensors and incorporates acoustic beamforming technology for highly reliable and accurate leak identification and location. The new ILDS combines the small leak detection capability of the chemical system with the reliability and rapid detection/location capability of the acoustic system to provide a significantly improved level of protection for the SG over a wide range of operation conditions. (author)

  15. Facilitating community water supply treatment : from transferring filtration technology to multi-stakeholder learning

    NARCIS (Netherlands)

    Visscher, J.T.

    2006-01-01

    For more than a quarter of a century, IRC has been supporting the development of Slow Sand Filtration (SSF) and more recently, together with CINARA, the pioneering of Multi-Stage Filtration (MSF) - a combination of Gravel Filtration and SSF that has been shown to have great potential as an effective

  16. Corrosion-Resistant Alkyd Coatings

    Science.gov (United States)

    1992-02-18

    vegetable oil fatty acids. These fatty acids can be used alone or in combination. Spc:fic*!!y, a .-.ixture of neopentyl glycol , trimethylolpropane...hvdroxyl groups in the molecule. Examples of such alcohol. ,irc ethylene glycol . dicthylene glycol . methylc-v: jdunl. propylene glycol . dipropylene... glycol , butanediol. nco- pentyl glycol , butylene glycols . pcntanediol. 2.3-dime- thylpropanediol, hexanediols, hydrogenated bisphennl- A

  17. Uus mõtlemine algab koolipingist / David White ; interv. Nils Niitra

    Index Scriptorium Estoniae

    White, David

    2006-01-01

    Ilmunud ka: Postimees 2. okt. lk. 5. Euroopa Komisjoni tööstuse peadirektoraadi innovatsioonipoliitika direktor käis Tartus Euroopa tehnoloogiasiirde IRC võrgustiku aastakonverentsil ja vastas küsimustele innovatsiooni kohta Euroopas, USA-s ja Eestis

  18. 76 FR 53025 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2011-08-24

    ... currently approved collection. Title: T.D. 8905--Preparer Due Diligence Requirements for Determining Earned... diligence requirements under section 6695(g) of the Internal Revenue Code for paid preparers of Federal... collection. Title: Report of Employer-Owned Life Insurance Contracts. Form: 8925. Abstract: IRC 6039I...

  19. 78 FR 10692 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2013-02-14

    ... DEPARTMENT OF THE TREASURY Internal Revenue Service Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G AGENCY: Internal Revenue Service (IRS), Treasury. ACTION: Notice. SUMMARY: This notice is provided in accordance with IRC section 6039G of the Health...

  20. On the Potential of Interference Rejection Combining in B4G Networks

    DEFF Research Database (Denmark)

    Tavares, Fernando Menezes Leitão; Berardinelli, Gilberto; Mahmood, Nurul Huda

    2013-01-01

    ) receivers. By simulation we investigate two significantly different interference scenarios with dense small cell deployment. The results show that IRC brings considerable improvement in outage as well as in peak and median throughputs in both scenarios, and thus has a big potential as a capacity...

  1. 32 CFR Appendix A to Part 86 - Criminal History Background Check Procedures

    Science.gov (United States)

    2010-07-01

    ... responsibility in ensuring a safe and secure environment for children within DoD activities or private... installation level. An IRC will be completed on individuals with a DoD affiliation such as living or working on... checks through the SCHR to personnel offices working with law enforcement or investigative agencies. They...

  2. 75 FR 65708 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-10-26

    ... Director. Section 1.6072(b), (c), (d), and (e) of the IRC deals with the filing dates of certain corporate... information is used to insure timely filing of corporate income tax returns. Respondents: Individuals or... change their methods of accounting for the capitalization of interest. Respondents: Individuals or...

  3. Creep Behavior of Structural Insulated Panels (SIPS): Results from a Pilot Study

    Science.gov (United States)

    Dwight McDonald; Marshall Begel; C. Adam Senalik; Robert Ross; Thomas D. Skaggs; Borjen Yeh; Thomas Williamson

    2014-01-01

    Structural insulated panels (SIPs) have been recognized as construction materials in the International Residential Code (IRC) since 2009. Although most SIPs are used in wall applications, they can also be used as roof or floor panels that are subjected to long-term transverse loading, for which SIP creep performance may be critical in design. However, limited...

  4. Quality of care and its determinants in longer term mental health facilities across Europe; a cross-sectional analysis

    NARCIS (Netherlands)

    Killaspy, Helen; Cardoso, Graca; White, Sarah; Wright, Christine; Caldas de Almeida, Jose Miguel; Turton, Penny; Taylor, Tatiana L.; Schuetzwohl, Matthias; Schuster, Mirjam; Cervilla, Jorge A.; Brangier, Paulette; Raboch, Jiri; Kalisova, Lucie; Onchev, Georgi; Alexiev, Spiridon; Mezzina, Roberto; Ridente, Pina; Wiersma, Durk; Visser, Ellen; Kiejna, Andrzej; Adamowski, Tomasz; Ploumpidis, Dimitris; Gonidakis, Fragiskos; King, Michael

    2016-01-01

    Background: The Quality Indicator for Rehabilitative Care (QuIRC) is an international, standardised quality tool for the evaluation of mental health facilities that provide longer term care. Completed by the service manager, it comprises 145 items that assess seven domains of care: living

  5. The Effect of Prophylactic Polishing Pastes on Surface Roughness of Indirect Restorative Materials

    Directory of Open Access Journals (Sweden)

    Esra Can Say

    2014-01-01

    Full Text Available The purpose of this study was to evaluate the influence of prophylactic polishing pastes (PPP; Detartrine (DT, Topex (TP on surface roughness (Ra of indirect composites (IRC; Tescera (TES, Gradia (GRD, and Estenia C&B (EST, a glass ceramic (Empress 2 layering (E2, and a leucite reinforced glass ceramic (Empress Esthetic (EE with two different (glazed (G; polished (P surface preparations. A total of 90 IRC and 120 ceramic discs, 8 mm in diameter and 2 mm thick, were prepared. E2 and EE specimens were randomly divided into two groups (n=30. One group was glazed (GE2; GEE, while the other group was polished (PE2; PEE the same as the IRCs. The specimens in each group were subsequently divided into three subgroups: control (C, DT, and TP. Ra (μm was evaluated with a profilometer. Data were analyzed by Kruskal Wallis, followed by the Dunn's multiple comparison tests P0.05. PE2 and PEE were not affected by DT or TP P>0.05, while GE2 and GEE exhibited significant roughening after TP P<0.05. Surface roughness of IRCs and glazed ceramics can be affected by PPP applications.

  6. Detection of interstellar vibrationally excited HCN

    International Nuclear Information System (INIS)

    Ziurys, L.M.; Turner, B.E.

    1986-01-01

    Vibrationally excited HCN has been observed for the first time in the interstellar medium. The J = 3-2 rotational transitions of the l-doubled (0,1/sup 1d/,1c, 0) bending mode of HCN have been detected toward Orion-KL and IRC +10216. In Orion, the overall column density in the (0,1,0) mode, which exclusively samples the ''hot core,'' is 1.7-10 16 cm -2 and can be understood in terms of the ''doughnut'' model for Orion. The ground-state HCN column density implied by the excited-state observations is 2.3 x 10 18 cm -2 in the hot core, at least one order of magnitude greater than the column densities derived for HCN in its spike and plateau/doughnut components. Radiative excitation by 14 μm flux from IRc2 accounts for the (0,1,0) population provided the hot core is approx.6-7 x 10 16 cm distant from IRc2, in agreement with the ''cavity'' model for KL. Toward IRC +10216 we have detected J = 3-2 transitions of both (0,1/sup 1c/,/sup 1d/,0) and (0,2 0 ,0) excited states. The spectral profiles have been modeled to yield abundances and excitation conditions throughout the expanding envelope

  7. Mission Planning Systems for Tactical Aircraft (Pre-Flight and In- Flight) (Systemes de Planification des Missions pour Avions Tactiques (Avant Vol et en Vol)

    Science.gov (United States)

    1991-05-01

    NIilitary,%ircsTai R ite P I tti71gSI ’ --- -’I Uttotmmand. Conttrol. Cumin ITtcatituns anti IBegye Intelligence ACS Manetiver Control Ssisrnm (’A~IAL...has either been introduced recently or is high workload and stress on the unaided operator, and it is imminent. These are reviewed elsewhere in this

  8. Inulin rich carbohydrates extraction from Jerusalem artichoke (Helianthus tuberosus L.) tubers and application of different drying methods.

    Science.gov (United States)

    Rubel, Irene A; Iraporda, Carolina; Novosad, Rocio; Cabrera, Fernanda A; Genovese, Diego B; Manrique, Guillermo D

    2018-01-01

    In this study the operational extraction variables to obtain higher yields of inulin from Jerusalem artichoke tubers (JAT), as well as the optimal conditions to obtain a stable and dispersible powdered product by either spray or freeze drying, were studied. With this purpose, the powder yield, moisture content, water activity and flowability or products obtained by different experimental conditions were analyzed. Inulin rich carbohydrates (IRC) extraction was performed from lyophilized and ground tubers employing distilled hot water as solvent. It was proved that the solid:solvent ratio (S:S) was the critical variable in the extraction process, followed by temperature. Thus, the IRC extraction was optimal without ultrasound assistance, at 76°C, employing a S:S of 1:16, during 90min. In addition, the powder obtained by freeze-drying of the IRC extract showed advantages respect to powders obtained by spray-drying regarding the yield and considering that maltodextrin was not necessary as encapsulation agent. In another hand, spray drying process provided IRC powered materials with appropriate flow properties, and taking into account cost and time of production, this method should be considered as an alternative of freeze-drying. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. 77 FR 72999 - Small Brewers Bond Reduction

    Science.gov (United States)

    2012-12-07

    ... 1986 (IRC), pertains to the taxation of distilled spirits, wines, and beer (see title 26 of the United... qualification of breweries, bonds and taxation, removals without payment of tax, and records and reporting..., including the increased number of small (``craft'') brewers. In an advance notice of proposed rulemaking...

  10. Enhancing the Equating of Item Difficulty Metrics: Estimation of Reference Distribution. Research Report. ETS RR-14-07

    Science.gov (United States)

    Ali, Usama S.; Walker, Michael E.

    2014-01-01

    Two methods are currently in use at Educational Testing Service (ETS) for equating observed item difficulty statistics. The first method involves the linear equating of item statistics in an observed sample to reference statistics on the same items. The second method, or the item response curve (IRC) method, involves the summation of conditional…

  11. 77 FR 23806 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2012-04-20

    ...- determinations made by a regulated investment company (RIC) or a real estate investment trust (REIT). IRC section...--Miscellaneous Sections Affected by the Taxpayer Bill of Rights 2 and the Personal Responsibility and Work... and certain fees. The regulations reflect changes to the law made by the Taxpayer Bill of Rights 2 and...

  12. Current Business and Economics Driven Discourse and Education: Perspectives from around the World. BCES Conference Books, Volume 15

    Science.gov (United States)

    Popov, Nikolay, Ed.; Wolhuter, Charl, Ed.; Kalin, Jana, Ed.; Hilton, Gillian, Ed.; Ogunleye, James, Ed.; Niemczyk, Ewelina, Ed.; Chigisheva, Oksana, Ed.

    2017-01-01

    This volume contains selected papers submitted to the 15th Annual International Conference of the Bulgarian Comparative Education Society (BCES), held in June 2017 in Borovets, Bulgaria, and papers submitted to the 5th International Partner Conference of the International Research Centre (IRC) "Scientific Cooperation," Rostov-on-Don,…

  13. 27 CFR 70.501 - Meaning of terms.

    Science.gov (United States)

    2010-04-01

    .... District director of customs. The district director of customs at a headquarters port of the district....; and the port director at a port not designated as a headquarters port. I.R.C. Internal Revenue Code of..., estate, partnership, association, company, or corporation. Tax. Any tax imposed by 26 U.S.C. 5001-5066...

  14. Effects in Post-Conflict West Africa of Teacher Training for Refugee Women

    Science.gov (United States)

    Shepler, Susan; Routh, Sharyn

    2012-01-01

    This article draws data from an innovative research project tracing former refugee teachers who received teacher training from the International Rescue Committee (IRC) over a 17-year-long education programme in refugee camps in Guinea (1991-2008). The research traced repatriated refugee teachers who had returned to their homes in Sierra Leone and…

  15. Effect of infrared-C radiation on skin temperature, electrodermal conductance and pain in hemiparetic stroke patients.

    Science.gov (United States)

    Lin, Chun-Chih; Chiang, Yong-Shun; Lung, Chia-Chi

    2015-01-01

    A novel application of infrared-C (IR-C) radiation (3-1000 μm) on hemiparetic stroke patients was evaluated. Hot compresses (HC) were used on the paretic shoulders of patients in this placebo-controlled trial to investigate the effects of IR-C on skin temperature, electrodermal conductance (EC) and pain relief. Skin temperature at the center of the middle deltoid (CMD), Quchi (LI11), and the center of the third metacarpal bone on dorsum of hand (COT) of the subjects at Brunnstrom stage 3-5 before and after IR-C HC, were examined. Meanwhile, EC was measured on Hegu (LI4), Quchi and Juanyu (LI15). Pain intensity was evaluated before and after treatment. Skin temperature increased significantly at the CMD and COT on the paretic side in males. In females after treatment, similar skin temperatures were found in each measured region on both the paretic and non-paretic sides. The EC on the paretic side tended to be higher than the non-paretic side before treatment. After treatment, the EC on paretic side declined in both sexes and became even lower than the non-paretic side in females. Pain intensity was lessened after treatment especially in males, which appeared to correspond with an increase in skin temperature and a decrease in EC. IR-C hot compress is a promising method for stroke patients in rehabilitation. Physiological mechanisms of this treatment were proposed and summarized from this research.

  16. 77 FR 61474 - Proposed Information Collection; Comment Request

    Science.gov (United States)

    2012-10-09

    ... Election filed under I.R.C. 83(b). OMB Number: 1545-2018. Form Number: Rev. Proc. 2006-31. Abstract: This... burden, invites the general public and other Federal agencies to take this opportunity to comment on... continuing effort to reduce paperwork and respondent burden, invite the general public and other Federal...

  17. Detection of HC11N in the cold dust cloud TMC-1

    International Nuclear Information System (INIS)

    Bell, M.B.; Matthews, H.E.

    1985-01-01

    The detection of the J = 41 = 40 rotational transition of HC11N in the direction of the Taurus molecular cloud complex is reported. The line strength is in good agreement with predicted values, and the rotational parameters, althrough determined more accurately with these results, remain unchanged from those obtained previously using observations of IRC + 10 deg 216 alone. 14 references

  18. Design and validation of standardized clinical and functional remission criteria in schizophrenia

    Directory of Open Access Journals (Sweden)

    Mosolov SN

    2014-01-01

    Full Text Available Sergey N Mosolov,1 Andrey V Potapov,1 Uriy V Ushakov,2 Aleksey A Shafarenko,1 Anastasiya B Kostyukova11Department of Mental Disorders Therapy, Moscow Research Institute of Psychiatry, Moscow, Russia; 2Moscow Psychiatric Outpatient Services #21, Moscow, RussiaBackground: International Remission Criteria (IRC for schizophrenia were developed recently by a group of internationally known experts. The IRC detect only 10%–30% of cases and do not cover the diversity of forms and social functioning. Our aim was to design a more applicable tool and validate its use – the Standardized Clinical and Functional Remission Criteria (SCFRC.Methods: We used a 6-month follow-up study of 203 outpatients from two Moscow centers and another further sample of stable patients from a 1-year controlled trial of atypical versus typical medication. Diagnosis was confirmed by International Classification of Diseases Version 10 (ICD10 criteria and the Mini-International Neuropsychiatric Interview (MINI. Patients were assessed by the Positive and Negative Syndrome Scale, including intensity threshold, and further classified using the Russian domestic remission criteria and the level of social and personal functioning, according to the Personal and Social Performance Scale (PSP. The SCFRC were formulated and were validated by a data reanalysis on the first population sample and on a second independent sample (104 patients and in an open-label prospective randomized 12-month comparative study of risperidone long-acting injectable (RLAI versus olanzapine.Results: Only 64 of the 203 outpatients (31.5% initially met the IRC, and 53 patients (26.1% met the IRC after 6 months, without a change in treatment. Patients who were in remission had episodic and progressive deficit (39.6%, or remittent (15% paranoid schizophrenia, or schizoaffective disorder (17%. In addition, 105 patients of 139 (51.7%, who did not meet symptomatic IRC, remained stable within the period. Reanalysis of

  19. Information system for data management of civil buildings instrumentation in generating power stations; Sistema de informacion para el manejo de datos de la instrumentacion de las obras civiles de las centrales generadoras

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado, Alonso; Escamilla, Juan Carlos; Alaniz, Felipe de Jesus [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Gonzalez, Francisco; Mena, Enrique [Comision Federal de Electricidad, Mexico, D. F. (Mexico)

    1997-12-31

    A relevant task performed by Comision Federal de Electricidad (CFE) is the analysis of the structural behavior and safety assessment of the country`s large electric energy generating stations. This task is performed capturing, revising an analyzing the information generated by measuring instruments installed in the power station civil structures. Such activity generates a large amount of data and the collection, analysis and assessment is a long and tiresome process; additionally, the generated information is kept in plain isolated files, that causes sluggishness in the process and delays in the access to the information. This article describes the characteristics of the Information System for Structure Measurements (Sistema de Informacion de Medicion de Estructuras) (SIME), developed by the Instituto de Investigaciones Electricas (IIE) for CFE in order to enhance the opportunity for the information management. SIME captures, arranges, stores and reports the data obtained from the measurements at the works with great efficiency and flexibility. This system is part of another of greater scope with which CFE will ensure an optimum operation condition of its civil buildings. [Espanol] Una tarea relevante que realiza la Comision Federal de Electricidad (CFE) es analizar el comportamiento estructural y evaluar la seguridad de las grandes obras generadoras de energia electrica del pais. Esta tarea la realiza capturando, revisando y analizando la informacion que generan instrumentos de medicion instalados en las estructuras civiles de las centrales. Tal actividad genera gran cantidad de datos y el proceso de recopilacion, analisis y evaluacion es tardado y tedioso; ademas, la informacion que se genera se guarda en archivos planos aislados, lo que ocasiona lentitud en el proceso y retraso en el acceso a la informacion. Este articulo describe las caracteristicas del Sistema de Informacion de Medicion de Estructuras (SIME) desarrollado por el Instituto de Investigaciones

  20. Connectivity-based fixel enhancement: Whole-brain statistical analysis of diffusion MRI measures in the presence of crossing fibres

    Science.gov (United States)

    Raffelt, David A.; Smith, Robert E.; Ridgway, Gerard R.; Tournier, J-Donald; Vaughan, David N.; Rose, Stephen; Henderson, Robert; Connelly, Alan

    2015-01-01

    In brain regions containing crossing fibre bundles, voxel-average diffusion MRI measures such as fractional anisotropy (FA) are difficult to interpret, and lack within-voxel single fibre population specificity. Recent work has focused on the development of more interpretable quantitative measures that can be associated with a specific fibre population within a voxel containing crossing fibres (herein we use fixel to refer to a specific fibre population within a single voxel). Unfortunately, traditional 3D methods for smoothing and cluster-based statistical inference cannot be used for voxel-based analysis of these measures, since the local neighbourhood for smoothing and cluster formation can be ambiguous when adjacent voxels may have different numbers of fixels, or ill-defined when they belong to different tracts. Here we introduce a novel statistical method to perform whole-brain fixel-based analysis called connectivity-based fixel enhancement (CFE). CFE uses probabilistic tractography to identify structurally connected fixels that are likely to share underlying anatomy and pathology. Probabilistic connectivity information is then used for tract-specific smoothing (prior to the statistical analysis) and enhancement of the statistical map (using a threshold-free cluster enhancement-like approach). To investigate the characteristics of the CFE method, we assessed sensitivity and specificity using a large number of combinations of CFE enhancement parameters and smoothing extents, using simulated pathology generated with a range of test-statistic signal-to-noise ratios in five different white matter regions (chosen to cover a broad range of fibre bundle features). The results suggest that CFE input parameters are relatively insensitive to the characteristics of the simulated pathology. We therefore recommend a single set of CFE parameters that should give near optimal results in future studies where the group effect is unknown. We then demonstrate the proposed method

  1. Regeneration of long-distance peripheral nerve defects after delayed reconstruction in healthy and diabetic rats is supported by immunomodulatory chitosan nerve guides.

    Science.gov (United States)

    Stenberg, Lena; Stößel, Maria; Ronchi, Giulia; Geuna, Stefano; Yin, Yaobin; Mommert, Susanne; Mårtensson, Lisa; Metzen, Jennifer; Grothe, Claudia; Dahlin, Lars B; Haastert-Talini, Kirsten

    2017-07-18

    Delayed reconstruction of transection or laceration injuries of peripheral nerves is inflicted by a reduced regeneration capacity. Diabetic conditions, more frequently encountered in clinical practice, are known to further impair regeneration in peripheral nerves. Chitosan nerve guides (CNGs) have recently been introduced as a new generation of medical devices for immediate peripheral nerve reconstruction. Here, CNGs were used for 45 days delayed reconstruction of critical length 15 mm rat sciatic nerve defects in either healthy Wistar rats or diabetic Goto-Kakizaki rats; the latter resembling type 2 diabetes. In short and long-term investigations, we comprehensively analyzed the performance of one-chambered hollow CNGs (hCNGs) and two-chambered CNGs (CFeCNGs) in which a chitosan film has been longitudinally introduced. Additionally, we investigated in vitro the immunomodulatory effect provided by the chitosan film. Both types of nerve guides, i.e. hCNGs and CFeCNGs, enabled moderate morphological and functional nerve regeneration after reconstruction that was delayed for 45 days. These positive findings were detectable in generally healthy as well as in diabetic Goto-Kakizaki rats (for the latter only in short-term studies). The regenerative outcome did not reach the degree as recently demonstrated after immediate reconstruction using hCNGs and CFeCNGs. CFeCNG-treatment, however, enabled tissue regrowth in all animals (hCNGs: only in 80% of animals). CFeCNGs did further support with an increased vascularization of the regenerated tissue and an enhanced regrowth of motor axons. One mechanism by which the CFeCNGs potentially support successful regeneration is an immunomodulatory effect induced by the chitosan film itself. Our in vitro results suggest that the pro-regenerative effect of chitosan is related to the differentiation of chitosan-adherent monocytes into pro-healing M2 macrophages. No considerable differences appear for the delayed nerve regeneration

  2. Information system for data management of civil buildings instrumentation in generating power stations; Sistema de informacion para el manejo de datos de la instrumentacion de las obras civiles de las centrales generadoras

    Energy Technology Data Exchange (ETDEWEB)

    Alvarado, Alonso; Escamilla, Juan Carlos; Alaniz, Felipe de Jesus [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Gonzalez, Francisco; Mena, Enrique [Comision Federal de Electricidad, Mexico, D. F. (Mexico)

    1998-12-31

    A relevant task performed by Comision Federal de Electricidad (CFE) is the analysis of the structural behavior and safety assessment of the country`s large electric energy generating stations. This task is performed capturing, revising an analyzing the information generated by measuring instruments installed in the power station civil structures. Such activity generates a large amount of data and the collection, analysis and assessment is a long and tiresome process; additionally, the generated information is kept in plain isolated files, that causes sluggishness in the process and delays in the access to the information. This article describes the characteristics of the Information System for Structure Measurements (Sistema de Informacion de Medicion de Estructuras) (SIME), developed by the Instituto de Investigaciones Electricas (IIE) for CFE in order to enhance the opportunity for the information management. SIME captures, arranges, stores and reports the data obtained from the measurements at the works with great efficiency and flexibility. This system is part of another of greater scope with which CFE will ensure an optimum operation condition of its civil buildings. [Espanol] Una tarea relevante que realiza la Comision Federal de Electricidad (CFE) es analizar el comportamiento estructural y evaluar la seguridad de las grandes obras generadoras de energia electrica del pais. Esta tarea la realiza capturando, revisando y analizando la informacion que generan instrumentos de medicion instalados en las estructuras civiles de las centrales. Tal actividad genera gran cantidad de datos y el proceso de recopilacion, analisis y evaluacion es tardado y tedioso; ademas, la informacion que se genera se guarda en archivos planos aislados, lo que ocasiona lentitud en el proceso y retraso en el acceso a la informacion. Este articulo describe las caracteristicas del Sistema de Informacion de Medicion de Estructuras (SIME) desarrollado por el Instituto de Investigaciones

  3. Finite Element Based Pelvic Injury Metric Creation and Validation in Lateral Impact for a Human Body Model.

    Science.gov (United States)

    Weaver, Caitlin; Baker, Alexander; Davis, Matthew; Miller, Anna; Stitzel, Joel D

    2018-02-20

    Pelvic fractures are serious injuries resulting in high mortality and morbidity. The objective of this study is to develop and validate local pelvic anatomical, cross-section-based injury risk metrics for a finite element (FE) model of the human body. Cross-sectional instrumentation was implemented in the pelvic region of the Global Human Body Models Consortium (GHBMC M50-O) 50th percentile detailed male FE model (v4.3). In total, 25 lateral impact FE simulations were performed using input data from cadaveric lateral impact tests performed by Bouquet et al. The experimental force-time data was scaled using five normalization techniques, which were evaluated using log rank, Wilcoxon rank sum, and correlation and analysis (CORA) testing. Survival analyses with Weibull distribution were performed on the experimental peak force (scaled and unscaled) and the simulation test data to generate injury risk curves (IRCs) for total pelvic injury. Additionally, IRCs were developed for regional injury using cross-sectional forces from the simulation results and injuries documented in the experimental autopsies. These regional IRCs were also evaluated using the receiver operator characteristic (ROC) curve analysis. Based on the results of the all the evaluation methods, the Equal Stress Equal Velocity (ESEV) and ESEV using effective mass (ESEV-EM) scaling techniques performed best. The simulation IRC shows slight under prediction of injury in comparison to these scaled experimental data curves. However, this difference was determined to not be statistically significant. Additionally, the ROC curve analysis showed moderate predictive power for all regional IRCs.

  4. The corporative information systems and their application in the SICORP of Comision Federal de Electricidad; Los sistemas de informacion corporativa y su aplicacion en el SICORP de la Comision Federal de Electricidad

    Energy Technology Data Exchange (ETDEWEB)

    Mejia Lavalle, Manuel; Gonzalez Sustaeta, Jorge [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico); Miranda Miranda, Oscar [Comision Federal de Electricidad (Mexico)

    2000-07-01

    To be well informed sometimes is a difficult goal to reach, mainly when the companies are developed and grown at the present times rate. It is from this necessity that the Corporative Information Systems (SIC) arise. In this article a real application of a SIC in the Comision Federal de Electricidad (CFE) is presented, in whose conceptualization and implementation, personnel of the Instituto de Investigaciones Electricas (IIE) is participating. [Spanish] Estar bien informado a veces resulta una meta dificil de alcanzar, sobre todo cuando las empresas se desarrollan y crecen al ritmo de los tiempos actuales. Es a partir de esta necesidad que surgen los Sistemas de Informacion Corporativa (SIC). En este articulo se presenta una aplicacion real de un SIC en la Comision Federal de Electricidad (CFE), en cuya conceptualizacion e implantacion esta participando personal del Instituto de Investigaciones Electricas (IIE).

  5. Comparison of the methods for discrete approximation of the fractional-order operator

    Directory of Open Access Journals (Sweden)

    Zborovjan Martin

    2003-12-01

    Full Text Available In this paper we will present some alternative types of discretization methods (discrete approximation for the fractional-order (FO differentiator and their application to the FO dynamical system described by the FO differential equation (FDE. With analytical solution and numerical solution by power series expansion (PSE method are compared two effective methods - the Muir expansion of the Tustin operator and continued fraction expansion method (CFE with the Tustin operator and the Al-Alaoui operator. Except detailed mathematical description presented are also simulation results. From the Bode plots of the FO differentiator and FDE and from the solution in the time domain we can see, that the CFE is a more effective method according to the PSE method, but there are some restrictions for the choice of the time step. The Muir expansion is almost unusable.

  6. Optimum design of a self-supported power transmission tower type 2M2 for 230 kW; Diseno optimo de una torre de transmision autosoportada tipo 2M2, para 230 kW

    Energy Technology Data Exchange (ETDEWEB)

    Espejel Valdez, Eduardo [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Millan Monje, Alejandro; Honk Hernandez, Wenceslao [Comision Federal de Electricidad, (CFE), Mexico, D. F. (Mexico)

    1986-12-31

    A group of specialists from the Comision Federal de Electricidad (CFE) and of the Instituto de Investigaciones Electricas (IIE) analyzes the design of various types of power transmission towers in their application stage, in order to enhance them. In this article the structural characteristics of the self-supported tower type 2M2 for 230 kV of two circuits and of suspension, are presented. [Espanol] Un grupo de especialistas de la Comision Federal de Electricidad (CFE) y del Instituto de Investigaciones Electricas (IIE) analiza el diseno de diversos tipos de torres de transmision en su etapa de aplicacion, con el fin de mejorarlos. En este articulo se presentan las caracteristicas estructurales de la torre autosoportada tipo 2M2 para 230 kV, de dos circuitos y de suspension.

  7. Industrial stacks design; Diseno de chimeneas industriales

    Energy Technology Data Exchange (ETDEWEB)

    Cacheux, Luis [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1987-12-31

    The Instituto de Investigaciones Electricas (IIE) though its Civil Works Department, develops, under contract with CFE`s Gerencia de Proyectos Termoelectricos (Management of Fossil Power Plant Projects), a series of methods for the design of stacks, which pretends to solve the a present day problem: the stack design of the fossil power plants that will go into operation during the next coming years in the country. [Espanol] El Instituto de Investigaciones Electricas (IIE), a traves del Departamento de Ingenieria Civil, desarrolla, bajo contrato con la Gerencia de Proyectos Termoelectricos, de la Comision Federal de Electricidad (CFE), un conjunto de metodos para el diseno de chimeneas, con el que se pretende resolver un problema inmediato: el diseno de las chimeneas de las centrales termoelectricas que entraran en operacion durante los proximos anos, en el pais.

  8. Electrochemical Oxidation of Cysteine at a Film Gold Modified Carbon Fiber Microelectrode Its Application in a Flow—Through Voltammetric Sensor

    Science.gov (United States)

    Wang, Lai-Hao; Huang, Wen-Shiuan

    2012-01-01

    A flow-electrolytical cell containing a strand of micro Au modified carbon fiber electrodes (CFE) has been designedand characterized for use in a voltammatric detector for detecting cysteine using high-performance liquid chromatography. Cysteine is more efficiently electrochemical oxidized on a Au /CFE than a bare gold and carbon fiber electrode. The possible reaction mechanism of the oxidation process is described from the relations to scan rate, peak potentials and currents. For the pulse mode, and measurements with suitable experimental parameters, a linear concentration from 0.5 to 5.0 mg·L−1 was found. The limit of quantification for cysteine was below 60 ng·mL−1. PMID:22737024

  9. Options for the solution of the problem of insulators contamination; Alternativas de solucion al problema de contaminacion en aisladores

    Energy Technology Data Exchange (ETDEWEB)

    Fierro Chavez, Jose Luis [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1996-12-31

    In accordance with Comision Federal de Electricidad (CFE) statistics, the insulators contamination is cataloged as the second cause of transmission power lines outages. In this article a revision of the different available options for the solution or diminution of this problem, is presented. The application of these options must be made within a technico-economic and cost-benefit frame. [Espanol] De acuerdo con estadisticas de la Comision Federal de Electricidad (CFE) la contaminacion del aislamiento esta catalogada como la segunda causa de salidas de las lineas de transmision. En este articulo se presenta una revision de las diferentes alternativas disponibles para solucionar o disminuir este problema. La aplicacion de estas alternativas debe hacerse dentro de un marco tecnicoeconomico y de costo-beneficio.

  10. Poly(brilliant green) and poly(thionine) modified carbon nanotube coated carbon film electrodes for glucose and uric acid biosensors.

    Science.gov (United States)

    Ghica, M Emilia; Brett, Christopher M A

    2014-12-01

    Poly(brilliant green) (PBG) and poly(thionine) (PTH) films have been formed on carbon film electrodes (CFEs) modified with carbon nanotubes (CNT) by electropolymerisation using potential cycling. Voltammetric and electrochemical impedance characterisation were performed. Glucose oxidase and uricase, as model enzymes, were immobilised on top of PBG/CNT/CFE and PTH/CNT/CFE for glucose and uric acid (UA) biosensing. Amperometric determination of glucose and UA was carried out in phosphate buffer pH 7.0 at -0.20 and +0.30 V vs. SCE, respectively, and the results were compared with other similarly modified electrodes existing in the literature. An interference study and recovery measurements in natural samples were successfully performed, indicating these architectures to be good and promising biosensor platforms. Copyright © 2014 Elsevier B.V. All rights reserved.

  11. Optimum design of a self-supported power transmission tower type 2M2 for 230 kW; Diseno optimo de una torre de transmision autosoportada tipo 2M2, para 230 kW

    Energy Technology Data Exchange (ETDEWEB)

    Espejel Valdez, Eduardo [Instituto de Investigaciones Electricas, Cuernavaca (Mexico); Millan Monje, Alejandro; Honk Hernandez, Wenceslao [Comision Federal de Electricidad, (CFE), Mexico, D. F. (Mexico)

    1985-12-31

    A group of specialists from the Comision Federal de Electricidad (CFE) and of the Instituto de Investigaciones Electricas (IIE) analyzes the design of various types of power transmission towers in their application stage, in order to enhance them. In this article the structural characteristics of the self-supported tower type 2M2 for 230 kV of two circuits and of suspension, are presented. [Espanol] Un grupo de especialistas de la Comision Federal de Electricidad (CFE) y del Instituto de Investigaciones Electricas (IIE) analiza el diseno de diversos tipos de torres de transmision en su etapa de aplicacion, con el fin de mejorarlos. En este articulo se presentan las caracteristicas estructurales de la torre autosoportada tipo 2M2 para 230 kV, de dos circuitos y de suspension.

  12. Simulator of a geotermoelectric unit for the training of operators; Simulador de una unidad geotermoelectrica para entrenamiento de operadores

    Energy Technology Data Exchange (ETDEWEB)

    Tavira Mondragon, Jose Antonio; Lopez Aguilera, Diana Monica; Roldan Villasana, Edgardo Javier; Rodriguez Lozano, Saul [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    1999-07-01

    The use of simulators replica in real time for operators training has demonstrated to be one of the best forms to enable the personnel of the Comision Federal de Electricidad (CFE). This article shows the basic characteristics of a simulator replica of the Cerro Prieto geotermoelectric power station of Baja California. It is expected that with this simulator 400 people between operators, shift superintendents and operation and maintenance auxiliary personnel become qualified. [Spanish] El uso de simuladores replica en tiempo real para entrenamiento de operadores de centrales generadoras ha demostrado ser una de las mejores formas de capacitar al personal de la Comision Federal de Electricidad (CFE). Este articulo muestra las caracteristicas principales de un simulador replica de la central geotermoelectrica de Cerro Prieto Baja California. Se espera que con este simulador se capaciten 400 personas entre operadores, superintendentes de turno y auxiliares de operacion y mantenimiento.

  13. Options for the solution of the problem of insulators contamination; Alternativas de solucion al problema de contaminacion en aisladores

    Energy Technology Data Exchange (ETDEWEB)

    Fierro Chavez, Jose Luis [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1997-12-31

    In accordance with Comision Federal de Electricidad (CFE) statistics, the insulators contamination is cataloged as the second cause of transmission power lines outages. In this article a revision of the different available options for the solution or diminution of this problem, is presented. The application of these options must be made within a technico-economic and cost-benefit frame. [Espanol] De acuerdo con estadisticas de la Comision Federal de Electricidad (CFE) la contaminacion del aislamiento esta catalogada como la segunda causa de salidas de las lineas de transmision. En este articulo se presenta una revision de las diferentes alternativas disponibles para solucionar o disminuir este problema. La aplicacion de estas alternativas debe hacerse dentro de un marco tecnicoeconomico y de costo-beneficio.

  14. Industrial stacks design; Diseno de chimeneas industriales

    Energy Technology Data Exchange (ETDEWEB)

    Cacheux, Luis [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1986-12-31

    The Instituto de Investigaciones Electricas (IIE) though its Civil Works Department, develops, under contract with CFE`s Gerencia de Proyectos Termoelectricos (Management of Fossil Power Plant Projects), a series of methods for the design of stacks, which pretends to solve the a present day problem: the stack design of the fossil power plants that will go into operation during the next coming years in the country. [Espanol] El Instituto de Investigaciones Electricas (IIE), a traves del Departamento de Ingenieria Civil, desarrolla, bajo contrato con la Gerencia de Proyectos Termoelectricos, de la Comision Federal de Electricidad (CFE), un conjunto de metodos para el diseno de chimeneas, con el que se pretende resolver un problema inmediato: el diseno de las chimeneas de las centrales termoelectricas que entraran en operacion durante los proximos anos, en el pais.

  15. Status of geothermal resources in Mexico

    International Nuclear Information System (INIS)

    Le-Bert, G.

    1990-01-01

    Except for some isolated instances with tourist or therapeutic objectives and some attempts in the Cerro Prieto geothermal field, there are no projects for direct heat utilization of geothermal resources in Mexico. Therefore, all places that are studied are studied with geothermal-electric objectives. It is convenient to keep in mind that in Mexico, by law, the Comision Federal de Electricidad (CFE) is the public utility in charge of electrical energy service. This institution is directly responsible for the exploration, development and commercial use of geothermal energy for electrical generation. Therefore, this paper includes the present and planned exploration and utilization of geothermal resources only for electricity generation for the period 1985 to the present. Likewise, starting 5 years ago, the CFE efforts have been directed toward the development of high enthalpy fields

  16. Analysis of electrophoresis performance

    Science.gov (United States)

    Roberts, G. O.

    1984-01-01

    The SAMPLE computer code models electrophoresis separation in a wide range of conditions. Results are included for steady three dimensional continuous flow electrophoresis (CFE), time dependent gel and acetate film experiments in one or two dimensions and isoelectric focusing in one dimension. The code evolves N two dimensional radical concentration distributions in time, or distance down a CFE chamber. For each time or distance increment, there are six stages, successively obtaining the pH distribution, the corresponding degrees of ionization for each radical, the conductivity, the electric field and current distribution, and the flux components in each direction for each separate radical. The final stage is to update the radical concentrations. The model formulation for ion motion in an electric field ignores activity effects, and is valid only for low concentrations; for larger concentrations the conductivity is, therefore, also invalid.

  17. Continuous flow electrophoretic separation of proteins and cells from mammalian tissues

    Science.gov (United States)

    Hymer, W. C.; Barlow, Grant H.; Blaisdell, Steven J.; Cleveland, Carolyn; Farrington, Mary Ann; Feldmeier, Mary; Hatfield, J. Michael; Lanham, J. Wayne; Grindeland, Richard; Snyder, Robert S.

