WorldWideScience

Sample records for ipomoea lacunosa convolvulaceae

  1. Comparative Metabolomic Analyses of Ipomoea lacunosa Biotypes with Contrasting Glyphosate Tolerance Captures Herbicide-Induced Differential Perturbations in Cellular Physiology.

    Science.gov (United States)

    Maroli, Amith S; Nandula, Vijay K; Duke, Stephen O; Gerard, Patrick; Tharayil, Nishanth

    2018-02-28

    Glyphosate-tolerant Ipomoea lacunosa is emerging as a problematic weed in the southeastern United States. Metabolomic profiling was conducted to examine the innate physiology and the glyphosate induced perturbations in two biotypes of I. lacunosa (WAS and QUI) that had contrasting glyphosate tolerance. Compared to the less tolerant QUI-biotype, the innate metabolism of the more tolerant WAS-biotype was characterized by a higher abundance of amino acids, and pyruvate; whereas the sugar profile of the QUI biotype was dominated by the transport sugar sucrose. Glyphosate application (80 g ae/ha) caused similar shikimate accumulation in both biotypes. Compared to QUI, in WAS, the content of aromatic amino acids was less affected by glyphosate treatment, and the content of Ala, Val, Ile, and Pro increased. However, the total sugars decreased by ∼75% in WAS, compared to ∼50% decrease in QUI. The innate, higher proportional abundance, of the transport-sugar sucrose in QUI coud partly explain the higher translocation and greater sensitivity of this biotype to glyphosate. The decrease in sugars, accompanied by an increase in amino acids could delay feedback regulation of upstream enzymes of the shikimate acid pathway in WAS, which could contribute to a greater glyphosate tolerance. Our study, through a metabolomics approach, provides complementary data that elucidates the cellular physiology of herbicide tolerance in Ipomoea lacunosa biotypes.

  2. Horizontal Transmission of "Candidatus Liberibacter solanacearum" by Bactericera cockerelli (Hemiptera: Triozidae) on Convolvulus and Ipomoea (Solanales: Convolvulaceae)

    Science.gov (United States)

    Torres, Glenda L.; Cooper, W. Rodney; Horton, David R.; Swisher, Kylie D.; Garczynski, Stephen F.; Munyaneza, Joseph E.; Barcenas, Nina M.

    2015-01-01

    “Candidatus Liberibacter solanacearum” (Proteobacteria) is an important pathogen of solanaceous crops (Solanales: Solanaceae) in North America and New Zealand, and is the putative causal agent of zebra chip disease of potato. This phloem-limited pathogen is transmitted to potato and other solanaceous plants by the potato psyllid, Bactericera cockerelli (Hemiptera: Triozidae). While some plants in the Convolvulaceae (Solanales) are also known hosts for B. cockerelli, previous efforts to detect Liberibacter in Convolvulaceae have been unsuccessful. Moreover, studies to determine whether Liberibacter can be acquired from these plants by B. cockerelli are lacking. The goal of this study was to determine whether horizontal transmission of Liberibacter occurs among potato psyllids on two species of Convolvulaceae, sweet potato (Ipomoea batatas) and field bindweed (Convolvulus arvensis), which grows abundantly in potato growing regions of the United States. Results indicated that uninfected psyllids acquired Liberibacter from both I. batatas and C. arvensis if infected psyllids were present on plants concurrently with the uninfected psyllids. Uninfected psyllids did not acquire Liberibacter from plants if the infected psyllids were removed from the plants before the uninfected psyllids were allowed access. In contrast with previous reports, PCR did detect the presence of Liberibacter DNA in some plants. However, visible amplicons were faint and did not correspond with acquisition of the pathogen by uninfected psyllids. None of the plants exhibited disease symptoms. Results indicate that horizontal transmission of Liberibacter among potato psyllids can occur on Convolvulaceae, and that the association between Liberibacter and Convolvulaceae merits additional attention. PMID:26555359

  3. Anti-inflammatory and antispasmodic activity of Ipomoea imperati (Vahl Griseb (Convolvulaceae

    Directory of Open Access Journals (Sweden)

    A.C.B. Paula

    2003-01-01

    Full Text Available Ipomoea imperati (Convolvulaceae lives on the sandy shores of the Brazilian coast and in other areas of the world. The anti-inflammatory activity of a methanol-water extract of the leaves of I. imperati was investigated in experimental models of acute and subchronic inflammation. Topical application of the extract (10 mg/ear inhibited mouse ear edema induced by croton oil (89.0 ± 1.3% by the lipid fraction with an IC50 of 3.97 mg/ear and 57.0 ± 1.3% by the aqueous fraction with an IC50 of 3.5 mg/ear and arachidonic acid (42.0 ± 2.0% with an IC50 of 4.98 mg/ear and 31.0 ± 2.0% with an IC50 of 4.72 mg/ear. Phospholipase A2, purified from Apis mellifera bee venom, was also inhibited by the extract (5.0 mg/ml lipid and aqueous fraction in vitro in a dose-dependent manner (85% by the lipid fraction with an IC50 of 3.22 mg/ml and 25% by the aqueous fraction with an IC50 of 3.43 mg/ml. The methanol-water extract of I. imperati (1000 mg/kg administered by the oral route also inhibited the formation of cotton pellet-induced granulomas (73.2 ± 1.2% by the lipid fraction and 56.14 ± 2.7% by the aqueous fraction and did not cause gastric mucosal lesions. I. imperati extracts (10 mg/ml also inhibited in a dose-dependent manner the muscle contractions of guinea pig ileum induced by acetylcholine and histamine (IC50 of 1.60 mg/ml for the lipid fraction and 4.12 mg/ml for the aqueous fraction. These results suggest the use of I. imperati as an anti-inflammatory and antispasmodic agent in traditional medicine.

  4. Experimental swainsonine poisoning in goats ingesting Ipomoea sericophylla and Ipomoea riedelii (Convolvulaceae Intoxicação experimental por swainsonina em caprinos ingerindo Ipomoea sericophylla e Ipomoea riedelii

    Directory of Open Access Journals (Sweden)

    Rossemberg C. Barbosa

    2007-10-01

    Full Text Available Ipomoea sericophylla and Ipomoea riedelii cause a glycoprotein storage disease in goats. This paper reports the experimental poisoning in goats by dried I. sericophylla and I. riedelii containing 0.05% and 0.01% swainsonine, respectively. Three groups with four animals each were used. Group 1 received daily doses of 2g/kg body weight (bw of dried I. sericophylla (150mg of swainsonine/kg. Goats from this group had clinical signs 36-38 days after the start of ingestion. Group 2 received dried I. riedelii daily doses of 2g/kg of I. riedelii (30mg of swainsonine/kg for 70 days. No clinical signs were observed, therefore the swainsonine dose was increased to 60mg/kg for another 70 days. Goats from Group 2 had clinical signs 26-65 days after increase in swainsonine dose to 60mg/kg. Group 3 was used as control. In these experiments the minimum toxic dose was 60mg/kg which represents 0.0004% of the dry matter in goats ingesting 1.5% bw of the dry matter. For goats ingesting 2%-2.5% bw of dry matter this dose would be 0.00024%-0.0003% of the dry matter. After the end of the experiment two goats were euthanized and another six were observed for recovery of clinical signs. Four goats that continued to consume swainsonine containing plant for 39-89 days after the first clinical signs had non reversible signs, while two goats that ingested the plant for only 15 and 20 days after the first clinical signs recovered completely. These and previous results indicate that irreversible lesions due to neuronal loss occur in goats that continue to ingest the plants for about 30 days after the first clinical signs. Clinical signs and histological lesions were similar to those reported previously for goats poisoned by swainsonine containing plants. No significant alterations were found in packed cell volume, red and white blood cell counts, hemoglobin and mean corpuscular hemoglobin concentrations, mean corpuscular volume, and serum levels of glucose, total protein, and

  5. The effect of leaf shape on the thermoregulation and frost tolerance of an annual vine, Ipomoea hederacea (Convolvulaceae).

    Science.gov (United States)

    Campitelli, Brandon E; Gorton, Amanda J; Ostevik, Katherine L; Stinchcombe, John R

    2013-11-01

    Leaf shape is predicted to have important ecophysiological consequences; for example, theory predicts that lobed leaves should track air temperature more closely than their entire-margined counterparts. Hence, leaf-lobing may be advantageous during cold nights (∼0°C) when there is the risk of damage by radiation frost (a phenomenon whereby leaves fall below air temperature because of an imbalance between radiational heat loss and convective heat gain). Here, we test whether radiation frost can lead to differential damage between leaf shapes by examining a leaf-shape polymorphism in Ipomoea hederacea, where leaves are either lobed or heart-shaped depending on a single Mendelian locus. We logged leaf temperature during midautumn, and measured chlorophyll fluorescence and survival as proxies of performance. Furthermore, we tested if the leaf-shape locus confers freezing tolerance using freezing assays on leaf tissue from different leaf shapes. We found that lobed leaves consistently remain warmer than heart-shaped leaves during the night, but that no pattern emerged during the day, and that temperature differences between leaf shapes were typically small. Furthermore, we found that leaf types did not differ in frost tolerance, but that a 1°C decrease leads to a transition from moderate to complete damage. Our results demonstrate that Ipomoea hederacea leaf shapes do experience different nighttime temperatures, and that only minor temperature differences can lead to disparate levels of freezing damage, suggesting that the differential thermoregulation could result in different levels of frost damage.

  6. Intoxicação espontânea por Ipomoea carnea subsp. fistulosa (Convolvulaceae em bovinos no Pantanal Matogrossense Spontaneous Ipomoea carnea subsp. fistulosa (Convolvulaceae poisoning of cattle in the Brazilian Pantanal

    Directory of Open Access Journals (Sweden)

    Nadia A.B. Antoniassi

    2007-10-01

    Full Text Available Relata-se a intoxicação espontânea por Ipomoea carnea subsp. fistulosa (canudo, algodoeiro em bovinos no Pantanal Matogrossense. As investigações iniciaram após a morte de 12 bovinos, de um rebanho de 500 animais, criados em uma extensa área intensamente infestada por I. carnea subsp. fistulosa com escassa disponibilidade de outra forragem. As mortes ocorreram entres os meses de junho e setembro de 2006. O quadro clínico foi caracterizado por emagrecimento e sinais neurológicos com dificuldade locomotora. Um bovino foi necropsiado sem que se observassem alterações macroscópicas significativas. Histologicamente havia tumefação e vacuolização celular, em neurônios, células acinares pancreáticas, tubulares renais e foliculares da tireóide. Bovinos com quadro clínico similar foram retirados da área invadida por I. carnea subsp. fistulosa e colocadas em áreas com pastagem nativa e de Brachiaria sp. e apresentaram melhora clínica após período de 15 dias.A spontaneous Ipomoea carnea subsp. fistulosa (canudo, algodoeiro poisoning of cattle in the county of Poconé, Brazilian Pantanal, is reported. The investigation began after 12 cattle had died from a flock of 500 animals maintained in an extensive area intensely infested by I. carnea subsp. fistulosa with scarce availability of other fodder plants. The deaths occurred from June to September of 2006. Clinical signs were loss of weight and neurological deficits with hypermetry and incoordination. No significant gross lesions were observed at postmortem examination of one bovine. Histological changes comprised widespread cytoplasmic vacuolation of neurons, cells of the thyroid, kidney and pancreas. Cattle with similar clinical picture, that had been removed from the area invaded by I. carnea subsp. fistulosa and placed into areas with native and Brachiaria sp. pasture, recovered clinically within 15 days.

  7. Ecologia da polinização de Ipomoea asarifolia (Ders. Roem. & Schult. (Convolvulaceae na região semi-árida de Pernambuco Pollination ecology of Ipomoea asarifolia (Ders. Roem. & Schult. (Convolvulaceae in the semi-arid area of Pernambuco

    Directory of Open Access Journals (Sweden)

    Lúcia Helena Piedade Kiill

    2003-09-01

    Full Text Available O presente trabalho foi desenvolvido no período de março/1995 a julho/1997, com o objetivo de estudar aspectos da fenologia, polinização e reprodução de Ipomoea asarifolia, na Fazenda Catalunha, Santa Maria da Boa Vista, PE. I. asarifolia é uma liana perene, com hábito exclusivamente rasteiro e floração registrada no período de março a outubro, caracterizada como do tipo cornucópia. As flores estão reunidas em cimeiras, são infundibuliformes, de cor rosa com as mesopétalas magenta, que funcionam como guias de néctar. A antese é diurna (5:30 e 6:00h e a duração das flores é de aproximadamente seis horas. A quantidade de néctar secretada por flor é inferior a 1µl. Abelhas Megachilidae e Apidae foram os principais visitantes desta Convolvulaceae. Liturge huberi Ducke foi considerada polinizador efetivo e Acamptopoeum prinii Holm. e Diadasina riparia Ducke polinizadores ocasionais. Quanto ao sistema de reprodução, I. asarifolia é autoincompatível, produzindo frutos e sementes viáveis somente após polinização cruzada. Os testes de crescimento de tubo polínico mostraram que, após 10 horas, há tubos polínicos na micrópila de óvulos autopolinizados e daqueles submetidos à polinização cruzada, sugerindo que se trata de um sistema de incompatibilidade tardia. Os testes de germinação mostraram que somente as sementes obtidas em condições naturais (93,3% e nos experimentos de polinização cruzada (100% foram viáveis, reforçando os dados obtidos no sistema de reprodução.The present work was carried out during March/1995 to July/1997, to study aspects of the phenology, pollination and reproduction of Ipomoea asarifolia growing at Fazenda Catalunha, Santa Maria da Boa Vista, PE. I. asarifolia is a perennial creeping liana with floration registered in the period of March to October, characterized as a cornucopian pattern of flowering. The flowers are gathered in cymes, with a pink funnel-like corolla with

  8. Doença de depósito lisossomal induzida pelo consumo de Ipomoea verbascoidea (Convolvulaceae) em caprinos no semiárido de Pernambuco

    Science.gov (United States)

    The aim of this paper was to reproduce the poisoning of Ipomoea verbascoidea in goats and describe the epidemiological, clinical and pathological aspects of spontaneous poisoning by this plant in Pernambuco. For this, we studied the epidemiology of the disease in seven mu¬nicipalities in the semiari...

  9. The Convolvulaceae of Timor with special reference to East Timor

    NARCIS (Netherlands)

    Simões, A.R.; Silva, H.; Silveira, P.

    2011-01-01

    A taxonomic review of the Convolvulaceae in Timor is presented. A total of 61 taxa are listed, comprising 53 species from 15 genera. The most diverse genus by far is Ipomoea with 25 reported species, followed by Merremia with seven species. Of the seven species initially thought to be endemic, only

  10. Doença de depósito lisossomal induzida pelo consumo de Ipomoea verbascoidea (Convolvulaceae em caprinos no semiárido de Pernambuco

    Directory of Open Access Journals (Sweden)

    Dayane D.C.C. Lima

    2013-07-01

    Full Text Available O objetivo deste trabalho foi reproduzir a intoxicação por Ipomoea verbascoidea em caprinos e descrever os aspectos epidemiológicos, clínicos e histopatológicos da intoxicação espontânea por essa planta no Estado de Pernambuco. Para isso, realizou-se o acompanhamento da epidemiologia da doença em sete municípios do semiárido pernambucano. Três caprinos espontaneamente intoxicados foram examinados e, em seguida eutanasiados e necropsiados (Grupo I. Para reproduzir experimentalmente a doença, as folhas secas de I. verbascoidea contendo 0,02% de swainsonina, foram fornecidas na dose de 4g/kg (0,8mg de swainsonina/kg a dois grupos de três animais. Os caprinos do Grupo II receberam a planta diariamente por 40 dias e foram eutanasiados no 41º dia de experimento. Os caprinos do Grupo III receberam a planta diariamente por 55 dias e foram eutanasiados no 120º dia de experimento. Outros três caprinos constituíram o grupo controle (Grupo IV. Nos grupos experimentais, as lesões encefálicas foram avaliadas por histopatologia e adicionalmente avaliaram-se as lesões cerebelares por morfometria, mediante mensuração da espessura da camada molecular, do número de neurônios de Purkinje e da área dos corpos celulares dessas células. Os principais sinais clínicos e lesões microscópicas foram semelhantes aos previamente reportados em animais intoxicados por plantas que contem swainsonina. Nos caprinos do GII e GIII, os primeiros sinais clínicos foram observados entre o 22º e 29º dia de experimento; clinicamente a doença desenvolvida por esses animais foi semelhante aos casos espontâneos. Nenhum dos caprinos do GIII se recuperou dos sinais neurológicos. Esse resultado evidencia que o consumo da planta por 26-28 dias após a observação dos primeiros sinais clínicos é suficiente para provocar lesões irreversíveis. Pela análise morfométrica, a camada molecular do cerebelo dos caprinos do Grupo I e III eram mais delgadas que

  11. Ocorrência de Brevipalpus phoenicis (Geijskes (Acari, Tenuipalpidae, Tetranychus urticae (Koch (Acari, Tetranychidae e Polyphagotarsonemus latus (Banks (Acari, Tarsonemidae sobre folhas de Ipomoea cairica (Linnaeus Sweet (Solanales, Convolvulaceae Occurrence of Brevipalpus phoenicis (Geijskes (Acari, Tenuipalpidae, Tetranychus urticae (Koch (Acari, Tetranychidae and Polyphagotarsonemus latus (Banks (Acari, Tarsonemidae on leaves of I. cairica (Linnaeus Sweet (Solanales, Convolvulaceae

    Directory of Open Access Journals (Sweden)

    Ozana M. de A. Maia

    2006-09-01

    Full Text Available A ocorrência de três espécies acarinas fitófagas é relatada pela primeira vez sobre folhas de Ipomoea cairica. As espécies Brevipalpus phoenicis (Geijskes, Tetranychus urticae (Koch e Polyphagotarsonemus latus (Banks, foram coletadas sobre folhas de I. cairica nas imediações da Universidade Federal do Paraná, Curitiba, Paraná, Brasil, em 20 de janeiro de 2005.The first occurrence of three phytophagus mites on Ipomoea cairica, is reported. The species Brevipalpus phoenicis (Geijskes, Tetranychus urticae (Koch and Polyphagotarsonemus latus (Banks were caught on leaves of I. cairica, around Universidade Federal do Paraná, Curitiba, Paraná, Brazil, in January 20th, 2005.