    1987-01-01

    This paper describes an apparatus for continuous flow electrophoresis (CFE), designed to separate macromolecules and cells at conditions of microgravity. In this CFE, buffer flows upward in a 120-cm long flow chamber, which is 16-cm wide x 3.0-mm thick in the microgravity version (and 6-cm wide x 1.5-mm thick in the unit-gravity laboratory version). Ovalbumin and rat serum albumin were separated in space (flight STS-4) with the same resolution of the two proteins achieved at 25 percent total w/v concentration that was obtained in the laboratory at 0.2 percent w/v concentration. Rat anterior pituitary cells, cultured human embryonic kidney cells, and canine Langerhans cells were separated into subpopulations (flight STS-8) more effectively than in unit gravity, with comparable resolution having been achieved at 100 times the concentration possible on earth.

  18. Neutronic analysis of the conversion of HEU to LEU fuel for a 5-MW MTR core

    International Nuclear Information System (INIS)

    Pazirandeh, A.; Bartsch, G.

    1987-01-01

    In recent years, due to cessation of highly enriched uranium (HEU) fuel supply, practical steps have been taken to substitute HEU fuel in almost all research reactors by medium-enriched uranium or low-enriched uranium (LEU) fuels. In this study, a neutronic calculation of a 5-MW research reactor core fueled with HEU (93% 235 U) is presented. In order to assess the performance of the core with the LEU ( 235 U loadings were examined. The core consists of 22 standard fuel elements (SFEs) and 6 control fuel elements (CFEs). Each fuel elements has 18 curved plates of which two end plates are dummies. Initial 235 U content is 195 g 235 U/SFE and 9.7 g 235 U/CFE or /PFE. In all calculations the permitted changes to the fuel elements are (a) 18 active plates per SFE, (b) fuel plates assumed to be flat, and (c) 8 or 9 active plates per CFE

  19. Electromagnetic Wave Absorption Property of Graphene with FeO4 Nanoparticles.

    Science.gov (United States)

    Yang, Cheng; Dai, Shenglong; Zhang, Xiaoyan; Zhao, Tianyu; Yan, Shaojiu; Zhao, Xiuying

    2016-02-01

    Nanomaterials consisting of various ratios of Fe3O4 and graphene (defined C-Fe3O4/GR) were pre- pared by an in situ coordination complex hydro-thermal synthesis method. The structure and morphology of the nanomaterials C-Fe3O4/GR obtained were characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), and transmission electron microscopy (TEM). It was found that the Fe3O4 nanoparticles distributed on the surfaces of graphene, and had a spinel structure and a uniform chemical phase when the weight ratios of Fe3O4 to graphene oxide (GO) were 9:1 or 9:2. It was suggested that GO had been successfully reduced to graphene and the Fe3O4 nanoparticles were chemically bonded to graphene. The SQUID vibrating sample magnetometer (SQUID-VSM) indicated that the maximum of the saturation magnetization was 83.6 emmicro g(-1) when the mass ratio of Fe3O4 to GO was 9:2. Electromagnetic wave absorption showed that the chemical compound of Fe3O4 and graphene had a better electromagnetic property than the mechanical blend of Fe3O4 and graphene (M-Fe3O4/GR). The C-Fe3O4/GR had a reflection loss larger than -10 dB in the frequency range 12.9-17.0 GHz for an absorber thickness of 3 mm, and a maximum reflection loss of -12.3 dB at 14.8 GHz and a maximum reflection loss of -31.2 dB at 10.5 GHz for an absorber thickness of 10 mm. Theoretical analysis showed that the electromagnetic wave absorption behavior obeyed the quarter-wave principles. These results showed that the C-Fe3O4/GR nanomaterials can meet the requirements for some engineering applications, showing great application potential in electromagnetic wave absorption.

  20. Conventional armed forces in Europe: Technology scenario development

    Energy Technology Data Exchange (ETDEWEB)

    Houser, G.M.

    1990-07-01

    In January 1986, the Soviet Union's Mikhail Gorbachev proposed elimination of all nuclear weapons by the year 2000. In April of that year, Mr. Gorbachev proposed substantial reductions of conventional weapons in Europe, from the Atlantic Ocean to the Ural Mountains, including reductions in operational-tactical nuclear weapons. In May 1986, the North Atlantic Treaty Organization (NATO) responded with the Brussels Declaration on Conventional Arms Control,'' which indicated readiness to open East/West discussions on establishing a mandate for negotiating conventional arms control throughout Europe. The Group of 23,'' which met in Vienna beginning in February 1987, concluded the meeting in January 1989 with a mandate for the Conventional Armed Forced in Europe (CFE) negotiations. On 6 March 1989, CFE talks began, and these talks have continued through six rounds (as of April 1990). Although US President George Bush, on 30 May 1989, called for agreement within six months to a year, and the Malta meeting of December 1989 called for completion of a CFE agreement by the end of 1990, much remains to be negotiated. This report provides three types of information. First, treaty provisions brought to the table by both sides are compared. Second, on the basis of these provisions, problem areas for each of the provision elements are postulated and possible scenarios for resolving these problem areas are developed. Third, the scenarios are used as requirements for tasks assigned program elements for possible US implementation of a CFE treaty. As progress is achieved during the negotiations, this report could be updated, as necessary, in each of the areas to provide a continuing systematic basis for program implementation and technology development. 8 refs.

  1. Amelioration of Sarcoptic Mange-Induced Oxidative Stress and Apoptosis in Dogs by Using Calendula officinalis Flower Extracts

    OpenAIRE

    Singh, Shanker K.; Dimri, Umesh

    2013-01-01

    Twenty-four clinically Sarcoptes-infested dogs were randomly enrolled into three groups (groups A, B, and C), 8 dogs in each group. Group A was treated with ivermectin + Calendula officinalis flower extract (CFE). Group B was treated with ivermectin + N-acetyl cysteine (NAC) (standard positive controls), while group C (negative control) was treated with ivermectin alone. Another eight healthy dogs were used as healthy controls (group D). By day 28 after therapy, the dogs treated adjunctly wit...

  2. The evolution of C and O abundances in stellar populations

    DEFF Research Database (Denmark)

    Nissen, Poul E.; Schuster, William J.

    2014-01-01

    Carbon and oxygen abundances in F and G main-sequence stars ranging in metallicity from [Fe/H] = -1.6 to +0.5 are determined from a non-LTE analysis of C i and O i atomic lines in high-resolution spectra. Both C and O are good tracers of stellar populations; distinct trends of [C/Fe] and [O/Fe] a...

  3. First fuel reload in Laguna Verde; Primera recarga de combustible en Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Bahena B, D

    1992-01-15

    A report containing the activities carried out during the first reload of nuclear fuel and major maintenance in the Laguna Verde nuclear reactor is presented. The previous and the specific activities are included. These last are related without including the technical considerations, data or the operation details, because these data were documented inside the registrations of the CFE, the ININ and in personal way. (Author)

  4. Evaluation of a process for the removal of gases contained in geothermal steam through condensation and re-evaporation; Evaluacion de un proceso de remocion de gases contenidos en el vapor geotermico, por medio de la condensacion y de revaporacion

    Energy Technology Data Exchange (ETDEWEB)

    Angulo C, Raul; Lam Rea, Luis; Garmino, Hector; Jimenez, Humberto [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1986-12-31

    The Cerro Prieto I Geothermal Field, developed and operated by the Comision Federal de Electricidad (CFE), has currently an installed electric power generation capacity of 180 MW and is at a very advanced stage in the development of Cerro Prieto II and III, which will allow to raise the generation capacity to 620 MW. During the exploitation of a geothermal field, in producing steam with the purpose of generating electricity, brines and waste gases are obtained. The hydrogen sulfide exhaust to the environment implies pollution problems, for this reason processes have been developed for the oxidation of these gases downstream the turbogenerator either in the flow of separated gases in the steam condensation or in the condensate produced. The Instituto de Investigaciones Electricas (IIE) has collaborated with CFE in the evaluation of the environmental impact of this gas and in the development of the processes for its abatement. [Espanol] El campo geotermico de Cerro Prieto I, desarrollado y operado por la Comision Federal de Electricidad (CFE), actualmente tiene una capacidad instalada de generacion de energia electrica de 180 MW, y se encuentra en etapa muy avanzada, el desarrollo de Cerro Prieto II y III, lo que permitira incrementar la capacidad de generacion a 620 MW. Durante la explotacion de un campo geotermico, al producir vapor con el proposito de generar electricidad, se obtienen salmueras y gases de desecho. La descarga de acido sulfhidrico a la atmosfera implica problemas de contaminacion, por esta razon se han desarrollado procesos para la oxidacion de este gas aguas abajo de la turbina generadora, ya sea en la corriente de gases que se separan en la condensacion del vapor o en el condensado producido. El Instituto de Investigaciones Electricas (IIE) ha colaborado con la CFE en la evaluacion del impacto ambiental de este gas y en el desarrollo de sus procesos de abatimiento.

  5. Present status and prospects of nuclear power in Mexico

    International Nuclear Information System (INIS)

    Eibenschutz, J.

    1987-01-01

    Mexico decided to build its first nuclear power plant at the end of 1972. Actual construction in Laguna Verde started in early 1977 and after several changes in the structure of the project, CFE has taken full responsibility for engineering and construction since 1981 of the first- and for the time being the only-nuclear power project.The first unit is in the process of commissioning and operation is planned for 1987. (author)

  6. Economic, energy and environmental evaluations of biomass-based fuel ethanol projects based on life cycle assessment and simulation

    International Nuclear Information System (INIS)

    Yu Suiran; Tao Jing

    2009-01-01

    This paper summarizes the research of Monte Carlo simulation-based Economic, Energy and Environmental (3E) Life Cycle Assessment (LCA) of the three Biomass-based Fuel Ethanol (BFE) projects in China. Our research includes both theoretical study and case study. In the theoretical study part, 3E LCA models are structured, 3E Index Functions are defined and the Monte Carlo simulation is introduced to address uncertainties in BFE life cycle analysis. In the case study part, projects of Wheat-based Fuel Ethanol (WFE) in Central China, Corn-based Fuel Ethanol (CFE) in Northeast China, and Cassava-based Fuel Ethanol (CFE) in Southwest China are evaluated from the aspects of economic viability and investment risks, energy efficiency and airborne emissions. The life cycle economy assessment shows that KFE project in Guangxi is viable, while CFE and WFE projects are not without government's subsidies. Energy efficiency assessment results show that WFE, CFE and KFE projects all have positive Net Energy Values. Emissions results show that the corn-based E10 (a blend of 10% gasoline and 90% ethanol by volume), wheat-based E10 and cassava-base E10 have less CO 2 and VOC life cycle emissions than conventional gasoline, but wheat-based E10 and cassava-based E10 can generate more emissions of CO, CH 4 , N 2 O, NO x , SO 2 , PM 10 and corn-based E10 can has more emissions of CH 4 , N 2 O, NO x , SO, PM 10 .

  7. Specification for the interconnection to a electric network of low tension of photovoltaic systems with 30 kW of capacity; Especificacion para la interconexion a la red electrica de baja tension de sistemas fotovoltaicos con capacidad hasta 30kW

    Energy Technology Data Exchange (ETDEWEB)

    Garcia Gutierrez, Jose [Comision Federal de Electricidad, Mexico (Mexico)

    2007-06-15

    In this presentation, there are shown the details of the photovoltaic systems interconnected with the electric network (SFVI), carried out by the Mexico's Federal Electricity Commission (CFE) with the support of the Mexican Electric Research Institute (IIE). First of all, there are found the objectives of the photovoltaic system interconnected to the electric network (SFVI). Then, there are mentioned the places where such sort of systems could be installed; besides, it is shown a diagram explaining the process of such systems. At the same time, there are briefly explained the components that are necessaries for their properly operation. Some of the elements previously mentioned are: photovoltaic generator (GFV), inverter, interface, and logic circuits and the control. It is shown a diagram with the location of the electrical disconnect switches. Then, it is shortly explained the place where the SFVI should be connected and there are given some requisites that are important to fulfill in order to have everything updated. Finally, it is mentioned the methodology that should be followed in order to supervise that everything works in a properly way, this last issue is carried out by CFE. [Spanish] En esta presentacion se presentan los pormenores del sistema fotovoltaico interconectado a la red (SFVI), realizado por la Comision federal de Electricidad (CFE) con apoyo del Instituto de Investigaciones Electricas (IIE). En primer lugar, se encuentran los objetivos que tiene el uso de SFVI. Enseguida, se muestra un diagrama que explica el proceso que dichos sistemas realizan. Asimismo, se explican brevemente los elementos que, de uno u otro modo, son necesarios para el adecuado funcionamiento del SFV. Ademas, se muestra un diagrama con la ubicacion de los interruptores de desconexion. Luego, se explica escuetamente el lugar donde se debe de conectar el SFVI, ademas de algunas condiciones que se deben de cumplir para que no haya mayores contratiempos. Finalmente, se

  8. Evaluation of a process for the removal of gases contained in geothermal steam through condensation and re-evaporation; Evaluacion de un proceso de remocion de gases contenidos en el vapor geotermico, por medio de la condensacion y de revaporacion

    Energy Technology Data Exchange (ETDEWEB)

    Angulo C, Raul; Lam Rea, Luis; Garmino, Hector; Jimenez, Humberto [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1985-12-31

    The Cerro Prieto I Geothermal Field, developed and operated by the Comision Federal de Electricidad (CFE), has currently an installed electric power generation capacity of 180 MW and is at a very advanced stage in the development of Cerro Prieto II and III, which will allow to raise the generation capacity to 620 MW. During the exploitation of a geothermal field, in producing steam with the purpose of generating electricity, brines and waste gases are obtained. The hydrogen sulfide exhaust to the environment implies pollution problems, for this reason processes have been developed for the oxidation of these gases downstream the turbogenerator either in the flow of separated gases in the steam condensation or in the condensate produced. The Instituto de Investigaciones Electricas (IIE) has collaborated with CFE in the evaluation of the environmental impact of this gas and in the development of the processes for its abatement. [Espanol] El campo geotermico de Cerro Prieto I, desarrollado y operado por la Comision Federal de Electricidad (CFE), actualmente tiene una capacidad instalada de generacion de energia electrica de 180 MW, y se encuentra en etapa muy avanzada, el desarrollo de Cerro Prieto II y III, lo que permitira incrementar la capacidad de generacion a 620 MW. Durante la explotacion de un campo geotermico, al producir vapor con el proposito de generar electricidad, se obtienen salmueras y gases de desecho. La descarga de acido sulfhidrico a la atmosfera implica problemas de contaminacion, por esta razon se han desarrollado procesos para la oxidacion de este gas aguas abajo de la turbina generadora, ya sea en la corriente de gases que se separan en la condensacion del vapor o en el condensado producido. El Instituto de Investigaciones Electricas (IIE) ha colaborado con la CFE en la evaluacion del impacto ambiental de este gas y en el desarrollo de sus procesos de abatimiento.

  9. Paneles Solares ¿Cómo funcionan? ¿Cuál es su verdadero precio?

    OpenAIRE

    Carreón Juárez, Héctor J.; Saravia Garza, Andrés E.; Escamilla Guerra, Fermín; Gómez de la Garza, Pablo

    2017-01-01

    Es un infograma en el cual queremos invitar a las mentes jóvenes a que utilizen el recurso de los paneles solares, haciéndoles saber de manera breve cómo funcionan y cómo se comporta la CFE con respecto a eso y cuánto dinero tendrían que invertir las familias en México.

  10. Estimation of charges for services of transmission of electrical energy between regions of the national electrical system; Estimacion de cargos por servicios de transmision de energia electrica entre regiones del sistema electrico nacional

    Energy Technology Data Exchange (ETDEWEB)

    Inda Ruiz, Adrian; Flores Alba, Dora Elia [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Escobar Lopez, Akihito [Comision Federal de Electricidad (Mexico)

    2002-07-01

    In order to facilitate the answer of the Comision Federal de Electricidad (CFE) to the requests of services of transmission of authorized or potential licensees, this organism devised the construction of matrices of charges that allow in a fast and direct way for specific transactions, to know the charges in which different types of transmission services incur classified by transport levels and by tension levels in which the service is asked for. These tables could be published in the media that might be judged advisable, in order that the applicant licensees have access to a preliminary estimation of the charges for the required services, without the need of going, for one first estimation, directly to the CFE for their calculation. This article presents the results of the development of a calculation tool that allows estimating, in a fast and efficient way, charges for transmission services between regions of the national electrical system. [Spanish] Para facilitar la respuesta de la Comision Federal de Electricidad (CFE) a las solicitudes de servicios de transmision de permisionarios autorizados o potenciales, esta ideo la construccion de matrices de cargos que permitan de manera rapida y directa para transacciones especificas, conocer los cargos en que incurren diferentes tipos de servicios de transmision clasificados por niveles de transporte y por niveles de tension en los que se solicita el servicio. Dichas tablas podran ser publicadas en los medios que se juzguen convenientes, con el fin de que los permisionarios solicitantes tengan acceso a una estimacion preliminar de los cargos por los servicios requeridos, sin necesidad de acudir, para una primera estimacion, directamente a la CFE para su calculo. Este articulo presenta los resultados del desarrollo de una herramienta de calculo que permite estimar, de manera rapida y eficiente, matrices de cargos por servicios de transmision entre regiones del sistema electrico nacional.

  11. Mexico´s Energy Reform : an analysis of the market, new policy and integration of renewable energy for economic and sustainable development

    OpenAIRE

    Favela, Alfredo Rojas

    2016-01-01

    In the framework of the approved Energy Reform in 2013, Mexico puts an end to seven decades of centralized control of the energy and electricity markets within the government through the State governed companies CFE (Federal Electricity Commission) and PEMEX (Mexican Oil). During the largest part of last century and the beginning of the current, the Mexican government relied heavily on the revenues generated by PEMEX through the sale of oil to foreign countries and tax revenues...

  12. First fuel reload in Laguna Verde

    International Nuclear Information System (INIS)

    Bahena B, D.

    1992-01-01

    A report containing the activities carried out during the first reload of nuclear fuel and major maintenance in the Laguna Verde nuclear reactor is presented. The previous and the specific activities are included. These last are related without including the technical considerations, data or the operation details, because these data were documented inside the registrations of the CFE, the ININ and in personal way. (Author)

  13. Magnetron sputtered diamond-like carbon microelectrodes for on-chip measurement of quantal catecholamine release from cells

    OpenAIRE

    Gao, Yuanfang; Chen, Xiaohui; Gupta, Sanju; Gillis, Kevin D.; Gangopadhyay, Shubhra

    2008-01-01

    Carbon electrodes are widely used in electrochemistry due to their low cost, wide potential window, and low and stable background noise. Carbon-fiber electrodes (CFE) are commonly used to electrochemically measure “quantal” catecholamine release via exocytosis from individual cells, but it is difficult to integrate CFEs into lab-on-a-chip devices. Here we report the development of nitrogen doped diamond-like carbon (DLC:N) microelectrodes on a chip to monitor quantal release of catecholamines...

  14. Quality of Graphite Target for Biological/Biomedical/Environmental Applications of 14C-Accelerator Mass Spectrometry

    Science.gov (United States)

    2010-01-01

    Catalytic graphitization for 14C-accelerator mass spectrometry (14C-AMS) produced various forms of elemental carbon. Our high-throughput Zn reduction method (C/Fe = 1:5, 500 °C, 3 h) produced the AMS target of graphite-coated iron powder (GCIP), a mix of nongraphitic carbon and Fe3C. Crystallinity of the AMS targets of GCIP (nongraphitic carbon) was increased to turbostratic carbon by raising the C/Fe ratio from 1:5 to 1:1 and the graphitization temperature from 500 to 585 °C. The AMS target of GCIP containing turbostratic carbon had a large isotopic fractionation and a low AMS ion current. The AMS target of GCIP containing turbostratic carbon also yielded less accurate/precise 14C-AMS measurements because of the lower graphitization yield and lower thermal conductivity that were caused by the higher C/Fe ratio of 1:1. On the other hand, the AMS target of GCIP containing nongraphitic carbon had higher graphitization yield and better thermal conductivity over the AMS target of GCIP containing turbostratic carbon due to optimal surface area provided by the iron powder. Finally, graphitization yield and thermal conductivity were stronger determinants (over graphite crystallinity) for accurate/precise/high-throughput biological, biomedical, and environmental14C-AMS applications such as absorption, distribution, metabolism, elimination (ADME), and physiologically based pharmacokinetics (PBPK) of nutrients, drugs, phytochemicals, and environmental chemicals. PMID:20163100

  15. Effect of Amount of Carbon on the Reduction Efficiency of Iron Ore-Coal Composite Pellets in Multi-layer Bed Rotary Hearth Furnace (RHF)

    Science.gov (United States)

    Mishra, Srinibash; Roy, Gour Gopal

    2016-08-01

    The effect of carbon-to-hematite molar ratio has been studied on the reduction efficiency of iron ore-coal composite pellet reduced at 1523 K (1250 °C) for 20 minutes in a laboratory scale multi-layer bed rotary hearth furnace (RHF). Reduced pellets have been characterized through weight loss measurement, estimation of porosity, shrinkage, qualitative and quantitative phase analysis by XRD. Performance parameters such as the degree of reduction, metallization, carbon efficiency, productivity, and compressive strength have been calculated to compare the process efficacy at different carbon levels in the pellets. Pellets with optimum carbon-to-hematite ratio (C/Fe2O3 molar ratio = 1.66) that is much below the stoichiometric carbon required for direct reduction of hematite yielded maximum reduction, better carbon utilization, and productivity for all three layers. Top layer exhibited maximum reduction at comparatively lower carbon level (C/Fe2O3 molar ratio 2.33). Correlation between degree of reduction and metallization indicated non-isothermal kinetics influenced by heat and mass transfer in multi-layer bed RHF. Compressive strength of the partially reduced pellet with optimum carbon content (C/Fe2O3 molar ratio = 1.66) showed that they could be potentially used as an alternate feed in a blast furnace or any other smelting reactor.

  16. Micro-electrolysis of Cr (VI) in the nanoscale zero-valent iron loaded activated carbon.

    Science.gov (United States)

    Wu, Limei; Liao, Libing; Lv, Guocheng; Qin, Faxiang; He, Yujuan; Wang, Xiaoyu

    2013-06-15

    In this paper we prepared a novel material of activated carbon/nanoscale zero-valent iron (C-Fe(0)) composite. The C-Fe(0) was proved to possess large specific surface area and outstanding reducibility that result in the rapid and stable reaction with Cr (VI). The prepared composite has been examined in detail in terms of the influence of solution pH, concentration and reaction time in the Cr (VI) removal experiments. The results showed that the C-Fe(0) formed a micro-electrolysis which dominated the reaction rate. The Micro-electrolysis reaches equilibrium is ten minutes. Its reaction rate is ten times higher than that of traditional adsorption reaction, and the removal rate of Cr reaches up to 99.5%. By analyzing the obtained profiles from the cyclic voltammetry, PXRD and XPS, we demonstrate that the Cr (VI) is reduced to insoluble Cr (III) compound in the reaction. Copyright © 2013 Elsevier B.V. All rights reserved.

  17. Poly(neutral red) based hydrogen peroxide biosensor for chromium determination by inhibition measurements.

    Science.gov (United States)

    Attar, Aisha; Emilia Ghica, M; Amine, Aziz; Brett, Christopher M A

    2014-08-30

    Amperometric hydrogen peroxide enzyme inhibition biosensors based on horseradish peroxidase (HRP) immobilised on electropolymerised neutral red (NR) or directly on the surface of carbon film electrodes (CFE) have been successfully applied to the determination of toxic Cr(III) and Cr(VI). Parameters influencing the performance of the biosensor including the enzyme immobilisation method, the amount of hydrogen peroxide, applied potential and electrolyte pH were optimised. The inhibition of horseradish peroxidase by the chromium species was studied under the optimised conditions. Results from the quantitative analysis of chromium ions are discussed in terms of detection limit, linear range and sensitivity. The HRP kinetic interactions reveal mixed binding of Cr(III) with I50=3.8μM and inhibition binding constant Ki=11.3μM at HRP/PNR/CFE biosensors and uncompetitive binding of Cr(VI) with I50=3.9μM and Ki=0.78μM at HRP/CFE biosensors in the presence of H2O2 substrate. Interferences from other heavy metal ions were studied and the inhibition show very good selectivity towards Cr(III) and Cr(VI). Copyright © 2014 Elsevier B.V. All rights reserved.

  18. Addressing the Hard Factors for Command File Errors by Probabilistic Reasoning

    Science.gov (United States)

    Meshkat, Leila; Bryant, Larry

    2014-01-01

    Command File Errors (CFE) are managed using standard risk management approaches at the Jet Propulsion Laboratory. Over the last few years, more emphasis has been made on the collection, organization, and analysis of these errors for the purpose of reducing the CFE rates. More recently, probabilistic modeling techniques have been used for more in depth analysis of the perceived error rates of the DAWN mission and for managing the soft factors in the upcoming phases of the mission. We broadly classify the factors that can lead to CFE's as soft factors, which relate to the cognition of the operators and hard factors which relate to the Mission System which is composed of the hardware, software and procedures used for the generation, verification & validation and execution of commands. The focus of this paper is to use probabilistic models that represent multiple missions at JPL to determine the root cause and sensitivities of the various components of the mission system and develop recommendations and techniques for addressing them. The customization of these multi-mission models to a sample interplanetary spacecraft is done for this purpose.

  19. Carbon-Based Fe3O4 Nanocomposites Derived from Waste Pomelo Peels for Magnetic Solid-Phase Extraction of 11 Triazole Fungicides in Fruit Samples

    Science.gov (United States)

    Ren, Keyu; Zhang, Wenlin; Cao, Shurui; Wang, Guomin; Zhou, Zhiqin

    2018-01-01

    Carbon-based Fe3O4 nanocomposites (C/Fe3O4 NCs) were synthesized by a simple one-step hydrothermal method using waste pomelo peels as the carbon precursors. The characterization results showed that they had good structures and physicochemical properties. The prepared C/Fe3O4 NCs could be applied as excellent and recyclable adsorbents for magnetic solid phase extraction (MSPE) of 11 triazole fungicides in fruit samples. In the MSPE procedure, several parameters including the amount of adsorbents, extraction time, the type and volume of desorption solvent, and desorption time were optimized in detail. Under the optimized conditions, the good linearity (R2 > 0.9916), the limits of detection (LOD), and quantification (LOQ) were obtained in the range of 1–100, 0.12–0.55, and 0.39–1.85 μg/kg for 11 pesticides, respectively. Lastly, the proposed MSPE method was successfully applied to analyze triazole fungicides in real apple, pear, orange, peach, and banana samples with recoveries in the range of 82.1% to 109.9% and relative standard deviations (RSDs) below 8.4%. Therefore, the C/Fe3O4 NCs based MSPE method has a great potential for isolating and pre-concentrating trace levels of triazole fungicides in fruits. PMID:29734765

  20. neutron transmission through crystalline materials

    International Nuclear Information System (INIS)

    El Mesiry, M.S.

    2011-01-01

    The aim of the present work is to study the neutron transmission through crystalline materials. Therefore a study of pyrolytic graphite (PG) as a highly efficient selective thermal neutron filter and Iron single crystal as a whole one, as well as the applicability of using their polycrystalline powders as a selective cold neutron filters is given. Moreover, the use of PG and iron single crystal as an efficient neutron monochromator is also investigated. An additive formula is given which allows calculating the contribution of the total neutron cross-section including the Bragg scattering from different )(hkl planes to the neutron transmission through crystalline iron and graphite. The formula takes into account their crystalline form. A computer CFe program was developed in order to provide the required calculations for both poly- and single-crystalline iron. The validity of the CFe program was approved from the comparison of the calculated iron cross-section data with the available experimental ones. The CFe program was also adapted to calculate the reflectivity from iron single crystal when it used as a neutron monochromator The computer package GRAPHITE, developed in Neutron Physics laboratory, Nuclear Research Center, has been used in order to provide the required calculations for crystalline graphite in the neutron energy range from 0.1 meV to 10 eV. A Mono-PG code was added to the computer package GRAPHITE in order to calculate the reflectivity from PG crystal when it used as a neutron monochromator.

  1. Measures of Microbial Biomass for Soil Carbon Decomposition Models

    Science.gov (United States)

    Mayes, M. A.; Dabbs, J.; Steinweg, J. M.; Schadt, C. W.; Kluber, L. A.; Wang, G.; Jagadamma, S.

    2014-12-01

    Explicit parameterization of the decomposition of plant inputs and soil organic matter by microbes is becoming more widely accepted in models of various complexity, ranging from detailed process models to global-scale earth system models. While there are multiple ways to measure microbial biomass, chloroform fumigation-extraction (CFE) is commonly used to parameterize models.. However CFE is labor- and time-intensive, requires toxic chemicals, and it provides no specific information about the composition or function of the microbial community. We investigated correlations between measures of: CFE; DNA extraction yield; QPCR base-gene copy numbers for Bacteria, Fungi and Archaea; phospholipid fatty acid analysis; and direct cell counts to determine the potential for use as proxies for microbial biomass. As our ultimate goal is to develop a reliable, more informative, and faster methods to predict microbial biomass for use in models, we also examined basic soil physiochemical characteristics including texture, organic matter content, pH, etc. to identify multi-factor predictive correlations with one or more measures of the microbial community. Our work will have application to both microbial ecology studies and the next generation of process and earth system models.

  2. MR and CT imaging of cerebral fat embolism

    International Nuclear Information System (INIS)

    Li Ying; Xu Jianmin; Wan Xiaohong; Chen Yu; Guo Yi

    2003-01-01

    Objective: To summarize the clinical characteristics and imaging features of cerebral fat embolism (CFE). Methods: The clinical features and imaging appearances of 3 cases with acute CFE were analyzed. Results: (1) 3 non-head injured cases had sudden mental status changes after leg injury. (2) The main clinical manifestation was vigil coma. (3) MRI showed lesions of the brain in all 3 cases. Cranial CT showed lesions in only 1 case. (4) MRI and CT showed spotty and patchy symmetrical lesions, which were low signal on T 1 WI and high signal on T 2 WI, and low density on CT scan. The lesions were distributed in the white matter along the boundary zones of the major vascular territories, thalamus and basal ganglia, internal capsule, corpus callosum, brain stem, and cerebellum. The margins of the lesions were obscure. (5) 1 case received MRI examination after therapy for 3 months, which showed no lesions in the brain. Conclusion: Cerebral fat embolism has its own clinical features and imaging characteristics. MRI is superior to CT in diagnosing CFE

  3. Acquisition parameters optimization of a transmission electron forward scatter diffraction system in a cold-field emission scanning electron microscope for nanomaterials characterization.

    Science.gov (United States)

    Brodusch, Nicolas; Demers, Hendrix; Trudeau, Michel; Gauvin, Raynald

    2013-01-01

    Transmission electron forward scatter diffraction (t-EFSD) is a new technique providing crystallographic information with high resolution on thin specimens by using a conventional electron backscatter diffraction (EBSD) system in a scanning electron microscope. In this study, the impact of tilt angle, working distance, and detector distance on the Kikuchi pattern quality were investigated in a cold-field emission scanning electron microscope (CFE-SEM). We demonstrated that t-EFSD is applicable for tilt angles ranging from -20° to -40°. Working distance (WD) should be optimized for each material by choosing the WD for which the EBSD camera screen illumination is the highest, as the number of detected electrons on the screen is directly dependent on the scattering angle. To take advantage of the best performances of the CFE-SEM, the EBSD camera should be close to the sample and oriented towards the bottom to increase forward scattered electron collection efficiency. However, specimen chamber cluttering and beam/mechanical drift are important limitations in the CFE-SEM used in this work. Finally, the importance of t-EFSD in materials science characterization was illustrated through three examples of phase identification and orientation mapping. © Wiley Periodicals, Inc.

  4. Verification and software validation for nuclear instrumentation; Verificacion y validacion de software para instrumentacion nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Gaytan G, E. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Salgado G, J. R. [Comision Nacional de Seguridad Nuclear y Salvaguardias, Dr. Barragan No. 779, Col. Narvarte, 03020 Mexico D. F. (Mexico); De Andrade O, E. [Universidad Federal de Rio de Janeiro, Caixa Postal 68509, 21945-970 Rio de Janeiro (Brazil); Ramirez G, A., E-mail: elvira.gaytan@inin.gob.mx [Comision Federal de Electricidad, Gerencia de Centrales Nucleoelectricas, Alto Lucero, Veracruz (Mexico)

    2014-10-15

    In this work is presented a Verification Methodology and Software Validation, to be applied in instruments of nuclear use with associate software. This methodology was developed under the auspices of IAEA, through the regional projects RLA4022 (ARCAL XCIX) and RLA1011 (RLA CXXIII), led by Mexico. In the first project three plans and three procedures were elaborated taking into consideration IEEE standards, and in the second project these documents were updated considering ISO and IEC standards. The developed methodology has been distributed to the participant countries of Latin America in the ARCAL projects and two related courses have been imparted with the participation of several countries, and participating institutions of Mexico like Instituto Nacional de Investigaciones Nucleares (ININ), Comision Federal de Electricidad (CFE) and Comision Nacional de Seguridad Nuclear y Salvaguardias (CNSNS). In the ININ due to the necessity to work with Software Quality Guarantee in systems for the nuclear power plant of the CFE, a Software Quality Guarantee Plan and five procedures were developed in the year 2004, obtaining the qualification of the ININ for software development for the nuclear power plant of CFE. These first documents were developed taking like reference IEEE standards and regulator guides of NRC, being the first step for the development of the methodology. (Author)

  5. Fabrication of multi-emitter array of CNT for enhancement of current density

    Energy Technology Data Exchange (ETDEWEB)

    Chouhan, Vijay, E-mail: vchouhan@post.kek.jp [Department of Accelerator Science, Graduate University for Advanced Studies, 1-1 Oho, Tsukuba, Ibaraki (Japan); Noguchi, Tsuneyuki [High Energy Accelerator Research Organization-KEK, 1-1 Oho, Tsukuba, Ibaraki (Japan); Kato, Shigeki [Department of Accelerator Science, Graduate University for Advanced Studies, 1-1 Oho, Tsukuba, Ibaraki (Japan); High Energy Accelerator Research Organization-KEK, 1-1 Oho, Tsukuba, Ibaraki (Japan)

    2011-11-11

    We studied and compared field emission properties of two kinds of emitters of randomly oriented multi-wall carbon nanotubes (MWNTs), viz. continuous film emitter (CFE) and multi-emitter array (MEA). The CFE has a continuous film of MWNTs while the MEA consists of many equidistant small circular emitters. Both types of emitters were prepared by dispersing MWNTs over a titanium (Ti) film (for CFEs) or Ti circular islands (for MEAs) deposited on tantalum (Ta) followed by rooting of MWNTs into the Ti film or the Ti islands at high temperature. Emission properties of both types of emitters were analyzed with changing their emission areas. In case of the CFEs, current density decreased with an increase in emission area whereas consistent current densities were achieved from MEAs with different emission areas. In other words, the total emission current was achieved in proportion to the emission area in the case of MEAs. Additionally a high current density of 22 A/cm{sup 2} was achieved at an electric field of 8 V/{mu}m from MEAs, which was far better than that obtained from CFEs. The high current density in MEAs was attributed to edge effect, in which higher emission current is achieved from the edge of film emitter. The results indicate that the field emission characteristics can be greatly improved if a cathode contains many small equidistant circular emitters instead of a continuous film. The outstanding stability of the CFE and the MEA has been demonstrated for 2100 and 1007 h, respectively.

  6. Verification and software validation for nuclear instrumentation

    International Nuclear Information System (INIS)

    Gaytan G, E.; Salgado G, J. R.; De Andrade O, E.; Ramirez G, A.

    2014-10-01

    In this work is presented a Verification Methodology and Software Validation, to be applied in instruments of nuclear use with associate software. This methodology was developed under the auspices of IAEA, through the regional projects RLA4022 (ARCAL XCIX) and RLA1011 (RLA CXXIII), led by Mexico. In the first project three plans and three procedures were elaborated taking into consideration IEEE standards, and in the second project these documents were updated considering ISO and IEC standards. The developed methodology has been distributed to the participant countries of Latin America in the ARCAL projects and two related courses have been imparted with the participation of several countries, and participating institutions of Mexico like Instituto Nacional de Investigaciones Nucleares (ININ), Comision Federal de Electricidad (CFE) and Comision Nacional de Seguridad Nuclear y Salvaguardias (CNSNS). In the ININ due to the necessity to work with Software Quality Guarantee in systems for the nuclear power plant of the CFE, a Software Quality Guarantee Plan and five procedures were developed in the year 2004, obtaining the qualification of the ININ for software development for the nuclear power plant of CFE. These first documents were developed taking like reference IEEE standards and regulator guides of NRC, being the first step for the development of the methodology. (Author)

  7. Cooperation for Interference Management: A GDoF Perspective

    KAUST Repository

    Gherekhloo, Soheil

    2016-10-13

    The impact of cooperation on interference management is investigated by studying an elemental wireless network, the so-called symmetric interference relay channel (IRC), from a generalized degrees of freedom (GDoF) perspective. This is motivated by the fact that the deployment of relays is considered as a remedy to overcome the bottleneck of current systems in terms of achievable rates. The focus of this paper is on the regime in which the interference link is weaker than the source-relay link in the IRC. Our approach toward studying the GDoF goes through the capacity analysis of the linear deterministic IRC (LD-IRC). New upper bounds on the sum capacity of the LD-IRC based on genie-aided approaches are established. These upper bounds together with some existing upper bounds are achieved by using four novel transmission schemes. Extending the upper bounds and the transmission schemes to the Gaussian case, the GDoF of the Gaussian IRC is characterized for the aforementioned regime. This completes the GDoF results available in the literature for the symmetric GDoF. It turns out that even if the incoming and outgoing links of the relay are both weaker than the desired channel, involving a relay can increase the GDoF. Interestingly, utilizing the relay in this case can increase the slope of the GDoF from -2 [in the interference channel (IC)] to -1 or 0. This shrinks the regime where ignoring the interference by treating it as noise is optimal. Furthermore, the analysis shows that if the relay ingoing and outgoing links are sufficiently strong, the relay is able to neutralize the interference completely. In this case, the bottleneck of the transmission will be the interference links, and hence, the GDoF increases if the interference link gets stronger. It is shown that in the strong interference regime, in contrast to the IC, the GDoF can be a monotonically decreasing function of the interference level. © 1963-2012 IEEE.

  8. Calendar

    Science.gov (United States)

    2004-06-01

    JULY 2004 2nd World Congress of the Game Theory Society, Faculty of Luminy, Marseille, France 5-9 July 2004 Europa Organisation (europa@europa-organisation.com), +33 5 34 45 26 45, www.gts2004.org Budapest Workshop on Behavioral Economics, Central European University, Budapest, Hungary 5-10 July 2004 Eva Dotzi (behavecon@ceu.hu), www.iza.org/en/calls_conferences/CallCEU_04.pdf FDA'04. 1st IFAC Workshop on Fractional Differentiation and its Applications, Bordeaux, France 19-20 July 2004 IFAC secretariat (fda04@lap.u-bordeaux1.fr), www.lap.u-bordeaux.fr/fda04/ Bachelier Finance Society Third World Congress, InterContinental Hotel, Chicago, IL, USA 21-24 July 2004 bfs2004@uic.edu, www.uic.edu/orgs/bachelier/ BS/IMS 2004. 6th World Congress of the Bernoulli Society for Mathematical Statistics and Probability, Barcelona, Spain 26-31 July 2004 wc2004@pacifico-meetings.com, +34 93 402 13 85, www.imub.ub.es/events/wc2004 AUGUST 2004 Summer School in Econometrics. The Cointegrated VAR Model: Econometric Methodology and Macroeconomic Applications, Institute of Economics, University of Copenhagen, Denmark 2-22 August 2004 Summerschool@econ.ku.dk, www.econ.ku.dk/summerschool SEPTEMBER 2004 First Bonzenfreies Colloquium on Market Dynamics and Quantitative Economics, Alessandria, Palazzo Borsalino, Italy 9-10 September 2004 colloquium@unipmn.it, www.mfn.unipmn.it/~colloqui/ Risk Analysis 2004. 4th International Conference on Computer Simulation in Risk Analysis and Hazard Mitigation, Aldemar Paradise Royal Mare Hotel, Rhodes, Greece 27-29 September 2004 enquiries@wessex.ac.uk, +44 (0)238 029 3223, www.wessex.ac.uk/conferences/2004/risk04/ OCTOBER 2004 IRC Hedge 2004, InterContinental Hotel, London, UK 10, 11 October 2004 enquiries@irc-conferences.com, www.irc-conferences.com/show_conference.php?id=10 NOVEMBER 2004 IRC DICE 2004, InterContinental Hotel, London, UK 22, 23 November 2004 enquiries@irc-conferences.com, www.irc-conferences.com/show_conference.php?id=13 DECEMBER 2004

  9. Dairy cows produce cytokine and cytotoxic T cell responses following vaccination with an antigenic fraction from Streptococcus uberis.

    Science.gov (United States)

    Wedlock, D Neil; Buddle, Bryce M; Williamson, John; Lacy-Hulbert, S Jane; Turner, Sally-Anne; Subharat, Supatsak; Heiser, Axel

    2014-07-15

    Streptococcus uberis is a major cause of mastitis in dairy cows worldwide and currently, there is no vaccine commercially available against this form of mastitis. In the current study, cell-free extracts (CFE) were prepared from each of three different S. uberis strains, designated as #3, #24 and #363 representative of the three main sequence types of S. uberis that cause mastitis in New Zealand. These proteins were formulated into vaccines with Emulsigen-D and the immunogenicity of the vaccines was determined in both calves and dairy cows. Two groups of calves (n=5/group) were vaccinated subcutaneously with CFE from strain #24 or strains #3, #24 and #363 formulated with Emulsigen-D, respectively. A third group (n=5) was vaccinated with CFE from the three strains formulated with Emulsigen-D and also containing recombinant bovine granulocyte macrophage colony-stimulating factor while, a control group (n=5) was not vaccinated. Vaccinated animals produced strong antibody responses to the S. uberis antigens and an antigen-specific cytotoxic effect against blood monocytes/macrophages that had phagocytosed S. uberis, with no significant differences in responses observed between the three vaccinated groups. In a second trial, the safety and immunogenicity of the vaccine containing CFE from all three strains of S. uberis and Emulsigen-D was determined in dairy cows. A group of six cows were vaccinated subcutaneously at 3 and 1 week prior to dry off and revaccinated 2-3 weeks before calving. Immune responses in blood and mammary gland secretions (MGS) were monitored during the dry period and in the subsequent lactation. The vaccine was well tolerated with no adverse effect from vaccination observed in any of the cows. Vaccination induced an antigen-specific cytotoxic effect against blood monocytes/macrophages that had phagocytosed S. uberis, moderate antigen-specific IFN-γ responses in blood and strong antibody responses in both blood and MGS. In conclusion, the results

  10. Qualidade de vida de crianças e adolescentes com insuficiência renal crônica em hemodiálise: construção do Módulo Específico DISABKIDS®

    OpenAIRE

    Isabella Schroeder Abreu

    2014-01-01

    Estudos envolvendo a mensuração da qualidade de vida relacionada à saúde (QVRS) de crianças e adolescentes com insuficiência renal crônica (IRC) são escassos no Brasil, o que pode ser resultado, da ausência de instrumentos específicos para este fim. Muitos estudos, nesse sentido, são desenvolvidos utilizando-se instrumentos específicos para adultos com IRC ou instrumentos genéricos de QVRS, não específicos para esta condição crônica (CC). A presente pesquisa trata-se de um estudo metod...

  11. Tunneling in the CH{sub 3} + H{sub 2} {yields} CH{sub 4} + H reaction and its isotopic analog: an anomalous isotope effect

    Energy Technology Data Exchange (ETDEWEB)

    Kurosaki, Yuzuru; Takayanagi, Toshiyuki [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-10-01

    Vibrationally adiabatic ground-state potential curves for the CH{sub 3} + H{sub 2} {yields} CH{sub 4} + H (I) and CD{sub 3} + H{sub 2} {yields} CD{sub 4}H + H (II) reactions were obtained by adding zero-point energies of harmonic vibrations orthogonal to intrinsic reaction coordinate (IRC) to bare potential curves along IRC. It was clarified that both the barrier height and barrier width of reaction II are smaller than those of reaction I. This computational result qualitatively explains the experimental observation of Momose et al. (J. Chem. Phys. 108 (1998) 7334) that reaction II occurs but reaction I does not occur in solid parahydrogen at 5 K. (author)

  12. World tour through the internet

    International Nuclear Information System (INIS)

    Jang, Ji Hwan; Kang, Ho Seong; Kim, Jong Hun

    1994-03-01

    This book deals with basic knowledge and familiarity with internet use, which is composed of seven chapters ; the world of internet, the basic knowledge for internet use such as telnet, mail, talk, basic command on Unix and command for communication, to access to the internet, if you get on the internet for the first time, useful service of internet such as archie service, gopher service, who is service, Use net, IRC and Netiquette on IRC, interesting internet trip like Billboard charts, TV-Rating, Solar Report, Agricultural Info, CARL, Nat'l Education BBS, internet service in Sydney university FEDIX, CAIR, NOAA, SDDAS, Stock, MUD and international Go server. The last chapter is computer networks connected to the internet ; computer services, BITNET, and FidoNet.

  13. New CO and HCN sources associated with IRAS carbon stars

    Science.gov (United States)

    NGUYEN-Q-RIEU; Epchtein, N.; TRUONG-BACH; Cohen, M.

    1987-01-01

    Emission of CO and HCN was detected in 22 out of a sample of 53 IRAS sources classified as unidentified carbon-rich objects. The sample was selected according to the presence of the silicon carbide feature as revealed by low-resolution spectra. The molecular line widths indicate that the CO and HCN emission arises from the circumstellar envelopes of very highly evolved stars undergoing mass loss. The visible stars tend to be deficient in CO as compared with unidentified sources. Most the detected CO and HCN IRAS stars are distinct and thick-shelled objects, but their infrared and CO luminosities are similar to those of IRC + 102156 AFGL and IRC-CO evolved stars. The 12 micron flux seems to be a good indicator of the distance, hence a guide for molecular searches.

  14. International radiation commissions 1896 to 2008. Research into atmospheric radiation from IMO to IAMAS

    International Nuclear Information System (INIS)

    Bolle, H.J.; Moeller, F.; London, J.

    2008-01-01

    The document covers a historical compilation on research into atmospheric radiation from 1896 to 2008. The first part is a brief history of the radiation commissions of IMO (International Meteorological Organization) and IUGG (International Union of Geodesy and Geophysics) for the period 1824 to 1948. Part 2 Covers the International Radiation Commission (IRC) of IAM (International Association of Meteorology)/IAMAS (International Association of Meteorology and Atmospheric Sciences)/IAMAP (International Association of Meteorology and Atmospheric Physics); the Re-constitution of the IUGG Radiation Commision, the Officers of the International Radiation Commission of IUUG 1948-2008, and the activities of the Radiation Commision of the IUGG 1948-2008. The appendices include the Radiation Commission Members, the summaries of presented papers from 1954 and 1957, the IRC publications, and acronyms

  15. The possibility of detecting DC

    International Nuclear Information System (INIS)

    Witte, N.S.; Brown, R.D.

    1977-01-01

    IRC + 10216, a bright infrared late type carbon star, is observed to have millimetre range line emission of the species 12 CO, 13 CO, CS, C 2 H, HC 3 N, CN, HCN, SiS and SiO in an extended envelope around the central infrared sources. A model explaining the line emission in terms of infrared pumping between the two lowest vibrational levels, first proposed for IRC + 10216, was used to calculate antenna temperatures for various rotational transitions of HC 3 N; since there is a prima facie agreement between the calculated and observed values for HC 3 N we have attempted the same calculation for DC 3 N. (J.R.)

  16. MOLECULAR LINE OBSERVATIONS OF THE CARBON-RICH CIRCUMSTELLAR ENVELOPE CIT 6 AT 7 mm WAVELENGTHS

    Energy Technology Data Exchange (ETDEWEB)

    Chau, Wayne; Zhang Yong; Nakashima, Jun-ichi; Kwok, Sun [Department of Physics, University of Hong Kong (Hong Kong); Deguchi, Shuji [Nobeyama Radio Observatory, National Astronomical Observatory, Minamimaki, Minamisaku, Nagano 384-1305 (Japan)

    2012-11-20

    We present a {lambda}7 mm spectral line survey of the carbon-rich circumstellar envelope (CSE) CIT 6 using the 45 m telescope at the Nobeyama Radio Observatory. A total of 25 spectral features belonging to five molecular species (HC{sub 3}N, HC{sub 5}N, HC{sub 7}N, SiO, and CS) are detected, enabling us to investigate the chemistry of cyanopolyyne chains. The line strengths are compared with those of the proto-typical carbon-rich CSE IRC+10216. The results show that the cyanopolyyne molecules are enhanced in CIT 6, suggesting that it is more evolved than IRC+10216. In order to investigate the structure of CIT 6, we have constructed a three-dimensional spatiokinematic model. By comparing the observed line profiles with the models, we conclude that this envelope is asymmetric and is composed of several incomplete shells.

  17. World tour through the internet

    Energy Technology Data Exchange (ETDEWEB)

    Jang, Ji Hwan; Kang, Ho Seong; Kim, Jong Hun

    1994-03-15

    This book deals with basic knowledge and familiarity with internet use, which is composed of seven chapters ; the world of internet, the basic knowledge for internet use such as telnet, mail, talk, basic command on Unix and command for communication, to access to the internet, if you get on the internet for the first time, useful service of internet such as archie service, gopher service, who is service, Use net, IRC and Netiquette on IRC, interesting internet trip like Billboard charts, TV-Rating, Solar Report, Agricultural Info, CARL, Nat'l Education BBS, internet service in Sydney university FEDIX, CAIR, NOAA, SDDAS, Stock, MUD and international Go server. The last chapter is computer networks connected to the internet ; computer services, BITNET, and FidoNet.

  18. International radiation commissions 1896 to 2008. Research into atmospheric radiation from IMO to IAMAS

    Energy Technology Data Exchange (ETDEWEB)

    Bolle, H J [comp.; Moeller, F; London, J

    2008-05-15

    The document covers a historical compilation on research into atmospheric radiation from 1896 to 2008. The first part is a brief history of the radiation commissions of IMO (International Meteorological Organization) and IUGG (International Union of Geodesy and Geophysics) for the period 1824 to 1948. Part 2 Covers the International Radiation Commission (IRC) of IAM (International Association of Meteorology)/IAMAS (International Association of Meteorology and Atmospheric Sciences)/IAMAP (International Association of Meteorology and Atmospheric Physics); the Re-constitution of the IUGG Radiation Commision, the Officers of the International Radiation Commission of IUUG 1948-2008, and the activities of the Radiation Commision of the IUGG 1948-2008. The appendices include the Radiation Commission Members, the summaries of presented papers from 1954 and 1957, the IRC publications, and acronyms.

  19. Integrated Assessment and Improvement of the Quality Assurance System for the Cosworth Casting Process

    Science.gov (United States)

    Yousif, Dilon

    The purpose of this study was to improve the Quality Assurance (QA) System at the Nemak Windsor Aluminum Plant (WAP). The project used Six Sigma method based on Define, Measure, Analyze, Improve, and Control (DMAIC). Analysis of in process melt at WAP was based on chemical, thermal, and mechanical testing. The control limits for the W319 Al Alloy were statistically recalculated using the composition measured under stable conditions. The "Chemistry Viewer" software was developed for statistical analysis of alloy composition. This software features the Silicon Equivalency (SiBQ) developed by the IRC. The Melt Sampling Device (MSD) was designed and evaluated at WAP to overcome traditional sampling limitations. The Thermal Analysis "Filters" software was developed for cooling curve analysis of the 3XX Al Alloy(s) using IRC techniques. The impact of low melting point impurities on the start of melting was evaluated using the Universal Metallurgical Simulator and Analyzer (UMSA).

  20. Caracterização da doença periodontal em cães com insuficiência renal crônica ou função renal normal

    OpenAIRE

    Barbudo-Selmi, Glenda Ramalho; Carvalho, Marileda Bonafim; Selmi, André Luis; Martins, Silvio Emílio Cuevas

    2004-01-01

    O objetivo deste estudo foi comparar a doença periodontal (DP) em cães com insuficiência renal crônica (IRC) e cães com função renal normal (FRN). Doze animais com IRC e 24 com FRN, apresentando formação de bolsa periodontal foram comparados. em todos os animais, realizou-se determinação do nível sérico de uréia e creatinina, da densidade urinária e dos valores do hemograma e leucograma. O exame da cavidade oral constou da avaliação do grau de placa bacteriana, gengivite, recessão gengival, b...

  1. The chemistry of molecular anions in circumstellar sources

    Energy Technology Data Exchange (ETDEWEB)

    Agúndez, Marcelino [LUTH, Observatoire de Paris-Meudon, 5 Place Jules Janssen, 92190 Meudon (France); Cernicharo, José [Departamento de Astrofísica, CAB, CSIC-INTA, Ctra. de Torrejón a Ajalvir km 4, 28850 Madrid (Spain); Guélin, Michel [Institut de Radioastronomie Millimétrique, 300 rue de la Piscine, 38406 Saint Martin d' Héres (France)

    2015-01-22

    The detection of negatively charged molecules in the interstellar and circumstellar medium in the past four years has been one of the most impacting surprises in the area of molecular astrophysics. It has motivated the interest of astronomers, physicists, and chemists on the study of the spectroscopy, chemical kinetics, and prevalence of molecular anions in the different astronomical regions. Up to six different molecular anions have been discovered in space to date, the last one being the small ion CN{sup −}, which has been observed in the envelope of the carbon star IRC +10216 and which contrary to the other larger anions is not formed by electron attachment to CN, but through reactions of large carbon anions with nitrogen atoms. Here we briefly review the current status of our knowledge of the chemistry of molecular anions in space, with particular emphasis on the circumstellar source IRC +10216, which to date is the astronomical source harboring the largest variety of anions.

  2. The role of near infrared radiation in photoaging of the skin.

    Science.gov (United States)

    Schroeder, Peter; Haendeler, Judith; Krutmann, Jean

    2008-07-01

    Infrared (IR) radiation is non-ionizing, electromagnetic radiation with wavelengths between 760 nm and 1 mm, which is further divided into IRA, IRB and IRC. IR accounts for more than half of the solar energy that reaches the human skin. While IRB and IRC do not penetrate deeply into the skin, more than 65% of IRA reaches the dermis. Human skin is increasingly exposed to IRA-radiation; most relevant sources are (i) natural solar radiation consisting of over 30% IRA, (ii) artificial IRA sources used for therapeutic or wellness purposes and (iii) artificial UV sources contaminated with IRA. As part of natural sunlight, IRA significantly contributes to extrinsic skin aging. This article reviews the cutaneous effects of IRA-radiation, the underlying molecular mechanisms and the available protective strategies.

  3. Stokes polarimetry of main-line OH emission from stellar masers

    International Nuclear Information System (INIS)

    Claussen, M.J.; Fix, J.D.

    1982-01-01

    Main-line OH emission has been measured in all four Stokes parameters from seven late-type variable stars and the F8 supergiant IRC+10420. Linearly polarized features were detected in UX Cyg, U Ori, and IRC+10420 at 1665 MHz. The linearly polarized features in UX Cyg and IRC +10420, when combined with adjacent circularly polarized features suggest Zeeman patterns. A polarization pattern in IRC+10420 is probably the best example of a complete Zeeman pattern yet observed in stellar masers, although it appears to lack the shifted linear (sigma) components. This study, combined with other recent work, shows that linearly polarized features in stellar sources are uncommon. Only about 10% of the stellar OH sources show linearly polarized features. As an aid in accounting for the observed polarization properties of stellar OH masers, model mass flows were calculated using magnetic field structures similar to that of the solar wind. Conclusions drawn from this model were: (1) unpolarized or weakly circularly polarized emission from sources can arise from the entire circumstellar shell; (2) circular polarization without linear polarization can be produced either by emission from the entire shell or by enhanced OH densities in small regions of the shell provided there are sufficient free electrons present to depolarize the linear components; and (3) Zeeman patterns which include both circular and linear polarizations can be produced in OH density enhancements if electron densities are low. The electron densities required for effective Faraday depolarization yield emission measures of the order of 10 9 pc cm -6 . Given the large distances of stellar OH masers, the thermal continuum emission from such depolarizing electrons would probably be undetectable

  4. Nobody Sells Gold for the Price of Silver: Dishonesty, Uncertainty and the Underground Economy

    Science.gov (United States)

    Herley, Cormac; Florêncio, Dinei

    The underground economy has attracted a lot of attention recently as a key component of cybercrime. In particular the IRC markets for stolen identities, phishing kits, botnets, and cybercrime related services have been extensively studied. It is suggested that sophisticated underground markets show great specialization and maturity. There are complex divisions of labor and service offerings for every need. Stolen credentials are traded in bulk for pennies on the dollar. It is suggested that large sums move on these markets.

  5. Reuse of the Cloud Analytics and Collaboration Environment within Tactical Applications (TacApps): A Feasibility Analysis

    Science.gov (United States)

    2016-03-01

    Representational state transfer  Java messaging service  Java application programming interface (API)  Internet relay chat (IRC)/extensible messaging and...JBoss application server or an Apache Tomcat servlet container instance. The relational database management system can be either PostgreSQL or MySQL ... Java library called direct web remoting. This library has been part of the core CACE architecture for quite some time; however, there have not been

  6. Structures and immunolocalization of Na+, K+ -ATPase, Na+ /H+ exchanger 3 and vacuolar-type H+ -ATPase in the gills of blennies (Teleostei: Blenniidae) inhabiting rocky intertidal areas.

    Science.gov (United States)

    Uchiyama, M; Komiyama, M; Yoshizawa, H; Shimizu, N; Konno, N; Matsuda, K

    2012-05-01

    The structure and immunolocalization of the ion transporters Na(+) ,K(+) -ATPase (NKA), Na(+) /H(+) exchanger (NHE3) and vacuolar-type H(+) -ATPase (VHA) were examined in the gills of teleosts of the family Blenniidae, which inhabit rocky shores with vertical zonation in subtropical seas. These features were compared among the following species with different ecologies: the amphibious rockskipper blenny Andamia tetradactylus, the intertidal white-finned blenny Praealticus tanegasimae and the purely marine yaeyama blenny Ecsenius yaeyamaensis. Light and electron microscopic observations indicated that thick gill filaments were arranged close to each other and alternately on two hemibranches of a gill arch in the opercular space of A. tetradactylus. Many mucous cells (MC) and mitochondrion-rich cells (MRC) were present in the interlamellar regions of the gill filament. An immunohistochemical study demonstrated that numerous NKA, NHE3 and some VHA were located predominantly on presumed MRCs of gill filaments and at the base of the lamellae. Analyses using serial (mirror image) sections of the gills indicated that only a few NKA immunoreactive cells (IRC) were colocalized with VHA on some MRCs in the filaments. In the gills of P. tanegasimae, NKA- and NHE3-IRCs were observed in the interlamellar region of the filaments and at the base of the lamellae. VHA-IRCs were located sparsely on the lamellae and filaments. In the gills of E. yaeyamaensis, the lamellae and filaments were thin and straight, respectively. MCs were located at the tip as well as found scattered in the interlamellar region of gill filaments. NKA-, NHE3- and VHA-IRCs were moderately frequently observed in the filaments and rarely on the lamellae. This study shows that the structure and distribution of ion transporters in the gills differ among the three blennid species, presumably reflecting their different ecologies. © 2012 The Authors. Journal of Fish Biology © 2012 The Fisheries Society of the

  7. 'Impulsive compulsivity' in obsessive-compulsive disorder: a phenotypic marker of patients with poor clinical outcome.

    Science.gov (United States)

    Kashyap, Himani; Fontenelle, Leonardo F; Miguel, Euripedes C; Ferrão, Ygor A; Torres, Albina R; Shavitt, Roseli G; Ferreira-Garcia, Rafael; do Rosário, Maria C; Yücel, Murat

    2012-09-01

    Although traditionally obsessive-compulsive disorder (OCD) and impulse control disorders (ICD) have represented opposing ends of a continuum, recent research has demonstrated a frequent co-occurrence of impulsive and compulsive behaviours, which may contribute to a worse clinical picture of some psychiatric disorders. We hypothesize that individuals with 'impulsive' OCD as characterized by poor insight, low resistance, and reduced control towards their compulsions will have a deteriorative course, greater severity of hoarding and/or symmetry/ordering symptoms, and comorbid ICD and/or substance use disorders (SUD). The sample consisted of 869 individuals with a minimum score of 16 on the Yale-Brown Obsessive Compulsive Scale (Y-BOCS). Of these, 65 had poor insight, low resistance, and reduced control towards compulsions ('poor IRC') and 444 had preserved insight, greater resistance and better control over compulsions ('good IRC'). These two groups were compared on a number of clinical and demographic variables. Individuals with poor IRC were significantly more likely to have a deteriorative course (p disorder (p = 0.026), trichotillomania (p = 0.014) and compulsive buying (p = 0.040). Regression analysis revealed that duration of obsessions (p = 0.037) and hoarding severity (p = 0.005) were significant predictors of poor IRC. In the absence of specific measures for impulsivity in OCD, the study highlights the utility of simple measures such as insight, resistance and control over compulsions as a phenotypic marker of a subgroup of OCD with impulsive features demonstrating poor clinical outcome. Copyright © 2012 Elsevier Ltd. All rights reserved.

  8. Molecular hydrogen jets from the Orion nebula

    International Nuclear Information System (INIS)

    Taylor, K.N.R.; Storey, J.W.V.; Zealey, W.J.

    1984-01-01

    In an attempt to understand the relationship of the recently discovered complex of Herbig Haro objects in Orion to the IR sources in this region, the authors have carried out a survey of the molecular hydrogen S(1) line distribution. The observations have led to the discovery of a previously unsuspected structure of finger-like filaments of H 2 emission extending radially outwards from a common centre at IRC9. (author)

  9. Observations of far-infrared molecular emission lines from the Orion molecular cloud

    International Nuclear Information System (INIS)

    Viscuso, P.J.

    1986-01-01

    The Orion Nebula has been the subject of intensive study for over one hundred years. Far-infrared (FIR) molecular line observations of CO in the shock region surrounding the infrared source IRc2 have suggested that the molecular hydrogen density in the shocked and post-shock gas is roughly 3 x 10 6 cm -3 . The temperature of this gas is on the order of 750-2000K. IRc2, like other nearby infrared sources within the Nebula, is thought to be a site of recent star formation. This object is apparently at the center of a massive bipolar molecular outflow of gas, which is producing a shock front where it meets the ambient molecular cloud surrounding IRc2. Study of such regions is important for the understanding of the chemical and physical processes that are involved in the formation of stars from molecular clouds. Recently, several far-infrared transitions among the low-lying levels of OH have been observed toward IRc2. OH is thought to be abundant, and it plays an important role in the chemical evolution of the shock and post-shock regions. The OH emission serves as a sensitive probe of the temperature and density for the shock-processed gas. A rigorous treatment of the radiative transfer of these measured transitions is performed using the escape probability formalism. From this analysis, the author determines the temperature of the OH-emitting region to be on the order of 40K. This suggests that the gas is part of the post-shock gas that has cooled sufficiently, most likely by way of radiative cooling by CO

  10. Online Problem Solving for Adolescent Brain Injury: A Randomized Trial of 2 Approaches.

    Science.gov (United States)

    Wade, Shari L; Taylor, Hudson Gerry; Yeates, Keith Owen; Kirkwood, Michael; Zang, Huaiyu; McNally, Kelly; Stacin, Terry; Zhang, Nanhua

    Adolescent traumatic brain injury (TBI) contributes to deficits in executive functioning and behavior, but few evidence-based treatments exist. We conducted a randomized clinical trial comparing Teen Online Problem Solving with Family (TOPS-Family) with Teen Online Problem Solving with Teen Only (TOPS-TO) or the access to Internet Resources Comparison (IRC) group. Children, aged 11 to 18 years, who sustained a complicated mild-to-severe TBI in the previous 18 months were randomly assigned to the TOPS-Family (49), TOPS-TO (51), or IRC group (52). Parent and self-report measures of externalizing behaviors and executive functioning were completed before treatment and 6 months later. Treatment effects were examined using linear regression models, adjusting for baseline symptom levels. Age, maternal education, and family stresses were examined as moderators. The TOPS-Family group had lower levels of parent-reported executive dysfunction at follow-up than the TOPS-TO group, and differences between the TOPS-Family and IRC groups approached significance. Maternal education moderated improvements in parent-reported externalizing behaviors, with less educated parents in the TOPS-Family group reporting fewer symptoms. On the self-report Behavior Rating Inventory of Executive Functions, treatment efficacy varied with the level of parental stresses. The TOPS-Family group reported greater improvements at low stress levels, whereas the TOPS-TO group reported greater improvement at high-stress levels. The TOPS-TO group did not have significantly lower symptoms than the IRC group on any comparison. Findings support the efficacy of online family problem solving to address executive dysfunction and improve externalizing behaviors among youth with TBI from less advantaged households. Treatment with the teen alone may be indicated in high-stress families.

  11. Original Paper Evaluation de la fonction rénale chez les patients ...

    African Journals Online (AJOL)

    Evaluation de la fonction rénale chez les patients atteints de maladie cardio vasculaire (MCV) : comparaison entre ... Mots clés : Cystatine C, créatinine, insuffisance rénale, débit de filtration glomérulaire, maladies cardiovasculaires. Evaluation of the ... L'insuffisance rénale chronique (IRC) et les maladies cardiovasculaires ...

  12. SU-F-J-129: Verification of Geometric and Dosimetric Accuracy of Respiratory Management Systems Using Homemade Phantom

    Energy Technology Data Exchange (ETDEWEB)

    Goksel, E; Kucucuk, H; Senkesen, O [Acibadem Kozyatgi Hospital, Istanbul (Turkey); Tezcanli, E [Acibadem University, Istanbul (Turkey)

    2016-06-15

    Purpose: Different placements of Infrared Cameras (IRC) in CT and treatment rooms can cause gating window level (GWL) variations leading to differences between GWL used for planning and treatments. Although, Varian Clinac DHX-OBI sytem and CT are equipped with the same kind of IRC, Truebeam STx (TB) has a different type of IRC known as banana type. In this study; geometric and dosimetric accuracy of respiratory management system (RPM) for different machines were investigated with a special homemade phantom. Methods: Special phantom was placed on the respiratory simulator machine and a CT data set was obtained at the end of the expirium phase (EOE). Conformal and IMRT plans were generated on the EOE CT image series for both DHX-OBI and TB LINACs while a VMAT plan was generated only for TB.The acquired respiratory graphs in the CT were directly sent to DHX-OBI system, and they were converted with software before sending to TB. EBT3 films were placed inside the phantom and were irradiated using RPM system with two machines for different plans. Planar dose distributions were compared with gamma analysis (GA) method (3mm, %3) to evaluate planned-measured dose differences. In addition, radio-opac marker was placed in the center of the phantom to evaluate the geometric accuracy of treatment field with gated flouroscopy (GF). Results: There were no shifts detected between planning and treeatment GWL for both DHX-OBI and TB. Difference on the GF image between digital graticule and radio-opac marker was <1mm for TB and 1mm for DHX-OBI. Although, GA agreement was 97% for conformal and IMRT techniques in TB, it was 96% for VMAT technique. While GA agreement was 98% for conformal technique in DHX-OBI, IMRT was 95%.ConclusionThis study showed that RPM can be used accurately in spite of different IRC placements or different types of ICR used.

  13. The Unexplored Impact of IPv6 on Intrusion Detection Systems

    Science.gov (United States)

    2012-03-01

    Protocol Version 4 IPv4 Internet Protocol Version 6 IRC Internet Relay Chat LAN Local Area Network xv MiTM Man in the Middle MLD Multicast Listener...section. 1. Sniffing 2. Application Layer Attacks 3. Rogue Devices 4. Man In the Middle ( MITM ) 5. Flooding 6. Reconnaissance 7. Unauthorized access 8...the method by which worms find hosts may have to change. Man In The Middle ( MITM ) The general theory of the Man in the Middle ( MITM ) threat does not

  14. Ignition of Ionic Liquids. Volume 2

    Science.gov (United States)

    2010-09-01

    TOFMS time-of-flight-mass-spectrometry TS transition state VUV vacuum ultraviolet ZPE zero-point energy Approved for public...energies ( ZPEs ) were scaled by a factor of 0.9613 and 0.9804, respectively, and when necessary intrinsic reaction coordinate (IRC) calculations were...oscillations in the PE reflect the vibration of the DNB molecule, including ZPE . The trajectory shows three dissociation steps, eliminating NO2 followed

  15. Advanced Technology Acquisition Strategies of the People’s Republic of China

    Science.gov (United States)

    2010-09-01

    Institute of Applied Physics and Computational Mathematics ICBM inter-continental ballistic missile IOE Institute of Optics and Electronics IRC...corporations, and other entities to devise collection schemes according to their particular needs. Another is China’s emphasis on “ actuarial ... mathematics , astronomy, manufacturing, and many other facets of economic and cultural development. The “four great inventions” (sì dà fā míng) of

  16. Internet : Kasutaja konspekt / Uuno Vallner

    Index Scriptorium Estoniae

    Vallner, Uuno

    1996-01-01

    Järg nr. 4, lk. 32-38, nr. 5, lk. 18-30, nr. 6, lk. 31-35, nr. 7, lk. 29-50, nr. 8, lk. 23-31, nr. 9, lk. 31-35. Mis on Internet, Inverneti töökeskkond, adresseerimine. Arhiivid. Pakitud failid. Finger. Whois. Ping. HTML põhikonstruktsioonid. Gopher, WAIS, talk, IRC, MUD, kommertsandmebaasisüsteemid. Telnet. Meililistid, Usenet ja uudisegrupid, failiülekanne

  17. Structural Area Inspection Frequency Evaluation (SAIFE). Volume 5. Results of Model Demonstration

    Science.gov (United States)

    1978-04-01

    serlV ice 11 i Stot’)’ .i ’ base~d Otil narrow -bodly at ir-c t’a ftA wh ich have fewer 0 1 euient~s than thle hypothet i cal widve - A body aircaf...kP1 c u TABLE 14. DL40MRATION RESULTS .M WING - SPAR, FMD Defects Per Million Flight Hours Crack Detected Preflight 0.00 0104 Service 0.00 0.49 Phase

  18. Changing up the system : a case study of how changes in waste management systems in Ulstein affect sorting behaviour

    OpenAIRE

    Tollefsen, Irene

    2014-01-01

    To mitigate a climate that is changing in a potentially catastrophic direction due to human influences, we need to develop sound environmental policies that abate these influences. And the changes need to come from changes in human behaviour. This paper compares two economic theories of human behaviour; the rational choice theory of neoclassic economics and the institutions-as-rationality-contexts (IRC) of institutional theory. Where rational choice theory views the individual as the correct ...

  19. Numerical modelling of the tilt casting processes of titanium alumindes

    OpenAIRE

    Wang, Hong

    2008-01-01

    This research has investigated the modelling and optimisation of the tilt casting process of Titanium Aluminides (TiAl). This study is carried out in parallel with the experimental research undertaken in IRC at the University of Birmingham. They propose to use tilt casting inside a vacuum chamber and attempt to combine this tilt casting process with Induction Skull Melting (ISM). A totally novel process is developing for investment casting, which is suitable for casting gamma TiAl.\\ud \\ud As ...

  20. Candidate Genes for Late Diabetic Complications

    OpenAIRE

    Lindholm, Eero

    2007-01-01

    Diabetes mellitus is a group of metabolic diseases characterized by hyperglycemia resulting from defects in insulin secretion, insulin action, or both. The new WHO criteria for classification of diabetes takes into account also clinical stages dividing the diabetic patients into noninsulin requiring (NIR), insulin requiring for control (IRC) and insulin requiring for survival (IRS) subgroups. Diabetic complications are the result of chronically elevated blood glucose. Genetic factors are beli...

  1. Research

    African Journals Online (AJOL)

    abp

    9 sept. 2015 ... port/publications/irc-pub01/jc151-hiv-in-pregnancy_en.pdf. (consulté le 20 juin 2014). Google Scholar. 12. Ministère de la Santé (RDC). Programme National de Lutte contre le Sida et les IST. Protocole national sur la Prévention de la Transmission du VIH de la mère à l'enfant. Juillet. 2010. Google Scholar.

  2. Cell-type-dependent action potentials and voltage-gated currents in mouse fungiform taste buds.

    Science.gov (United States)

    Kimura, Kenji; Ohtubo, Yoshitaka; Tateno, Katsumi; Takeuchi, Keita; Kumazawa, Takashi; Yoshii, Kiyonori

    2014-01-01

    Taste receptor cells fire action potentials in response to taste substances to trigger non-exocytotic neurotransmitter release in type II cells and exocytotic release in type III cells. We investigated possible differences between these action potentials fired by mouse taste receptor cells using in situ whole-cell recordings, and subsequently we identified their cell types immunologically with cell-type markers, an IP3 receptor (IP3 R3) for type II cells and a SNARE protein (SNAP-25) for type III cells. Cells not immunoreactive to these antibodies were examined as non-IRCs. Here, we show that type II cells and type III cells fire action potentials using different ionic mechanisms, and that non-IRCs also fire action potentials with either of the ionic mechanisms. The width of action potentials was significantly narrower and their afterhyperpolarization was deeper in type III cells than in type II cells. Na(+) current density was similar in type II cells and type III cells, but it was significantly smaller in non-IRCs than in the others. Although outwardly rectifying current density was similar between type II cells and type III cells, tetraethylammonium (TEA) preferentially suppressed the density in type III cells and the majority of non-IRCs. Our mathematical model revealed that the shape of action potentials depended on the ratio of TEA-sensitive current density and TEA-insensitive current one. The action potentials of type II cells and type III cells under physiological conditions are discussed. © 2013 Federation of European Neuroscience Societies and John Wiley & Sons Ltd.

  3. Memory Corruption Mitigations and Their Implementation Progress in Third-Party Windows Applications

    Science.gov (United States)

    2012-09-01

    coverage in the news, which helped the public recognize the importance of computers in everyday life and, more importantly, the challenges in securing...Media Players Winamp, VLC Media Player, Quicktime Player, iTunes, Real Player Instant Messaging Applications mIRC, Yahoo Messenger, AIM, Nimbuzz...as cell phones and tablets, may boost this ratio in the upcoming years. In such a highly connected world, it is becoming more and more challenging

  4. CRL 2688: A post-carbon-star object and probable planetary nebula progenitor

    International Nuclear Information System (INIS)

    Zuckerman, B.; Gilra, D.P.; Turner, B.E.; Morris, M.; Palmer, P.

    1976-01-01

    Millimeter-wavelength emission is observed toward CRL 2688 from H 12 CN, H 13 CN, CS, and HC 3 N. The similarity of this emission and that from the molecular envelope of the carbon star IRC+10216 establishes, beyond a reasonable doubt, that CRL 2688 is a post--carbon-star object. It appears probable that both of these objects will evolve into planetary nebulae. An evolutionary sequence leading from carbon stars to planetary nebulae is outlined

  5. The Infrared-Radio Correlation of Dusty Star Forming Galaxies at High Redshift

    Science.gov (United States)

    Lower, Sidney; Vieira, Joaquin Daniel; Jarugula, Sreevani

    2018-01-01

    Far-infrared (FIR) and radio continuum emission in galaxies are related by a common origin: massive stars and the processes triggered during their birth, lifetime, and death. FIR emission is produced by cool dust, heated by the absorption of UV emission from massive stars, which is then re-emitted in the FIR. Thermal free-free radiation emitted from HII regions dominates the spectral energy density (SED) of galaxies at roughly 30 GHz, while non-thermal synchrotron radiation dominates at lower frequencies. At low redshift, the infrared radio correlation (IRC, or qIR) holds as a tight empirical relation for many star forming galaxy types, but until recently, there has not been sensitive enough radio observations to extend this relation to higher redshifts. Many selection biases cloud the results of these analyses, leaving the evolution of the IRC with redshift ambiguous. In this poster, I present CIGALE fitted spectral energy distributions (SEDs) for 24 gravitationally-lensed sources selected in the mm-wave from the South Pole Telescope (SPT) survey. I fit the IRC from infrared and submillimeter fluxes obtained with Herschel, Atacama Pathfinder Experiment (APEX), and SPT and radio fluxes obtained with ATCA at 2.1, 5.5, 9, and 30 GHz. This sample of SPT sources has a spectroscopic redshift range of 2.1poster, I will present the results of this study and compare our results to various results in the literature.

  6. Counselor-Assisted Problem Solving (CAPS) Improves Behavioral Outcomes in Older Adolescents with Complicated Mild to Severe TBI

    Science.gov (United States)

    Wade, Shari L.; Stancin, Terry; Kirkwood, Michael; Brown, Tanya Maines; Rochester, Mayo Clinic; McMullen, Kendra M.; Taylor, H. Gerry

    2013-01-01

    Objective To test the efficacy of Counselor-Assisted Problem Solving (CAPS) versus an internet resources comparison (IRC) condition in reducing behavior problems in adolescents following traumatic brain injury (TBI). Design Randomized clinical trial with interviewers naïve to treatment condition. Setting Three large tertiary children's hospitals and two general hospitals with pediatric commitment. Participants 132 children ages 12-17 years hospitalized during the previous 6 months for moderate to severe TBI. Interventions Participants in CAPS (n = 65) completed 8-12 online modules providing training in problem solving, communication skills, and self-regulation and subsequent synchronous videoconferences with a therapist. Participants in the IRC group (n = 67) received links to internet resources about pediatric TBI. Main Outcome Measures Child Behavior Checklist (CBCL) administered before and after completion of treatment (i.e., approximately six months after treatment initiation). Results Post hoc analysis of covariance (ANCOVA), controlling for pre-treatment scores, was used to examine group differences in behavior problems in the entire sample and among older (n=59) and younger adolescents (n=53). Among older but not younger adolescents, CAPS resulted in greater improvements on multiple dimensions of externalizing behavior problems than did IRC. Conclusion Online problem-solving therapy may be effective in reducing behavior problems in older adolescent survivors of moderate-severe TBI. PMID:23640543

  7. Effect of Temperature and Sheet Temper on Isothermal Solidification Kinetics in Clad Aluminum Brazing Sheet

    Science.gov (United States)

    Benoit, Michael J.; Whitney, Mark A.; Wells, Mary A.; Winkler, Sooky

    2016-09-01

    Isothermal solidification (IS) is a phenomenon observed in clad aluminum brazing sheets, wherein the amount of liquid clad metal is reduced by penetration of the liquid clad into the core. The objective of the current investigation is to quantify the rate of IS through the use of a previously derived parameter, the Interface Rate Constant (IRC). The effect of peak temperature and initial sheet temper on IS kinetics were investigated. The results demonstrated that IS is due to the diffusion of silicon (Si) from the liquid clad layer into the solid core. Reduced amounts of liquid clad at long liquid duration times, a roughened sheet surface, and differences in resolidified clad layer morphology between sheet tempers were observed. Increased IS kinetics were predicted at higher temperatures by an IRC model as well as by experimentally determined IRC values; however, the magnitudes of these values are not in good agreement due to deficiencies in the model when applied to alloys. IS kinetics were found to be higher for sheets in the fully annealed condition when compared with work-hardened sheets, due to the influence of core grain boundaries providing high diffusivity pathways for Si diffusion, resulting in more rapid liquid clad penetration.