  12. Protective Effect of Purple Sweet Potato (Ipomoea batatas Linn ...

    African Journals Online (AJOL)

    Purpose: To evaluate the protective effects of purple sweet potato (Ipomoea batatas Linn, Convolvulaceae) extract (IBE) in stimulated BV-2 microglial cells and its anti-oxidant properties. Methods: Cell viability assessment was performed by 3-(4, 5-dimethylthiazol-2-yl)-2, 5- diphenyltetrazolium bromide (MTT) assay.

  13. Uji Aktivitas Antioksidan Ekstrak Etanol Daun Kangkung Air (Ipomoea aquatica Forsk.) dan Kangkung Darat (Ipomoea reptans Poir.) yang Ditanam di Daerah Berbeda Ketinggian

    OpenAIRE

    Sijabat, Novriani

    2015-01-01

    Kangkung is a member of Convolvulaceae plants which is popular in Indonesia. Kangkung leaves contain of amino acid, fatty acid, minerals, and a high value of total phenolic content. Kangkung had been found with cyotoxic, antiproliferative and anti-inflammatory activities. There are 2 types of kangkung : water’s kangkung (Ipomoea aquatica Forsk.) and land’s kangkung (Ipomoea reptans Poir.) Both are growing well on different-altitude areas. The purpose of this study was to det...

  14. The Convolvulaceae of Malaysia, I

    NARCIS (Netherlands)

    Ooststroom, van S.J.

    1938-01-01

    This is the first contribution to a series of papers dealing with the Convolvulaceae of Malaysia (Malay Peninsula and Archipelago, Philippines and New Guinea). As far as possible the contributions will be published in accordance with the systematical arrangement of the genera. For a survey on this

  15. Review of the genus Ipomoea: traditional uses, chemistry and biological activities

    Directory of Open Access Journals (Sweden)

    Marilena Meira

    Full Text Available Approximately 600-700 species of Ipomoea, Convolvulaceae, are found throughout tropical and subtropical regions of the world. Several of those species have been used as ornamental plants, food, medicines or in religious ritual. The present work reviews the traditional uses, chemistry and biological activities of Ipomoea species and illustrates the potential of the genus as a source of therapeutic agents. These species are used in different parts of the world for the treatment of several diseases, such as, diabetes, hypertension, dysentery, constipation, fatigue, arthritis, rheumatism, hydrocephaly, meningitis, kidney ailments and inflammations. Some of these species showed antimicrobial, analgesic, spasmolitic, spasmogenic, hypoglycemic, hypotensive, anticoagulant, anti-inflammatory, psychotomimetic and anticancer activities. Alkaloids, phenolics compounds and glycolipids are the most common biologically active constituents from these plant extracts.

  16. Floral biology and breeding system of three Ipomoea weeds Biologia floral e sistema reprodutivo de três espécies daninhas de Ipomoea

    Directory of Open Access Journals (Sweden)

    R.C.S. Maimoni-Rodella

    2007-03-01

    Full Text Available The floral biology of three weeds, Ipomoea cairica, I. grandifolia and I. nil (Convolvulaceae, was studied in Botucatu and Jaboticabal, São Paulo, in southeastern Brazil. The three species are melittophilous, with a varied set of floral visitors, but with some overlapping. Cluster analysis using Jacquard similarity index indicated a greater similarity among different plant species in the same locality than among the populations at different places, in relation to floral visitor sets. The promiscuous and opportunistic features of the flowers were shown, with such type of adaptation to pollination being advantageous to weeds since pollinator availability is unpredictable at ruderal environments.A biologia floral de Ipomoea cairica, I. grandifolia e I. nil - plantas daninhas da família Convolvulaceae - foi estudada em Botucatu e Jaboticabal, Estado de São Paulo, Brasil. As três espécies são melitófilas, apresentando conjuntos de visitantes florais bastante diversificados, embora haja alguma sobreposição entre eles. Com relação aos visitantes florais, a análise de agrupamento, empregando-se o índice de similaridade de Jaccard, indicou maior similaridade entre diferentes espécies de Ipomoea ocorrentes no mesmo local do que entre populações da mesma espécie em diferentes localidades. O caráter promíscuo e oportunista da adaptação à polinização, presente nessas espécies, foi demonstrado, sendo essa adaptação vantajosa para plantas daninhas, uma vez que em ambientes ruderais a disponibilidade de polinizadores é imprevisível.

  17. Wound healing activity of Ipomoea batatas tubers (sweet potato

    Directory of Open Access Journals (Sweden)

    Madhav Sonkamble

    2011-10-01

    Full Text Available Background: Ipomoea batatas (L. Lam. from the family Convolvulaceae is the world’s sixth largest food crop. The tubers of Ipomoea batatas commonly known as sweet potato are consumed as a vegetable globally. The tubers contain high levels of polyphenols such as anthocyanins and phenolic acids and vitamins A, B and C, which impart a potent antioxidant activity that can translate well to show wound healing effects. To check their effects on wound healing, the peels and peel bandage were tested on various injury models in rats in the present study.Methods: The methanolic extracts of the peels and peel bandage of Ipomoea batatas tubers (sweet potato were screened for wound healing by excision and incision wound models on Wistar rats. Three types of gel formulations were prepared, viz., gel containing 3.0% (w/w peel extract, gel containing 6.0% (w/w peel extract and gel containing 10% (w/w peel extract. Betadine (5% w/w povidone iodine cream was used as a reference standard. In the incision wound model, Tensile strength of the skin was measured. Epithelization time, wound contraction, hydroxyproline content of the scab, and ascorbic acid and malondialdehyde content of the plasma were determined in the excision wound model.Results: In the incision wound model, high tensile strength of the wounded skin was observed in animals treated with the peel extract gels and the peel bandage when compared with wounded control animals. The increase in tensile strength indicates the promotion of collagen fibers and that the disrupted wound surfaces are being firmly knit by collagen. In the excision wound model, significant wound closure was observed on the 4th day in rats treated with all three gel formulations when compared with the wounded control rats. A significant increase inFunctional Foods in Health and Disease 2011; 10:403-415hydroxyproline and ascorbic acid content in the gel-treated animals and a significant decrease in malondialdehyde content in the

  18. High throughput sequencing identifies chilling responsive genes in sweetpotato (Ipomoea batatas Lam.) during storage.

    Science.gov (United States)

    Xie, Zeyi; Zhou, Zhilin; Li, Hongmin; Yu, Jingjing; Jiang, Jiaojiao; Tang, Zhonghou; Ma, Daifu; Zhang, Baohong; Han, Yonghua; Li, Zongyun

    2018-05-21

    Sweetpotato (Ipomoea batatas L.) is a globally important economic food crop. It belongs to Convolvulaceae family and origins in the tropics; however, sweetpotato is sensitive to cold stress during storage. In this study, we performed transcriptome sequencing to investigate the sweetpotato response to chilling stress during storage. A total of 110,110 unigenes were generated via high-throughput sequencing. Differentially expressed genes (DEGs) analysis showed that 18,681 genes were up-regulated and 21,983 genes were down-regulated in low temperature condition. Many DEGs were related to the cell membrane system, antioxidant enzymes, carbohydrate metabolism, and hormone metabolism, which are potentially associated with sweetpotato resistance to low temperature. The existence of DEGs suggests a molecular basis for the biochemical and physiological consequences of sweetpotato in low temperature storage conditions. Our analysis will provide a new target for enhancement of sweetpotato cold stress tolerance in postharvest storage through genetic manipulation. Copyright © 2018. Published by Elsevier Inc.