  8. BMI-1 Promotes Self-Renewal of Radio- and Temozolomide (TMZ)-Resistant Breast Cancer Cells.

    Science.gov (United States)

    Yan, Yanfang; Wang, Ying; Zhao, Pengxin; Ma, Weiyuan; Hu, Zhigang; Zhang, Kaili

    2017-12-01

    Breast cancer is a hormone-dependent malignancy and is the most prevalent cause of cancer-related mortality among females. Radiation therapy and chemotherapy are common treatments of breast cancer. However, tumor relapse and metastasis following therapy are major clinical challenges. The importance of B-lymphoma Moloney murine leukemia virus insertion region-1 (BMI-1) was implicated in cell proliferation, stem cell maintenance, and tumor initiation. We established radio- and temozolomide (TMZ)-resistant (IRC-R) MCF-7 and MDA-MB-231 cell lines to investigate the mechanism involved in therapeutic resistance. Cell proliferation and sphere number were dramatically elevated, and BMI-1 was remarkably upregulated, in IRC-R cells compared to parental cells. Silencing BMI-1 by RNA interference only affected the cell proliferation of IRC-R but not parental cells, suggesting the critical role of BMI-1 in radio- and TMZ resistance. We used a xenograft mice model to elucidate that BMI-1 was necessary in tumor development by assessing tumor volume and Ki67 expression. We found that Hedgehog (Hhg) signaling exerted synergized functions together with BMI-1, implicating the importance of BMI-1 in Hhg signaling. Downregulation of BMI-1 could be an effective strategy to suppress tumor growth, which supports the potential clinical use of targeting BMI-1 in breast cancer treatment.

  9. Survival and failure modes: platform-switching for internal and external hexagon cemented fixed dental prostheses.

    Science.gov (United States)

    Anchieta, Rodolfo B; Machado, Lucas S; Hirata, Ronaldo; Coelho, Paulo G; Bonfante, Estevam A

    2016-10-01

    This study evaluated the probability of survival (reliability) of platform-switched fixed dental prostheses (FDPs) cemented on different implant-abutment connection designs. Eighty-four-three-unit FDPs (molar pontic) were cemented on abutments connected to two implants of external or internal hexagon connection. Four groups (n = 21 each) were established: external hexagon connection and regular platform (ERC); external hexagon connection and switched platform (ESC); internal hexagon and regular platform (IRC); and internal hexagon and switched platform (ISC). Prostheses were subjected to step-stress accelerated life testing in water. Weibull curves and probability of survival for a mission of 100,000 cycles at 400 N (two-sided 90% CI) were calculated. The beta values of 0.22, 0.48, 0.50, and 1.25 for groups ERC, ESC, IRC, and ISC, respectively, indicated a limited role of fatigue in damage accumulation, except for group ISC. Survival decreased for both platform-switched groups (ESC: 74%, and ISC: 59%) compared with the regular matching platform counterparts (ERC: 95%, and IRC: 98%). Characteristic strength was higher only for ERC compared with ESC, but not different between internal connections. Failures chiefly involved the abutment screw. Platform switching decreased the probability of survival of FDPs on both external and internal connections. The absence in loss of characteristic strength observed in internal hexagon connections favor their use compared with platform-switched external hexagon connections. © 2016 Eur J Oral Sci.

  10. MDCT urography: retrospective determination of optimal delay time after intravenous contrast administration

    International Nuclear Information System (INIS)

    Meindl, Thomas; Coppenrath, Eva; Kahlil, Rami; Reiser, Maximilian F.; Mueller-Lisse, U.G.; Mueller-Lisse, Ulrike L.

    2006-01-01

    The optimal delay time after intravenous (i.v.) administration of contrast medium (CM) for opacifcation of the upper urinary tract (UUT) for multidetector computed tomography urography (MDCTU) was investigated. UUT opacification was retrospectively evaluated in 36 four-row MDCTU examinations. Single- (n=10) or dual-phase (n=26) MDCTU was performed with at least 5-min delay after i.v. CM. UUT was divided into four sections: intrarenal collecting system (IRCS), proximal, middle and distal ureter. Two independent readers rated UUT opacification: 1, none; 2, partial; 3, complete. Numbers and percentages of scores, and the 5%, 25%, 50%, 75% and 95% percentiles of delay time were calculated for each UUT section. After removing diseased segments, 344 segments were analysed. IRCS, proximal and middle ureter were completely opacified in 94% (81/86), 93% (80/86) and 77% (66/86) of cases, respectively. Median delay time was 15 min for complete opacification. The distal ureter was completely opacified in 37% (32/86) of cases and not opacified in 26% (22/86). Median delay time for complete opacification was 11 min with 25% and 75% percentiles of 10 and 16 min, respectively. At MDCTU, opacification of the IRCS, proximal and middle ureter was hardly sensitive to delay time. Delay times between 10 and 16 min were favourable in the distal ureter. (orig.)

  11. MDCT urography: experience with a bi-phasic excretory phase examination protocol

    International Nuclear Information System (INIS)

    Meindl, Thomas; Coppenrath, Eva; Degenhart, Christoph; Reiser, Maximilian F.; Mueller-Lisse, Ullrich G.; Mueller-Lisse, Ulrike L.

    2007-01-01

    The benefit of multidetector computed tomographic urography (MDCTU) for visualising early and late excretory phase (EP) upper urinary tract (UUT) opacification has been studied. UUT opacification was retrospectively evaluated in 45 bi-phasic four-row MDCTU examinations. The UUT was divided into intrarenal collecting system (IRCS), proximal, middle and distal ureter. Two independent readers rated opacification: 1, none; 2, partial; 3, complete. Numbers of segments and percentages of UUTs at each score were calculated for each EP and two EPs combined. Results of a single EP and of combined EPs were compared by Wilcoxon matched-pairs signed-ranks. IRCS and proximal ureter were at least partially opacified in each EP in >95%. The middle ureter was at least partially opacified in the early and late EP in 85% and 93%, respectively. The distal ureter was opacified in 65% (49/75) in the early EP and in 78% (59/75) in the late EP. Combining two EPs, non-opacified distal segments decreased to 9% (7/75). Significant improvement between a single EP and combining two EPs were found for the middle and distal ureter (P < 0.03). Bi-phasic MDCTU substantially improved opacification of the middle and distal ureter. IRCS and proximal ureter are reliably opacified with one EP. (orig.)

  12. "Effects of a Web-Based Intervention on Family Functioning Following Pediatric Traumatic Brain Injury"

    Science.gov (United States)

    Minich, Nori; Taylor, H. Gerry; Kirkwood, Michael; Brown, Tanya Maines; Stancin, Terry; Wade, Shari L

    2015-01-01

    Objective Investigate effectiveness of an online Counselor-Assisted Problem-Solving (CAPS) intervention on family functioning after traumatic brain injury (TBI). Methods Participants were randomized to CAPS (n = 65) or internet resource comparison (IRC; n = 67). CAPS is a counselor-assisted web-based program. IRC was given access to online resources. Outcomes were examined 6 months, 12 months, and 18 months after baseline. Injury severity, age, and SES were examined as moderators. Results A main effect of time was noted for teen-reported conflict and parent-reported problem solving. CAPS had decreased parent-reported conflict and a reduction in parental effective communication. Effects were specific to subsets of the sample. Conclusions CAPS, a family-based problem-solving intervention designed to address problem behaviors, had modest effects on some aspects of family functioning, when compared to IRC. Effects were generally limited to subsets of the families and were not evident across all follow-up assessments. PMID:26461100

  13. Selective separation of indium by iminodiacetic acid chelating resin

    International Nuclear Information System (INIS)

    Fortes, M.C.B.; Benedetto, J.S.; Martins, A.H.

    2007-01-01

    - Indium can be recovered by treating residues, flue dusts, slags, and metallic intermediates in zinc smelting. This paper investigates the adsorption characteristics of indium and iron on an iminodiacetic acid chelating resin, Amberlite R IRC748 (Rohm and Haas Co.-USA). High concentrations of iron are always present in the aqueous feed solution of indium recovery. In addition, the chemical behaviour of iron in adsorptive systems is similar to that of indium. The metal concentrations in the aqueous solution were based on typical indium sulfate leach liquor obtained from zinc hydrometallurgical processing in a Brazilian plant. The ionic adsorption experiments were carried out by the continuous column method. Amberlite R IRC748 resin had a high affinity for indium under acidic conditions. Indium ions adsorbed onto the polymeric resin were eluted with a 0.5 mol/dm 3 sulphuric acid solution passed through the resin bed in the column. 99.5% pure indium sulfate aqueous solution was obtained using the iminodiacetic acid chelating resin Amberlite R IRC748. (author)

  14. Analysis test of understanding of vectors with the three-parameter logistic model of item response theory and item response curves technique

    Directory of Open Access Journals (Sweden)

    Suttida Rakkapao

    2016-10-01

    Full Text Available This study investigated the multiple-choice test of understanding of vectors (TUV, by applying item response theory (IRT. The difficulty, discriminatory, and guessing parameters of the TUV items were fit with the three-parameter logistic model of IRT, using the parscale program. The TUV ability is an ability parameter, here estimated assuming unidimensionality and local independence. Moreover, all distractors of the TUV were analyzed from item response curves (IRC that represent simplified IRT. Data were gathered on 2392 science and engineering freshmen, from three universities in Thailand. The results revealed IRT analysis to be useful in assessing the test since its item parameters are independent of the ability parameters. The IRT framework reveals item-level information, and indicates appropriate ability ranges for the test. Moreover, the IRC analysis can be used to assess the effectiveness of the test’s distractors. Both IRT and IRC approaches reveal test characteristics beyond those revealed by the classical analysis methods of tests. Test developers can apply these methods to diagnose and evaluate the features of items at various ability levels of test takers.

  15. Analysis test of understanding of vectors with the three-parameter logistic model of item response theory and item response curves technique

    Science.gov (United States)

    Rakkapao, Suttida; Prasitpong, Singha; Arayathanitkul, Kwan

    2016-12-01

    This study investigated the multiple-choice test of understanding of vectors (TUV), by applying item response theory (IRT). The difficulty, discriminatory, and guessing parameters of the TUV items were fit with the three-parameter logistic model of IRT, using the parscale program. The TUV ability is an ability parameter, here estimated assuming unidimensionality and local independence. Moreover, all distractors of the TUV were analyzed from item response curves (IRC) that represent simplified IRT. Data were gathered on 2392 science and engineering freshmen, from three universities in Thailand. The results revealed IRT analysis to be useful in assessing the test since its item parameters are independent of the ability parameters. The IRT framework reveals item-level information, and indicates appropriate ability ranges for the test. Moreover, the IRC analysis can be used to assess the effectiveness of the test's distractors. Both IRT and IRC approaches reveal test characteristics beyond those revealed by the classical analysis methods of tests. Test developers can apply these methods to diagnose and evaluate the features of items at various ability levels of test takers.

  16. Casimir meets Poisson: improved quark/gluon discrimination with counting observables

    Science.gov (United States)

    Frye, Christopher; Larkoski, Andrew J.; Thaler, Jesse; Zhou, Kevin

    2017-09-01

    Charged track multiplicity is among the most powerful observables for discriminating quark- from gluon-initiated jets. Despite its utility, it is not infrared and collinear (IRC) safe, so perturbative calculations are limited to studying the energy evolution of multiplicity moments. While IRC-safe observables, like jet mass, are perturbatively calculable, their distributions often exhibit Casimir scaling, such that their quark/gluon discrimination power is limited by the ratio of quark to gluon color factors. In this paper, we introduce new IRC-safe counting observables whose discrimination performance exceeds that of jet mass and approaches that of track multiplicity. The key observation is that track multiplicity is approximately Poisson distributed, with more suppressed tails than the Sudakov peak structure from jet mass. By using an iterated version of the soft drop jet grooming algorithm, we can define a "soft drop multiplicity" which is Poisson distributed at leading-logarithmic accuracy. In addition, we calculate the next-to-leading-logarithmic corrections to this Poisson structure. If we allow the soft drop groomer to proceed to the end of the jet branching history, we can define a collinear-unsafe (but still infrared-safe) counting observable. Exploiting the universality of the collinear limit, we define generalized fragmentation functions to study the perturbative energy evolution of collinear-unsafe multiplicity.

  17. Effectiveness of hemorrhoidal treatment by rubber band ligation and infrared photocoagulation.

    Science.gov (United States)

    Linares Santiago, E; Gómez Parra, M; Mendoza Olivares, F J; Pellicer Bautista, F J; Herrerías Gutiérrez, J M

    2001-04-01

    To demonstrate the effectiveness of the treatment of internal hemorrhoids with rubber band ligation (RBL) and infrared photocoagulation (IRC). From march 1996 to december 1999, we prospectively studied 358 patients with a total of 817 hemorrhoid groups and a follow-up period of 36 months. Distribution according to gender and age was: 210 men with a mean age of 46 years and 148 women with a mean age 45.8 years. The mean number of hemorrhoids treated per patients was 2.3. All of them had complete a follow-up protocol at 15, 30, 60 and 180 days and at 12, 24 and 36 months. Rubber band ligation was performed with McGown ligator and suction pump, placing the band at the base of the hemorrhoid. For the infrared coagulation we used a Lumatec coagulation system, applying at least four shoots around each hemorrhoid, with an exposition time ranging between 1 and 1.5 seconds. Treatment was considered effective when patients became asymptomatic (relief of pain, bleeding or anal itching) and the obliteration of hemorrhoids after the treatment was confirmed by anal inspection and anoscopy. Two hundred ninety five of 358 patients were treated with RBL (82.4%), this treatment being effective in 98% of the patients after 180 days and very good after 36 months. There were 6/295 relapses at 36 months (2%). All minor and major complications were observed within the first 15 days of treatment: rectal tenesmus in 96/295 patients (32.5%), mild anal pain in 115/295 (38.9%), self-limited and mild bleeding after the detachment of the bands in 30/295 (10%), and febricula in one patient. Sixty three of 358 patients were treated with IRC (17.6%). In this group, relapses were observed in 6/63 patients (9.5%) at 36 months, all of them with grade III hemorrhoids that required additional treatment with RBL. All the complications (inherent to the technique) were observed within the first days: mild anal pain in 40/63 patients (63.4%) and mild bleeding in 1/63 (1.6%). The treatment with RBL or IRC

  18. Randomized Clinical Trial of Online Parent Training for Behavior Problems After Early Brain Injury.

    Science.gov (United States)

    Wade, Shari L; Cassedy, Amy E; Shultz, Emily L; Zang, Huaiyu; Zhang, Nanhua; Kirkwood, Michael W; Stancin, Terry; Yeates, Keith O; Taylor, H Gerry

    2017-11-01

    To evaluate the effectiveness of Internet-based Interacting Together Everyday: Recovery After Childhood TBI (I-InTERACT) versus abbreviated parent training (Express) or access to online resources (internet resources comparison [IRC]) in improving parenting skills and decreasing behavior problems after early traumatic brain injury (TBI). In this randomized, controlled, clinical trial, 113 children 3 to 9 years old previously hospitalized for moderate to severe TBI were randomly assigned to receive Express (n = 36), I-InTERACT (n = 39), or IRC (n = 38). Express included 7 online parent skills sessions, and I-InTERACT delivered 10 to 14 sessions addressing parenting skills, TBI education, stress, and anger management. The 2 interventions coupled online modules with therapist coaching through a Health Insurance Portability and Accountability Act-compliant Skype link. The IRC group received access to online TBI and parent skills resources. Co-primary outcomes were blinded ratings of parenting skills and parent report of behavior problems and problem intensity on the Eyberg Child Behavior Inventory (ECBI). Outcomes were assessed before treatment and 3 and 6 months after treatment, with the latter constituting the primary endpoint. The Express and I-InTERACT groups displayed higher levels of positive parenting at follow-up. Only the I-InTERACT group had lower levels of negative parenting at 6 months. The Express group had lower ECBI intensity scores than the IRC group. Baseline symptom levels moderated improvements; children in the Express and I-InTERACT groups with higher baseline symptoms demonstrated greater improvements than those in the IRC group. Changes in parenting skills mediated improvements in behavior in those with higher baseline symptoms. Brief online parent skills training can effectively decrease behavior problems after early TBI in children with existing behavioral symptoms. Clinical trial registration information-Internet-based Interacting Together

  19. The Earth Observing System (EOS) Ground System: Leveraging an Existing Operational Ground System Infrastructure to Support New Missions

    Science.gov (United States)

    Hardison, David; Medina, Johnny; Dell, Greg

    2016-01-01

    The Earth Observer System (EOS) was officially established in 1990 and went operational in December 1999 with the launch of its flagship spacecraft Terra. Aqua followed in 2002 and Aura in 2004. All three spacecraft are still operational and producing valuable scientific data. While all are beyond their original design lifetime, they are expected to remain viable well into the 2020s. The EOS Ground System is a multi-mission system based at NASA Goddard Space Flight Center that supports science and spacecraft operations for these three missions. Over its operational lifetime to date, the EOS Ground System has evolved as needed to accommodate mission requirements. With an eye towards the future, several updates are currently being deployed. Subsystem interconnects are being upgraded to reduce data latency and improve system performance. End-of-life hardware and operating systems are being replaced to mitigate security concerns and eliminate vendor support gaps. Subsystem hardware is being consolidated through the migration to Virtual Machine based platforms. While mission operations autonomy was not a design goal of the original system concept, there is an active effort to apply state-of-the-art products from the Goddard Mission Services Evolution Center (GMSEC) to facilitate automation where possible within the existing heritage architecture. This presentation will provide background information on the EOS ground system architecture and evolution, discuss latest improvements, and conclude with the results of a recent effort that investigated how the current system could accommodate a proposed new earth science mission.

  20. System for the design of electrical distribution substations; Sistema para el diseno de subestaciones electricas de distribucion

    Energy Technology Data Exchange (ETDEWEB)

    Zayas Perez, Benjamin Eddie; Islas Perez, Eduardo; Bahena Rada, Jessica Liliana; Romero Lima, Jesus [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Sierra Rodriguez, Benjamin; Moreno Diaz, Humberto [Comision Federal de Electricidad (Mexico)

    2011-07-01

    The physical design of electric substations involves a variety of activities, such as developing, reviewing and performing modifications to different design proposals, estimating costs and producing documents to be integrated into an executive project. These activities are usually conducted at the Distribution Divisions of the Federal Electric Commission (CFE) through two separate processes: the development of engineering plans with computer-aided design software (CAD) and volumetric calculations for the initial budget using conventional spreadsheets. The documents are manually developed on an individual basis, without the existence of any functions to allow for automatically updating the design modifications of any of the plans. The corresponding initial budget becomes a lengthy and laborious process with the likelihood of inconsistencies among the documents. In order to optimize the design process for the public and electromechanical works of electric substations (ES) in a three-dimensional (3D) graphic environment, the IIE's Management of Process Supervision, in coordination with the CFE Distribution Subdivision, developed the System for the Design of Electric Substation Distribution (SDESD). This system makes use of the advantages of CAD3D technology to develop detail engineering, cost engineering to calculate initial budgets and virtual reality for three-dimensional interactive navigation. It is worth mentioning that this system is currently in the implementation phase at the CFE Distribution Subdivision. This article briefly describes the main stages in the development of the project, as well as the functioning and principal components of the system. [Spanish] El diseno fisico de subestaciones electricas implica una variedad de actividades, tales como elaborar, revisar y efectuar modificaciones de diferentes propuestas de diseno, estimar costos y producir documentos, para integrarlos como parte de un proyecto ejecutivo. Estas actividades usualmente se

  1. Co-generation project for the Combined Cycle Power Plant President Juarez Rosarito and a reverse osmosis desalting plant; Proyecto de cogeneracion para la planta de ciclo combinado Presidente Juarez Rosarito y una planta desaladora de osmosis inversa

    Energy Technology Data Exchange (ETDEWEB)

    Beltran Mora, Hector; Espindola Hernandez, Salvador [Universidad NAcional Autonoma de Mexico (UNAM), Mexico, D.F. (Mexico)

    2006-11-15

    In this work a technical and economical analysis of the installation of a reverse osmosis desalting plant connected to a power station that uses the combined cycle technology under a co-generation scheme is presented: production of electricity and water. The operation program of the desalting power station will be determined by the demand of energy of the combined cycle power station; the proposal is that the desalting plant operates in the hours of low load of the power station and shuts down at the peak hours of electrical energy demand. So that this study is representative, the demand curves of electric energy of the units of combined cycle of Central President Juarez Rosarito of the Comision Federal de Electricidad (CFE) have been taken and updated the data of the reverse osmosis desalting plants that are available at the moment in the market. As basis of the study the level costs will be determined so much as the electrical energy generated by the power station of combined cycle, operating inside and outside of a co-generation scheme and the costs made level for the water produced by the reverse osmosis plant under two assumptions: the first one is buying the electrical energy from CFE and the second one considering that the CFE is the owner of the desalting plant and therefore the cost of electrical energy to desalting the plant is zero. This work shows the economic impacts on the costs of the generation of electrical energy and on those of the desalted water in a co-generation scheme. The results shown in this study can be considered for the future planning in the construction of desalting plants to supply of water in the Northwestern zones of the country where serious problems of water shortage exist. [Spanish] En este trabajo se presenta un analisis tecnico y economico de la instalacion de una planta desaladora de osmosis inversa acoplada a una central de generacion de energia electrica que utiliza la tecnologia de ciclo combinado bajo un esquema de

  2. Areas to explore surrounding the Cerro Prieto geothermal field, BC; Areas para exploracion en los alrededores del campo geotermico de Cerro Prieto, BC

    Energy Technology Data Exchange (ETDEWEB)

    Aguilar Dumas, Alvaro [Comision Federal de Electricidad, Gerencia de Proyectos Geotermoelectricos, Residencia General de Cerro Prieto, Mexicali, Baja California (Mexico)]. E-mail: alvaro.aguilar@cfe.gob.mx

    2009-07-15

    Exploration plays an important role in tapping underground natural resources-whether water, oil, natural gas or minerals. Exploratory data allow us to learn reservoir conditions, increasing probable reserves and reservoir life span. Around the Cerro Prieto geothermal field, BC, and in the Mexicali Valley in general, exploration had almost stopped but recently was resumed by the Studies Division of Comision Federal de ELectricidad (CFE)'s Gerencia de Proyectos Geotermoelectricos. The division sent technical personnel to structurally map the northern and eastern portions of Laguna Salada. The paper offers a general outline of the main zones undergoing exploratory studies-studies perhaps culminating in siting exploratory wells to locate more geothermal resources (and ultimately producing them using binary power plants). CFE also wants to site injection wells west of the current production zone, and this is covered, as well. All activities are meant to increase the productive lifespan of the geothermal reservoir. [Spanish] Cuando se trata de la explotacion de recursos naturales del subsuelo, sea agua, gas, petroleo o minerales, la exploracion juega un papel muy importante, ya que permite conocer las condiciones del yacimiento que pudieran llevar a incrementar las reservas de los recursos explotados y extender su vida util. En las zonas aledanas al campo geotermico de Cerro Prieto, BC, y en general en el Valle de Mexicali, la exploracion estaba practicamente detenida habiendose reactivado a raiz de que la Subgerencia de Estudios de la Gerencia de Proyectos Geotermoelectricos de la Comision Federal de Electricidad (CFE) envio personal para realizar mapeos estructurales en las porciones norte y oriente de la Laguna Salada. Este trabajo presenta un panorama general de las areas prioritarias para realizar estudios exploratorios y poder programar, con mas bases, pozos exploratorios enfocados a localizar mas recursos geotermicos, inclusive para generar energia por medio

  3. The use of residual geothermal energy in an edible mushroom production plant, Los Humeros geothermal fields (Mexico): Achievements and alternatives; El uso de la energia geotermica residual en la planta productora de hongos comestibles del campo geotermico Los Humeros (Mexico): Logros y alternativas

    Energy Technology Data Exchange (ETDEWEB)

    Rangel Rangel, Maria Elena [Proteccion ambiental, Puebla (Mexico)

    2000-12-01

    A plant for raising edible mushrooms with residual geothermal energy is a project of the Comision Federal de Electricidad (CFE). The results reflect important achievements in the development of technology for the productions of wholesome and available food with geothermal heat instead of conventional energy sources. The installations have an enormous technological and commercial potential- demonstrated by the cultivation of oyster mushrooms (Pleurotus ostreatus), which success has awakened the interest of research institutions. The Instituto of Ecologia, A.C., has begun a joint project with CFE cultivating shiitake mushrooms (Lentinula edodes) with geothermal energy. These achievements mark a clear trend toward the integral use of facilities, the establishment of a crop with greater economic advantages, and the diffusion of this project. [Spanish] La planta productora de hongos comestibles es un proyecto de la Comision Federal de Electricidad (CFE) para dar un uso alterno a la energia geotermica residual. Los resultados obtenidos hasta el momento reflejan logros importantes en la generacion de tecnologia propia para la produccion de un alimento sano y accesible, sustituyendo la energia proveniente de combustibles convencionales por calor geotermico. Las instalaciones creadas cuentan con un enorme potencial tecnologico y comercial demostrando con el cultivo de las setas (Pleurotus ostreatus) con un exito tal que ha despertado el interes de instituciones dedicadas a la investigacion. Tal es el caso de Instituto de Ecologia, A.C que acualmente se encuentra involucrado en un proyecto conjunto sobre el cultivo del hongo Lentinula edodes (shiitake) utilizando energia geotermica en su proceso productivo. Con lo anterior, se esta marcando una clara tendencia hacia el aprovechamiento integral de las instalaciones, el establecimiento de un cultivo con mayores ventajas economicas y la difusion de este proyecto.

  4. Energy saving program in an operating potable water and sanitation organism; Programa de ahorro de energia en un organismo operador de agua potable y saneamiento

    Energy Technology Data Exchange (ETDEWEB)

    Flores Cruz, Juan Jose [Fideicomiso para el Ahorro de la Energia Electrica, (Mexico)

    2001-03-01

    For the achievement of the objectives it was decided to use, among others, the following strategies: Personnel training, increase of the efficiency of the electromechanical equipment, study of Comision Federal de Electricidad (CFE) tariffs, correction of low power factors, increase of load factors, operation automate, regulation of the operation times, preventive maintenance of the equipment, establishment of technical standards, rational and efficient use of air conditioning equipment and illumination. So that these actions were applied in an easy and opportune form, it was established that within the structure of the General Coordination of Foreign Municipalities, the Program of Energy Saving depended directly of the Technical Management of CFE. In this way, the recommendations are first put under consideration of high-level officers, and then are lowered to the operative departments. [Spanish] Para el logro de los objetivos se acordo utilizar, entre otras, las siguientes estrategias: capacitacion del personal; aumentar la eficiencia de los equipos electromecanicos; estudio de tarifas de la Comision Federal de Electricidad (CFE); correccion de bajos factores de potencia; aumento de los factores de carga; automatizar la operacion; regular de los tiempos de operacion; mantenimiento preventivo a los equipos; establecimiento de normas tecnicas; uso racional y eficiente de aire acondicionado e iluminacion. Para que estas acciones se aplicaran en forma agil y oportuna, se establecio que dentro de la estructura de la Coordinacion General de Municipios Foraneos, el Programa de Ahorro de Energia dependiera directamente de la Gerencia Tecnica de la CRE. De esta forma, las recomendaciones primero se someten a consideracion de los funcionarios de alto nivel, y luego bajan a los departamentos operativos.

  5. Results of Geothermal Exploitation in Mexico During 1996; Resultados de la explotacion geotermica en Mexico en 1996

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez Negrin, Luis C. A. [Gerencia de Proyectos Geotermoelectricos de la Comision Federal de Electricidad, Morelia (Mexico)

    1997-01-01

    During 1996, 56.2 million tons of steam were produced, at an average annual rate of 6,416 tons per hour (t/h), to supply enough steam to operate of 26 geothermal-electric plants in three geothermal fields, which represent an installed capacity of 743 MW. To accomplish that production, 177 geothermal wells were operated at an average annual production of 36 t/h of steam. Electricity generation was 5,737 gigawatts-hour, which represent 3.8% of the whole electrical energy generated in Mexico in 1996. Production of steam and generation of electricity were increased in 1996, comparing with 1994 and 1995. However, unitary costs were practically the same between 1995 and 1996. The Comision Federal de Electricidad (Federal Commission for Electricity, or CFE) has programmed several geothermal- electric projects to increase the installed capacity in the fields under exploitation in new fields. Also, the CFE has some non electrical projects to reach an integral use of geothermics in Mexico. [Espanol] A fin de suministrar el vapor necesario para la generacion de 26 plantas geotermoelectricas instaladas en tres campos geotermicos, con una capacidad total de 743 megawatts (MW) durante 1996 se produjeron 56.2 millones de toneladas de vapor, a una tasa media anual de 6,416 toneladas por hora (t/h). Ello implico la operacion de 177 pozos productores, con una produccion de la energia electrica generada en Mexico en 1996. Tanto la produccion de vapor como la generacion de electricidad en 1996 se incrementaron con respecto a los anos precedentes de 1994 y 1995, pese a que los costos unitarios se mantuvieron practicamente constantes entre 1995 y 1996. La Comision Federal de Electricidad (CFE) tiene en programa varios proyectos geotermoelectricos para incrementar la capacidad instalada en los campos en explotacion y para iniciar el aprovechamiento en campos nuevos, asi como proyectos no electricos para conseguir un aprovechamiento integral de la geotermia en Mexico.

  6. Increasing drought and diminishing benefits of elevated carbon dioxide for soybean yields across the US Midwest.

    Science.gov (United States)

    Jin, Zhenong; Ainsworth, Elizabeth A; Leakey, Andrew D B; Lobell, David B

    2018-02-01

    Elevated atmospheric CO 2 concentrations ([CO 2 ]) are expected to increase C3 crop yield through the CO 2 fertilization effect (CFE) by stimulating photosynthesis and by reducing stomatal conductance and transpiration. The latter effect is widely believed to lead to greater benefits in dry rather than wet conditions, although some recent experimental evidence challenges this view. Here we used a process-based crop model, the Agricultural Production Systems sIMulator (APSIM), to quantify the contemporary and future CFE on soybean in one of its primary production area of the US Midwest. APSIM accurately reproduced experimental data from the Soybean Free-Air CO 2 Enrichment site showing that the CFE declined with increasing drought stress. This resulted from greater radiation use efficiency (RUE) and above-ground biomass production at elevated [CO 2 ] that outpaced gains in transpiration efficiency (TE). Using an ensemble of eight climate model projections, we found that drought frequency in the US Midwest is projected to increase from once every 5 years currently to once every other year by 2050. In addition to directly driving yield loss, greater drought also significantly limited the benefit from rising [CO 2 ]. This study provides a link between localized experiments and regional-scale modeling to highlight that increased drought frequency and severity pose a formidable challenge to maintaining soybean yield progress that is not offset by rising [CO 2 ] as previously anticipated. Evaluating the relative sensitivity of RUE and TE to elevated [CO 2 ] will be an important target for future modeling and experimental studies of climate change impacts and adaptation in C3 crops. © 2017 John Wiley & Sons Ltd.

  7. Morphology of the asymmetric iron–silicon interfaces

    International Nuclear Information System (INIS)

    Badía-Romano, L.; Rubín, J.; Bartolomé, F.; Magén, C.; Bartolomé, J.

    2015-01-01

    Highlights: • Exhaustive study of the Fe silicide formation at interfaces of (Fe/Si) multilayers. • Thickness = 1.4 nm and roughness = 0.6 nm are found for the Si-on-Fe interface. • First time that the Fe 1s HAXPES spectra of a multilayered system is recorded. • The c-Fe 1−x Si sublayer is identical in both Si-on-Fe and Fe-on-Si interfaces. • The asymmetry is caused only by the ferromagnetic silicide Fe 1−x Si x sublayer. - Abstract: A systematic study of the iron–silicon interfaces formed upon preparation of (Fe/Si) multilayers has been performed by combination of modern and powerful techniques. Samples were prepared by thermal evaporation under ultrahigh vacuum onto a Si(1 0 0) substrate. The morphology of these films and their interfaces was studied by a combination of scanning transmission electron microscopy, X-ray reflectivity, angle resolved X-ray photoelectron spectroscopy and hard X-ray photoelectron spectroscopy. The Si-on-Fe interface thickness and roughness were determined to be 1.4(1) nm and 0.6(1) nm, respectively. Moreover, determination of the stable phases formed at both Fe-on-Si and Si-on-Fe interfaces was performed using conversion electron Mössbauer spectroscopy on multilayers with well separated Si-on-Fe and Fe-on-Si interfaces. It is shown that while a fraction of Fe remains as α-Fe, the rest has reacted with Si, forming the paramagnetic c-Fe 1−x Si phase and a ferromagnetic Fe rich silicide (DO 3 type phase). We conclude that the paramagnetic c-Fe 1−x Si silicide sublayer is identical in both Si-on-Fe and Fe-on-Si interfaces, whereas an asymmetry is revealed in the composition of the ferromagnetic silicide sublayer

  8. Coldness applied to plastic engineering techniques and rooms; Le froid applique aux techniques de la plasturgie et a ses locaux

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    This technical dossier is the result of a collaboration between the CFE, EdF Industrie and the French federation of plastic engineering. It aims at answering all questions relative to plastic materials processing: 1 - general study on the economical aspects of plastic engineering, plastic materials, and manufacturing processes; 2 - the different cold processing techniques (air cooling and refrigerating systems); 3 - the main transformation processes for thermo-plastic materials and the advantage of cooling techniques; 4 - the environmental conditioning of rooms (clean rooms); 5 - examples of realizations. (J.S.)

  9. Metallic nanoparticles in dielectrics: A comparative study

    KAUST Repository

    Agambayev, Agamyrat; Farhat, Mohamed; Bagci, Hakan; Salama, Khaled N.

    2017-01-01

    The Maxwell-Garnett method is used to predict the effective dielectric constant and the tangent loss of various composites consisting of a PVDF-TrFE-CFE-matrix and metallic microsphere fillers made of Cu, Ni, W, Zn, or Fe. Simulation results demonstrate that for small filler fraction values and at low frequencies, the electrical properties of the resulting composite do not depend on the conductivity of the filler. These findings show that composites fabricated using cheaper metal nanoparticle fillers are as effective as those fabricated using expensive ones.

  10. Determination of the concentration profile of chemical elements in superheater pipes; Determinacion del perfil de concentracion de elementos quimicos en tubos de sobrecalentadores

    Energy Technology Data Exchange (ETDEWEB)

    Aldape U, F; Aspiazu F, J [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    1986-05-15

    This work has for object to determine the profile of concentration of chemical elements at trace level in a superheater pipe of Thermoelectric Plants using the X-ray emission spectroscopy technique induced by protons coming from the Accelerator of the Nuclear Center. In the X-ray detection, a Si Li detector was used. The technique was chosen because it allows a multielemental analysis, of high sensitivity and precision. The results can help to understand the problems that are had in the change of flexibility or of corrosion. This will be from utility to the Federal Electricity Commission (CFE). (Author)

  11. Burner redesign for the reduction of the unburned particulate emission in thermal power stations of Comision Federal de Electricidad; Rediseno de quemadores para la reduccion de la emision de particulas inquemadas en centrales termicas de la Comisionon Federal de Electricidad

    Energy Technology Data Exchange (ETDEWEB)

    Huerta Espino, Mario; Espipnoza Garza, Jesus; Mani Gonzalez, Alejandro; Giles Alarcon, Armando; Pena Garcia, Adriana; Albarran Sanchez, Irma L; Mendez Aranda, Angel [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2001-07-01

    In the presence of the increasing demand for reaching higher efficiencies and a smaller production of polluting emissions in combustion systems, studies focused to the optimization of the present designs of burners are required. The Comision Federal de Electricidad (CFE) and the Instituto de Investigaciones Electricas (IIE) have established a project that contemplates the redesign of burners in ten of its units of thermoelectric generation. In this work the redesign of the flame stabilizer or diffuser for the reduction of the unburned particulate emission is explained. The results of the modeling of a burner of rotational flow of steam generators of the CFE are shown, as well as the graphs of the contours of the recirculation zone generated by each diffuser without combustion and a figure of the velocity profile that is generated in front of the diffuser. In agreement with the results obtained in the aerodynamic evaluation of frontal burners of rotational flow, it is possible to established that the characteristics of the recirculation zone, generated by this type of burners, are related to geometric parameters of the diffuser that identify with the number of turns and the pressure drop, where it is necessary to look for designs that improve the conditions of the mixing process and combustion in the burner. [Spanish] Ante la creciente demanda por alcanzar mayores eficiencias y una menor produccion de emisiones contaminantes en sistemas de combustion, se requieren estudios enfocados a la optimizacion de los disenos actuales de quemadores. La Comision Federal de Electricidad (CFE) y el Instituto de Investigaciones Electricas (IIE) han establecido un proyecto que contempla el rediseno de quemadores en diez de sus unidades de generacion termoelectrica. En este trabajo se explica el rediseno del estabilizador de flama o difusor para la reduccion de la emision de particulas inquemadas. Se muestran los resultados de la modelacion de un quemador de flujo rotacional de

  12. Constant Leverage And Constant Cost Of Capital: A Common Knowledge Half-Truth

    Directory of Open Access Journals (Sweden)

    Ignacio Vélez–Pareja

    2008-04-01

    In this document we show that for finite cash flows, Ke and hence WACC depend on the discount rate that is used to value the tax shield, TS and as expected, Ke and WACC are not constant with Kd as the discount rate for the tax shield, even if the leverage is constant. We illustrate this situation with a simple example. We analyze five methods: DCF using APV, FCF and traditional and general formulation for WACC, present value of CFE plus debt and Capital Cash Flow, CCF.