  19. Secretory structures of Ipomoea asarifolia: anatomy and histochemistry

    Directory of Open Access Journals (Sweden)

    Fabiano M. Martins

    2012-02-01

    Full Text Available Ipomoea asarifolia (Desr. Roem. & Schult., Convolvulaceae, is a weed that infests agricultural areas and is toxic to cattle. In spite of its toxicity, the leaves of this plant are used in traditional remedies in the state of Bahia, Brazil. The present work describes the leaf anatomy of I. asarifolia and characterizes the exudates of its secretory structures. The leaves have a unistratified epidermis composed of ordinary cells with straight to slightly sinuous anticlinal walls and thin cuticles. Paracytic stomata are found on both surfaces of the leaves at the same level as the ordinary epidermal cells. Trichomes producing polysaccharide secretions occur on the petiole and leaf blade and are considered colleters. The mesophyll is dorsiventral and the vascular bundle of the central vein is bicollateral. Two opposed nectaries occur on the petiole near the leaf blade. Each nectary is composed of a small canal with internal ramifications and numerous secretory trichomes. The laticiferous glands are articulated, not anastomosed, and are composed of large diameter cells with thin cell walls. The secretions of the laticiferous glands are lipidic.

  20. AISLAMIENTO Y PURIFICACIÓN DEL HONGO ECTOMICORRÍZICO Helvella lacunosa EN DIFERENTES MEDIOS DE CULTIVO

    Directory of Open Access Journals (Sweden)

    Daniel Domínguez Romero

    2013-04-01

    Full Text Available Helvella lacunosa (H. lacunosa adicionalmente a su importancia micorrízica tiene un alto valor comercial. La producción comercial de H. lacunosa tiene dos ventajas: Beneficio económico para las comunidades que sean capaces de producirlo y; conservación de la biodiversidad en el bosque al prevenir la sobre explotación de la especie y mantener la relación micorrízica hongo:planta. Es necesario, en principio, obtener el micelio puro (aislamiento, y a partir de éste buscar la técnica de micorrización más adecuada para su producción. El aislamiento de cepas, requiere de pruebas selectivas de diversos medios de cultivo lo que permite identificar los requerimientos potenciales para inducir el desarrollo del micelio. Se realizaron pruebas de crecimiento en cinco medios de cultivo con el objetivo de obtener cepas puras del hongo ectomicorrízico H. lacunosa. Mediante un Análisis de Covarianza se demostró que existe una relación lineal entre el tiempo de incubación y el diámetro, lo que indica que la velocidad de crecimiento acumulado del micelio, fue diferente entre los medios de cultivo (F4, 240 = 17.008; p

  1. Disentangling the origins of cultivated sweet potato (Ipomoea batatas (L. Lam..

    Directory of Open Access Journals (Sweden)

    Caroline Roullier

    Full Text Available Sweet potato (Ipomoea batatas (L. Lam., Convolvulaceae counts among the most widely cultivated staple crops worldwide, yet the origins of its domestication remain unclear. This hexaploid species could have had either an autopolyploid origin, from the diploid I. trifida, or an allopolyploid origin, involving genomes of I. trifida and I. triloba. We generated molecular genetic data for a broad sample of cultivated sweet potatoes and its diploid and polyploid wild relatives, for noncoding chloroplast and nuclear ITS sequences, and nuclear SSRs. Our data did not support an allopolyploid origin for I. batatas, nor any contribution of I. triloba in the genome of domesticated sweet potato. I. trifida and I. batatas are closely related although they do not share haplotypes. Our data support an autopolyploid origin of sweet potato from the ancestor it shares with I. trifida, which might be similar to currently observed tetraploid wild Ipomoea accessions. Two I. batatas chloroplast lineages were identified. They show more divergence with each other than either does with I. trifida. We thus propose that cultivated I. batatas have multiple origins, and evolved from at least two distinct autopolyploidization events in polymorphic wild populations of a single progenitor species. Secondary contact between sweet potatoes domesticated in Central America and in South America, from differentiated wild I. batatas populations, would have led to the introgression of chloroplast haplotypes of each lineage into nuclear backgrounds of the other, and to a reduced divergence between nuclear gene pools as compared with chloroplast haplotypes.

  2. Disentangling the origins of cultivated sweet potato (Ipomoea batatas (L.) Lam.).

    Science.gov (United States)

    Roullier, Caroline; Duputié, Anne; Wennekes, Paul; Benoit, Laure; Fernández Bringas, Víctor Manuel; Rossel, Genoveva; Tay, David; McKey, Doyle; Lebot, Vincent

    2013-01-01

    Sweet potato (Ipomoea batatas (L.) Lam., Convolvulaceae) counts among the most widely cultivated staple crops worldwide, yet the origins of its domestication remain unclear. This hexaploid species could have had either an autopolyploid origin, from the diploid I. trifida, or an allopolyploid origin, involving genomes of I. trifida and I. triloba. We generated molecular genetic data for a broad sample of cultivated sweet potatoes and its diploid and polyploid wild relatives, for noncoding chloroplast and nuclear ITS sequences, and nuclear SSRs. Our data did not support an allopolyploid origin for I. batatas, nor any contribution of I. triloba in the genome of domesticated sweet potato. I. trifida and I. batatas are closely related although they do not share haplotypes. Our data support an autopolyploid origin of sweet potato from the ancestor it shares with I. trifida, which might be similar to currently observed tetraploid wild Ipomoea accessions. Two I. batatas chloroplast lineages were identified. They show more divergence with each other than either does with I. trifida. We thus propose that cultivated I. batatas have multiple origins, and evolved from at least two distinct autopolyploidization events in polymorphic wild populations of a single progenitor species. Secondary contact between sweet potatoes domesticated in Central America and in South America, from differentiated wild I. batatas populations, would have led to the introgression of chloroplast haplotypes of each lineage into nuclear backgrounds of the other, and to a reduced divergence between nuclear gene pools as compared with chloroplast haplotypes.

  3. Antioxidant Potential and DNA Damage Protection by the Slate Grey Saddle Mushroom, Helvella lacunosa (Ascomycetes), from Kashmir Himalaya (India).

    Science.gov (United States)

    Shameem, Nowsheen; Kamili, Azra N; Ahmad, Mushtaq; Masoodi, F A; Parray, Javid A

    2016-01-01

    This study pertains to the radical scavenging potential of and DNA protection by Helvella lacunosa, an edible mushroom from Kashmir Himalaya (India). Different solvents, on the basis of their polarities, were used to extract all solvent-soluble bioactive compounds. Seven different antioxidant methods were also used to determine extensive radical scavenging activity. The mushroom ethanol extract and butanol extract showed effective scavenging activity of radicals at 95% and 89%, respectively. At 800 µg/mg, the ethanol extract was potent enough to protect DNA from degradation by hydroxyl radicals. It is evident from these findings that the presence of antioxidant substances signifies the use of H. lacunosa as food in the mountainous valleys of the Himalayan region.

  4. Phylogenetics and diversification of morning glories (tribe ipomoeeae, convolvulaceae) based on whole plastome sequences

    Science.gov (United States)

    Phylogenetic studies have demonstrated the largest morning glory genus, Ipomoea, is not monophyletic, and nine other segregate genera are derived from within Ipomoea. Therefore, systematic research is focused on the monophyletic tribe Ipomoeeae (c. 650-900 species). We used whole plastid genomes to ...

  5. Gas exchange and plant growth after defoliation on Leandra lacunosa, a cerrado woody species with continuous leaf production

    Directory of Open Access Journals (Sweden)

    Maria Angélica Damascos

    2005-11-01

    Full Text Available Morphological and physiological leaf traits were studied on control and defoliated potted Leandra lacunosa young plants. After defoliation, remaining bottom leaves showed no significant change in net photosynthesis and stomatal conductance values with time, but the leaf transpiration rate was higher. The production of the new leaves was greater after defoliation in top defoliated plants. Bottom defoliated plants increased stem extension rates and net photosynthesis transitorily. Two months after defoliation, control and defoliated plants did not differ in stem length and root dry mass values. In spite of smaller area and photosynthetic capacity, remaining bottom leaves were able to compensate top leaves elimination. The effectiveness of this compensatory response, however, depended on the ability of new leaves to escape from herbivores.Características morfológicas e fisiológicas foliares foram estudadas em indivíduos jovens envasados de Leandra lacunosa que sofreram desfolhamento e em indivíduos controle. Após o desfolhamento, as folhas remanescentes da parte inferior não apresentaram mudanças significativas dos valores de fotossíntese e condutância estomática. Entretanto, a taxa de transpiração foliar foi maior quando comparada com plantas desfolhadas em porções inferiores. A rebrota de folhas foi maior após o desfolhamento da parte superior. Nas plantas desfolhadas em porções inferiores, ocorreu, momentaneamente, aumento da taxa fotossintética e da extensão do caule. Após dois meses de desfolhamento as plantas controle e desfolhadas não diferiram quanto aos valores do comprimento do caule e massa seca da raiz. Portanto, apesar da menor área foliar e menor capacidade fotossintética, as folhas na parte inferior foram capazes de compensar a eliminação das folhas superiores. A efetividade desta resposta compensatória, no entanto, dependerá da habilidade das novas folhas emitidas escaparem do ataque dos herbívoros.

  6. Development of hydroethanolic extract of Ipomoea pes-caprae using factorial design followed by antinociceptive and anti-inflammatory evaluation

    Directory of Open Access Journals (Sweden)

    Daniela Vieira

    2012-11-01

    Full Text Available Ipomoea pes-caprae (L. R. Br., Convolvulaceae, is a medicinal plant that grows abundantly as a pan-tropical stand plant. The 3² (two factors and three levels factorial design, was applied to determine the best time and drug/solvent proportion to maximize the flavonoid content in the hydroethanolic extract by maceration process. The antinociceptive and anti-inflammatory effects were studied at 5-20 mg/kg, i.p., using the writhing test and carrageenan-induced pleurisy models in mice. The optimized extract was able to inhibit more than 50% of abdominal writhing at 20 mg/kg, with 55.88%±2.4 of maximum inhibition. Indomethacin, used as positive control, inhibited 64.86% at 10 mg/kg. In the pleurisy model, the extract produced dose-dependent inhibition of the first phase of inflammation (4 h in the pleural cavity induced by injection of carrageenan (1% in mice. It inhibited 50%±0.82 (p<0.01 of exudation induced by carrageenan, and 60.88%±0.14 (p<0.01 of leukocyte migration to the pleural cavity. In conclusion, the results validate the technological conditions of the maceration process to produce an optimized bioactive herb extract for the development of analgesic and anti-inflammatory phytopharmaceuticals using 70 ºGL ethanol, a plant to solvent ratio of 12.5% (w/v, and ten days of maceration.

  7. The efficiency of bees in pollinating ephemeral flowers of Jacquemontia bracteosa (Convolvulaceae

    Directory of Open Access Journals (Sweden)

    Sílvia K. D. Santos

    Full Text Available ABSTRACT The family Convolvulaceae is widely distributed in tropical regions, mainly in open areas. Convolvulaceae flowers are characterized mainly by being beautiful and ephemeral, attracting many flower visitors that belong to different taxonomic groups. This work aimed to investigate the interactions between insects and flowers of Jacquemontia bracteosa (Convolvulaceae, focusing on the pollination efficiency, in an area in the Brazilian semiarid. From November 2011 to October 2012, floral biology of J. bracteosa was investigated as well as the flower visit frequency, behavior, and morphology of floral visitors. The flowers of J. bracteosa are white, showy and open early in the morning, lasting less than 12 hours, with fruiting occurring both by selfing and outcrossing fecundation. A total of 337 specimens insects were collected on J. bracteosa flowers during the field observations. The Neotropical bee, Ancyloscelis apiformis, was considered the most efficient pollinator of J. bracteosa. This bee showed appropriate behavior, high frequency (64% of the total sample, and was constant on the flowers. Furthermore, they arrived soon when the flowers began to open and presented 90% of efficiency in tests of flower pollination of J. bracteosa. Other native bee species also visited the flowers of J. bracteosa and may be considered potential pollinators because they presented behavior and morphology compatible with the flowers. This study suggests that maintenance of weeds or ruderal plants, especially those that also have ornamental potential in anthropic area, may be an option for the preservation of local native pollinators, which are threatened by environmental degradation.

  8. RESPUESTA DEL CULTIVO DE PIMENTÓN (CAPSICUM ANNUUM A LA INOCULACIÓN CON GLOMUS MANIHOTIS Y ACAULOSPORA LACUNOSA EN SUELO CON NIVELES ALTO DE FOSFORO

    Directory of Open Access Journals (Sweden)

    Laura Esther Rojas-Martínez

    2014-01-01

    Full Text Available Background: Glomus manihotis y Acaulospora lacunosa are fungi forming arbuscular mycorrhizae; mutually beneficial symbiotic associations between fungi and specialized roots. This root-fungus formation performs various functions in association with plants. Previous research has shown that they can provide biological substitutes for mineral fertilizers. Objective: The objective of the study was to evaluate the effects of inoculation of Glomus manihotis (GL and Acaulospora lacunosa (ACU in pepper plants grown in soils with high levels of P. Methods: The Phillips and Hayman method was used for the determination of the percentage of infection. Other variables were: height, total fresh weight, shoot dry weight, root length, weight and number of fruit, percentage of infection and foliage nutrient content. Results: Plants inoculated with (GL recorded an infection rate of 70.3 %, inoculated with (ACU had 45 % and the inoculated treatment (GL / ACU 28%. The infection had a positive effect in the majority agronomic variables analyzed in plants inoculated with (GL and (ACU, but not in the mixed treatment (GL / ACU which was very similar to control. In terms of the content of nutrients in foliage, there were no significant differences in treatments NPK, but there were significant differences in the mobile few nutrients such as Zn, Cu and Fe, favoring plants inoculated with (ACU. Conclusions: These results suggest that inoculation with mycorrhizal fungi in conditions of high phosphorus levels may be an effective adjuvant in the optimal development of a plant, long as they determine the effective specific fungus under these conditions.

  9. Agronomic performance of locally adapted sweet potato (Ipomoea ...

    African Journals Online (AJOL)

    SERVER

    ELISA established that field plants had a higher virus titre compared to the tissue culture regenerated plants. Key words: Sweet potato (Ipomoea batatas), tissue culture, ..... Commercial Vegetable Production Guides (CVPG) (2003). Sweet.

  10. Éxito reproductivo y calidad de los frutos en poblaciones del extremo sur de la distribución de Ipomoea purpurea (Convolvulaceae

    Directory of Open Access Journals (Sweden)

    Leonardo Galetto

    2002-01-01

    Full Text Available Se evaluó la producción de frutos y semillas en Ipomea purpurea en relación con diferentes tratamientos de polinización (autopolinización espontánea, autopolinización manual y polinización cruzada, durante dos temporadas reproductivas. La masa de los frutos, de las semillas y el número de semillas por fruto, se compararon entre tratamientos y entre años, a fin de detectar diferencias en la calidad de los frutos. Los resultados para las poblaciones estudiadas en el centro de Argentina confirman que se trata de una especie autocompatible y con la capacidad de producir frutos por autogamia espontánea. Los valores de éxito reproductivo mediados por polinización natural fueron altos (> 50%. Un fruto maduro pesa 0,1 g y contiene 4-6 semillas; la masa del total de semillas producidas por un fruto representa alrededor del 60% de la masa total del fruto. Los caracteres de los frutos y las semillas no presentaron diferencias significativas entre años o tratamientos. Asimismo, se compararon los frutos provenientes de polinización natural entre los individuos con distinto color de flor. En general, tampoco se encontraron diferencias significativas. Sólo los frutos provenientes de flores rosa presentaron un número significativamente menor de semillas que los frutos de los otros morfotipos florales (blanco o púrpura. El grupo principal de visitantes florales fue el de los Himenópteros, que pueden ser considerados polinizadores. Se registraron otros grupos de visitantes florales que no tendrían un papel preponderante en la transferencia de polen

  11. Soil-to-Plant Transfer of Radiocesium in Ipomoea aquatica

    International Nuclear Information System (INIS)

    Salmah Moosa; Anis Nadia Mohd Faisol Mahadeven; Mohd Noor Hidayat Adenan

    2016-01-01

    The effectiveness of the bio fertilizer regarding the growth promotion and radiocaesium ("1"3"7Cs) uptake was evaluated in Ipomoea aquatica. The growth of Ipomoea aquatica was enhanced with the application of bio fertilizer. The practice of bio fertilizer resulted in significant increase of "1"3"7Cs concentration in all plant parts and higher "1"3"7Cs transfer from soil to plants. TF values of "1"3"7Cs ranged from 0.555 to 6.726 for the species. The plant roots possessed the lightest weight after being harvest, and show a highest "1"3"7Cs concentration in plant roots. Ipomoea aquatica could be utilized for agricultural countermeasures and phyto remediation, to diminish the allocation of radiocaesium from soil to human. (author)

  12. Analysis of the chemical composition of the essential oils extracted from Lippia lacunosa Mart. and Schauer and Lippia rotundifolia Cham. (Verbenaceae) by gas chromatography and gas chromatography-mass spectrometry

    International Nuclear Information System (INIS)

    Leitao, Suzana G.; Barbosa, Ymira Galico; Viccini, Lyderson F.; Salimena, Fatima R.G.; Peixoto, Paulo H.P.