  13. Control integral systems; Sistemas integrales de control

    Energy Technology Data Exchange (ETDEWEB)

    Burgos, Estrella [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1999-12-31

    Almost two third of the electric power generation in Mexico are obtained from hydrocarbons, for that reasons Comision Federal de Electricidad (CFE) dedicated special commitment in modernizing the operation of fossil fuel central stations. In attaining this objective the control systems play a fundamental roll, from them depend a good share of the reliability and the efficiency of the electric power generation process, as well as the extension of the equipment useful life. Since 1984 the Instituto de Investigaciones Electricas (IIE) has been working, upon the request of CFE, on the development of digital control systems. To date it has designed and implemented a logic control system for gas burners, which controls 32 burners of the Unit 4 boiler of the Generation Central of Valle de Mexico and two systems for distributed control for two combined cycle central stations, which are: Dos Bocas, Veracruz Combined cycle central, and Gomez Palacio, Durango combined cycle central. With these two developments the IIE enters the World tendency of implementing distributed control systems for the fossil fuel power central update [Espanol] Casi las dos terceras partes de la generacion electrica en Mexico se obtienen a partir de hidrocarburos, es por eso que la Comision Federal de Electricidad (CFE) puso especial empeno en modernizar la operacion de las centrales termoelectricas de combustibles fosiles. En el logro de este objetivo los sistemas de control desempenan un papel fundamental, de ellos depende una buena parte la confiabilidad y la eficiencia en el proceso de generacion de energia electrica, asi como la prolongacion de la vida util de los equipos. Desde 1984 el Instituto de Investigaciones Electricas (IIE) ha trabajado, a solicitud de la CFE, en el desarrollo de sistemas digitales de control. A la fecha se han disenado e implantado un sistema de control logico de quemadores de gas, el cual controla 32 quemadores de la caldera de la unidad 4 de la central de generacion

  14. Adding Data Accessibility and Rule-Based Targeted Data Collection to the California Cancer Reporting System for Breast Cases.

    Science.gov (United States)

    1998-03-01

    findings contained in this report are those of the author(s) and should not be construed as an official Department of the Army position, policy or...to policies of appT i rrnhle Federal Law 45 CFE. 46. In conducting research utilizing recombinant DNA technology, the investigator {a) adhered...34-r— ■«-r-mooaimco-q-r-Tj-comcoTi- SCOrCOCVOlCOCMCMt CM CM oocNcooo->*-i-~T-T- cNCD -ɝ’in’<rooco oococO’inT-ot-~CNvrt^M-mcO’-cn CnOl-r-r

  15. Control integral systems; Sistemas integrales de control

    Energy Technology Data Exchange (ETDEWEB)

    Burgos, Estrella [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1998-12-31

    Almost two third of the electric power generation in Mexico are obtained from hydrocarbons, for that reasons Comision Federal de Electricidad (CFE) dedicated special commitment in modernizing the operation of fossil fuel central stations. In attaining this objective the control systems play a fundamental roll, from them depend a good share of the reliability and the efficiency of the electric power generation process, as well as the extension of the equipment useful life. Since 1984 the Instituto de Investigaciones Electricas (IIE) has been working, upon the request of CFE, on the development of digital control systems. To date it has designed and implemented a logic control system for gas burners, which controls 32 burners of the Unit 4 boiler of the Generation Central of Valle de Mexico and two systems for distributed control for two combined cycle central stations, which are: Dos Bocas, Veracruz Combined cycle central, and Gomez Palacio, Durango combined cycle central. With these two developments the IIE enters the World tendency of implementing distributed control systems for the fossil fuel power central update [Espanol] Casi las dos terceras partes de la generacion electrica en Mexico se obtienen a partir de hidrocarburos, es por eso que la Comision Federal de Electricidad (CFE) puso especial empeno en modernizar la operacion de las centrales termoelectricas de combustibles fosiles. En el logro de este objetivo los sistemas de control desempenan un papel fundamental, de ellos depende una buena parte la confiabilidad y la eficiencia en el proceso de generacion de energia electrica, asi como la prolongacion de la vida util de los equipos. Desde 1984 el Instituto de Investigaciones Electricas (IIE) ha trabajado, a solicitud de la CFE, en el desarrollo de sistemas digitales de control. A la fecha se han disenado e implantado un sistema de control logico de quemadores de gas, el cual controla 32 quemadores de la caldera de la unidad 4 de la central de generacion

  16. The U.S. climate change policy: a preliminary evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Viguier, L.

    2002-03-01

    This paper builds upon the first workshop of the Energy and climate Change programme of the CFE, held on january 15, 2002 at IFRI. The President Bush decision to reject the Kyoto protocol was taken for three main reasons. The first argument is related to scientific uncertainty regarding global warming and how human action could impact it. Secondly, Bush thinks that the Kyoto Protocol is unfair and ineffective because it excludes developing countries. Finally he thinks that the Kyoto targets are unrealistic, arbitrary and not based upon science. (A.L.B.)

  17. Information management in NACD regimes: a comparative analysis

    International Nuclear Information System (INIS)

    Unger, R.

    1998-01-01

    While all non-proliferation, arms control and disarmament (NACD) regimes must address the issue of information management, this area has remained an under-explored part of the arms control field. This paper compares information management processes across a variety of NACD regimes for the purpose of identifying potential synergies between regimes and suggesting means by which to strengthen future arms control verification efforts. The paper explores the information management systems of the International Atomic Energy Agency (IAEA), the United Nations Special Commission in Iraq (UNSCOM), the Conventional Forces in Europe Agreement (CFE), and the Comprehensive Test Ban Treaty (CTBT). (author)

  18. The Use of Cervical Auscultation to Predict Oropharyngeal Aspiration in Children: A Randomized Controlled Trial.

    Science.gov (United States)

    Frakking, Thuy T; Chang, Anne B; O'Grady, Kerry-Ann F; David, Michael; Walker-Smith, Katie; Weir, Kelly A

    2016-12-01

    In this study, we aimed to determine if the use of cervical auscultation (CA) as an adjunct to the clinical feeding evaluation (CFE + CA) improves the reliability of predicting oropharyngeal aspiration (abbreviated to aspiration) in children. The design of the study is based on open label, randomized controlled trial with concealed allocation. Results from children (<18 years) randomized to either CFE or CFE + CA were compared to videofluoroscopic swallow study (VFSS), the reference standard data. Aspiration was defined using the Penetration-Aspiration Scale. All assessments were undertaken at a single tertiary pediatric hospital. 155 children referred for a feeding/swallowing assessment were randomized into the CFE n = 83 [38 males; mean age = 34.9 months (SD 34.4)] or CFE + CA n = 72 [43 males; mean age = 39.6 months (SD 39.3)] group. kappa statistic, sensitivity, and specificity values, area under receiver operating curve (aROC). No significant differences between groups were found, although CFE + CA (kappa = 0.41, 95 % CI 0.2-0.62) had higher agreement for aspiration detection by VFSS, compared to the clinical feeding exam alone (kappa = 0.31, 95 % CI 0.10-0.52). Sensitivity was 85 % (95 % CI 62.1-96.8) for CFE + CA and 63.6 % (95 % CI 45.1-79.6) for CFE. aROC was not significantly greater for CFE + CA (0.75, 95 % CI 0.65-0.86) than CFE (0.66, 95 % CI 0.55-0.76) across all age groups. Although using CA as an adjunct to the clinical feeding evaluation improves the sensitivity of predicting aspiration in children, it is not sensitive enough as a diagnostic tool in isolation. Given the serious implications of missing the diagnosis of aspiration, instrumental assessments (e.g., VFSS), remain the preferred standard.

  19. The opportunity to limit and reduce inventories of fissionable weapon materials

    International Nuclear Information System (INIS)

    Hebel, L.C.

    1991-01-01

    As the United States and the Soviet government agree on major reductions in nuclear weapon delivery systems, they need to address the disposal of the nuclear warheads and bombs for those systems. Such measures could be strongly reinforced if the two nations also institute restraints and reductions in the total amount of fissionable materials available for weapons. Many metric tonnes of such materials would be made surplus by the reductions in strategic nuclear weapons due to the Strategic Arms Reduction Treaty (START-I). Equally large reductions in short-range (theater) nuclear weapons are expected in the wake of the recent Treaty on Conventional Forces in Europe (CFE)

  20. Design of optoelectronic system to meter of electrical current to the habitation house

    International Nuclear Information System (INIS)

    Camas, J.; Flores, M.; Anzuelo, G.; Garcia, C.; Juarez, N.; Torres, W.; Mota, R.

    2009-01-01

    In this work, we present an optoelectronic digital meter of electrical current. The development of this design is described step by step with diagram to blocks. The advantage over conventional meters of CFE (Comision Federal de electricidad) and the design proposed are analyzed. Information in the optoelectronic design is controlled by Microcontroller PIC16F877. This Microcontroller uses an external crystal as an oscillator with a 4 MHz frequency. The information is shown in a LCD (Liquid Crystal Display). In addition, to quantify the electrical current was necessary an interruption of light. (Author)

  1. Carbon-enhanced Metal-poor Stars in SDSS/SEGUE. I. Carbon Abundance Estimation and Frequency of CEMP Stars

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Young Sun [NMSU, Las Cruces; Beers, Timothy C. [Michigan State U., JINA; Masseron, Thomas [Brussels U.; Plez, Bertrand [U. Montpellier 2, LUPM; Rockosi, Constance M. [Lick Observ.; Sobeck, Jennifer [Chicago U.; Yanny, Brian [Fermilab; Lucatello, Sara [Padua Observ.; Sivarani, Thirupathi [Bangalore, Indian Inst. Astrophys.; Placco, Vinicius M. [Sao Paulo U., IAG; Carollo, Daniela [Macquarie U.

    2013-10-17

    We describe a method for the determination of stellar [C/Fe] abundance ratios using low-resolution (R = 2000) stellar spectra from the SDSS and SEGUE. By means of a star-by-star comparison with a set of SDSS/SEGUE spectra with available estimates of [C/Fe] based on published high-resolution analyses, we demonstrate that we can measure [C/Fe] from SDSS/SEGUE spectra with S/N > 15 to a precision better than 0.35 dex. Using the measured carbon-to-iron abundance ratios obtained by this technique, we derive the frequency of carbon-enhanced stars ([C/Fe] > +0.7) as a function of [Fe/H], for both the SDSS/SEGUE stars and other samples from the literature. We find that the differential frequency slowly rises from almost zero to about 14% at [Fe/H] ~ -2.4, followed by a sudden increase, by about a factor of three, to 39% from [Fe/H] ~ -2.4 to [Fe/H] ~ -3.7. We also examine how the cumulative frequency of CEMP stars varies across different luminosity classes. The giant sample exhibits a cumulative CEMP frequency of 32% for [Fe/H] < -2.5, 31% for [Fe/H] < -3.0, and 33% for [Fe/H] < -3.5. For the main-sequence turnoff stars, we obtain a lower cumulative CEMP frequency, around 10% for [Fe/H] < -2.5. The dwarf population displays a large change in the cumulative frequency for CEMP stars below [Fe/H] = -2.5, jumping from 15% for [Fe/H] < -2.5 to about 75% for [Fe/H] < -3.0. When we impose a restriction with respect to distance from the Galactic mid-plane (|Z| < 5 kpc), the frequency of the CEMP giants does not increase at low metallicity ([Fe/H] < -2.5), but rather, decreases, due to the dilution of C-rich material in stars that have undergone mixing with CNO-processed material from their interiors. The frequency of CEMP stars near the main-sequence turnoff, which are not expected to have experienced mixing, increases for [Fe/H] < -3.0. [abridged

  2. Step-wise and punctuated genome evolution drive phenotype changes of tumor cells

    International Nuclear Information System (INIS)

    Stepanenko, Aleksei; Andreieva, Svitlana; Korets, Kateryna; Mykytenko, Dmytro; Huleyuk, Nataliya; Vassetzky, Yegor; Kavsan, Vadym

    2015-01-01

    Highlights: • There are the step-wise continuous and punctuated phases of cancer genome evolution. • The system stresses during the different phases may lead to very different responses. • Stable transfection of an empty vector can result in genome and phenotype changes. • Functions of a (trans)gene can be opposite/versatile in cells with different genomes. • Contextually, temozolomide can both promote and suppress tumor cell aggressiveness. - Abstract: The pattern of genome evolution can be divided into two phases: the step-wise continuous phase (step-wise clonal evolution, stable dominant clonal chromosome aberrations (CCAs), and low frequency of non-CCAs, NCCAs) and punctuated phase (marked by elevated NCCAs and transitional CCAs). Depending on the phase, system stresses (the diverse CIN promoting factors) may lead to the very different phenotype responses. To address the contribution of chromosome instability (CIN) to phenotype changes of tumor cells, we characterized CCAs/NCCAs of HeLa and HEK293 cells, and their derivatives after genotoxic stresses (a stable plasmid transfection, ectopic expression of cancer-associated CHI3L1 gene or treatment with temozolomide) by conventional cytogenetics, copy number alterations (CNAs) by array comparative genome hybridization, and phenotype changes by cell viability and soft agar assays. Transfection of either the empty vector pcDNA3.1 or pcDNA3.1-CHI3L1 into 293 cells initiated the punctuated genome changes. In contrast, HeLa-CHI3L1 cells demonstrated the step-wise genome changes. Increased CIN correlated with lower viability of 293-pcDNA3.1 cells but higher colony formation efficiency (CFE). Artificial CHI3L1 production in 293-CHI3L1 cells increased viability and further contributed to CFE. The opposite growth characteristics of 293-CHI3L1 and HeLa-CHI3L1 cells were revealed. The effect and function of a (trans)gene can be opposite and versatile in cells with different genetic network, which is defined by

  3. Metallic nanoparticles in dielectrics: A comparative study

    KAUST Repository

    Agambayev, Agamyrat

    2017-10-25

    The Maxwell-Garnett method is used to predict the effective dielectric constant and the tangent loss of various composites consisting of a PVDF-TrFE-CFE-matrix and metallic microsphere fillers made of Cu, Ni, W, Zn, or Fe. Simulation results demonstrate that for small filler fraction values and at low frequencies, the electrical properties of the resulting composite do not depend on the conductivity of the filler. These findings show that composites fabricated using cheaper metal nanoparticle fillers are as effective as those fabricated using expensive ones.

  4. Smart microgrids in refineries, Mexico case; Microrredes inteligentes en refinerias, caso Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Estrada Garcia, Javier Alejandro; Linan Garcia, Roberto; Picasso Blanquel, Cuitlahuac; Silva Farias, Jose Luis [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2013-03-01

    In this paper we present the technological trends on smart microgrids for refineries, case Mexico. Distributed generation on refineries is a model of microgrid with great challenges to solve, considering renewable energy. Also it discusses the scenario in bidirectional connection from refineries to the utility supergrid Comision Federal de Electricidad (CFE by its acronym in Spanish) and how to reach the development of a smart microgrid. We look different scenarios in power systems refineries, and the feasibility to achieve and develop the technology concepts in smart grid, such as: demand response in real time, exchange of energy between microgrid with supergrid-CFE and viceversa, energy efficiency, microgrid automation, selfhealing/real time autorecovery fault in power systems, storage energy and its application on power systems blackout in refineries. Finally we discussed the concepts that represent the greatest challenges to be solved on the smart microgrids and consider obtaining alternatives solution in medium or long term. [Spanish] En este documento se presentan las tendencias tecnologicas en micro redes inteligentes para refinerias, en el caso de Mexico. La generacion distribuida en refinerias es un modelo de micro red con grandes desafios por resolver, considerando la energia renovable. Se analiza tambien el escenario en conexion bidireccional de refinerias a la super red de la Comision Federal de Electricidad (CFE), la empresa electrica mexicana, y como lograr el desarrollo de una micro red inteligente. Se consideran diferentes escenarios en refinerias de sistemas de potencia, y la factibilidad de alcanzar y desarrollar los conceptos de tecnologia en una red inteligente, tales como: respuesta de demanda en tiempo real, intercambio de energia entre la micro red con la super red de la CFE y viceversa, eficiencia de energia, automatizacion de micro redes, autorrecuperacion de fallas en autoarreglo/tiempo real. En sistemas de potencia, almacenamiento de

  5. Training system for the maintenance of power lines of the distribution network, ALEn3D; Sistema para la capacitacion y entrenamiento para el mantenimiento de lineas de la red de distribucion, ALEn3D

    Energy Technology Data Exchange (ETDEWEB)

    Galvan Bobadilla, Israel; Perez Ramirez, Miguel; Ayala Garcia, Andres; Munoz Roman, Jaime Javier; Rodriguez Gallegos, Eric; Salgado Martinez, Marco Antonio [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Sierra Rodriguez, Benjamin [Comision Federal de Electricidad (Mexico)

    2011-07-01

    The maintenance of power lines is a complex activity with many inherent risks. Therefore, training of personnel in this area is a priority for electric energy companies. This article presents a capacity-building system based on virtual reality developed by the Federal Electric Commission (CFE), called ALEn3D. This allows maintenance technicians to train in risk-free interactive 3D environments and to later use that knowledge with an actual installation. The work was validated by expert electricians and, therefore, the system represents a wealth of knowledge and best practices for the maintenance of distribution lines. ALEn3D was designed as a tool for self capacity-building for adults, and therefore includes usability and e-learning elements to facilitate learning and automate the students' ongoing progress. The system can be run by a personal computer, is low-cost, optimized and user friendly. It is being used in the 16 distribution divisions of the CFE. [Spanish] El mantenimiento en lineas energizadas es un actividad compleja y con muchos riesgos inherentes, por lo que la capacitacion del personal en esta area es una prioridad para las empresas de energia electrica. Este articulo presenta un sistema de capacitacion basado en realidad virtual desarrollado para la Comision Federal de Electricidad (CFE), denominado ALEn3D, el cual permite a los tecnicos de mantenimiento capacitarse en ambientes 3D interactivos libes de riesgos, para posteriormente usar esos conocimientos en una instalacion real. El trabajo fue validado por expertos electricistas, por lo tanto, el sistema es un acervo de conocimientos y mejores practicas del mantenimiento a lineas de distribucion. ALEn3D fue disenado como una herramienta de autocapacitacion para adultos, por lo que se incluyeron aspectos de usabilidad y e-learning que facilitan el aprendizaje y automatizan el seguimiento del estudiante. El sistema puede ser ejecutado en una computadora personal y es utilizado en las 16

  6. Methodology to establish the profile that defines a meta-specification that applies to distribution substations - Mexico case based on norm IEC-61850; Metodologia para establecer el perfil que define una meta-especificacion que aplica a subestaciones de distribucion -caso Mexico- basada en la norma IEC-61850

    Energy Technology Data Exchange (ETDEWEB)

    Picazo Blanquel, Cuitlahuac; Chairez Campos Carlos; Garcia Hernandez, Joaquin; Godinez Enriquez, Hebert; Poujol Galvan, Francisco C.; Suarez Cerda, Dionisio A. [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico); Villalobos Ramos, Andres; LLamas Gonzalez, Rosa E. [Comision Federal de Electricidad (Mexico); Samitier Otero, Carlos [Global Networking Engineering (Spain)

    2010-07-01

    In this article is presented a case of study of automation of electrical substations of Comision Federal de Electricidad (CFE) of Mexico, in which the Norm IEC-61850 has been taken as reference. The case of study consists of defining a metaspecification for the protection, control, measurement and communication systems required by the substations of electrical distribution. For the development the obtained previous experience in the development of a bequeathed system SA, norm IEC61850 has been taken as reference, as well as the experiences documented in the Instituto de Investigaciones Electricas (IIE), the Comision Federal de Electricidad (CFE) and Global Networking Engineering (GNE), Spain. This way, the obtained result is the metaspecification, which establishes the application of the control, protective equipment and measurement under the interoperability concepts, as well as the automation functions of substations applied in the intelligent networks (REI's). The methodology put into practice includes the design of the system architecture (SAS), the operation philosophy, the topology of the communications network, the data modeling one with logical nodes that include data types and classes of common data (CDC), transference of information, and administration of the archives ICD, SSD, SCD, and CID. [Spanish] En este articulo se presenta un caso de estudio de automatizacion de subestaciones electricas de la Comision Federal de Electricidad (CFE) de Mexico, en el cual se ha tomado como referencia la norma IEC-61850. El caso de estudio consiste en definir una metaespecificacion para los sistemas proteccion, control, medicion y comunicaciones requeridos por las subestaciones de distribucion electrica. Para el desarrollo se ha tomado como referencia la experiencia previa obtenida en el desarrollo de un sistema SA legado, la norma IEC61850, asi como las experiencias documentadas en el Instituto de Investigaciones Electricas (IIE), la Comision Federal de

  7. The online diagnosis of steam turbines; El diagnostico en linea de turbinas de vapor

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez S, J. Antonio; Rivera G, Juan J; Cristalinas N, Victor M; Marino L, Carlos A [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2004-07-01

    To maintain the efficiency values, power and unit thermal consumption of the electrical generation units near the design levels, has been always one of the objectives of the operation and maintenance personnel of the power plants of the Comision Federal de Electricidad (CFE). A way to obtain this objective is through the systematic analysis of the equipment operating conditions and of the diagnosis of the deviations causes of the normal operation way. The Gerencia de Operacion de Maquinaria (Management of Turbo-Machinery) through projects contracted with the Unidad de Investigacion y Desarrollo (Unit of Investigation and Development) of the CFE has made the thermal evaluation of different generation units. These evaluations have allowed to identify which internal components are causing the deviations and to improve the planning of the maintenance activities required to bring back the unit to its best working conditions. In this article the methodology for the online thermal evaluation of the steam turbines and its heat transfer auxiliary equipment is described -water condenser and heaters- and some of the obtained results are also presented. [Spanish] Mantener cercanos a los niveles de diseno los valores de eficiencia, potencia y consumo termico unitario de las unidades de generacion electrica ha sido siempre uno de los objetivos del personal de operacion y mantenimiento de las plantas de la Comision Federal de Electricidad (CFE). Una manera de lograr este objetivo es a traves del analisis sistematico de las condiciones de operacion de los equipos y del diagnostico de las causas de las desviaciones del modo normal de operacion. La Gerencia de Turbomaquinaria a traves de proyectos contratados con la Unidad de Investigacion y Desarrollo de la CFE ha realizado la evaluacion termica de diferentes unidades de generacion. Estas evaluaciones han permitido identificar cuales componentes internos estan provocando las desviaciones y mejorar la planeacion de las actividades

  8. Aerodynamic instability of cables in transmission power lines; Inestabilidad aerodinamica en cables de lineas de transmision

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Lopez, Alberto; Vilar Rojas, Jorge Ivan; Munoz Black, Celso J. [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1995-12-31

    One of the aerodynamic instabilities of transmission power lines cables is galloping, which consists in the appearance of important cable vibrations, mainly when the wind hits orthogonally the power line. In some cases the maximum amplitude that occurs reaches several meters, even when the wind velocities in a region are well below the value used for the mechanical design of the power lines. In general terms, galloping is associated with particular climatic conditions such as low temperatures and high humidities. In these conditions a coating of ice that adheres to the cable is formed, changing its transverse cross section, propitiating the galloping, although some authors have reported galloping without ice. These climatic conditions are presented mainly in the Northern part of our country and in the high regions of the mountain zones; nevertheless, the galloping phenomenon has been reported in few cases by Comision Federal de Electricidad (CFE). The possible expansion of the power lines in these regions of the country leads to prevent the measures needed to diminish the appearance of this phenomenon. In this paper mention is made in particular of the solution adopted to the galloping problem that has appeared in the transmission power line of Salamayuca to Reforma, Ciudad Juarez, Chihuahua (CFE,1991). [Espanol] Una de las inestabilidades aerodinamicas que se presentan en los cables de lineas de transmision es el galopeo, el cual consiste en la aparicion de vibraciones importantes de los cables, sobre todo cuando el flujo del viento incide ortogonalmente a la linea. En algunos casos las amplitudes maximas que se presentan llegan a ser de varios metros, aun cuando las velocidades del viento en una region esten muy por debajo del valor empleado para el diseno mecanico de las lineas. Generalmente, el galopeo se asocia con condiciones climaticas particulares como son las bajas temperaturas y altas humedades. En estas condiciones se forma una cubierta de hielo que se

  9. Step-wise and punctuated genome evolution drive phenotype changes of tumor cells

    Energy Technology Data Exchange (ETDEWEB)

    Stepanenko, Aleksei, E-mail: a.a.stepanenko@gmail.com [Department of Biosynthesis of Nucleic Acids, Institute of Molecular Biology and Genetics, National Academy of Sciences of Ukraine, Kyiv 03680 (Ukraine); Andreieva, Svitlana; Korets, Kateryna; Mykytenko, Dmytro [Department of Biosynthesis of Nucleic Acids, Institute of Molecular Biology and Genetics, National Academy of Sciences of Ukraine, Kyiv 03680 (Ukraine); Huleyuk, Nataliya [Institute of Hereditary Pathology, National Academy of Medical Sciences of Ukraine, Lviv 79008 (Ukraine); Vassetzky, Yegor [CNRS UMR8126, Université Paris-Sud 11, Institut de Cancérologie Gustave Roussy, Villejuif 94805 (France); Kavsan, Vadym [Department of Biosynthesis of Nucleic Acids, Institute of Molecular Biology and Genetics, National Academy of Sciences of Ukraine, Kyiv 03680 (Ukraine)

    2015-01-15

    Highlights: • There are the step-wise continuous and punctuated phases of cancer genome evolution. • The system stresses during the different phases may lead to very different responses. • Stable transfection of an empty vector can result in genome and phenotype changes. • Functions of a (trans)gene can be opposite/versatile in cells with different genomes. • Contextually, temozolomide can both promote and suppress tumor cell aggressiveness. - Abstract: The pattern of genome evolution can be divided into two phases: the step-wise continuous phase (step-wise clonal evolution, stable dominant clonal chromosome aberrations (CCAs), and low frequency of non-CCAs, NCCAs) and punctuated phase (marked by elevated NCCAs and transitional CCAs). Depending on the phase, system stresses (the diverse CIN promoting factors) may lead to the very different phenotype responses. To address the contribution of chromosome instability (CIN) to phenotype changes of tumor cells, we characterized CCAs/NCCAs of HeLa and HEK293 cells, and their derivatives after genotoxic stresses (a stable plasmid transfection, ectopic expression of cancer-associated CHI3L1 gene or treatment with temozolomide) by conventional cytogenetics, copy number alterations (CNAs) by array comparative genome hybridization, and phenotype changes by cell viability and soft agar assays. Transfection of either the empty vector pcDNA3.1 or pcDNA3.1-CHI3L1 into 293 cells initiated the punctuated genome changes. In contrast, HeLa-CHI3L1 cells demonstrated the step-wise genome changes. Increased CIN correlated with lower viability of 293-pcDNA3.1 cells but higher colony formation efficiency (CFE). Artificial CHI3L1 production in 293-CHI3L1 cells increased viability and further contributed to CFE. The opposite growth characteristics of 293-CHI3L1 and HeLa-CHI3L1 cells were revealed. The effect and function of a (trans)gene can be opposite and versatile in cells with different genetic network, which is defined by

  10. Assessment of competency for execution: professional guidelines and an evaluation checklist.

    Science.gov (United States)

    Zapf, Patricia A; Boccaccini, Marcus T; Brodsky, Stanley L

    2003-01-01

    The issue of whether mental health professionals should be involved in conducting evaluations of competency for execution is a topic that has elicited controversy and heated debate. This article picks up at a point beyond the controversy and addresses issues of professionalism and the objective assessment of competency for execution. Specifically, this article identifies professional standards for conducting competence for execution (CFE) evaluations, describes current practices in this area, and provides an interview checklist that can be used as an evaluation guide by involved professionals. Copyright 2002 John Wiley & Sons, Ltd.

  11. Hole-transporting transistors and circuits based on the transparent inorganic semiconductor copper(I) thiocyanate (CuSCN) processed from solution at room temperature

    KAUST Repository

    Pattanasattayavong, Pichaya

    2012-12-27

    The wide bandgap and highly transparent inorganic compound copper(I) thiocyanate (CuSCN) is used for the first time to fabricate p-type thin-film transistors processed from solution at room temperature. By combining CuSCN with the high-k relaxor ferroelectric polymeric dielectric P(VDF-TrFE-CFE), we demonstrate low-voltage transistors with hole mobilities on the order of 0.1 cm2 V-1 s-1. By integrating two CuSCN transistors, unipolar logic NOT gates are also demonstrated. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Determination of the concentration profile of chemical elements in superheater pipes

    International Nuclear Information System (INIS)

    Aldape U, F.; Aspiazu F, J.

    1986-05-01

    This work has for object to determine the profile of concentration of chemical elements at trace level in a superheater pipe of Thermoelectric Plants using the X-ray emission spectroscopy technique induced by protons coming from the Accelerator of the Nuclear Center. In the X-ray detection, a Si Li detector was used. The technique was chosen because it allows a multielemental analysis, of high sensitivity and precision. The results can help to understand the problems that are had in the change of flexibility or of corrosion. This will be from utility to the Federal Electricity Commission (CFE). (Author)

  13. Aerodynamic instability of cables in transmission power lines; Inestabilidad aerodinamica en cables de lineas de transmision

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Lopez, Alberto; Vilar Rojas, Jorge Ivan; Munoz Black, Celso J [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1996-12-31

    One of the aerodynamic instabilities of transmission power lines cables is galloping, which consists in the appearance of important cable vibrations, mainly when the wind hits orthogonally the power line. In some cases the maximum amplitude that occurs reaches several meters, even when the wind velocities in a region are well below the value used for the mechanical design of the power lines. In general terms, galloping is associated with particular climatic conditions such as low temperatures and high humidities. In these conditions a coating of ice that adheres to the cable is formed, changing its transverse cross section, propitiating the galloping, although some authors have reported galloping without ice. These climatic conditions are presented mainly in the Northern part of our country and in the high regions of the mountain zones; nevertheless, the galloping phenomenon has been reported in few cases by Comision Federal de Electricidad (CFE). The possible expansion of the power lines in these regions of the country leads to prevent the measures needed to diminish the appearance of this phenomenon. In this paper mention is made in particular of the solution adopted to the galloping problem that has appeared in the transmission power line of Salamayuca to Reforma, Ciudad Juarez, Chihuahua (CFE,1991). [Espanol] Una de las inestabilidades aerodinamicas que se presentan en los cables de lineas de transmision es el galopeo, el cual consiste en la aparicion de vibraciones importantes de los cables, sobre todo cuando el flujo del viento incide ortogonalmente a la linea. En algunos casos las amplitudes maximas que se presentan llegan a ser de varios metros, aun cuando las velocidades del viento en una region esten muy por debajo del valor empleado para el diseno mecanico de las lineas. Generalmente, el galopeo se asocia con condiciones climaticas particulares como son las bajas temperaturas y altas humedades. En estas condiciones se forma una cubierta de hielo que se

  14. Adesão de portadores de insuficiência renal crônica ao tratamento de hemodiálise Adhesión de portadores de insuficiencia renal crónica al tratamiento de hemodiálisis Adherence of chronic renal insufficiency patients to hemodialysis

    Directory of Open Access Journals (Sweden)

    Antônio Cláudio Madeiro

    2010-01-01

    Full Text Available OBJETIVO: Avaliar a adesão do cliente com insuficiência renal crônica (IRC ao tratamento de hemodiálise. MÉTODO: Estudo descritivo, quantitativo, realizado em uma unidade de hemodiálise, Fortaleza-CE, alvo foi composta de 45 clientes em hemodiálise, que participaram de uma entrevista. RESULTADOS: Constatou-se como reações dos clientes diante do diagnóstico de IRC: 58% negativas, 33% indiferentes e 9% positivas. Reações diante da hemodiálise: 73,4% negativas, 13,3% indiferentes e 13,3% positivas. Principais dificuldades de adesão: transporte; tempo das sessões; dor da punção da fístula; fatores financeiros; dependência de acompanhantes e déficit de conhecimento. Estratégias de adesão: medo da morte; fé em Deus; esperança de transplante e suporte familiar. CONCLUSÃO: Constatou-se que o cliente portador de IRC adere ao tratamento para sobreviver, mas muitos não se adaptam.OBJETIVO: Evaluar la adhesión del cliente, con insuficiencia renal crónica (IRC, al tratamiento de hemodiálisis. MÉTODO: Se trata de un estudio descriptivo cuantitativo, realizado en una unidad de hemodiálisis, en Fortaleza-CE; la población objeto fue compuesta de 45 clientes que realizaban hemodiálisis, los que fueron entrevistados. RESULTADOS: Delante del diagnóstico se constató como reacciones de los clientes de IRC: 58% negativas, 33% indiferentes y 9% positivas. Las reacciones delante de la hemodiálisis fueron: 73,4% negativas, 13,3% indiferentes y 13,3% positivas. Las principales dificultades en la adhesión fueron: transporte; tiempo de las sesiones; dolor de la punción de la fístula; factores financieros; dependencia de acompañantes; y, déficit de conocimiento. Las estrategias de adhesión fueron: miedo a la muerte; fe en Dios; esperanza de trasplante; y, soporte familiar. CONCLUSIÓN: Se constató que el cliente portador de IRC adhiere al tratamiento para sobrevivir, sin embargo muchos no se adaptan.OBJECTIVE: To evaluate the

  15. TEST DE FUROSEMIDA : SU PATRÓN EN LA INSUFICIENCIA RENAL CRÓNICA NO SEVERA

    Directory of Open Access Journals (Sweden)

    Carlos G. Musso

    2008-01-01

    Full Text Available El test de furosemida consiste en una prueba de fisiología renal que se utiliza para evaluar la capacidad de los túbulos colectores para secretar potasio. Dicho estímulo está mediado por acción de la hormona aldosterona, cuyos niveles séricos se elevan tras el suministro de furosemida. Si bien el patrón de respuesta de este test ha sido descrito en niños y jóvenes sanos, no se lo ha hecho aun en pacientes portadores de insuficiencia renal crónica. Por este motivo se decidió realizar el siguiente estudio a fin lograr su descripción.Material y Método: Se estudiaron veintiséis voluntarios jóvenes (edad: 20 - 40 años, sometidos a una dieta baja en potasio (40 mmol de potasio/día: veinte de ellos eran jóvenes sanos (no presentaban ninguna enfermedad ni tomaban ninguna medicación, y el resto eran pacientes jóvenes portadores de enfermedad renal crónica estadío II/III (filtrado glomerular (FG entre 83,1 ml/min - 39,2 ml/min secundaria a glomerulopatía (diagnóstico por biopsia renal. Ninguno de los pacientes estudiados era portador de diabetes mellitus, obstrucción urinaria, ni estaban en tratamiento con drogas potencialmente inductoras de diskalemia: diuréticos, inhibidores de la enzima convertidora, y antagonistas del receptor de angiotensina II. Desde el comienzo del test y hasta 180 minutos post recibir una dosis única de furosemida endovenosa (1 mg/kg, se obtuvieron muestras de orina y sangre para medir niveles de creatinina y potasio. A partir de estos datos se calculó la excreción fraccional de potasio (EFK correspondiente a cada muestra. El análisis estadístico fue realizado aplicando el test de Student.Resultados: Si bien no hubo diferencia estadísticamente significativa ni en el valor basal (pre-furosemida, ni promedio (post-furosemida de la EFK, entre los sujetos sanos y los pacientes con insuficiencia renal crónica (IRC: EFK basal 16,4 ± 8,6% ( IRC vs 11,5 ± 4,6% (sanos (p= NS; EFK promedio 40,8 ± 3

  16. Cotidiano e trabalho: concepções de indivíduos portadores de insuficiência renal crônica e seus familiares Cotidiano y trabajo: concepciones de individuos portadores de insuficiencia renal crónica y sus familiares Daily life and work: conceptions of chronic renal insufficiency patients and their relatives

    Directory of Open Access Journals (Sweden)

    Ligia Carreira

    2003-12-01

    Full Text Available Este é um estudo descritivo-exploratório, que objetivou conhecer as concepções, atitudes e comportamentos relacionados ao trabalho, de 16 indivíduos portadores de insuficiência renal crônica (IRC e seus familiares. Os dados foram coletados no período de abril a agosto de 2000, por meio de entrevista semi-estruturada. Os resultados revelaram que o trabalho é valorizado por todas as famílias como fonte de saúde e de provimento financeiro, além de ser importante na formação do caráter do indivíduo; e que a maioria dos indivíduos com IRC não desenvolvem atividade remunerada, e, quando o fazem, contam com a ajuda e compreensão do patrão e familiares. Conclui-se que IRC e seu tratamento não constituem impedimento direto e absoluto à realização desse tipo de atividade, mas trazem limitações importantes. Considera-se necessário os profissionais de saúde se aliarem na busca de apoio por parte de familiares e sociedade, para que esses indivíduos possam ser inseridos no mercado de trabalho quando o desejarem e tiverem condições para tal.Estudio descriptivo y exploratorio que se propuso conocer las concepciones, actitudes, creencias y comportamientos de 16 individuos portadores de insuficiencia renal crónica (IRC y sus familiares, en relación con el trabajo. Los datos fueron recogidos entre abril y agosto del 2000, a través de una entrevista semi-estructurada. Los resultados revelaron que el trabajo es valorizado por todas las familias como fuente de salud y de provisión financiera, además de ser importante en la formación del carácter del individuo. Igualmente, la investigación mostró que la mayoría de los individuos con IRC no desarrollan una actividad remunerada y cuando lo hacen, cuentan con la ayuda y la comprensión del patrón y de los familiares. Concluimos, por tanto, que la IRC y su tratamiento no constituyen un impedimento directo para la realización de este tipo de actividad, pero que trae limitaciones

  17. The AKARI FU-HYU galaxy evolution program: first results from the GOODS-N field

    Science.gov (United States)

    Pearson, C. P.; Serjeant, S.; Negrello, M.; Takagi, T.; Jeong, W.-S.; Matsuhara, H.; Wada, T.; Oyabu, S.; Lee, H. M.; Im, M. S.

    2010-05-01

    The AKARI FU-HYU mission program carried out mid-infrared imaging of several well studied Spitzer fields preferentially selecting fields already rich in multi-wavelength data from radio to X-ray wavelengths filling in the wavelength desert between the Spitzer IRAC and MIPS bands. We present the initial results for the FU-HYU survey in the GOODS-N field. We utilize the supreme multiwavelength coverage in the GOODS-N field to produce a multiwavelength catalogue from infrared to ultraviolet wavelengths, containing more than 4393 sources, including photometric redshifts. Using the FU-HYU catalogue we present colour-colour diagrams that map the passage of PAH features through our observation bands. We find that the longer mid-infrared bands from AKARI (IRC-L18W 18 micron band) and Spitzer (MIPS24 24 micron band) provide an accurate measure of the total MIR emission of the sources and therefore their probable total mid-infrared luminosity. We also find that colours incorporating the AKARI IRC-S11 11 micron band produce a bimodal distribution where an excess at 11 microns preferentially selects moderate redshift star-forming galaxies. These powerful colour-colour diagnostics are further used as tools to extract anomalous colour populations, in particular a population of Silicate Break galaxies from the GOODS-N field showing that dusty starbursts can be selected of specific redshift ranges (z = 1.2-1.6) by mid-infrared drop-out techniques. The FU-HYU catalogue will be made publically available to the astronomical community.

  18. Progress assessed with the Mayo-Portland Adaptability Inventory in 604 participants in 4 types of post-inpatient rehabilitation brain injury programs.