    2008-01-01

    Lippia lacunosa and L. rotundifolia (Verbenaceae) are two Brazilian species of complex taxonomic delimitation. The composition of the essential oils from leaves and flowers of these plants was investigated by gas chromatography (GC) and gas chromatography coupled with mass spectrometry (GC-MS) analysis. The major components of the essential oils of flowers and leaves of L. lacunosa were: myrcene (14.7% and 11.9%), myrcenone (45.2% and 64.2%), Z-ocimenone (5.7% and 5.2%), and E-ocimenone (14.7% and 4.1%), respectively; whereas in L. rotundifolia (flowers and leaves) were ..-pinene (8.7% and 1.8%), myrcene (5.1% and 3.6%), limonene (26.0% and 7.9 %), cis-pinocamphone (4.5% and 3.1%) and myrtenal (22.3% and 16.7%), respectively. The essential oils from L. lacunosa exhibited a strong and pleasant mango aroma, which was related to the presence of myrcene and myrcenone. The marked differences in the chemical composition of their essential oils may represent a powerful tool for the botanical classification. (author)

  13. Analysis of the chemical composition of the essential oils extracted from Lippia lacunosa Mart. and Schauer and Lippia rotundifolia Cham. (Verbenaceae) by gas chromatography and gas chromatography-mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Leitao, Suzana G.; Barbosa, Ymira Galico [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro, RJ (Brazil). Fac. de Farmacia; Oliveira, Danilo R. de; Leitao, Gilda G. [Universidade Federal do Rio de Janeiro (UFRJ), Rio de Janeiro, RJ (Brazil). Nucleo de Pesquisas de Produtos Naturais]. E-mail: sgleitao@pharma.ufrj.br; Suelsen, Valeria; Martino, Virginia [Universidad de Buenos Aires (Argentina). Facultad de Farmacia y Bioquimica; Bizzo, Humberto R.; Lopes, Daise [EMBRAPA Agroindustria de Alimentos, Rio de Janeiro, RJ (Brazil); Viccini, Lyderson F.; Salimena, Fatima R.G.; Peixoto, Paulo H.P. [Universidade Federal de Juiz de Fora (UFJF), Juiz de Fora, MG (Brazil). Inst. de Ciencias Biolgicas

    2008-07-01

    Lippia lacunosa and L. rotundifolia (Verbenaceae) are two Brazilian species of complex taxonomic delimitation. The composition of the essential oils from leaves and flowers of these plants was investigated by gas chromatography (GC) and gas chromatography coupled with mass spectrometry (GC-MS) analysis. The major components of the essential oils of flowers and leaves of L. lacunosa were: myrcene (14.7% and 11.9%), myrcenone (45.2% and 64.2%), Z-ocimenone (5.7% and 5.2%), and E-ocimenone (14.7% and 4.1%), respectively; whereas in L. rotundifolia (flowers and leaves) were ..-pinene (8.7% and 1.8%), myrcene (5.1% and 3.6%), limonene (26.0% and 7.9 %), cis-pinocamphone (4.5% and 3.1%) and myrtenal (22.3% and 16.7%), respectively. The essential oils from L. lacunosa exhibited a strong and pleasant mango aroma, which was related to the presence of myrcene and myrcenone. The marked differences in the chemical composition of their essential oils may represent a powerful tool for the botanical classification. (author)

  14. Effects of feeding sweet potato ( Ipomoea batatas ) leaves on growth ...

    African Journals Online (AJOL)

    Forty-five (45) weaner rabbits were randomly allotted to five dietary treatments (T) to evaluate the effects of graded levels of sweet potato (Ipomoea batatas) leaves (SPL) and pelletized concentrate feed (PCF) on growth performance and nutrient digestibility of rabbits. The treatments were: T1 (0% SPL; 100% PCF); T2 (25% ...

  15. Effect of sweetpotato leaf (Ipomoea Batatas) extract on some ...

    African Journals Online (AJOL)

    The use of plants and herbs as food supplements and medicinal additives is fast gaining grounds and recognition in the world especially in Africa. Sweet potato leaves (Ipomoea batatas) decoction is a folk remedy for asthma, bugbites, burns, catarrh, diarrhea, fever, nausea, stomach distress and tumours. Also this plant has ...

  16. Genetic Diversity of Local and Introduced Sweet Potato [Ipomoea ...

    African Journals Online (AJOL)

    This study was therefore conducted to estimate the genetic diversity of 114 Sweet potato [Ipomoea batatas (L.) Lam] accessions obtained from Nigeria, Asia, Latin America and Local collections along with two improved varieties. Accessions were planted in 2012/13 cropping season at Haramaya University, eastern Ethiopia ...

  17. Possibilities of sweet potato [Ipomoea batatas (L.) Lam] value chain ...

    African Journals Online (AJOL)

    FAOUZIATH

    2016-03-30

    Mar 30, 2016 ... Key words: Benin, sweet potato, Ipomoea batatas, nutritional composition, orange flesh cultivar, value chain. INTRODUCTION ... largely consumed after processing into garri, traditional flour, lafun, and improved flour. ..... foods give them a role in human health and they can serve as substrates for the ...

  18. Recovery of methane-rich gas from solid-feed anaerobic digestion of ipomoea (Ipomoea carnea).

    Science.gov (United States)

    Sankar Ganesh, P; Sanjeevi, R; Gajalakshmi, S; Ramasamy, E V; Abbasi, S A

    2008-03-01

    Studies are presented on new types of anaerobic digesters in which chopped or dry crushed Ipomoea carnea was fed without any other pretreatment, in an attempt to develop commercially viable means of utilizing the otherwise very harmful plant. Two types of solid-feed anaerobic digesters (SFADs) were studied. The first type had a single vessel in which the bottom 35% portion was separated from the top portion by a perforated PVC disk. The weed was charged from the top and inoculated with anaerobically digested cowdung-water slurry. The fermentation of the weed in the reactor led to the formation of volatile fatty acids (VFAs) plus some biogas. The leachate, rich in the VFAs, was passed through the perforated PVC sheet and collected in the lower portion of the vessel. The other type of reactors had two vessels, the first one was fully charged with the weed and the second received the VFA leachate. With both types were attached upflow anaerobic filters (UAFs) which converted the leachate into combustible biogas consisting of approximately 70% methane. All SFADs developed very consistent performance in terms of biogas yield within 17 weeks of start. The two-compartment reactors yielded significantly more biogas than the single-compartment reactors of corresponding total volume, and the reactors with which anaerobic filters (AF) were attached yielded more biogas than the ones without AF. The best performing units generated 2.41m(3) of biogas per m(3) of digester volume, as compared to 0.1-0.2m(3) of biogas, m(-3)d(-1), obtainable with conventional digesters. This indicates the viability of this technology. The spent weed can be vermicomposted directly to obtain good soil-conditioner cum fertilizer; earthworm Eudrilus eugeniae produced 540mg vermicast per animal every day, achieving near total conversion of feed to vermicast in 20 days. The proposed systems, thus, makes it possible to accomplish total utilization of ipomoea.

  19. Identification among morphologically similar Argyreia (Convolvulaceae) based on leaf anatomy and phenetic analyses.

    Science.gov (United States)

    Traiperm, Paweena; Chow, Janene; Nopun, Possathorn; Staples, G; Swangpol, Sasivimon C

    2017-12-01

    The genus Argyreia Lour. is one of the species-rich Asian genera in the family Convolvulaceae. Several species complexes were recognized in which taxon delimitation was imprecise, especially when examining herbarium materials without fully developed open flowers. The main goal of this study is to investigate and describe leaf anatomy for some morphologically similar Argyreia using epidermal peeling, leaf and petiole transverse sections, and scanning electron microscopy. Phenetic analyses including cluster analysis and principal component analysis were used to investigate the similarity of these morpho-types. Anatomical differences observed between the morpho-types include epidermal cell walls and the trichome types on the leaf epidermis. Additional differences in the leaf and petiole transverse sections include the epidermal cell shape of the adaxial leaf blade, the leaf margins, and the petiole transverse sectional outline. The phenogram from cluster analysis using the UPGMA method represented four groups with an R value of 0.87. Moreover, the important quantitative and qualitative leaf anatomical traits of the four groups were confirmed by the principal component analysis of the first two components. The results from phenetic analyses confirmed the anatomical differentiation between the morpho-types. Leaf anatomical features regarded as particularly informative for morpho-type differentiation can be used to supplement macro morphological identification.

  20. Development of successive cambia and wood structure in stem of Rivea hypocriteriformis (Convolvulaceae

    Directory of Open Access Journals (Sweden)

    Rajput Kishore S.

    2016-07-01

    Full Text Available This study examined the formation of successive rings of cambia in Rivea hypocriteriformis Choisy (Convolvulaceae. The mature stem is composed of four to five rings of xylem alternating with phloem. Successive cambia originate as smaller and larger segments; union and anastomosing of small cambial segments often leads to the formation of discontinuous rings. In the initial stage of growth, several vascular bundles interconnect to form the first ring of vascular cambium. The cambium remains functional for one complete season and becomes dormant during summer; a new ring of cambium is completed prior to the subsequent monsoon season and sprouting of new leaves. Successive cambia are initiated from the pericyclic parenchyma situated three to four cell layers outside of the protophloem. Functionally, all the successive cambia are bidirectional and produce secondary xylem centripetally and phloem centrifugally. The secondary xylem is diffuse-porous, with indistinct growth rings and consisting of wide fibriform vessels, fibre tracheids, and axial and ray parenchyma cells. The xylem rays are uni- to multiseriate and heterocellular. The multiseriate rays contain lignified marginal ray cells and thin-walled, unlignified central cells. The central ray cells also show accumulations of starch and druses. Discrete strands of intraxylary phloem occur at the periphery of the pith, and additional intraxylary phloem develops from adjacent cells as secondary growth progresses. Earlier-formed phloem shows heavy accumulation of callose, followed by its compaction. The development of successive cambia is correlated with extension growth and with the phenology of the plant.

  1. PERKEMBANGAN AERENKIM AKAR KANGKUNG DARAT (Ipomoea reptans Poir DAN KANGKUNG AIR (Ipomoea aquatic Forsk

    Directory of Open Access Journals (Sweden)

    Aliya Ningsih

    2016-09-01

    Full Text Available Abstrak Penelitian tentang perkembangan aerenkim pada kangkung darat dan kangkung air telah dilakukan pada bulan Oktober 2014 sampai Februari 2015 di Laboratorium Struktur Perkembangan Tumbuhan Jurusan Biologi Fakultas Matematika dan Ilmu Pengetahuan Alam, Universitas Andalas. Jaringan akar diproses dengan metode parafin, kemudian dideskripsikan secara kuantitatif. Rongga aerenkim pada kangkung air terbentuk pada minggu ke tiga dengan jumlah dua rongga sel sedangkan pada kangung darat terbentuk pada minggu ke empat. Proses pembentukan aerenkim terjadi melalui proses pelisisan sel korteks.Abstract Research of aerenchyma development on terrestrial kale Ipomea reptans poir and water kale Ipomoea aquatic Forsk was conducted from October, 2014 until February, 2015 at Laboratory of plant growth structure, the Faculty of Math and Science, Department of Biology, Andalas University. Kales were analyzed by using paraffin method then described by quantitive data. Results showed: (i aerenchyma cavities were formed in the 1st week, (ii aquatic Forsks with two cell cavities were formed in the 3rd week, (iii terrestrial kales were formed in the 4th week. The formation process of aerenchyma occurred through lysis process of cortical cell.

  2. Systematics and plastid genome evolution of the cryptically photosynthetic parasitic plant genus Cuscuta (Convolvulaceae

    Directory of Open Access Journals (Sweden)

    Kuehl Jennifer V

    2007-12-01

    Full Text Available Abstract Background The genus Cuscuta L. (Convolvulaceae, commonly known as dodders, are epiphytic vines that invade the stems of their host with haustorial feeding structures at the points of contact. Although they lack expanded leaves, some species are noticeably chlorophyllous, especially as seedlings and in maturing fruits. Some species are reported as crop pests of worldwide distribution, whereas others are extremely rare and have local distributions and apparent niche specificity. A strong phylogenetic framework for this large genus is essential to understand the interesting ecological, morphological and molecular phenomena that occur within these parasites in an evolutionary context. Results Here we present a well-supported phylogeny of Cuscuta using sequences of the nuclear ribosomal internal transcribed spacer and plastid rps2, rbcL and matK from representatives across most of the taxonomic diversity of the genus. We use the phylogeny to interpret morphological and plastid genome evolution within the genus. At least three currently recognized taxonomic sections are not monophyletic and subgenus Cuscuta is unequivocally paraphyletic. Plastid genes are extremely variable with regards to evolutionary constraint, with rbcL exhibiting even higher levels of purifying selection in Cuscuta than photosynthetic relatives. Nuclear genome size is highly variable within Cuscuta, particularly within subgenus Grammica, and in some cases may indicate the existence of cryptic species in this large clade of morphologically similar species. Conclusion Some morphological characters traditionally used to define major taxonomic splits within Cuscuta are homoplastic and are of limited use in defining true evolutionary groups. Chloroplast genome evolution seems to have evolved in a punctuated fashion, with episodes of loss involving suites of genes or tRNAs followed by stabilization of gene content in major clades. Nearly all species of Cuscuta retain some

  3. Systematics and plastid genome evolution of the cryptically photosynthetic parasitic plant genus Cuscuta (Convolvulaceae).

    Science.gov (United States)

    McNeal, Joel R; Arumugunathan, Kathiravetpilla; Kuehl, Jennifer V; Boore, Jeffrey L; Depamphilis, Claude W

    2007-12-13

    The genus Cuscuta L. (Convolvulaceae), commonly known as dodders, are epiphytic vines that invade the stems of their host with haustorial feeding structures at the points of contact. Although they lack expanded leaves, some species are noticeably chlorophyllous, especially as seedlings and in maturing fruits. Some species are reported as crop pests of worldwide distribution, whereas others are extremely rare and have local distributions and apparent niche specificity. A strong phylogenetic framework for this large genus is essential to understand the interesting ecological, morphological and molecular phenomena that occur within these parasites in an evolutionary context. Here we present a well-supported phylogeny of Cuscuta using sequences of the nuclear ribosomal internal transcribed spacer and plastid rps2, rbcL and matK from representatives across most of the taxonomic diversity of the genus. We use the phylogeny to interpret morphological and plastid genome evolution within the genus. At least three currently recognized taxonomic sections are not monophyletic and subgenus Cuscuta is unequivocally paraphyletic. Plastid genes are extremely variable with regards to evolutionary constraint, with rbcL exhibiting even higher levels of purifying selection in Cuscuta than photosynthetic relatives. Nuclear genome size is highly variable within Cuscuta, particularly within subgenus Grammica, and in some cases may indicate the existence of cryptic species in this large clade of morphologically similar species. Some morphological characters traditionally used to define major taxonomic splits within Cuscuta are homoplastic and are of limited use in defining true evolutionary groups. Chloroplast genome evolution seems to have evolved in a punctuated fashion, with episodes of loss involving suites of genes or tRNAs followed by stabilization of gene content in major clades. Nearly all species of Cuscuta retain some photosynthetic ability, most likely for nutrient

  4. Control of amphibious weed ipomoea (Ipomoea carnea) by utilizing it for the extraction of volatile fatty acids as energy precursors.

    Science.gov (United States)

    Rafiq Kumar, M; Tauseef, S M; Abbasi, Tasneem; Abbasi, S A

    2015-01-01

    Volatile fatty acids (VFAs), comprising mainly of acetic acid and lesser quantities of propionic and butyric acids, are generated when zoomass or phytomass is acted upon by acidogenic and acetogenic microorganisms. VFAs can be utilized by methanogens under anaerobic conditions to generate flammable methane-carbon dioxide mixtures known as 'biogas'. Acting on the premise that this manner of VFA utilization for generating relatively clean energy can be easily accomplished in a controlled fashion in conventional biogas plants as well as higher-rate anaerobic digesters, we have carried out studies aimed to generate VFAs from the pernicious weed ipomoea (Ipomoea carnea). The VFA extraction was accomplished by a simple yet effective technology, appropriate for use even by laypersons. For this acid-phase reactors were set, to which measured quantities of ipomoea leaves were charged along with water inoculated with cow dung. The reactors were stirred intermittently. It was found that VFA production started within hours of the mixing of the reactants and peaked by the 10(th) or 11(th) day in all the reactors, effecting a conversion of over 10% of the biomass into VFAs. The reactor performance had good reproducibility and the process appeared easily controllable, frugal and robust.

  5. Control of amphibious weed ipomoea (Ipomoea carnea by utilizing it for the extraction of volatile fatty acids as energy precursors

    Directory of Open Access Journals (Sweden)

    M. Rafiq Kumar

    2015-01-01

    Full Text Available Volatile fatty acids (VFAs, comprising mainly of acetic acid and lesser quantities of propionic and butyric acids, are generated when zoomass or phytomass is acted upon by acidogenic and acetogenic microorganisms. VFAs can be utilized by methanogens under anaerobic conditions to generate flammable methane–carbon dioxide mixtures known as ‘biogas’. Acting on the premise that this manner of VFA utilization for generating relatively clean energy can be easily accomplished in a controlled fashion in conventional biogas plants as well as higher-rate anaerobic digesters, we have carried out studies aimed to generate VFAs from the pernicious weed ipomoea (Ipomoea carnea. The VFA extraction was accomplished by a simple yet effective technology, appropriate for use even by laypersons. For this acid-phase reactors were set, to which measured quantities of ipomoea leaves were charged along with water inoculated with cow dung. The reactors were stirred intermittently. It was found that VFA production started within hours of the mixing of the reactants and peaked by the 10th or 11th day in all the reactors, effecting a conversion of over 10% of the biomass into VFAs. The reactor performance had good reproducibility and the process appeared easily controllable, frugal and robust.