    Science.gov (United States)

    Eicher, Vicki; Murphy, Mary Pat; Murphy, Thomas F; Malec, James F

    2012-01-01

    To compare progress in 4 types of post-inpatient rehabilitation brain injury programs. Quasiexperimental observational cohort study. Community and residential. Individuals (N=604) with acquired brain injury. Four program types within the Pennsylvania Association of Rehabilitation Facilities were compared: intensive outpatient and community-based rehabilitation (IRC; n=235), intensive residential rehabilitation (IRR; n=78), long-term residential supported living (SLR; n=246), and long-term community-based supported living (SLC; n=45). With the use of a commercial web-based data management system developed with federal grant support, progress was examined on 2 consecutive assessments. Mayo-Portland Adaptability Inventory (MPAI-4). Program types differed in participant age (F=10.69, PMPAI-4 score (F=6.89, PMPAI-4 score and chronicity were significantly associated with the second MPAI-4 rating. On average, SLR participants were 9.1 years postinjury compared with 5.1 years for IRR, 6.0 years for IRC, and 6.8 years for SLC programs. IRR participants were more severely disabled per MPAI-4 total score on admission than the other groups. Controlling for these variables, program types varied significantly on second MPAI-4 total score (F=5.14, P=.002). Both the IRR and IRC programs resulted in significant functional improvement across assessments. In contrast, both the SLR and SLC programs demonstrated relatively stable MPAI-4 scores. Results are consistent with stated goals of the programs; that is, intensive programs resulted in functional improvements, whereas supported living programs produced stable functioning. Further studies using data from this large, multiprovider measurement collaboration will potentially provide the foundation for developing outcome expectations for various types of postacute brain injury programs. Copyright © 2012 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.

  19. Health monitoring and rehabilitation of a concrete structure using intelligent materials

    Science.gov (United States)

    Song, G.; Mo, Y. L.; Otero, K.; Gu, H.

    2006-04-01

    This paper presents the concept of an intelligent reinforced concrete structure (IRCS) and its application in structural health monitoring and rehabilitation. The IRCS has multiple functions which include self-rehabilitation, self-vibration damping, and self-structural health monitoring. These functions are enabled by two types of intelligent (smart) materials: shape memory alloys (SMAs) and piezoceramics. In this research, Nitinol type SMA and PZT (lead zirconate titanate) type piezoceramics are used. The proposed concrete structure is reinforced by martensite Nitinol cables using the method of post-tensioning. The martensite SMA significantly increases the concrete's damping property and its ability to handle large impact. In the presence of cracks due to explosions or earthquakes, by electrically heating the SMA cables, the SMA cables contract and close up the cracks. In this research, PZT patches are embedded in the concrete structure to detect possible cracks inside the concrete structure. The wavelet packet analysis method is then applied as a signal-processing tool to analyze the sensor signals. A damage index is defined to describe the damage severity for health monitoring purposes. In addition, by monitoring the electric resistance change of the SMA cables, the crack width can be estimated. To demonstrate this concept, a concrete beam specimen with reinforced SMA cables and with embedded PZT patches is fabricated. Experiments demonstrate that the IRC has the ability of self-sensing and self-rehabilitation. Three-point bending tests were conducted. During the loading process, a crack opens up to 0.47 inches. Upon removal of the load and heating the SMA cables, the crack closes up. The damage index formed by wavelet packet analysis of the PZT sensor data predicts and confirms the onset and severity of the crack during the loading. Also during the loading, the electrical resistance value of the SMA cable changes by up to 27% and this phenomenon is used to

  20. Exploration and development of the Cerro Prieto geothermal field

    Energy Technology Data Exchange (ETDEWEB)

    Lippmann, M.J.; Goldstein, N.E.; Halfman, S.E.; Witherspoon, P.A.

    1983-07-01

    A multidisciplinary effort to locate, delineate, and characterize the geothermal system at Cerro Prieto, Baja California, Mexico, began about 25 years ago. It led to the identification of an important high-temperature, liquid-dominated geothermal system which went into production in 1973. Initially, the effort was undertaken principally by the Mexican electric power agency, the Comision Federal de Electricidad (CFE). Starting in 1977 a group of US organizations sponsored by the US Department of Energy, joined CFE in this endeavor. An evaluation of the different studies carried out at Cerro Prieto has shown that: (1) surface electrical resistivity and seismic reflection surveys are useful in defining targets for exploratory drilling; (2) the mineralogical studies of cores and cuttings and the analysis of well logs are important in designing the completion of wells, identifying geological controls on fluid movement, determining thermal effects and inferring the thermal history of the field; (3) geochemical surveys help to define zones of recharge and paths of fluid migration; and (4) reservoir engineering studies are necessary in establishing the characteristics of the reservoir and in predicting its response to fluid production.

  1. Adjustable movable capacitors bank at 20 or 30 MVAr in 115 kV; Banco movil de capacitores ajustable a 20 o 30 MVAr en 115 kV

    Energy Technology Data Exchange (ETDEWEB)

    Ponce Velez, Marco A; Lopez Velazquez, Juan Jose [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico); Lopez Tagle, Alfredo; Aragon Garcia, Hector [Comision Federal de Electricidad (Mexico)

    1999-07-01

    The use of fixed capacitors banks in distribution and transmission systems is a useful tool to compensate the demand of reactive power and the drop of voltage of the power lines. Nevertheless, unforeseen happenings can be originated that could cause decompensation in the system reliability. Due to the previous fact, the Transmission and Transformation Coordinator (CTT) of the Comision Federal de Electricidad (CFE) asked for the design and the construction of a movable bank of capacitors for an emergent compensation of reactive power. In this article it is presented the most relevant of the design, the construction and the operation of the movable bank of capacitors developed in the Instituto de Investigaciones Electricas (IIE). [Spanish] El empleo de bancos capacitadores fijos en los sistemas de distribucion y transmision es una herramienta util para compensar la demanda de reactivos y la caida de tension de las lineas. Sin embargo, se pueden originar imprevistos que descompensan la confiabilidad del sistema. Debido a lo anterior, la Coordinadora de Transmision y Transformacion (CTT) de la Comision Federal de Electricidad (CFE) solicito el diseno y la construccion de un banco movil de capacitores para una compensacion emergente de potencia reactiva. En este articulo se presenta lo mas relevante del diseno, la construccion y la operacion del banco movil de capacitores desarrollado en el Instituto de Investigaciones Electricas (IIE).

  2. On-line monitoring for the detection and prevention of faults in the power transformers; Monitoreo en linea para la deteccion y prevencion de fallas en transformadores de potencia

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Tagle, Alfredo; Equihua Tapia, Hugo [Comision Federal de Electricidad (Mexico); Linan Garcia, Roberto; Pascacio de los Santos, Alberth; Nunez Dominguez, Arturo [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2000-07-01

    Power transformers are held to thermal, electrical and mechanical efforts, which degrade the isolation system oil/paper. So that to detect incipient degradations in transformers with more than 25 years of service installed in the transmission network of Commission Federal de Electricidad (CFE). The Instituto de Investigaciones Electricas (IIE), developed and installed six on-line Monitoring Systems for Power Transformers (SMLTP). The systems are installed at the substations Puebla II, banks AT-1 and AT-2, Malpaso II, bank, AT-1 and phase B of bank AT-1 of the electrical substation Villa de Garcia. [Spanish] Los transformadores de potencia estan sujetos a esfuerzos termicos, electricos y mecanicos, los cuales degradan el sistema de aislamiento aceite/papel. De modo que con el proposito de detectar degradaciones incipientes en transformadores con mas de 25 anos de servicio instalado en la red de transmision de la Comision Federal de Electricidad (CFE). El Instituto de Investigaciones Electricas (IIE), desarrollo e instalo seis Sistemas de Monitoreo en Linea para Transformadores de Potencia (SMLTP). Los sistemas se encuentran en las subestaciones Puebla II, bancos AT-1 y AT-2, Malpaso II, banco, AT-1 y fase B del banco AT-1 de la subestacion electrica Villa de Garcia.

  3. ABUNDANCES IN THE LOCAL REGION. I. G AND K GIANTS

    Energy Technology Data Exchange (ETDEWEB)

    Luck, R. Earle, E-mail: rel2@case.edu [Department of Astronomy, Case Western Reserve University 10900 Euclid Avenue, Cleveland, OH 44106-7215 (United States)

    2015-09-15

    Parameters and abundances for 1133 stars of spectral types F, G, and K of luminosity class III have been derived. In terms of stellar parameters, the primary point of interest is the disagreement between gravities derived with masses determined from isochrones, and gravities determined from an ionization balance. This is not a new result per se, but the size of this sample emphasizes the severity of the problem. A variety of arguments led to the selection of the ionization-balance gravity as the working value. The derived abundances indicate that the giants in the solar region have Sun-like total abundances and abundance ratios. Stellar evolution indicators have also been investigated with the Li abundances and the [C/Fe] and C/O ratios, indicating that standard processing has been operating in these stars. The more salient result for stellar evolution is that the [C/Fe] data across the red-giant clump indicates the presence of mass-dependent mixing in accord with standard stellar evolution predictions.

  4. Temporary storage in dry of the spent nuclear fuel in the Nuclear Power Plant of Laguna Verde; Almacenamiento temporal en seco del combustible nuclear gastado en la Central Nuclear Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Hernandez M, N.; Vargas A, A., E-mail: natividad.hernandez@cfe.gob.mx [Comision Federal de Electricidad, Gerencia de Centrales Nucleoelectricas, Carretera Veracruz-Medellin Km. 7.5, 94270 Dos Bocas, Veracruz (Mexico)

    2013-10-15

    To guarantee the continuity in the operation of the two nuclear reactors of the nuclear power plant of Laguna Verde (NPP-L V) is an activity of high priority of the Comision Federal de Electricidad (CFE) in Mexico. At the present time, the CFE is working in the storage project in dry of the spent fuel with the purpose of to liberate space of the pools and to have the enlarged capacity of storage of the spent fuel that is discharged of the reactors. This work presents the storage option in dry of the spent fuel, considering that the original capacity of the spent fuel pools of the NPP-L V was of 1242 spaces each one and that in 1991, through a modification of the original design, the storage capacity was increased to 3177 spaces by pool. At present, the cells occupied by unit are of 2165 (68%) for the Unit-I and 1839 (58%) for the Unit-2, however, in 2017 and 2022 the capacity to discharge the complete core will be limited by what is required of a retirement option of spent fuel assemblies to liberate spaces. (author)

  5. Utilizing Waste Thermocol Sheets and Rusted Iron Wires to Fabricate Carbon-Fe3O4 Nanocomposite Based Supercapacitors: Turning Wastes into Value-Added Materials.

    Science.gov (United States)

    Vadiyar, Madagonda M; Liu, Xudong; Ye, Zhibin

    2018-05-14

    In the present work, we demonstrate the synthesis of porous activated carbon (specific surface area, 1,883 m2 g-1), Fe3O4 nanoparticles, and carbon-Fe3O4 nanocomposites using local waste thermocol sheets and rusted iron wires. The resulting carbon, Fe3O4 nanoparticles, and carbon-Fe3O4 composites are used as electrode materials for supercapacitor application. In particular, C-Fe3O4 composite electrodes exhibit a high specific capacitance of 1,375 F g-1 at 1 A g-1 and longer cyclic stability with 98 % of capacitance retention over 10,000 cycles. Subsequently, asymmetric supercapacitor, i. e., C-Fe3O4//Ni(OH)2/CNT device exhibits a high energy density of 91.1 Wh kg-1 and a remarkable cyclic stability, showing 98% of capacitance retention over 10,000 cycles. Thus, this work has important implications not only for the fabrication of low-cost electrodes for high-performance supercapacitors but also for the recycling of waste thermocol sheets and rust iron wires for value-added reuse. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Nanometer-scale discernment of field emission from tungsten surface with single carbon monoxide molecule

    Science.gov (United States)

    Matsunaga, Soichiro; Suwa, Yuji; Katagiri, Souichi

    2017-12-01

    Unusual quantized beam fluctuations were found in the emission current from a cold-field emitter (CFE) operating in an extremely high vacuum of 10-10 Pa. To clarify the microscopic mechanism behind these fluctuations, we developed a new calculation method to evaluate the field emission from a heterogeneous surface under a strong electric field of 4 × 109 V/m by using the local potential distribution obtained by a first-principles calculation, instead of by using the work function. As a result of the first-principles calculations of a single molecule adsorbed on a tungsten surface, we found that dissociative adsorption of a carbon monoxide (CO) molecule enhances the emission current by changing the potential barrier in the area surrounding the C and O adatoms when these two atoms are placed at their most stable positions. It is also found that the migration of the O atom from the most stable position reduces the emission current. These types of enhancement and reduction of the emission current quantitatively explain the observed quantized fluctuations of the CFE emission current.

  7. Effective delayed neutron fraction and prompt neutron lifetime of Tehran research reactor mixed-core

    International Nuclear Information System (INIS)

    Lashkari, A.; Khalafi, H.; Kazeminejad, H.

    2013-01-01

    Highlights: ► Kinetic parameters of Tehran research reactor mixed-core have been calculated. ► Burn-up effect on TRR kinetics parameters has been studied. ► Replacement of LEU-CFE with HEU-CFE in the TRR core has been investigated. ► Results of each mixed core were compared to the reference core. ► Calculation of kinetic parameters are necessary for reactivity and power excursion transient analysis. - Abstract: In this work, kinetic parameters of Tehran research reactor (TRR) mixed cores have been calculated. The mixed core configurations are made by replacement of the low enriched uranium control fuel elements with highly enriched uranium control fuel elements in the reference core. The MTR P C package, a nuclear reactor analysis tool, is used to perform the analysis. Simulations were carried out to compute effective delayed neutron fraction and prompt neutron lifetime. Calculation of kinetic parameters is necessary for reactivity and power excursion transient analysis. The results of this research show that effective delayed neutron fraction decreases and prompt neutron lifetime increases with the fuels burn-up. Also, by increasing the number of highly enriched uranium control fuel elements in the reference core, the prompt neutron lifetime increases, but effective delayed neutron fraction does not show any considerable change

  8. Development for analysis system of rods enrichment of nuclear fuels; Desarrollo de un sistema de analisis de enriquecimiento de barras de combustible nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Rojas C, E.L

    1998-11-01

    Nuclear industry is strongly regulated all over the world and quality assurance is important in every nuclear installation or process related with it. Nuclear fuel manufacture is not the exception. ININ was committed to manufacture four nuclear fuel bundles for the CFE nucleo electric station at Laguna Verde, Veracruz, under General Electric specifications and fulfilling all the requirements of this industry. One of the quality control requisites in nuclear fuel manufacture deals with the enrichment of the pellets inside the fuel bundle rods. To achieve the quality demanded in this aspect, the system described in this work was developed. With this system, developed at ININ it is possible to detect enrichment spikes since 0.4 % in a column of pellets with a 95 % confidence interval and to identify enrichment differences greater than 0.2 % e between homogeneous segments, also with a 95 % confidence interval. ININ delivered the four nuclear fuel bundles to CFE and these were introduced in the core of the nuclear reactor of Unit 1 in the fifth cycle. Nowadays they are producing energy and have shown a correct mechanical performance and neutronic behavior. (Author)

  9. Energy. Chapter 4; Energia. Capitulo 4

    Energy Technology Data Exchange (ETDEWEB)

    Martin del Castillo, Carlos [Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico)

    2009-07-01

    This chapter stands out that the infrastructure for the electric energy generation, as well as the one departing from fossil fuels has been the responsibility of two institutions with great solvency in the scope of engineering: the Comision Federal de Electricidad (CFE) and Petroleos Mexicanos (PEMEX). It is presented here the energy future in a sustainable context; a prospective study to year 2050; a strategic proposal of Petroleos Mexicanos; the forecast of the oil industry in Mexico and a technological prospective of the energy. [Spanish] En este capitulo se destaca que la infraestructura para la generacion de energia, tanto electrica como a partir de combustibles fisiles ha corrido a cargo de dos instituciones con gran solvencia en el ambito de la ingenieria: la Comision Federal de Electricidad (CFE) y Petroleos Mexicanos (Pemex). Se presenta el futuro de la energia en un contexto sustentable; un estudio prospectivo al ano 2050; una propuesta estrategica de Petroleos Mexicanos; la prospectiva de la industria petrolera en Mexico y; una prospectiva tecnologica de la energia.

  10. Measurement and control techniques for electric equipment development; Tecnicas de medicion y control para el desarrollo de equipos electricos

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Neblina, Joaquin [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1988-12-31

    In broad outlines the measuring and control techniques that are used in the electric equipment development in the short circuit laboratories, are described. In this article the utilization criteria of the traditional and modern (analogical and digital) instruments are described as well as the tendency towards the system`s integration for the automation of the measurement and control processes. Also, mention is made of the systems currently being developed at the Instituto de Investigaciones Electricas (IIE) to be applied at the Short Circuit Laboratories of Comision Federal de Electricidad (CFE) and of the IIE. [Espanol] Se describen a grandes rasgos las tecnicas de medicion y control que se emplean para el desarrollo de equipos electricos en los laboratorios de corto circuito. En este articulo se describen los criterios de utilizacion de los instrumentos tradicionales y modernos (analogicos y digitales), asi como la tendencia hacia la integracion de sistemas para la automatizacion de los procesos de medicion y control. Tambien se mencionan los sistemas que actualmente se desarrollan en el Instituto de Investigaciones Electricas (IIE) para aplicarlos en los Laboratorios de Corto Circuito de la Comision Federal de Electricidad (CFE) y del Instituto.

  11. Optimization in the design and efficiency of retractable soot blowers; Optimacion del diseno y la eficiencia de sopladores de hollin retractiles

    Energy Technology Data Exchange (ETDEWEB)

    Diego Marin, Antonio [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1988-12-31

    In this article the importance of soot blowers in the subject of design, operation and maintenance are described and the effects that its inefficient functioning causes in the steam generators. The activities and the results of a project for the evaluation of the functioning of the soot blowers in the Comision Federal de Electricidad (CFE) boilers. Finally, the scope of a new project oriented towards the retractable soot blowers efficiency optimization, and to the creation of the infra-structure to substitute the import of its components. [Espanol] En este articulo se describe la importancia de los sopladores de hollin en los aspectos de diseno, operacion y mantenimiento, y los efectos que su funcionamiento deficiente produce en los generadores de vapor. Se presentan tambien las actividades y los resultados de un proyecto para evaluar el funcionamiento de los deshollinadores de las calderas de la Comision Federal de Electricidad (CFE). Finalmente, se presenta el alcance de un nuevo proyecto que se orienta a optimar la eficiencia de los sopladores de hollin retractiles y a crear la infraestructura para sustituir las importaciones de sus componentes.

  12. Efficient photodegradation of Acid Red B by immobilized ferrocene in the presence of UVA and H2O2

    International Nuclear Information System (INIS)

    Nie Yulun; Hu Chun; Qu Jiuhui; Hu Xuexiang

    2008-01-01

    SiO 2 -C 2 H 4 -ferrocene (SiCFe) was synthesized by covalent grafting of ferrocene on functionalized silica gel with a -C 2 H 4 - linkage. On the basis of characterization by diffuse reflectance UV-vis spectra (DRS) and Fourier transform infrared spectra (FT-IR), ferrocene has been successfully anchored on the silica gel. Under UVA (λ max = 365 nm) irradiation, the catalyst exhibited high photocatalytic activity in the degradation of Acid Red B (ARB), especially in the presence of H 2 O 2 . Meanwhile, the catalytic activity of SiCFe was maintained effectively even after reused for 4 times without any significant destruction of ferrocene. The influence of initial solution pH and wavelength of UV light on the catalyst's activity was also investigated. Electron spin resonance (ESR) studies revealed that both ·OH and HO 2 ·/O 2 · - radicals were involved as the active species in the ARB degradation process. Furthermore, results of total organic carbon (TOC) and FT-IR analysis indicated that ARB degradation proceeded by the cleavage of -N=N-, followed by hydroxylation and opening of phenyl rings to form aliphatic acids and further oxidization of the aliphatic acids to produce carbon dioxide and water. A possible reaction mechanism was proposed on the basis of all the information obtained under various experimental conditions

  13. Questions to the reactors power upgrade of the Nuclear Power Plant of Laguna Verde

    International Nuclear Information System (INIS)

    Salas M, B.

    2014-08-01

    The two reactors of the Nuclear Power Plant of Laguna Verde (NPP-L V) were subjected to power upgrade labors with the purpose of achieving 20% upgrade on the original power; these labors concluded in August 24, 2010 for the Reactor 1 and in January 16, 2011 for the Reactor 2, however in January of 2014, the NNP-L V has not received by part of the Comision Nacional de Seguridad Nuclear y Salvaguardias (CNSNS) the new Operation License to be able to work with the new power, because it does not fulfill all the necessary requirements of safety. In this work is presented and analyzed the information obtained in this respect, with data provided by the Instituto Federal de Acceso a la Informacion Publica y Proteccion de Datos (IFAI) and the Comision Federal de Electricidad (CFE) in Mexico, as well as the opinion of some workers of the NPP-L V. The Governing Board of the CFE announcement that will give special continuation to the behavior on the operation and reliability of the NPP-L V, because the frequency of not announced interruptions was increased 7 times more in the last three years. (Author)

  14. Use of the operation planning network at Centro Nacional de Control de Energia (CENACE); Uso de la red de planeacion de la operacion en el Centro Nacional de Control de Energia (CENACE)

    Energy Technology Data Exchange (ETDEWEB)

    Navarro, Roberto; Alatorre, Pedro; Gonzalez, Nemorio; Nieva, Rolando [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1997-12-31

    A description is made of the ways Comision Federal de Electricidad (CFE) utilizes the system called Short Term Operation Planning Network (Red de Planeacion de la Operacion a Corto Plazo) (REDPLA) in the elaboration of the generation daily pre-dispatch (PD) of the National Electric System (SEN). The PD defines the hourly generation with which each central must contribute, to cover the predicted demand during the following 24 hours, so that the total production cost be the lowest. Respecting at every moment the transmission limitations, the characteristics of the generation system and the operational restrictions. [Espanol] Se describe la manera en que la Comision Federal de Electricidad (CFE) utiliza el sistema denominado Red de Planeacion de la Operacion a Corto Plazo (Redpla) en la elaboracion del predespacho diario (PD) de generacion del sistema electrico nacional (SEN). El PD define la generacion horaria que debera aportar cada central electrica para cubrir la demanda pronosticada durante las proximas 24 horas, de tal manera que el costo de produccion total sea el mas bajo, respetando en todo momento las limitaciones de transmision, las caracteristicas del sistema de generacion y las restricciones operativas del sistema.

  15. Compreensão leitora de palavras e frases: elaboração de procedimento avaliativo

    Directory of Open Access Journals (Sweden)

    Adriana Marques de Oliveira

    2013-06-01

    Full Text Available Este estudo teve por objetivos elaborar o procedimento de avaliação da compreensão de leitura de palavras e frases e caracterizar o desempenho de escolares de 2º ano do Ensino Fundamental neste procedimento. O estudo foi dividido em duas partes: 1 elaboração das provas de avaliação da compreensão de leitura, composta por três provas: compreensão da palavra escrita (CPE, frase (CFE e frases a partir de figura (CFF e 2 aplicação das provas elaboradas em 120 escolares distribuídos em: GI, 60 escolares do ensino público municipal e GII, 60 escolares do ensino particular. A prova CPE obteve maior média de acertos, seguida da CFF e CFE para ambos os grupos, pois a figura auxilia no processo de extração do significado tanto da palavra como da frase. O procedimento elaborado, ao identificar as dificuldades inerentes do início do processo de alfabetização, mostrou-se eficaz para avaliar as habilidades iniciais da compreensão da leitura.

  16. Measurement and control techniques for electric equipment development; Tecnicas de medicion y control para el desarrollo de equipos electricos

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Neblina, Joaquin [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1987-12-31

    In broad outlines the measuring and control techniques that are used in the electric equipment development in the short circuit laboratories, are described. In this article the utilization criteria of the traditional and modern (analogical and digital) instruments are described as well as the tendency towards the system`s integration for the automation of the measurement and control processes. Also, mention is made of the systems currently being developed at the Instituto de Investigaciones Electricas (IIE) to be applied at the Short Circuit Laboratories of Comision Federal de Electricidad (CFE) and of the IIE. [Espanol] Se describen a grandes rasgos las tecnicas de medicion y control que se emplean para el desarrollo de equipos electricos en los laboratorios de corto circuito. En este articulo se describen los criterios de utilizacion de los instrumentos tradicionales y modernos (analogicos y digitales), asi como la tendencia hacia la integracion de sistemas para la automatizacion de los procesos de medicion y control. Tambien se mencionan los sistemas que actualmente se desarrollan en el Instituto de Investigaciones Electricas (IIE) para aplicarlos en los Laboratorios de Corto Circuito de la Comision Federal de Electricidad (CFE) y del Instituto.

  17. Optimization in the design and efficiency of retractable soot blowers; Optimacion del diseno y la eficiencia de sopladores de hollin retractiles

    Energy Technology Data Exchange (ETDEWEB)

    Diego Marin, Antonio [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1987-12-31

    In this article the importance of soot blowers in the subject of design, operation and maintenance are described and the effects that its inefficient functioning causes in the steam generators. The activities and the results of a project for the evaluation of the functioning of the soot blowers in the Comision Federal de Electricidad (CFE) boilers. Finally, the scope of a new project oriented towards the retractable soot blowers efficiency optimization, and to the creation of the infra-structure to substitute the import of its components. [Espanol] En este articulo se describe la importancia de los sopladores de hollin en los aspectos de diseno, operacion y mantenimiento, y los efectos que su funcionamiento deficiente produce en los generadores de vapor. Se presentan tambien las actividades y los resultados de un proyecto para evaluar el funcionamiento de los deshollinadores de las calderas de la Comision Federal de Electricidad (CFE). Finalmente, se presenta el alcance de un nuevo proyecto que se orienta a optimar la eficiencia de los sopladores de hollin retractiles y a crear la infraestructura para sustituir las importaciones de sus componentes.

  18. Workshop on capture and sequestration of CO{sub 2} (CCS); Taller sobre captura y secuestro de CO{sub 2} (CCS)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2008-07-15

    In this workshop diverse communications related to the capture and sequestration of CO{sub 2} are presented. This workshop was realized in the Technological Museum of the Comision Federal de Electricidad (CFE), in Mexico City on the ninth and tenth of July, 2008, and it had the objective of reflecting the necessity of considering in Mexico the application of the capture and sequestration technologies of CO{sub 2} (CCS), as well as to put in touch the technicians and managers of the Mexican institutions with the world-wide leaders in these technologies and with the managers of companies that are successfully applying CCS technologies. [Spanish] En este taller se presentan diversas ponencias relacionadas con la captura y secuestro de CO{sub 2}. Este taller se realizo en el Museo Tecnologico de la Comision Federal de Electricidad (CFE), en la Ciudad de Mexico, los dias 9 y 10 de julio de 2008 y tuvo como objetivo reflexionar sobre la necesidad de considerar en Mexico, la aplicacion de las tecnologias de captura y secuestro de CO{sub 2} (CCS), asi como poner en contacto a los tecnicos y directivos de las instituciones mexicanas con los lideres mundiales en estas tecnologias y con los directivos de empresas que estan aplicando con exito tecnologias de CCS.

  19. Supervisory system for real time monitoring of transient thermal stresses in turbines rotors; Sistema supervisorio para el monitoreo en tiempo real de esfuerzos termicos transitorios en rotores de turbinas

    Energy Technology Data Exchange (ETDEWEB)

    Urquiza Beltran, Gustavo; Rios Miranda, Edmundo; Venegas Guzman, Ricardo; Alvarez Garcia, Gabriela [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1991-12-31

    This article presents a supervisory system that, as its main functions, assists the operator on base of the thermal stresses, monitoring in real time the high pressure (HP) and intermediate pressure rotors (IP) of a steam turbine during the start, shut down and/or sudden load changes. The system is based on a thermal model uni-dimensional integrated to the SIMPER (Information System for the Predictive Maintenance of Rotating Equipment), tested in a 300 MW unit of Comision Federal de Electricidad (CFE). [Espanol] En este articulo se presenta un sistema supervisorio que, como funciones principales, asiste al operador con base en el monitoreo de esfuerzos termicos en tiempo real en los rotores de presion alta (PA) y presion intermedia (PI) de una turbina de vapor durante un arranque, paro y/o variaciones bruscas de carga. El sistema esta basado en un modelo termico unidimensional integrado al SIMPER (sistema informatico para el mantenimiento predictivo de equipo rotatorio), experimentado en una unidad de 300 MW de la Comision Federal de Electricidad (CFE).

  20. Autologous method for ex vivo expansion of human limbal epithelial progenitor cells based on plasma rich in growth factors technology.

    Science.gov (United States)

    Riestra, A C; Vazquez, N; Chacon, M; Berisa, S; Sanchez-Avila, R M; Orive, G; Anitua, E; Meana, A; Merayo-Lloves, J

    2017-04-01

    Develop an autologous culture method for ex vivo expansion of human limbal epithelial progenitor cells (LEPCs) using Plasma Rich in Growth Factors (PRGF) as a growth supplement and as a scaffold for the culture of LEPCs. LEPCs were cultivated in different media supplemented with 10% fetal bovine serum (FBS) or 10% PRGF. The outgrowths, total number of cells, colony forming efficiency (CFE), morphology and immunocytochemistry against p63- α and cytokeratins 3 and 12 (CK3-CK12) were analyzed. PRGF was also used to elaborate a fibrin membrane. The effects of the scaffold on the preservation of stemness and the phenotypic characterization of LEPCs were investigated through analysis of CK3-CK12, ABCG-2 and p63. LEPCs cultivated with PRGF showed a significantly higher growth area than FBS cultures. Moreover, the number of cells were also higher in PRGF than FBS, while displaying a better morphology overall. CFE was found to be also higher in PRGF groups compared to FBS, and the p63-α expression also differed between groups. LEPCs cultivated on PRGF membranes appeared as a confluent monolayer of cells and still retained p63 and ABCG-2 expression, being negative for CK3-CK12. PRGF can be used in corneal tissue engineering, supplementing the culture media, even in a basal media without any other additives, as well as providing a scaffold for the culture. Copyright © 2017 Elsevier Inc. All rights reserved.

  1. Questions to the reactors power upgrade of the Nuclear Power Plant of Laguna Verde; Cuestionamientos al aumento de potencia de los reactores de la Central Nuclear de Laguna Verde

    Energy Technology Data Exchange (ETDEWEB)

    Salas M, B., E-mail: salasmarb@yahoo.com.mx [UNAM, Facultad de Ciencias, Departamento de Fisica, Circuito exterior s/n, Ciudad Universitaria, 04510 Mexico D. F. (Mexico)

    2014-08-15

    The two reactors of the Nuclear Power Plant of Laguna Verde (NPP-L V) were subjected to power upgrade labors with the purpose of achieving 20% upgrade on the original power; these labors concluded in August 24, 2010 for the Reactor 1 and in January 16, 2011 for the Reactor 2, however in January of 2014, the NNP-L V has not received by part of the Comision Nacional de Seguridad Nuclear y Salvaguardias (CNSNS) the new Operation License to be able to work with the new power, because it does not fulfill all the necessary requirements of safety. In this work is presented and analyzed the information obtained in this respect, with data provided by the Instituto Federal de Acceso a la Informacion Publica y Proteccion de Datos (IFAI) and the Comision Federal de Electricidad (CFE) in Mexico, as well as the opinion of some workers of the NPP-L V. The Governing Board of the CFE announcement that will give special continuation to the behavior on the operation and reliability of the NPP-L V, because the frequency of not announced interruptions was increased 7 times more in the last three years. (Author)

  2. Development for analysis system of rods enrichment of nuclear fuels

    International Nuclear Information System (INIS)

    Rojas C, E.L.

    1998-01-01

    Nuclear industry is strongly regulated all over the world and quality assurance is important in every nuclear installation or process related with it. Nuclear fuel manufacture is not the exception. ININ was committed to manufacture four nuclear fuel bundles for the CFE nucleo electric station at Laguna Verde, Veracruz, under General Electric specifications and fulfilling all the requirements of this industry. One of the quality control requisites in nuclear fuel manufacture deals with the enrichment of the pellets inside the fuel bundle rods. To achieve the quality demanded in this aspect, the system described in this work was developed. With this system, developed at ININ it is possible to detect enrichment spikes since 0.4 % in a column of pellets with a 95 % confidence interval and to identify enrichment differences greater than 0.2 % e between homogeneous segments, also with a 95 % confidence interval. ININ delivered the four nuclear fuel bundles to CFE and these were introduced in the core of the nuclear reactor of Unit 1 in the fifth cycle. Nowadays they are producing energy and have shown a correct mechanical performance and neutronic behavior. (Author)

  3. Trends and challenges in global arms control regimes: Implications for the Mediterranean, North Africa, and the Middle East

    Energy Technology Data Exchange (ETDEWEB)

    Lehman, R.F. II

    1994-06-01

    In another sense, however, the nuclear age and ballistic missiles long ago created a much smaller world in which the distinctions between global and regional security have been lessened. In an age of weapons of mass destruction, any point on the earth can find itself suddenly at the center of world attention. This makes it all the more important that we understand all of the arms control tools available, including global approaches. In discussing global arms control regimes, I will focus primarily on those that are open to universal membership such as the Nuclear Nonproliferation Treaty (NPT) or which have global reach, such as certain export control and supplier regimes. It is important to remember, however, that certain regional, bilateral, and even unilateral arms control measures can have a global impact as well. One need only witness the impact of the Treaty on Conventional Forces in Europe (CFE). Despite its mere {open_quotes}Atlantic to the Urals{close_quotes} focus, the CFE treaty helped change the political and strategic calculations of the entire world. Likewise, the Conference on Security and Cooperation in Europe (CSCE), with its headquarters in Vienna, is centered on Europe but spreads from Vancouver to Vladivostok (or perhaps we should say from Amchitka to Kamchatka), circumnavigating much of the northern hemisphere when measured the long way around via North America. The political significance of its successes and failures outdistance CSCE`s geographical spread.

  4. Use of the operation planning network at Centro Nacional de Control de Energia (CENACE); Uso de la red de planeacion de la operacion en el Centro Nacional de Control de Energia (CENACE)

    Energy Technology Data Exchange (ETDEWEB)

    Navarro, Roberto; Alatorre, Pedro; Gonzalez, Nemorio; Nieva, Rolando [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1998-12-31

    A description is made of the ways Comision Federal de Electricidad (CFE) utilizes the system called Short Term Operation Planning Network (Red de Planeacion de la Operacion a Corto Plazo) (REDPLA) in the elaboration of the generation daily pre-dispatch (PD) of the National Electric System (SEN). The PD defines the hourly generation with which each central must contribute, to cover the predicted demand during the following 24 hours, so that the total production cost be the lowest. Respecting at every moment the transmission limitations, the characteristics of the generation system and the operational restrictions. [Espanol] Se describe la manera en que la Comision Federal de Electricidad (CFE) utiliza el sistema denominado Red de Planeacion de la Operacion a Corto Plazo (Redpla) en la elaboracion del predespacho diario (PD) de generacion del sistema electrico nacional (SEN). El PD define la generacion horaria que debera aportar cada central electrica para cubrir la demanda pronosticada durante las proximas 24 horas, de tal manera que el costo de produccion total sea el mas bajo, respetando en todo momento las limitaciones de transmision, las caracteristicas del sistema de generacion y las restricciones operativas del sistema.

  5. Impact of structural changes on dielectric and thermal properties of vinylidene fluoride–trifluoroethylene-based terpolymer/copolymer blends

    Energy Technology Data Exchange (ETDEWEB)

    Casar, G. [Jožef Stefan Institute and Jožef Stefan International Postgraduate School, Jamova 39, SI-1000 Ljubljana (Slovenia); Li, X. [Department of Electrical Engineering and Materials Research Institute, The Pennsylvania State University, University Park, PA 16802 (United States); Malič, B. [Jožef Stefan Institute and Jožef Stefan International Postgraduate School, Jamova 39, SI-1000 Ljubljana (Slovenia); Zhang, Q.M. [Department of Electrical Engineering and Materials Research Institute, The Pennsylvania State University, University Park, PA 16802 (United States); Bobnar, V., E-mail: vid.bobnar@ijs.si [Jožef Stefan Institute and Jožef Stefan International Postgraduate School, Jamova 39, SI-1000 Ljubljana (Slovenia)

    2015-03-15

    We report dielectric and thermal properties of the poly(vinylidene fluoride–trifluoroethylene–chlorofluoroethylene) terpolymer [P(VDF–TrFE–CFE), a member of the relaxor polymer family that exhibits fast response speeds, giant electrostriction, high electric energy density, and large electrocaloric effect] blended with the ferroelectric poly(vinylidene fluoride–trifluoroethylene) copolymer, P(VDF–TrFE). Although the differential scanning calorimetry (DSC) clearly reveals that both components form separate crystalline phases, at low copolymer content blends entirely exhibit a relaxorlike linear dielectric response, since the interfacial couplings to the bulky defects in the terpolymer convert the normal ferroelectric copolymer into a relaxor. On the other hand, dielectric experiments evidence that in blends with 20–50 wt% of P(VDF–TrFE) the ferroelectric and relaxor states coexist. This coexistence is confirmed by DSC results, which further reveal the influence of blending on the terpolymer crystallinity and melting point. At last, the crystallinity data appropriately explain the variation of the dielectric constant in P(VDF–TrFE–CFE)/P(VDF–TrFE) blends.

  6. Effect of medium components on the production of a biosurfactant from Candida tropicalis applied to the removal of hydrophobic contaminants in soil.

    Science.gov (United States)

    Batista, Ranielly M; Rufino, Raquel D; Luna, Juliana M; de Souza, José Edson G; Sarubbo, Leonie A

    2010-05-01

    The influence of medium constituents on the production of biosurfactants by Candida tropicalis cultivated in waste frying oil was investigated according to a fractional factorial 2(5-1) design. The combined effect of the C/N(inorganic), C/Fe, C/Mg, and C/P ratios and yeast extract on surface tension reduction, biosurfactant yield, emulsification activity, and biomass were studied. The highest biosurfactant yield was reached when low C/Mg and low C/P ratio variables were combined, while the cell growth was favored by increasing the nitrogen concentration. The highest surface tension net decrease, on the other hand, was observed at low yeast extract concentration, low C/Fe, and high C/P ratios. Emulsification indices against lubrication and automobile waste oil of approximately 65 to 95% were observed. The crude biosurfactant produced in the medium--formulated with 2% waste frying oil, 0.067% NH4Cl, 0.025% MgSO4.7H2O, 0.067% KH2PO4, and 0.0026% FeCl3.6H2O--removed approximately 78 to 97% of the petroleum and motor oil adsorbed in sand samples.

  7. Promotion of TNF-α on malignant transformation of syrian hamster embryo cells irradiated with α-particles

    International Nuclear Information System (INIS)

    Zhu Maoxiang; Guo Renfeng; Yang Zhihua; GongYifen

    1999-01-01

    Objective: To illustrate the role of tumor necrosis factor-α (TNF-α) in radiation-induced cancer and regulatory mechanism of protein tyrosine phosphorylation. Methods: Taking Syrian hamster embryo cells exposed to 0.5 Gy α-particles as the target, an array of biological indicators such as cell growth curve, transformation frequency (TF), colony formation efficiency (CFE) and tumor formation in nude mice were observed, and the activities of protein tyrosine kinases and protein tyrosine phosphatases were measured. Results: Neither 0.5 Gy α-particle irradiation nor TNF-α alone could induce transformation of SHE cells morphologically, but the TF, CFE and levels of protein tyrosine phosphorylation were obviously increased in SHE cells treated with 600 U/ml TNF-α after exposure to 0.5 Gy α-particles, and malignant transformation was proved by tumorigenicity assays. Conclusion: TNF-α promotes significantly the transformation of SHE cells induced by α-particles, and protein tyrosine phosphorylation is probably involved in regulation of the process

  8. Supervisory system for real time monitoring of transient thermal stresses in turbines rotors; Sistema supervisorio para el monitoreo en tiempo real de esfuerzos termicos transitorios en rotores de turbinas

    Energy Technology Data Exchange (ETDEWEB)

    Urquiza Beltran, Gustavo; Rios Miranda, Edmundo; Venegas Guzman, Ricardo; Alvarez Garcia, Gabriela [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1992-12-31

    This article presents a supervisory system that, as its main functions, assists the operator on base of the thermal stresses, monitoring in real time the high pressure (HP) and intermediate pressure rotors (IP) of a steam turbine during the start, shut down and/or sudden load changes. The system is based on a thermal model uni-dimensional integrated to the SIMPER (Information System for the Predictive Maintenance of Rotating Equipment), tested in a 300 MW unit of Comision Federal de Electricidad (CFE). [Espanol] En este articulo se presenta un sistema supervisorio que, como funciones principales, asiste al operador con base en el monitoreo de esfuerzos termicos en tiempo real en los rotores de presion alta (PA) y presion intermedia (PI) de una turbina de vapor durante un arranque, paro y/o variaciones bruscas de carga. El sistema esta basado en un modelo termico unidimensional integrado al SIMPER (sistema informatico para el mantenimiento predictivo de equipo rotatorio), experimentado en una unidad de 300 MW de la Comision Federal de Electricidad (CFE).

  9. Analysis of the automation and control of the well production conditions in the Cerro Prieto geothermal field, Mexico; Analisis de la automatizacion y del control de las condiciones de produccion de los pozos del campo geotermico de Cerro Prieto, BC, Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Murillo Zamora, Isaac [Comision Federal de Electricidad, Mexicali, BC, (Mexico); Ocampo Diaz, Juan de Dios [Universidad Autonoma de Baja California, Mexicali, BC, (Mexico); De la Pena Reyna, Gilberto [Comision Federal de Electricidad, Morelia, Michoacan (Mexico)

    2005-12-01

    Through 31 years of development of the Cerro Prieto geothermal field, the number of wells in operation and the distances between them has been increasing. Now there are 150 wells producing a mixture of water and steam at different ratios, depending on the reservoir characteristics (pressure, temperature, depth, etc.) and the operation conditions in the superficial installations (obstructions in the orifice plates diameter, separator pressures, etc.). Therefore, Comision Federal de Electricidad (CFE) has started a pilot plan to handle the automation and control of the operating conditions of production wells, and to install a data production acquisition system. The initial results of the system are in this paper. [Spanish] A traves de los 31 anos de desarrollo del campo geotermico de Cerro Prieto el numero de pozos en operacion asi como la distancia entre ellos se ha estado incrementando. Ahora hay mas de 150 pozos produciendo una cantidad de mezcla de agua y vapor a diferentes rangos, dependiendo de las caracteristicas del yacimiento (presion, temperatura, profundidad, etc.) y de las condiciones de operacion de las instalaciones superficiales (diametros de placas de orificio obstruidos, presion de los separadores, etc.). Como resultado la Comision Federal de Electricidad (CFE) ha dado inicio a un plan de pruebas para llevar a cabo la automatizacion y control de las condiciones de operacion de los pozos productores, e instalar un sistema con equipos para recoleccion de datos del campo, cuyos primeros resultados se presentan en este articulo.

  10. Beach Point Test Site, Aberdeen Proving Ground, Edgewood Area, Maryland. Focused Feasibility Study, Final Project Work Plan

    Science.gov (United States)

    1993-10-01

    Evialuatihwoat VMIOIU EMueat and Sidi .adroMe" ftae Cooamrnderg Sedimentnby CW4rChm liftwu m5 at o wTO &* MIVdLW* aInv0 .Irc-gres uf Engownnuen Ul C UM& jini ...Diwa C nesgtsiSxeSdea D80413 $Pak. Od &%1wrVU AST1W r. OP 976 pp 4%,J,. (US) We"h IN. WI ADMet. P. R.. a&W GAO &di 0. J.. -PankdeSiu I,"l.r r.r I Ah~abY

  11. Department of Veterans Affairs, Journal of Rehabilitation Research and Development, Volume 30, Number 2, 1993

    Science.gov (United States)

    1992-01-01

    Centre, University of Oxford, Oxford, OX3 7LD UK; Department Of Clinical Biochemistry , John Radcliffe Hospital, Oxford, OX3 9DU UK; I.R.C. Biomedical...PhD, PEng, Dept. of Kinesiology , University of Waterloo, Waterloo, Ontario N2L 3GI, Canada FUNCTIONAL ASSESSMENT 35. The Control of Genu Recurvatum by... Kinesiology , University of Waterloo, Waterloo, ON, P, et al., J Trauma 33(5):728-736, 1992. N2L 3GI, Canada Contact: Pierre Maurette, MD, Dept. d’anesthesie

  12. Experimental Verification of Interference Mitigation Techniques for 5G Small Cells

    DEFF Research Database (Denmark)

    Assefa, Dereje; Berardinelli, Gilberto; Tavares, Fernando Menezes Leitão

    2015-01-01

    deployment with four cells, where each cell features one Access Point (AP) and one User Equipment (UE). In particular, we compare traditional Frequency Reuse Planning (FRP) with the recently proposed Maximum Rank Planning (MRP) technique, which relies on the degrees of freedom offered by the multi...... with the USRP N200 hardware by Ettus Research. The experimental results in a fully loaded network reveal the capability of the MRP technique to achieve higher throughput performance than FRP for 90% of the cases when IRC receivers are used. Lower network loads lead to further performance improvements for MRP....

  13. Naval Weapons Center Plume Radar Frequency Interference Code

    Science.gov (United States)

    1982-10-01

    ppm sodium. Both equilibrium and finite rate chemistry during the expansion from the chamber were tried as initial conditions for the plume. In...was too large. The difference between the.e two sets of initial conditions diminished downstream as the chemistry in the plume mixing region began to...Rerkirre Arvliral I Comirlnrnde!- ir.C h ic 1. tVS. Pacific Hice ((Code 3251 1 Corimu tinde r. ’n, r-d I leer. Pearl I atar I Coimniaide r. Sevent

  14. Managing inter-cell interference with advanced receivers and rank adaptation in 5G small cells

    DEFF Research Database (Denmark)

    Tavares, Fernando Menezes Leitão; Berardinelli, Gilberto; Catania, Davide

    2015-01-01

    -cell interference management. In this paper, we evaluate whether it is possible to rely on such advanced receivers as the main tool to deal with the inter-cell interference problem. We present a system-level performance evaluation in three different dense indoor small cell scenarios using a receiver model...... that includes both interference rejection combining (IRC) and successive interference cancellation (SIC) principles, as well as different rank adaptation strategies. Our results confirm that interference suppression receivers with a supportive system design can indeed represent a valid alternative to frequency...

  15. A SEARCH FOR HYDROXYLAMINE (NH{sub 2}OH) TOWARD SELECT ASTRONOMICAL SOURCES

    Energy Technology Data Exchange (ETDEWEB)

    Pulliam, Robin L.; Remijan, Anthony J. [National Radio Astronomy Observatory, Charlottesville, VA 22903 (United States); McGuire, Brett A. [Division of Chemistry and Chemical Engineering, California Institute of Technology Pasadena, CA 91125 (United States)

    2012-05-20

    Observations of 14 rotational transitions of hydroxylamine (NH{sub 2}OH) using the NRAO 12 m telescope on Kitt Peak are reported toward IRC+10216, Orion KL, Orion S, Sgr B2(N), Sgr B2(OH), W3IRS5, and W51M. Although recent models suggest the presence of NH{sub 2}OH in high abundance, these observations resulted in non-detection. Upper limits are calculated to be as much as six orders of magnitude lower than those predicted by models. Possible explanations for the lower-than-expected abundance are explored.

  16. A SEARCH FOR HYDROXYLAMINE (NH2OH) TOWARD SELECT ASTRONOMICAL SOURCES

    International Nuclear Information System (INIS)

    Pulliam, Robin L.; Remijan, Anthony J.; McGuire, Brett A.

    2012-01-01

    Observations of 14 rotational transitions of hydroxylamine (NH 2 OH) using the NRAO 12 m telescope on Kitt Peak are reported toward IRC+10216, Orion KL, Orion S, Sgr B2(N), Sgr B2(OH), W3IRS5, and W51M. Although recent models suggest the presence of NH 2 OH in high abundance, these observations resulted in non-detection. Upper limits are calculated to be as much as six orders of magnitude lower than those predicted by models. Possible explanations for the lower-than-expected abundance are explored.

  17. Structure of stellar hydroxyl masers

    International Nuclear Information System (INIS)

    Reid, M.J.; Muhleman, D.O.; Moran, J.M.; Johnston, K.J.; Schwartz, P.R.

    1977-01-01

    This paper presents the results of two spectral-line very long baseline (VLB) interferometric experiments on stellar OH masers. These masers are usually associated with long-period variable stars, and exhibit a characteristic double-peaked 1612 MHz OH spectrum. The sources IRC +10011, R Aql, and U Ori were carefully studied in order to determine the spatial structure of their masers. Maser components in these sources exhibited a complex structure which can be interpreted in terms of ''core-halo'' models. For these sources, the emission at any velocity appears to originate from a small (approximately-less-than0.''03) region of brightness approximately-greater-than10 9 K, and from a large (approximately-greater-than0.''5) region of brightness approximately-less-than10 8 K. In IRC+10011, ''core'' components in the two OH peaks probably are separated by less than the apparent size of the ''halos.'' A map of the low-velocity emission of U Ori with a resolution of 0.''01 indicates that the ''cores'' are distributed over a region of only 0.''2. This region is smaller than the apparent sizes of the ''halos.'' Other sources surveyed to determine apparent maser sizes include IRC+50137, OH 1821--12, OH 1837--05, OH 26.5+0.6, W43 A, and VX Sgr at 1612 MHz; and W Hya, R Aql, and IRC--10529 at 1667 MHz. The results of all VLB observations of 1612 MHz stellar OH masers are summarized.The apparent sizes of the strongest components (''halos'') of stellar OH masers typically are approximately-greater-than0.''5, corresponding to linear dimensions of approximately-greater-than3 x 10 15 cm. These surprisingly large sizes imply brightness temperatures much lower than those observed in most other types of astronomical masers. The large sizes rule out models of the 1612 MHz OH masers that require contracting or rotating circumstellar envelopes to explain the double-peaked OH spectra, or that try to explain the apparent maser sizes in terms of interstellar or interplanetary scattering

  18. AGARD Index of Publications 1974-1976

    Science.gov (United States)

    1977-09-01

    Now Mexico . When possible, subusquent flight test darmonstrations Author rsults were compared with thirrse obtained by other InvestigatorsIni other...lEngland). TOSR ik.0M oe .Tng n .S INn BLO ARAAYS THE A. IG HbOFrn Mn A INTDGCuTEmDeg fIRC LageITal TORIllk.DM.Je R aa adN INg nA R ALO AAAY T HE...with disease is diagnosed as tuberculosis , even more so since Camlorniuic able Disease Sell t975 5 p) rafs (For availability tuberrcuiinerion may

  19. Authority and Hierarchy within Anonymous Internet Relay Chat Networks

    Directory of Open Access Journals (Sweden)

    Stewart Kenton Bertram

    2015-09-01

    Full Text Available 'The protest group Anonymous has emerged as one of the most significant social movements of recent years, announcing their arrival as a globally recognized brand with regular disruptive cyber attacks and the leak of large volumes of sensitive data. Despite the obvious significance of Anonymous, to date, little academic research has been focused on what role hierarchy and internal authority play (if any within the group. Bespoke software was used to structure over 5000 examples of IRC log files, so that a base line descriptive statistical picture could be drawn, as well as a more granular enumeration of the privileges associated with individual users.'

  20. Radiative transfer in spherical circumstellar dust envelopes. III. Dust envelope models of some well known infrared stars

    International Nuclear Information System (INIS)

    Apruzese, J.P.

    1975-01-01

    The radiative transfer techniques described elsewhere by the author have been employed to construct dust envelope models of several well known infrared stars. The resulting calculations indicate that the infrared emissivity of circumstellar grains generally must be higher than that which many calculations of small nonsilicate grains yield. This conclusion is dependent to some degree on the (unknown) size of the stellar envelopes considered, but is quite firm in the case of the spatially resolved envelope of IRC+10216. Further observations of the spatial distribution of the infrared radiation from stellar envelopes will be invaluable in deciphering the properties of the circumstellar grains

  1. Wirkungsart der Medikamente auf die Veraenderungen des Kammerwasser Produktion und des Augeninnendruckes

    Directory of Open Access Journals (Sweden)

    E. SHARABIANLOU

    1971-07-01

    Full Text Available An ana lysis was made o r the eff ect o n the eyes o f severa l types of d rug. Ad ren ergic. parusymp.uholitic. an ti-adrenergic. psycho tro pic. diuret ic and cort ico id d rugs as wel1 as an ti-depressants. vusod ilata to rs and ca rd io-to nics were among the vario us prod ucts stud ied . The resul ts of Ihis ~l n al "'s is showed th.u before these PI'OdUCb :Irc used . a careful examinat ion o f the eves ions.

  2. Internet: la red de redes

    OpenAIRE

    Climent Serrano, Salvador

    1998-01-01

    Historia de I nternet en donde se realiza una descripción de la transmisión de los datos por TCP/IP y se explica el número IP. Se estudian los servicios de Internet como, Correo electrónico (e-mail), Transferencia de ficheros (ftp), World wide wed (la telaraña mundial), Navegadores, URL (Uniform Resource Locator), 4.5 Noticias (news), Chats (IRC), Webphone, Archie, Gopher, Wais, Comercio electrónico sus componentes.

  3. Internet, la xarxa de xarxes

    OpenAIRE

    Climent Serrano, Salvador

    1989-01-01

    Història d'Internet on es realitza una descripció de la transmissió de les dades per TCP / IP i s'explica el nombre IP. S'estudien els serveis d'Internet com, Correu electrònic (e-mail), Transferència de fitxers (ftp), World wide wed (la teranyina mundial), Navegadors, URL (Uniform Resource Locator), 4.5 Notícies (news), Xats (IRC ), Webphone, Archie, Gopher, Wais, Comerç electrònic els seus components.

  4. Kuuntele ja osallistu - Sosiaalinen media myynnin ja markkinoinnin tukena

    OpenAIRE

    Lönnblad, Hanna

    2010-01-01

    Sosiaalinen media on tullut jäädäkseen. Viimeisen kymmenen vuoden aikana IRC-Gallerian, Habbo Hotelin ja Facebookin kaltaiset palvelut ovat omineet itselleen kasvavan osan nykyihmisen ajankäytöstä niin töissä, kouluissa kuin vapaa-ajalla. Sosiaalisen median palveluita pidetään teinien leikkipaikkoina, mutta tosiasiassa uusi media tarjoaa rajattomasti potentiaalia myös yritystoiminnan kehittämiseen ja kasvattamiseen kaiken-kokoisille yrityksille. Virtuaalista maailmaa ei tule väheksyä. Opi...

  5. SAICE infrastructure report card for South Africa 2011

    CSIR Research Space (South Africa)

    Wall, K

    2011-01-01

    Full Text Available responsible for the plan- ning, construction, operation and maintenance of our nation?s life-support system?. Overall, it gave the nation?s infrastructure a D+ grade. The 2006 IRC received wide media coverage and resulted in increased dialogue and engage... of government, the private sector designers and constructors, suppliers of equipment and materials, and even suppliers of finance. Moreover, it is a learned society and operates as a non-profit organisation. The Institution views this as its responsibility...

  6. Guidelines for indirect radionuclide cystography; Empfehlungen zur Durchfuehrung der indirekten Radionuklidzystographie

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, I. [Great Ormond Street Hospital for Children, London (United Kingdom); Piepsz, A. [CHU St. Pierre, Brussels (Belgium); Colarinha, P. [Instituto Portugues de Oncologia, Lisbon (Portugal); Hahn, K.; Fischer, S. [LMU Muenchen (Germany). Klinik fuer Nuklearmedizin; Olivier, P. [CHU Brabois, Nancy (France); Sixt, R.; Velzen, J. van [The Queen Silvia Children' s Hospital, Goeteborg (Sweden)

    2000-11-01

    The guidelines are intended to help nuclear medical teams in their daily routine. The guidelines give information relating to indications, data acquisition, data analysis and interpretation. They express the opinions of the Paediatric Committee of EANM, and have been adjusted for compliance with standards and procedures adopted in Europe. (orig./CB) [German] Zweck dieser Leitlinie ist es, dem nuklearmedizinischen Team Hilfestellung fuer die taegliche Routinepraxis zu geben. Diese Leitlinie enthaelt Informationen ueber Indikationen, Datenakquisition, Auswertung und Interpretation der indirekten Radionuklidzystographie (IRC). Diese Leitlinie, die die Meinungen des Paediatric Committee der EANM zusammenfasst, wurde jedoch in Teilbereichen der Europaeischen Vorgehensweise angepasst. (orig.)

  7. Aspects epidemiologiques, cliniques et evolutifs de l'insuffisance ...

    African Journals Online (AJOL)

    Sur le plan biologique, l'anémie était présent chez 100% de nos patients. La classification de l'IRC montrait que 71,7% des cas étaient diagnostiqués au stade 5 de la maladie rénale chronique. La lésion causale la plus retrouvée était representée par les glomérulopathies chroniques acquises (52,8%). La survie globale à ...

  8. Proteinuria among adult sickle cell anemia patients in Nigeria

    African Journals Online (AJOL)

    et dépistage systématique de la protéinurie peut aider à déceler ceux à risque accru de maladie rénale. Prévalence de l'IRC est élevée chez les patients de la SCA avec protéinurie significative. Mots clés: Insuffisance rénale chronique, protéinurie, anémie falciforme. Introduction. The prevalence of the hemoglobin S gene ...

  9. The Circumstellar Environment of VY CMa

    Science.gov (United States)

    Smith, N.; Humphreys, R. M.; Krautter, J.; Gehrz, R. D.; Davidson, K.; Jones, T. J.; Hubrig, S.

    1999-05-01

    VY Canis Majoris is one of the most luminous known M supergiants. It is near the upper liminosity limit for cool stars on the HR Diagram. The optical star is partially obscured by its own circumstellar material. We present preliminary results of recent HST/WFPC2 optical imaging, and ground-based near-IR and mid-IR imaging of VY CMa and its circumstellar environment. We compare these results with previously obtained images of the related, but more evolved object IRC+10420 and discuss implications for their possible evolutionary and mass loss histories.

  10. Elided Populations: A Baseline Survey on Human Trafficking in Kenya

    DEFF Research Database (Denmark)

    Owiso, Michael

    2017-01-01

    -regional, as well as inter-regional trafficking, is available. This study seeks to build synergy in the counter-trafficking efforts in Kenya. In so doing it aims to in the overall identify gaps in combating and responding to human trafficking and offer programmatic recommendations/suggestions particularly for IRC......Trafficking in persons is a crime. It is gaining momentum in the continent and particularly in Kenya and also attracting the attention of actors who are working to combat it. This focus shows the multiplicity of actors working together to prosecute, prevent and protect. Evidence of both intra...

  11. Experimental Evaluation of Interference Suppression Receivers and Rank Adaptation in 5G Small Cells

    DEFF Research Database (Denmark)

    Assefa, Dereje; Berardinelli, Gilberto; Catania, Davide

    2015-01-01

    Advanced receivers are a key component of the 5th Generation (5G) ultra-dense small cells concept given their capability of efficiently dealing with the ever-increasing problem of inter-cell interference. In this paper, we evaluate the potential of interference suppression receivers in real network...... the Interference Rejection Combining (IRC) and Successive Interference Cancellation (SIC) receivers and different rank adaptation approaches. Each node in our software defined radio (SDR) testbed features a 22 MIMO transceiver built with the USRP N200 hardware by Ettus Research. Our experimental results confirm...

  12. Toward a Computational Theory of Early Visual Processing in Reading.

    Science.gov (United States)

    1980-09-01

    Austin. I’R- 15,S 1979. I Iais I arrs S. miid Rosen kid A triel I i Irc iical rla xat~o r wa c WiNCCVl parIsinlg. C UIp hrI I( 1iSiwn -.l SI.S. eds. I I in...1977), 201-231. I ley F. It. i’e I’.’chohe’I Pedagog , of’Reading. Macmillan. New York, 1908. hles; . "Spatial nonlilicarities in the instanlaneous

  13. Analizar las interacciones virtuales

    Directory of Open Access Journals (Sweden)

    Luis Gómez Encinas

    2003-11-01

    Full Text Available El propósito de este artículo es abordar una serie de cuestiones relacionadas con las interacciones virtuales. En concreto, nos centraremos en el IRC, los comúnmente llamados chats, para a partir de una crítica a ciertos posicionamientos analíticos, expresar la necesidad de indagar en esa faceta del ciberespacio desde el punto de vista de las relaciones sociales. Nuevas relaciones sociales, que acontecen en un espacio nuevo, y que por tanto se desarrollan bajo reglas y motivaciones que desbordan los viejos esquemas de observación.

  14. Changes in subcellular distribution of n-octanoyl or n-decanoyl ghrelin in ghrelin-producing cells

    Directory of Open Access Journals (Sweden)

    Yoshihiro eNishi

    2013-07-01

    Full Text Available Background: The enzyme ghrelin O-acyltransferase (GOAT catalyzes the acylation of ghrelin. The molecular form of GOAT, together with its reaction in vitro, has been reported previously. However, the sub-cellular processes governing the acylation of ghrelin remain to be elucidated.Methods: Double immunoelectron microscopy was used to examine changes in the relative proportions of secretory granules containing n-octanoyl ghrelin (C8-ghrelin or n-decanoyl ghrelin (C10-ghrelin in ghrelin-producing cells of mouse stomachs. The dynamics of C8-type (possessing C8-ghrelin exclusively, C10-type (possessing C10-ghrelin only and mixed-type secretory granules (possessing both C8- and C10-ghrelin were investigated after fasting for 48h or after two weeks’ feeding with chow containing glyceryl-tri-octanoate (C8-MCT or glyceryl-tri-decanoate (C10-MCT. The dynamics of C8- or C10-ghrelin immunoreactivity (ir-C8- or ir-C10-ghrelin within the mixed-type granules were also investigated.Results: Immunoelectron microscopic analysis revealed the co-existence of C8- and C10-ghrelin within the same secretory granules (mixed-type in ghrelin-producing cells. Compared to control mice fed standard chow, the ratio of C10-type secretory granules increased significantly after ingestion of C10-MCT, whereas that of C8-type granules declined significantly under the same treatment. After ingestion of C8-MCT, the proportion of C8-type secretory granules increased significantly. Within the mixed-type granules the ratio of ir-C10-ghrelin increased significantly and that of ir-C8-ghrelin decreased significantly upon fasting. Conclusions: These findings confirmed that C10-ghrelin, another acyl-form of active ghrelin, is stored within the same secretory granules as C8-ghrelin, and suggested that the types of medium-chain acyl-molecules surrounding and available to the ghrelin-GOAT system may affect the physiological processes of ghrelin acylation.

  15. Changes in Subcellular Distribution of n-Octanoyl or n-Decanoyl Ghrelin in Ghrelin-Producing Cells

    Science.gov (United States)

    Nishi, Yoshihiro; Mifune, Hiroharu; Yabuki, Akira; Tajiri, Yuji; Hirata, Rumiko; Tanaka, Eiichiro; Hosoda, Hiroshi; Kangawa, Kenji; Kojima, Masayasu

    2013-01-01

    Background: The enzyme ghrelin O-acyltransferase (GOAT) catalyzes the acylation of ghrelin. The molecular form of GOAT, together with its reaction in vitro, has been reported previously. However, the subcellular processes governing the acylation of ghrelin remain to be elucidated. Methods: Double immunoelectron microscopy was used to examine changes in the relative proportions of secretory granules containing n-octanoyl ghrelin (C8-ghrelin) or n-decanoyl ghrelin (C10-ghrelin) in ghrelin-producing cells of mouse stomachs. The dynamics of C8-type (possessing C8-ghrelin exclusively), C10-type (possessing C10-ghrelin only), and mixed-type secretory granules (possessing both C8- and C10-ghrelin) were investigated after fasting for 48 h or after 2 weeks feeding with chow containing glyceryl-tri-octanoate (C8-MCT) or glyceryl-tri-decanoate (C10-MCT). The dynamics of C8- or C10-ghrelin-immunoreactivity (ir-C8- or ir-C10-ghrelin) within the mixed-type granules were also investigated. Results: Immunoelectron microscopic analysis revealed the co-existence of C8- and C10-ghrelin within the same secretory granules (mixed-type) in ghrelin-producing cells. Compared to control mice fed standard chow, the ratio of C10-type secretory granules increased significantly after ingestion of C10-MCT, whereas that of C8-type granules declined significantly under the same treatment. After ingestion of C8-MCT, the proportion of C8-type secretory granules increased significantly. Within the mixed-type granules the ratio of ir-C10-ghrelin increased significantly and that of ir-C8-ghrelin decreased significantly upon fasting. Conclusion: These findings confirmed that C10-ghrelin, another acyl-form of active ghrelin, is stored within the same secretory granules as C8-ghrelin, and suggested that the types of medium-chain acyl-molecules surrounding and available to the ghrelin-GOAT system may affect the physiological processes of ghrelin acylation. PMID:23847595

  16. Development of Technological Profiles for Transfer of Energy- and Resource Saving Technologies

    Directory of Open Access Journals (Sweden)

    Lysenko, V.S.

    2015-01-01

    Full Text Available The article deals with the methodological foundations for the development of technological profiles for «System of Transfer of Energy- and Resource Saving Technologies». It is determined that a compliance with the methodology and standards of the European network «Relay Centers» (Innovation Relay Centers — IRC network, since 2008 — EEN, the Russian Technology Transfer Network RTTN and Uk rainian Technology Transfer Network UTTN is the main pri nciple of the development process of technological requests and offers.

  17. Biotechnology; Managing the Risks of Field Testing Genetically Engineered Organisms

    Science.gov (United States)

    1988-06-01

    iSte (t’ I risk Sou Irce rat her thaliaii sIlliply jirol Iibit ing it. Risk-I alanc ing Appuoach lHisk-ha lancing is II ie lii(1 cmi iilly used risk...inely reqIlilt ’S OF it S t(V’tlI&’t 0r 1- tiC 10~-ri NA or-gi- nlisils. As a r-esiult, inl Felwllairy 1 987. viH ix ec nmwnded t hat ap pend ix K< lie

  18. A Feasibility Study of Incorporating ARPANET Type Technology at United States Naval Installations

    Science.gov (United States)

    1980-03-01

    viH ’iiscuss sofi"^ other fe=itures...i»qencv ^’etl~o^k - A-noric^n 3t’^n’-i?rr< Co"ie o’^ In’^cnrration Tn tercHange - -^/ ist -io"’. [rainino Sur-’oort ’^yste’i^ - ^irc^rno ;. er^nc^s...inn on its confiquration, 5. ^ oro’Tp-i not vet runnino on the AhPAMET ist ? P n I ! F p Y 5 3 P i T i 4 ° ’"^ ? t E Correct *^0S1 1 is a steo uo

  19. XML in an Adaptive Framework for Instrument Control

    Science.gov (United States)

    Ames, Troy J.

    2004-01-01

    NASA Goddard Space Flight Center is developing an extensible framework for instrument command and control, known as Instrument Remote Control (IRC), that combines the platform independent processing capabilities of Java with the power of the Extensible Markup Language (XML). A key aspect of the architecture is software that is driven by an instrument description, written using the Instrument Markup Language (IML). IML is an XML dialect used to describe interfaces to control and monitor the instrument, command sets and command formats, data streams, communication mechanisms, and data processing algorithms.

  20. Bis[3,5-difluoro-2-(4-methylpyridin-2-ylphenyl-κ2C1,N](picolinato-κ2N,Oiridium(III chloroform monosolvate

    Directory of Open Access Journals (Sweden)

    Young-Inn Kim

    2011-09-01

    Full Text Available In the title complex, [Ir(C12H8F2N2(C6H4NO2]·CHCl3, two similar molecules of each component comprise the asymmetric unit. The independent complex molecules are linked by intermolecular π–π interactions [centroid–centroid distance = 3.830 (4 Å]. The IrIII ion adopts a distorted octahedral geometry, being coordinated by three N atoms, two C atoms, and one O atom of three bidentate ligands, with the N atoms arranged meridionally.

  1. Bis[2-(1,3-benzothiazol-2-ylphenyl-κ2C1,N][1,3-bis(4-bromophenylpropane-1,3-dionato-κ2O,O′]iridium(III

    Directory of Open Access Journals (Sweden)

    Sung Kwon Kang

    2013-08-01

    Full Text Available The title complex, [Ir(C15H9Br2O2(C13H8NS2], lies about a crystallographic twofold rotation axis passing through the IrIII atom and the central C atom of the bis(bromophenylpropane-1,3-dionate ligand. The IrIII atom adopts a distorted octahedral geometry coordinated by two N atoms in the axial positions, and two C and two O atoms in the equatorial plane. The dihedral angle between the two thiazole ring systems in the complex is 77.45 (10°.

  2. trans-(2-Benzoylpyridine-κ2N,Odichlorido[2-(2-pyridylcarbonylphenyl-κ2C1,N]iridium(III dichloromethane solvate

    Directory of Open Access Journals (Sweden)

    2009-03-01

    Full Text Available The title compound, [Ir(C12H8NOCl2(C12H9NO]·CH2Cl2, which was obtained from the reaction of iridium(III chloride trihydrate and 2-benzoylpyridine, contains an IrIII atom coordinated by two N, one O, one C and two Cl atoms in trans positions, forming a distorted octahedral environment. The solvent molecule CH2Cl2 is disordered over two positions with an occupancy of 0.8:0.2.

  3. Crystal structure of fac-[2-(4-methyl-5-phenylpyridin-2-ylphenyl-κ2C1,N]bis[2-(pyridin-2-ylphenyl-κ2C1,N]iridium(III

    Directory of Open Access Journals (Sweden)

    Chi-Heon Lee

    2016-12-01

    Full Text Available In the title compound, [Ir(C11H8N2(C18H14N], the IrIII ion adopts a distorted octahedral coordination environment defined by three C,N-chelating ligands, one stemming from a 2-(4-phenyl-5-methylpyridin-2-ylphenyl ligand and two from 2-(pyridin-2-ylphenyl ligands, arranged in a facial manner. The IrIII ion lies almost in the equatorial plane [deviation = 0.0069 (15 Å]. In the crystal, intermolecular π–π stacking interactions, as well as intermolecular C—H...π interactions, are present, leading to a three-dimensional network.

  4. (Acetylacetonato-κ2O,O′bis[5-methoxy-2-(naphth[1,2-d][1,3]oxazol-2-ylphenyl-κ2C1,N]iridium(III

    Directory of Open Access Journals (Sweden)

    Yuan-Yuan Zhou

    2011-10-01

    Full Text Available In the title compound, [Ir(C18H12NO22(C5H7O2], the Ir atom is O,O′-chelated by the acetylacetonate group and C,N-chelated by the 2-arylnaphth[1,2-d]oxazole groups. The six-coordinate metal atom displays a distorted octahedral geometry. Intramolecular C—H...O hydrogen bonds occur. In the crystal, intermolecular C—H...O hydrogen bonds link the molecules into columns parallel to the b axis.

  5. (Pyridine-2-aldoximato-κ2N,N′bis[2-(pyridin-2-ylphenyl-κ2C1,N]iridium(III

    Directory of Open Access Journals (Sweden)

    Bimal Chandra Singh

    2013-03-01

    Full Text Available In the title complex, [Ir(C11H8N2(C6H5N2O], the octahedrally coordinated IrIII atom is bonded to two 2-(pyridin-2-ylphenyl ligands, through two phenyl C and two pydidine N atoms, and to one pyridine-2-aldoxime ligand through a pyridine N and an oxime N atom. The oxime O atom of the aldoxime unit forms intermolecular C—H...O hydrogen bonds, which result in a two-dimensional hydrogen-bonded polymeric network parallel to (100. C—H...π interactions are also observed.

  6. A Review of Water Mist Technology for Fire Suppression

    Science.gov (United States)

    1994-09-30

    TATEM Navy Technology Center for Safeny and Survivability Chemistry Division C. L. BEYLER P. J. DINENNO E. K. BUDNICK G. G. BACK S.E. YOUNIS Hughes ...Institute, Boris, Sweden, 91 R30189A, April 30, 1992. 32. Jackman , L.A., "Mathematical Model of the Interact’i- of Sprinkler Spray Drops with Fire Gases...of Phase II Energy Fields for Fire Extinguishment," prepared for the U.S. Air Force, Hughes Associates, Irc., Columbia, MD, January 1993. 53. Evans

  7. Planning for interprofessional change in primary health care: exploring the use of the Interprofessional Resource Centre

    Directory of Open Access Journals (Sweden)

    Patterson C

    2013-05-01

    Full Text Available Christine Patterson,1 Heather Arthur,1,2 Gladys Peachey,1 Julie Vohra,1 David Price,3 Dave Pearson,4 Rob Mariani51School of Nursing, Faculty of Health Sciences, McMaster University, Hamilton, ON, Canada; 2Heart and Stroke Foundation of Ontario/Michael G DeGroote Endowed Chair in Cardiovascular Nursing Research, McMaster University, Hamilton, ON, Canada; 3Department of Family Medicine, McMaster University, Hamilton, ON, Canada; 4Central West Local Health Integration Network, Brampton, ON, Canada; 5Ascentum Consulting, Ottawa, ON, CanadaImportance: Resources to support change are needed for solo practitioners who are transitioning to family health teams (FHTs which involve multiple health disciplines working together to provide team-based care.Objective: The purpose of this project was: (1 to explore the use of an online resource, the Interprofessional Resource Centre (IRC, when planning for interprofessional change and; (2 to explore the experience of planning interprofessional change.Design and setting: Six FHTs organized under the structure of one Local Health Integrated Network (LHIN in Ontario, Canada.Intervention: Participants in six FHTs were directed to the IRC to support planning interprofessional change. In addition, two of the six FHTs participated in pilot site meetings with investigators where they received in-person support to apply the information from the IRC to an interprofessional activity.Results: Pilot site participants reported the IRC was useful for planning, but they cited lack of time to use it as a key barrier. When planning for interprofessional change, providers experienced challenges with physician buy-in and team dynamics. As a strategy for change, providers would like to learn from other FHTs who have experienced success with interprofessional change; at the LHIN level, they saw a need for more educational opportunities. Participation was found to be low among those only receiving online support.Conclusion and

  8. Pigment epithelial detachment followed by retinal cystoid degeneration leads to vision loss in treatment of neovascular age-related macular degeneration.

    Science.gov (United States)

    Schmidt-Erfurth, Ursula; Waldstein, Sebastian M; Deak, Gabor-Gyoergy; Kundi, Michael; Simader, Christian

    2015-04-01

    Intravitreal antiangiogenic therapy is the major therapeutic breakthrough in neovascular age-related macular degeneration (AMD). Optical coherence tomography (OCT) is the leading diagnostic tool, but solid criteria for optimal therapeutic outcomes are lacking. A comprehensive analysis of structure/function correlations using Food and Drug Administration- and European Medicines Agency-approved substances and fixed and flexible regimens was performed. Post hoc analysis of a prospective, randomized multicenter clinical trial including 189 study sites. A total of 1240 patients with active neovascular AMD. Participants received intravitreal ranibizumab or aflibercept. A fixed regimen was used for 48 weeks followed by a flexible regimen until week 96. At monthly intervals, best-corrected visual acuity (BCVA) was measured and retinal morphology was assessed by standardized OCT, including intraretinal cysts (IRCs), subretinal fluid (SRF), and pigment epithelial detachment (PED), presenting with a width ≥400 μm or a height of ≥200 μm. Results were correlated for each regimen, feature, and time. The BCVA outcomes in relation to retinal pathomorphology based on noninferiority for all treatment arms. In neovascular AMD, only IRC at baseline and persistent through week 12 had a negative impact on BCVA. With therapeutic intervention, exudative features such as IRC and SRF resolved rapidly in 74% of eyes, whereas PED responded only slowly with 38%. Independent of the type of regimen, fixed or flexible, retinal morphology correlated tightly with visual function. Intraretinal cysts consistently showed the lowest BCVA gains with either regimen or substance. With the switch from a fixed to a flexible pro re nata (PRN) regimen, progressive visual loss occurred exclusively in the group with primary PED presenting as the hallmark of neovascular activity and was induced by secondary formation of IRC in the neurosensory retina. The efficacy of antiangiogenic therapy in neovascular

  9. Direct Imaging Confirmation and Characterization of a Dust-Enshrouded Candidate Exoplanet Orbiting Fomalhaut

    OpenAIRE

    Currie, Thayne; Debes, John; Rodigas, Timothy J.; Burrows, Adam; Itoh, Yoichi; Fukagawa, Misato; Kenyon, Scott; Kuchner, Marc; Matsumura, Soko

    2012-01-01

    We present Subaru/IRCS J band data for Fomalhaut and a (re)reduction of archival 2004--2006 HST/ACS data first presented by Kalas et al. (2008). We confirm the existence of a candidate exoplanet, Fomalhaut b, in both the 2004 and 2006 F606W data sets at a high signal-to-noise. Additionally, we confirm the detection at F814W and present a new detection in F435W. Fomalhaut b's space motion may be consistent with it being in an apsidally-aligned, non debris ring-crossing orbit, although new astr...

  10. Deep Thermal Infrared Imaging of HR 8799 bcde: New Atmospheric Constraints and Limits on a Fifth Planet

    OpenAIRE

    Currie, Thayne; Burrows, Adam; Girard, Julien H.; Cloutier, Ryan; Fukagawa, Misato; Sorahana, Satoko; Kuchner, Marc; Kenyon, Scott J.; Madhusudhan, Nikku; Itoh, Yoichi; Jayawardhana, Ray; Matsumura, Soko; Pyo, Tae-Soo

    2014-01-01

    We present new $L^\\prime$ (3.8 $\\mu m$) and Br-$\\alpha$ (4.05 $\\mu m$) data and reprocessed archival $L^\\prime$ data for the young, planet-hosting star HR 8799 obtained with Keck/NIRC2, VLT/NaCo and Subaru/IRCS. We detect all four HR 8799 planets in each dataset at a moderate to high signal-to-noise (SNR $\\gtrsim$ 6-15). We fail to identify a fifth planet, "HR 8799 f", at $r$ $

  11. Insuficiencia renal crónica.

    OpenAIRE

    Torres Zamudio, César

    2013-01-01

    La insuficiencia renal crónica (IRC) se define como el deterioro lento y progresivo de las funciones renales debido a la destrucción irreversible de las nefronas. El resultado es un descenso gradual de la velocidad de filtración glomerular, de la función tubular y de la capacidad de reabsorción, que da lugar a la pérdida del control hidroelectrolítico, a trastornos aci­dobásicos y a problemas sistémicos. Suele producirse una progresión gradual hacia la uremia. Evoluciona en periodos de tiempo...

  12. Hiperplasia de mastócitos na oxalose óssea

    Directory of Open Access Journals (Sweden)

    Duarte M.E.L.

    1999-01-01

    Full Text Available OBJETIVOS: Avaliar através de técnicas de histomorfometria a incidência de hiperplasia de mastócitos na medula óssea de pacientes portadores de oxalose e insuficiência renal crônica. MATERIAL E MÉTODOS: Foram estudados 18 indivíduos divididos em 3 grupos: 6 (4 homens e 2 mulheres com média de idade de 26.31±2.5 anos portadores de oxalose óssea e insuficiência renal crônica (IRC ; 6 (5 mulheres e 1 homem com idade média de 22.1±3.56 anos portadores de IRC e 6 indivíduos saudáveis (5 homens e 1 mulher com idade média de 23±2.78 anos. A análise do tecido ósseo foi realizada em biópsias de crista ilíaca, incluídas em resina, sem descalcificação prévia e coradas pela técnica do Azul de Toluidina. A contagem dos mastócitos foi feita utilizando-se sistema analisador de imagem e os valores (média±DP foram expressos sob a forma de células por mm² de tecido. RESULTADOS: O número de mastócitos foi significativamente maior nos portadores de oxalose óssea, 32.67±9.59, ao se comparar com os pacientes portadores de IRC sem oxalose (20.84±5.04,p<0.05 e nos indivíduos do grupo controle (3.26±1.03,p<0.001 CONCLUSÕES: A oxalose óssea está associada com um aumento substancial do número de mastócitos na medula óssea. Esta alteração não está relacionada com a IRC per se e não parece representar uma resposta inespecífica à fibrose medular. O acúmulo anormal de mastócitos deve, de alguma forma, contribuir para o desenvolvimento da fibrose de medula óssea que acompanha esta condição.

  13. Development of a treatment process for the removal of heavy metals from raw water for drinking water supply using chelating ion exchange resins. Subproject 1. Final report; Entwicklung der Verfahrenstechnik zur Eliminierung von Schwermetallen aus Rohwaessern zur Trinkwassergewinnung mit chelatbildenden Kationenaustauscherharzen zur technischen Reife. Teilprojekt 1. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Overath, H.; Stetter, D.; Doerdelmann, O.

    2002-07-01

    Chelating cation exchange resins with iminodiacetic acid group (Lewatit TP 207 and Amberlite IRC 748) were tested for the removal of heavy metals in a drinking water treatment plant. The pilot scale filtration experiments were conducted by varying the operating conditions, such as flow rate and feed concentrations. Heavy metal concentrations (nickel, lead, cadmium, zinc) in the feed were adjusted between 20 and 200 {mu}g/L. Different methods for regeneration and conditioning of the resins were developed and investigated. Finally the ion exchange resins were tested according to German health regulations for ion exchangers in drinking water treatment. (orig.)

  14. The identification of IRAS 15194-5115 with a bright extreme carbon star

    International Nuclear Information System (INIS)

    Meadows, P.J.

    1987-01-01

    The authors identify IRAS 15194-5115 with a previously unknown extreme carbon star which is the third brightest carbon star in the sky at 12 μm (1148 Jy). Results of optical and infrared photometry and spectroscopy are presented. The 3.03 μm absorption feature associated with C 2 H 2 and HCN is seen as well as SiC emission at 11.2 μm. A comparison with recent model calculations of other workers indicates that this star is very similar to IRC+10216 and that it lies at a distance of about 1.7 kpc. (author)

  15. Development and application of a methodology for the classification of the operating conditions of power transformers; Desarrollo y aplicacion de una metodologia para la clasificacion del estado operativo de transformadores de potencia

    Energy Technology Data Exchange (ETDEWEB)

    Lara Covarrubias, Hector

    2004-05-15

    This thesis work shows the development of a classification model that allows the user to assess the operative condition of power transformers. The proposed model includes the following steps: Relative weights assignation for each IEEE-62-1995 required test. Those relative weights are obtained from test results and standardized and experience based limits obtained by Comision Federal de Electricidad (CFE). Once the relative weights have been assigned, three states, green, yellow and red were defined. Each state was then ranked with a weight number (1, 2 or 3). Specific weights were assigned for each test included in the model. Test score assignation takes into account the product of the relative value and the specific weight of each test. Transformer risk assessment uses the total score obtained from the sum of the tests partial scores. Transformer risk assessment was then classified in three categories. Total score causes the system to issue maintenance or substitution recommendations. The described model will improve maintenance scheduling according the transformer risk assessment and it is fully applicable to the complete CFE power transformer population. Further, smart investment and substitution plans, can be easily obtained from the model, preventing catastrophic failures that may cause logistic and economical problems to the Mexican Power System operation. As an example, the results obtained from the model application to two transformer banks installed in a CFE hydroelectric power plant were discussed and analyzed. [Spanish] El trabajo que se muestra en esta tesis, es el desarrollo de un modelo para la clasificacion del estado operativo de los transformadores de potencia. El modelo propuesto incluye los siguientes pasos: Asignacion de pesos relativos para cada una de las pruebas establecidas en la norma IEEE-62-1995 en funcion de sus resultados, limites establecidos en la normatividad y limites propuestos con base en la experiencia de la Comision Federal de

  16. PVDF-based copolymers, terpolymers and their multi-component material systems for capacitor applications

    Science.gov (United States)

    Chu, Baojin

    Miniature of power electronics, scaling-down of microelectronics and other electrical and electronic systems, and development of many technologies (such as hybrid vehicles or implantable heart defibrillators) require capacitors with high energy density to improve the weight and volume efficiency of the whole system. Various capacitor technologies are investigated to meet the requirements of developing future technologies. Among these technologies, polymer film capacitor technology is one of the most promising. Besides high energy density, polymer-based capacitors possess the merits of high power density, low loss, high reliability (self-healing), easy processing, and feasibility (in size, shape and energy level). Due to the ferroelectricity of polyvinylidene fluoride (PVDF)-based polymers, they exhibit much higher polarization response under an electric field, in comparison with other linear dielectric polymers for capacitor applications. The maximum polarization level of PVDF-based polymers can be as high as 0.1 C/m2 and the breakdown field can be higher than 600 MV/m. An estimated energy density of around 30 J/cm3 can be expected in this class of materials. However, this value is much higher than the energy density that can be achieved in the PVDF homopolymer and the poly(vinylidene fluoride-trifluoroethylene) (P(VDF-TrFE)) copolymers due to the polarization hysteresis in these polymers. Therefore, in this thesis, PVDF-based polymer materials were investigated and developed to approach this expected energy density by various strategies. An energy density of higher than 24 J/cm 3, which is close to the predicted value, was found in PVDF-based copolymers. Recently, the poly(vinylidene fluoride-trifluoroethylene-chlorofluoroethylene) (P(VDF-TrFE-CFE)) terpolymer was developed in Prof. Qiming Zhang's group. Previous works have shown that incorporation of CTE into P(VDF-TrFE) copolymers, in which bulky CFE acts as a defect, could convert the copolymer into relaxor

  17. Estenose carotídea e cirurgia de revascularização miocárdica Carotid stenosis and coronary artery bypass grafting

    Directory of Open Access Journals (Sweden)

    Marcelo Pereira da Rosa

    2011-06-01

    Full Text Available OBJETIVO: Identificar a prevalência de estenose carotídea (EC e os possíveis preditores de mortalidade em indivíduos submetidos à cirurgia de revascularização miocárdica (CRM eletiva. MÉTODOS: Estudo de coorte que incluiu 393 candidatos à CRM. Todos os pacientes realizaram ultrassonografia com Doppler em cores de artérias carótidas antes da CRM e foram seguidos durante a internação quanto à morbidade e mortalidade. A EC foi considerada clinicamente relevante quando > 50%. Um p 50% (p = 0,001 e insuficiência renal crônica (IRC (p = 0,03 foram preditores, independentes de mortalidade. CONCLUSÃO: EC mostrou ter uma prevalência elevada na amostra estudada e, conjuntamente com a IRC, foi preditor, independente de mortalidade.OBJECTIVE: To identify carotid stenosis (CS prevalence and potential mortality predictors in individuals undergoing elective coronary artery bypass grafting (CABG. METHODS: Cohort study including 393 scheduled for CABG. All patients underwent a color Doppler ultrasound study of the carotid arteries prior to CABG and were assessed for morbidity and mortality over the hospitalization. CS was considered clinically relevant when if > 50%. Significance was set at p 50% (p = 0.001 and chronic renal failure (CRF (p = 0.03 remained as mortality independent predictors. CONCLUSION: CS showed a high prevalence in the study sample and together with CRF was a mortality independent factor.

  18. Isothermal relaxation current and microstructure changes of thermally aged polyester films impregnated by epoxy resin

    Science.gov (United States)

    Jiang, Xiongwei; Sun, Potao; Peng, Qingjun; Sima, Wenxia

    2018-01-01

    In this study, to understand the effect of thermal aging on polymer films degradation, specimens of polyester films impregnated by epoxy resin with different thermal aging temperatures (80 and 130 °C) and aging times (500, 1600, 2400 and 3000 h) are prepared, then charge de-trapping properties of specimens are investigated via the isothermal relaxation current (IRC) measurement, the distributions of trap level and its corresponding density are obtained based on the modified IRC model. It is found that the deep trap density increases remarkably at the beginning of thermal aging (before 1600 h), but it decreases obviously as the aging degree increases. At elevated aging temperature and, in particular considering the presence of air gap between two-layer insulation, the peak densities of deep traps decrease more significant in the late period of aging. It can be concluded that it is the released energy from de-trapping process leads to the fast degradation of insulation. Moreover, after thermal aging, the microstructure changes of crystallinity and molecular structures are analyzed via the x-ray diffraction experiment and Fourier transform infrared spectrometer. The results indicate that the variation of the deep trap density is closely linked with the changes of microstructure, a larger interface of crystalline/amorphous phase, more defects and broken chains caused by thermal aging form higher deep trap density stored in the samples.

  19. Rebuilding immunity with Remune.

    Science.gov (United States)

    Whitfield, L

    1998-01-01

    Remune, an immune response therapy composed of inactivated HIV, is designed to enhance the immune system's ability to recognize and kill HIV proteins. Developed by Dr. Jonas Salk, researchers hope Remune's actions can alter the course of HIV infection and slow disease progression. Remune has gained Food and Drug Administration (FDA) approval to enter the critical Phase III trial stage. Two clinical trials are tracking Remune's immunogenicity (ability to provoke an immune response), its immunogenicity relative to dose level, and its effect on viral load. An ongoing trial, approved in February of 1996, enrolled 2,500 patients at 74 sites. The manufacturer, Immune Response Corporation (IRC), announced earlier this year that treatment with Remune induces an immune response to HIV that cross-reacts with different strains of the virus. This immune response is crucial for developing an effective worldwide treatment. Remune decreases levels of tumor necrosis factor alpha (TNF-a). IRC recently began a Phase I clinical trial in Great Britain that combines Remune with a protease inhibitor, two antiviral nucleoside analogues, and Interleukin-2. The trial is designed to determine the role that the drug may play in restoring immune response.

  20. ALCANCES Y LIMITACIONES DE LOS ÍNDICES ESPECTRALES DE LA VEGETACIÓN: MARCO TEÓRICO

    Directory of Open Access Journals (Sweden)

    Fernando Paz Pellat

    2014-07-01

    Full Text Available Los índices de vegetación (IV se han propuesto como una forma indirecta de medir variables biofísicas de la vegetación con base en datos espectrales obtenidos con sensores remotos. En el presente trabajo se analizaron los IV desde una aproximación teórica al considerar las interacciones de primer y segundo orden, al igual que el problema de transferencia radiativa en medios homogéneos y heterogéneos de la vegetación. Los patrones de las curvas de igual vegetación (índice de área foliar o IAF son usados como referencia en la revisión de los IV. Las curvas iso-IAF se parametrizaron en el espacio espectral del rojo (R e infrarrojo cercano (IRC y se analizó el uso de otros espacios espectrales. Los patrones de las curvas iso-IAF fueron invariantes bajo efectos atmosféricos, así como de espacios espectrales diferentes del R e IRC. Se consideró los efectos de la geometría sol-sensor para su estandarización, de tal manera que los patrones espectrales desarrollados permanecen invariantes. El marco teórico desarrollado, patrones de las curvas iso-IAF, permite analizar en forma generalizada a los IV de cualquier tipo.

  1. Separation of lithium isotopes on ion exchangers; Separation des isotopes du lithium sur echangeurs d'ions

    Energy Technology Data Exchange (ETDEWEB)

    Menes, F; Saito, E; Roth, E [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1958-07-01

    A survey of the literature shows that little information has been published on the separation of lithium isotopes with ion exchange resins. We have undertaken a series of elutions using the ion-exchange resins 'Dowex 50 x 12' and IRC 50, and various eluting solutions. Formulae derived from the treatment of Mayer and Tompkins permit the calculation of the separation factor per theoretical plate. For the solutions tried out in our experiments the separation factors lie in the interval 1.001 to 1.002. These values are quite low in comparison to the factor 1.022 found by Taylor and Urey for ion exchange with zeolites. (author) [French] Nous avons trouve relativement peu de donnees dans la litterature scientifique sur la separation des isotopes de lithium par les resines echangeuses d'ions. Nous avons effectue un certain nombre d'essais sur Dowex 50 X 12 et IRC 50 utilisant divers eluants. Des formules derivees de celles de Mayer et Tompkins permettent le calcul du coefficient de separation par plateau theorique. Pour les eluants etudies, ces facteurs de separation se trouvent entre 1,001 et 1,002. Ces valeurs sont faibles en comparaison du facteur 1,022 trouve par Taylor et Urey pour les zeolithes. (auteur)

  2. AntBot: Anti-pollution peer-to-peer botnets

    Energy Technology Data Exchange (ETDEWEB)

    Yan, Guanhua [Los Alamos National Laboratory; Eidenbenz, Stephan [Los Alamos National Laboratory; Ha, Duc T [UNIV. AT BUFFALO

    2009-01-01

    Botnets, which are responsible for many email sparnming and DDoS (Distributed Denial of Service) attacks in the current Internet, have emerged as one of most severe cyber-threats in recent years. To evade detection and improve resistance against countermeasures, botnets have evolved from the first generation that relies on IRC chat channels to deliver commands to the current generation that uses highly resilient P2P (Peer-to-Peer) protocols to spread their C&C (Command and Control) information. It is, however, revealed that P2P botnets, although relieved from the single point of failure that IRC botnets suffer, can be easily disrupted using pollution-based mitigation schemes [15]. In this paper, we play the devil's advocate and propose a new type of hypothetical botnets called AntBot, which aim to propagate their C&C information to individual bots even though there exists an adversary that persistently pollutes keys used by seized bots to search the command information. The key idea of AntBot is a tree-like structure that bots use to deliver the command so that captured bots reveal only limited information. To evaluate effectiveness of AntBot against pollution-based mitigation in a virtual environment, we develop a distributed P2P botnet simulator. Using extensive experiments, we demonstrate that AntBot operates resiliently against pollution-based mitigation. We further present a few potential defense schemes that could effectively disrupt AntBot operations.

  3. A randomized trial of teen online problem solving: efficacy in improving caregiver outcomes after brain injury.

    Science.gov (United States)

    Wade, Shari L; Walz, Nicolay C; Carey, JoAnne; McMullen, Kendra M; Cass, Jennifer; Mark, Erin; Yeates, Keith Owen

    2012-11-01

    To examine the results of a randomized clinical trial (RCT) of Teen Online Problem Solving (TOPS), an online problem solving therapy model, in increasing problem-solving skills and decreasing depressive symptoms and global distress for caregivers of adolescents with traumatic brain injury (TBI). Families of adolescents aged 11-18 who sustained a moderate to severe TBI between 3 and 19 months earlier were recruited from hospital trauma registries. Participants were assigned to receive a web-based, problem-solving intervention (TOPS, n = 20), or access to online resources pertaining to TBI (Internet Resource Comparison; IRC; n = 21). Parent report of problem solving skills, depressive symptoms, global distress, utilization, and satisfaction were assessed pre- and posttreatment. Groups were compared on follow-up scores after controlling for pretreatment levels. Family income was examined as a potential moderator of treatment efficacy. Improvement in problem solving was examined as a mediator of reductions in depression and distress. Forty-one participants provided consent and completed baseline assessments, with follow-up assessments completed on 35 participants (16 TOPS and 19 IRC). Parents in both groups reported a high level of satisfaction with both interventions. Improvements in problem solving skills and depression were moderated by family income, with caregivers of lower income in TOPS reporting greater improvements. Increases in problem solving partially mediated reductions in global distress. Findings suggest that TOPS may be effective in improving problem solving skills and reducing depressive symptoms for certain subsets of caregivers in families of adolescents with TBI.

  4. Expansion of the Idaho National Engineering Laboratory Research Center: Environmental assessment

    International Nuclear Information System (INIS)

    1994-03-01

    The US Department of Energy (DOE) proposes to expand and upgrade facilities at the Idaho National Engineering Laboratory (INEL) Research Center (IRC) by constructing a research laboratory addition on the northeast corner of existing laboratory building; upgrading the fume hood system in the existing laboratory building; and constructing a hazardous waste handling facility and a chemical storage building. The DOE also proposes to expand the capabilities of biotechnology research programs by increasing use of radiolabeled compounds to levels in excess of current facility limits for three radionuclides (carbon-14, sulfur-35, and phosphorus-32). This Environmental assessment identifies the need for the new facilities, describes the proposed projects and environmental setting, and evaluates the potential environmental effects. Impacts associated with current operation are discussed and established as a baseline. Impacts associated with the proposed action and cumulative impacts are described against this background. Alternatives to the proposed action (No action; Locating proposed facilities at a different site) are discussed and a list of applicable regulations is provided. The no action alternative is continuation of existing operations at existing levels as described in Section 4 of this EA. Proposed facilities could be constructed at a different location, but these facilities would not be useful or practical since they are needed to provide a support function for IRC operations. Further, the potential environmental impacts would not be reduced if a different site was selected

  5. Ultrasound method applied to characterize healthy femoral diaphysis of Wistar rats in vivo

    International Nuclear Information System (INIS)

    Fontes-Pereira, A.; Matusin, D.P.; Rosa, P.; Schanaider, A.; Krüger, M.A. von; Pereira, W.C.A.

    2014-01-01

    A simple experimental protocol applying a quantitative ultrasound (QUS) pulse-echo technique was used to measure the acoustic parameters of healthy femoral diaphyses of Wistar rats in vivo. Five quantitative parameters [apparent integrated backscatter (AIB), frequency slope of apparent backscatter (FSAB), time slope of apparent backscatter (TSAB), integrated reflection coefficient (IRC), and frequency slope of integrated reflection (FSIR)] were calculated using the echoes from cortical and trabecular bone in the femurs of 14 Wistar rats. Signal acquisition was performed three times in each rat, with the ultrasound signal acquired along the femur's central region from three positions 1 mm apart from each other. The parameters estimated for the three positions were averaged to represent the femur diaphysis. The results showed that AIB, FSAB, TSAB, and IRC values were statistically similar, but the FSIR values from Experiments 1 and 3 were different. Furthermore, Pearson's correlation coefficient showed, in general, strong correlations among the parameters. The proposed protocol and calculated parameters demonstrated the potential to characterize the femur diaphysis of rats in vivo. The results are relevant because rats have a bone structure very similar to humans, and thus are an important step toward preclinical trials and subsequent application of QUS in humans

  6. Laboratory Studies Of Astrophysically-interesting Phosphorus-bearing Molecules

    Science.gov (United States)

    Ziurys, Lucy M.; Halfen, D. T.; Sun, M.; Clouthier, D. J.

    2009-05-01

    Over the past year, there has been a renewed interest in the presence of phosphorus-containing molecules in the interstellar medium. Recent observations have increased the number of known interstellar phosphorus-bearing species from two (PN, CP) to six with the identification of HCP, CCP, and PH3 in the carbon-rich circumstellar shell of IRC+10216 and PO in the oxygen-rich envelope of VY Canis Majoris. More species of this type may be present in the ISM, but laboratory rest frequencies, necessary for such detections, are not generally known for many potential molecules. To fill in this gap, we have been conducting measurements of the pure rotational spectra of phosphorus-containing molecules of astrophysical interest, using both millimeter/submm direct absorption and Fourier transform microwave (FTMW) spectroscopy. We have developed a new phosphorus source for this purpose. These methods cover the frequency ranges 65-850 GHz and 4-40 GHz, respectively. Our recent study of the CCP radical (X2Πr) using both of these techniques has resulted in its identification in IRC+10216. Rotational spectra of other molecules such as PCN, HPS, and CH3PH2 have been recorded. We will report on these species and additional new laboratory developments

  7. Synthesis of a highly active carbon-supported Ir-V/C catalyst for the hydrogen oxidation reaction in PEMFC

    International Nuclear Information System (INIS)

    Li Bing; Qiao Jinli; Yang Daijun; Zheng Junsheng; Ma Jianxin; Zhang Jiujun; Wang Haijiang

    2009-01-01

    The active, carbon-supported Ir and Ir-V nanoclusters with well-controlled particle size, dispersity, and composition uniformity, have been synthesized via an ethylene glycol method using IrCl 3 and NH 4 VO 3 as the Ir and V precursors. The nanostructured catalysts were characterized by X-ray diffraction and high-resolution transmission electron microscopy. The catalytic activities of these carbon-supported nanoclusters were screened by applying on-line cyclic voltammetry and electrochemical impedance spectroscopy techniques, which were used to characterize the electrochemical properties of fuel cells using several anode Ir/C and Ir-V/C catalysts. It was found that Ir/C and Ir-V/C catalysts affect the performance of electrocatalysts significantly based on the discharge characteristics of the fuel cell. The catalyst Ir-V/C at 40 wt.% displayed the highest catalytic activity to hydrogen oxidation reaction and, therefore, high cell performance is achieved which results in a maximum power density of 563 mW cm -2 at 0.512 V and 70 deg. C in a real H 2 /air fuel cell. This performance is 20% higher as compared to the commercial available Pt/C catalyst. Fuel cell life test at a constant current density of 1000 mA cm -2 in a H 2 /O 2 condition shows good stability of anode Ir-V/C after 100 h of continuous operation.

  8. Adsorption and the initial stages of samarium condensation on iridium coated by graphite monolayer

    International Nuclear Information System (INIS)

    Abdullaev, R.M.; Tontegode, A.Ya.; Yusifov, F.K.

    1978-01-01

    Adsorption and the initial stages of vacuum samarium condensation on iridium coated by graphite monolayer (valent-saturated neutral substrate) were studied by the thermodesorption mass-spectrometry and thermoemission methods, and were compared with samarium adsorption and condensation on iridium. Desorption heat of samarium atoms with thin coating of Ir-C, equal to E approximately 1.9 eV has been determined. For desorption with Ir E is approximately 6 eV. Such a great difference in desorption heats is connected with the reduction of covalent constituent of adsorption bond in a neutral substrate. Samarium on Ir-C is found to be condensated in two states: loosely bound and tightly bound which sharply differ in properties. The tightly bound state is characterized by abnormally low vapour pressure. Possible nature of this state is discussed. Double effect on the condensation of the substrate valent saturation is noted. On the one hand, the reduction of the particle bond with the substrate decreases their concentration on the surface, preventing condensation. On the other hand, the release of the valent eloctrons of adatous brings about strong lateral interaction between them, which in its turn, promotes condensation during eased migration on the neutral substrate

  9. [Outcome of patients with chronic respiratory insufficiency treated at home with tracheotomy and assisted ventilation].

    Science.gov (United States)

    Dudeffant, P; Manier, G; Gbikpi-Benissan, G; Cardinaud, J P

    1985-01-01

    60 patients were studied with severe chronic respiratory failure (IRC) and a permanent tracheostomy treated with domiciliary ventilation (VADT). The study commenced from the time of the tracheostomy and included length of survival (by the actuarial method) quality of life, subjectively and objectively (progress of blood gases in a stable clinical state and cumulative length of periods in hospital). Factors influencing the decision for tracheostomy and VADT were examined. Restrictive cases benefitted from the technique as much from the improved quality of life as from the duration of survival (77% at 5 years). Patients with an obstructive or mixed pattern had a 5 years survival of 73% after the first episode of acute or chronic respiratory failure which was 73% better than comparable patients given neither a tracheostomy nor oxygen therapy. The five years survival of 42% on VADT in our series compares favourably with the main series published. In our opinion the improved survival in these patients (which tends to rejoin that of the general population) and the improved quality of life justifies the use of this treatment in severe obstructive IRC, despite a greater demand and cost of this treatment than those with a restrictive defect.

  10. ABC's of monitoring federal tax exemption.

    Science.gov (United States)

    Sanborn, A B; MacKelvie, C F

    1988-10-01

    Congress and the Internal Revenue Service (IRS) are taking a close look at the Internal Revenue Code (IRC) as it applies to Catholic institutions' activities. Although most Catholic institutions' exempt status is secured by reserved power organizational characteristics, it would behoove healthcare leaders to become familiar with the tax system and the IRS operation and, if necessary, make appropriate accommodations. They should understand what triggers an IRS audit and the audit process itself. The IRS subjects exempt institutions to organizational and operational tests. It deems that a healthcare entity is organized exclusively for an exempt (and charitable) purpose when that entity's articles of incorporation: 1. Limit the organization's purposes to charitable purposes. 2. Limit the organizations's activities to those which further its exempt purposes only, with other purposes furthered in only an insubstantial way. 3. Limit activities to those specified in IRC Section 501(c)(3). 4. Limit distribution of the organization's assets on dissolution to another organization with a like or similar exempt purpose. 5. Limit legislative and bar political activities Although most Catholic healthcare entities are "tax managed" conservatively, from an operational perspective, they often enter into transactions that the IRS considers "red flags." Some of these "red flag" transactions involve: Joint venture operations. Physician recruitment and physician handling plans. Rental/lease arrangements. Defined compensation plans. Hospital productivity plans. Profit-sharing plans. Contingent compensation arrangements. Acquisition, mergers, and divestitures. Taxable subsidiaries and unrelated business income.

  11. DEPRESSÃO E INSUFICIÊNCIA RENAL CRÔNICA: UMA ANÁLISE PSICOSSOCIOLÓGICA

    Directory of Open Access Journals (Sweden)

    Maria da Penha de Lima Coutinho

    2015-08-01

    Full Text Available Este estudo objetivou apreender as representações sociais (RS elaboradas por pacientes nefrológicos em tratamento da hemodiálise e por seus familiares acerca da depressão e da insuficiência renal crônica (IRC. A amostra foi não probabilística, com 52 participantes, dos quais 26 eram pacientes, submetidos a um questionário sociodemográfico, à Escala Hospitalar de Ansiedade e Depressão, (subescala de depressão e a uma entrevista semiestruturada. Os dados foram coletados em três hospitais e processados pelo SPSS 19.0 e pelo Alceste, sendo analisados por meio da estatística descritiva e análise lexical. Verificou-se que a RS da depressão foi ancorada nos elementos psico/cognitivo, físico/orgânico e psicossocial, objetivada principalmente na tristeza e no isolamento. A IRC foi representada com base nas adversidades psicossociais vivenciadas pelos grupos de pertença investigados. Observou-se que esta doença foi ancorada no suporte familiar e espiritual, nas restrições hídricas e alimentares, sendo associada ao desconhecimento da hemodiálise.

  12. Taxation of Insolvent Companies: Empirical Evidence in Portugal

    Directory of Open Access Journals (Sweden)

    Ana Cristina dos Santos Arromba Dinis

    2016-04-01

    Full Text Available This article discusses the issue of taxation of insolvent companies in Portugal, particularly regarding the Portuguese tax on revenue of legal entities (IRC. For this purpose, first, some considerations on the legal framework of insolvent companies are woven and, second, their tax regime is analyzed. Then, a brief review of the main studies that, in the international context, analyze and debate major issues derived from the tax regime of insolvent companies is conducted, particularly in Brazil, Spain, United States, and Italy. Finally, there are the results of an empirical study conducted in Portugal, in 2013, which evaluates and compares the opinions of insolvency administrators (IA, the tax and customs authority (TA, and court magistrates (CM, in order to contribute to a better solution concerning business taxation under this regime. Respondents (IA, TA, CM demonstrate objective thinking about the fact they believe it is very important that the Portuguese Code of Insolvency and Business Recovery (CIRE and the Portuguese Code of Tax on Revenue of Legal Entities (CIRC are modified, now to make clear whether the settlement of property ownership of an insolvent estate is liable to the IRC, then to assign a chapter specifically devoted to the subject of taxation on insolvency in Portugal.

  13. HIGH-VELOCITY MOLECULAR OUTFLOW IN CO J = 7-6 EMISSION FROM THE ORION HOT CORE

    International Nuclear Information System (INIS)

    Furuya, Ray S.; Shinnaga, Hiroko

    2009-01-01

    Using the Caltech Submillimeter Observatory 10.4 m telescope, we performed sensitive mapping observations of 12 CO J = 7-6 emission at 807 GHz toward Orion IRc2. The image has an angular resolution of 10'', which is the highest angular resolution data toward the Orion Hot Core published for this transition. In addition, thanks to the on-the-fly mapping technique, the fidelity of the new image is rather high, particularly in comparison with previous images. We have succeeded in mapping the northwest-southeast high-velocity molecular outflow, whose terminal velocity is shifted by ∼70-85 km s -1 with respect to the systemic velocity of the cloud. This yields an extremely short dynamical time scale of ∼900 years. The estimated outflow mass loss rate shows an extraordinarily high value, on the order of 10 -3 M sun yr -1 . Assuming that the outflow is driven by Orion IRc2, our result agrees with the picture so far obtained for a 20 M sun (proto)star in the process of formation.

  14. Depletion of intracellular polyamine content does not alter the survival of 9L rat brain tumour cells after X-irradiation

    International Nuclear Information System (INIS)

    Seidenfeld, J.; Deen, D.F.; Marton, L.J.

    1980-01-01

    A 24-hour preincubation of 9L rat brain tumour cells with 10 mM DL-α methylornithine (αMO) reduced 9L putrescine content by more than 97%, spermidine content by 67% and total polyamine content by 50%. This did not increase the sensitivity of 9L cells to killing by X-rays. Polyamine content of treated and untreated cells did not vary with X-ray dose. A similar experiment was performed with 9L cells incubated for 48 hours in the presence and absence of 25 mM DL-α-difluoromethylornithine (DFMO). X-ray dose again did not affect polyamine contents of either DFMO treated or untreated cells. The reduction of total polyamine content by 75% produced by this treatment did not affect the X-ray dose-response curve of 9L cells. Incubation of 9L cells with 40 μM methylglyoxal bis (guanylhydrazone) (MGBG) for 48 hours also did not increase the sensitivity of the treated cells to killing by X-rays. Measurement of intracellular polyamine contents for MGBG-treated and untreated cell showed that Sd was reduced by 70% and Sp by 66%. The increase in Pu content resulted in equal total polyamine contents on a molar basis for both groups of cells. Cultures of 9L cells were incubated for 48 hours in the presence or absence of 40 μM MGBG + 25 mM DFMO, producing an 87% reduction in total polyamine content of treated cells. The Sd content of cells treated with DFMO alone was lower than that of cells treated with DFMO + MGBG, and the combination of the two inhibitors had no effect on the X-ray dose-response. 0.1 mM DFMO did not affect the CFE of untreated unirradiated 9L cells. Addition of 1 mM DFMO caused a greater reduction in the CFE of 9L cells when added at the same time as seeding the cells than when added 24 hours later. There was no difference between the effects of 10 and 25 mM DFMO on the CFE of 9L cells. (U.K.)

  15. A coerção e suas implicações na relação professor-aluno The coercion and its fallout in the relationship between teacher and student

    Directory of Open Access Journals (Sweden)

    Juliane Viecili

    2002-12-01

    Full Text Available Este artigo tem como objetivo examinar os comportamentos de aluno com história de fracasso escolar (CFE e alunos sem história de fracasso escolar (SFE e os comportamentos de coerção e estimulação positiva dos professores em relação a cada grupo de alunos. Dez crianças, com idade entre 8 e 12 anos, freqüentadoras do ensino fundamental de uma escola pública, participaram do estudo, juntamente com três professores. O procedimento de coleta de dados utilizado foi a observação direta dos comportamentos em sala de aula, com registro de categorias por intervalo de tempo com aluno como foco da observação. Os resultados indicam a utilização diferenciada de coerção com alunos CFE e de estimulação positiva com alunos SFE. Discute-se o uso diferenciado de contingências coercitivas e reforçadoras em relação aos alunos CFE e SFE e seus efeitos nos comportamentos acadêmicos e não-acadêmicos de ambos os grupos de alunos.This paper intends to examine the behavior of students with histories of school failure (WSF and students without histories of school failure (WTSF and the coercive and reinforcing behavior of teacher in relation with each group of students. Ten children, ranging 8 to 12 years old, attending a public elementary school, and tree teachers, were the participants of the study. The data was collected through the direct observation of behavior inside the classroom, with report of categories per time interval and the student was the observation focus. The results showed the use of differentiated coercion with WSF, and the positive stimulation with WTSF. The differentiated use of coercive and reinforcing contingencies with both WSF and WTSF students, and its effects in the academic and non-academic behaviors of both groups of students are discussed.

  16. Interface interaction in the B4C/(Fe-B-C) system

    International Nuclear Information System (INIS)

    Aizenshtein, M.; Mizrahi, I.; Froumin, N.; Hayun, S.; Dariel, M.P.; Frage, N.

    2008-01-01

    The wetting behavior in the B 4 C/(Fe-C-B) system was investigated in order to clarify the role of Fe additions on the sinterability of B 4 C. Iron and its alloys with C and B react with the boron carbide substrate and form a reaction zone consisting of a fine mixture of FeB and graphite. The apparent contact angles are relatively low for the alloys with a moderate concentration of the boron and carbon and allow liquid phase sintering to occur in the B 4 C-Fe mixtures. A dilatometric study of the sintering kinetics confirms that liquid phase sintering actually takes place and leads to improved mass transfer. A thermodynamic analysis of the ternary Fe-B-C system allows accounting for the experimental observations

  17. Determinations of the {sup 12}C/{sup 13}C Ratio for the Secondary Stars of AE Aquarii, SS Cygni, and RU Pegasi

    Energy Technology Data Exchange (ETDEWEB)

    Harrison, Thomas E.; Marra, Rachel E., E-mail: tharriso@nmsu.edu, E-mail: rmarra@nmsu.edu [Department of Astronomy, New Mexico State University, Box 30001, MSC 4500, Las Cruces, NM 88003-8001 (United States)

    2017-07-10

    We present new moderate-resolution near-infrared spectroscopy of three CVs obtained using GNIRS on Gemini-North. These spectra covered three {sup 13}CO bandheads found in the K -band, allowing us to derive the isotopic abundance ratios for carbon. We find small {sup 12}C/{sup 13}C ratios for all three donor stars. In addition, these three objects show carbon deficits, with AE Aqr being the most extreme ([C/Fe] = −1.4). This result confirms the conjecture that the donor stars in some long-period CVs have undergone considerable nuclear evolution prior to becoming semi-contact binaries. In addition to the results for carbon, we find that the abundance of sodium is enhanced in these three objects, and the secondary stars in both RU Peg and SS Cyg suffer magnesium deficits. Explaining such anomalies appears to require higher mass progenitors than commonly assumed for the donor stars of CVs.

  18. Photovoltaic systems interconnected to the electric network; Sistemas fotovoltaicos interconectados a la red electrica

    Energy Technology Data Exchange (ETDEWEB)

    Agredano Diaz, Jaime [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)

    2007-06-15

    This presentation is about the project carried out in the State of Baja California, Mexico, more specifically in the region called Mexicalli. In the first part, there are given the reasons and the effects developed in this region due to the climatologic changes occurred every summer. In effect, there are described both the cause and the economic impact representing for those families that live around there, the summer's arrival. Next, it is shown the solution found by the State government participating the Mexican Electric Research Institute (IIE). Such participation is translated on a project that shows the feasibility of installing photovoltaic systems on households. Such systems are interconnected to the Mexico's Federal Commission of Electricity's (CFE) electric network. Next, it is given a description of both its methodology and its performance. Then, it is firstly given the positive effect in both issues economic and environmental and secondly the general parameters of the installation of the system on the 220 households of the complex Valle de las Misiones. In addition, it is mentioned the method that would be used in order to get a bigger impact as well as better coverage of the system. Finally, there are presented the project's sponsors, among there can be found: the Mexican Energy Secretariat (SENER), the CFE, the Mexican Energy Regulatory Commission (CRE), the Universidad Autonoma de Baja California (UABC), the IIE, the North American Development Bank (NADB), and the Government of the State of Baja California. [Spanish] Esta ponencia es acerca del proyecto de sistemas fotovoltaicos desarrollado en el Estado de Baja California, mas especificamente en Mexicalli. En la primera parte, se presentan las causas y las consecuencias que ocasionan los cambios climatologicos desarrollados en esta region durante el verano; es decir, se describe la razon y el impacto economico que representa para las familias de esta region la llegada del verano

  19. High-Resolution Spectroscopy of the Hydrogen-Deficient Binary υ Sgr

    Directory of Open Access Journals (Sweden)

    Kipper Tõnu

    2012-09-01

    Full Text Available The high resolution spectra of hydrogen-deficient binary υ Sgr are analyzed. The atmospheric parameters are Teff = 12300±200 K, log g = 2:5±0:5 and ξt = 5 - 15 kms−1 depending on the element. For Fe II ξt = 9:3 ± 0:3 kms−1. Iron is slightly underabundant (-0.2 dex. Nitrogen is overabundant with [N/Fe]ͬ ≈ 1.0, carbon and oxygen are underabundant with [C/Fe] ≈ -1.6 and [O/Fe] ≈ -1.1. The s-process elements Y, Zr and Ba are overabundant about 0.5 dex. Quite large number of emission lines, both permitted and forbidden, originating from low excitation levels of neutral and ionized metals, are identified. Radial velocities of these emission lines indicate that an accretion disk in the system is present.

  20. A new model for thermodynamic analysis on wetting behavior of superhydrophobic surfaces

    International Nuclear Information System (INIS)

    Zhang Hongyun; Li Wen; Fang Guoping

    2012-01-01

    Superhydrophobic surfaces have shown inspiring applications in microfluidics, and self-cleaning coatings owing to water-repellent and low-friction properties. However, thermodynamic mechanism responsible for contact angle hysteresis (CAH) and free energy barrier (FEB) have not been understood completely yet. In this work, we propose an intuitional 3-dimension (3D) droplet model along with a reasonable thermodynamic approach to gain a thorough insight into the physical nature of CAH. Based on this model, the relationships between radius of three-phase contact line, change in surface free energy (CFE), average or local FEB and contact angle (CA) are established. Moreover, a thorough theoretical consideration is given to explain the experimental phenomena related to the superhydrophobic behavior. The present study can therefore provide some guidances for the practical fabrications of the superhydrophobic surfaces.