  6. The Antioxidant Activity and the Effects of Convolvulus Aucheri (Convolvulaceae Extract on Biochemical Indices in Rats

    Directory of Open Access Journals (Sweden)

    R. MAMMADOV

    2014-06-01

    Full Text Available Convolvulus L., the second largest genus of the family Convolvulaceae, has about 250 species distributed mainly in the temperate and tropical regions of the world, with a cosmopolitan distribution. According to recent studies, this genus is represented in Turkey by 33 species, 9 of which are endemic. Convolvulus species are extensively used in traditional medicine for various purposes as in ulcer treatment, diabetes, and tension. The aim of this study was to investigate the antioxidant activity and the effects of Convolvulus aucheri extract on biochemical indices in rats.The antioxidant activities of various solvent extracts (methanol, ethanol, acetone and benzene obtained from C. aucheri were evaluated by using 2,2-diphenyl-1-picrylhydrazyl (DPPH and β-carotene-linoleic acid assays. In addition, total phenolic contents in all the extracts of C. aucheri were determined as gallic acid equivalents. As for the biochemical assay, the extracts of the plant at the concentrations of 0.5 and 1 ml/100 g body weight/day were administered orally to the experimental groups for 36 days. Blood samples were taken by cardiac venipuncture on the 2nd and 4th weeks after the initial treatment. Aspartate aminotransferase (AST, alanine aminotransferase (ALT, gamma-glutamyltransferase (GGT and blood urea nitrogen (BUN were measured for the determination of liver function.Among all the extracts, the ethanolic extracts of C. aucheri showed the highest antioxidant activity (66.88 ± 0.8%. The highest free radical scavenging activity (59.50 ± 1.2% was recorded on the ethanolic extracts. The phenolic contents of the ethanolic extracts are higher than the other types of extracts (23.03 mg/g GAE. In biochemical assay, it was found a significant increase in the levels of serum ALT, AST and decrease the serum GGT levels in the experimental groups when compared to the controls (p<0.05. On the other hand, we found significant increase in the level of BUN.

  7. Sensorial, physical and chemical evaluation of bio-fortified Ipomoea batatas

    OpenAIRE

    Mara N.G. Santos; Joice V.C. Orsine; Alexandre I. de A. Pereira; Roberto Cañete; María R.C.G. Novaes

    2014-01-01

    Context: Bio-fortified sweet potato, Ipomoea batatas (L.) Lamarck beta-carotene rich, has been included in the most vulnerable population’s diet with the purpose of reducing health disturbances associated with hipovitaminosis. Aims:To evaluate a physical and chemical analysis of total carotenes and beta-carotene and to determine the antioxidant potential as well as to carry out a sensorial analysis of the bio-fortified Ipomoea batatas (L.) Lamarck (BDB) in nature and processed. Method...

  8. The effect of coloured light on Ipomoea purpurea growth

    International Nuclear Information System (INIS)

    Surducan, Vasile; Lung, Ildiko; Surducan, Emanoil

    2009-01-01

    Ipomoea purpurea is a climbing ornamental plant native to Mexico. The paper is describing the experimental setup and results for indoor growing plants exposed to white LED light (inside a reference chamber) and four different wavelength LED lights (inside a measure chamber). Four growing experiments of 12-15 days, took place in identical environmental conditions (identical temperature and relative humidity inside the reference and measure chambers, similar lighting conditions and soil moisture). At the end of the experiments, the plant chlorophyll and xanthophylls content have been measured and the plant aspect (vegetal mass, leaves colour and robustness) has been observed. The smallest content in chlorophyll (a and b) was developed by the plants growth in blue light (480 nm), however those plants where 10% taller than plants growth in white light, but less robust. The higher content in carotenoids and xanthophylls was observed in plants which growth in white and red light.

  9. The effect of coloured light on Ipomoea purpurea growth

    Science.gov (United States)

    Surducan, Vasile; Lung, Ildiko; Surducan, Emanoil

    2009-08-01

    Ipomoea purpurea is a climbing ornamental plant native to Mexico. The paper is describing the experimental setup and results for indoor growing plants exposed to white LED light (inside a reference chamber) and four different wavelength LED lights (inside a measure chamber). Four growing experiments of 12-15 days, took place in identical environmental conditions (identical temperature and relative humidity inside the reference and measure chambers, similar lighting conditions and soil moisture). At the end of the experiments, the plant chlorophyll and xanthophylls content have been measured and the plant aspect (vegetal mass, leaves colour and robustness) has been observed. The smallest content in chlorophyll (a and b) was developed by the plants growth in blue light (480 nm), however those plants where 10% taller than plants growth in white light, but less robust. The higher content in carotenoids and xanthophylls was observed in plants which growth in white and red light.

  10. Penetapan Kadar Kalsium, Kalium, Dan Natrium Pada Kangkung (Ipomoea Aquatica Forssk.) Secara Spektrofotometri Serapan Atom

    OpenAIRE

    Hasibuan, Anggita Vela

    2016-01-01

    Kangkung is one of the vegetables that are quite popular in public and this plant include in the tribe of convolvulaceae. This plant contains many important elements that needed by the body, that are carbohydrate, protein, fat, vitamins, and mineral such as calcium, potassium, phosphorus, iron, and sodium. The purpose of this research was to determine the level of calcium, potassium, and sodium in land kangkung and water kangkung. Methods of research conducted by dried destruction to the...

  11. The role of stamens in ethylene production in Ipomoea nil

    International Nuclear Information System (INIS)

    Kiss, H.G.

    1989-01-01

    Ethylene production inhibits filament and corolla growth during young stages in flower development, and it promotes corolla unfolding and senescence in Ipomoea nil. Initial studies with the in vitro application of gibberellic acid (GA 3 ), demonstrated that decreased filament growth occurred when the anthers remained attached to the filaments during the young stages in development. The removal of the anthers from intact plants did not enhance filament growth until the synthesis of wound ethylene was inhibited by applied aminoethoxyvinylglycine (AVG) or cobalt chloride. It was hypothesized that the anthers were source tissues and that the filaments were transport vectors for the ethylene precursor 1-aminocyclopropane-1-carboxylic acid (ACC) and indole-3-acetic acid (IAA) to regulate growth events in the various floral organs. To test this hypothesis, endogenous IAA and ACC and ethylene production were measured by enzyme linked immunosorbent assay (ELISA) or gas chromatography. The transport of 14 C-IAA and 14 C-ACC through filament segments and filaments within intact flower buds also was examined during flower development

  12. Is Allelopathic Activity of Ipomoea murucoides Induced by Xylophage Damage?

    Science.gov (United States)

    Flores-Palacios, Alejandro; Corona-López, Angélica María; Rios, María Yolanda; Aguilar-Guadarrama, Berenice; Toledo-Hernández, Víctor Hugo; Rodríguez-López, Verónica; Valencia-Díaz, Susana

    2015-01-01

    Herbivory activates the synthesis of allelochemicals that can mediate plant-plant interactions. There is an inverse relationship between the activity of xylophages and the abundance of epiphytes on Ipomoea murucoides. Xylophagy may modify the branch chemical constitution, which also affects the liberation of allelochemicals with defense and allelopathic properties. We evaluated the bark chemical content and the effect of extracts from branches subjected to treatments of exclusion, mechanical damage and the presence/absence of epiphytes, on the seed germination of the epiphyte Tillandsia recurvata. Principal component analysis showed that branches without any treatment separate from branches subjected to treatments; damaged and excluded branches had similar chemical content but we found no evidence to relate intentional damage with allelopathy; however 1-hexadecanol, a defense volatile compound correlated positively with principal component (PC) 1. The chemical constitution of branches subject to exclusion plus damage or plus epiphytes was similar among them. PC2 indicated that palmitic acid (allelopathic compound) and squalene, a triterpene that attracts herbivore enemies, correlated positively with the inhibition of seed germination of T. recurvata. Inhibition of seed germination of T. recurvata was mainly correlated with the increment of palmitic acid and this compound reached higher concentrations in excluded branches treatments. Then, it is likely that the allelopathic response of I. murucoides would increase to the damage (shade, load) that may be caused by a high load of epiphytes than to damage caused by the xylophages.

  13. Is Allelopathic Activity of Ipomoea murucoides Induced by Xylophage Damage?

    Directory of Open Access Journals (Sweden)

    Alejandro Flores-Palacios

    Full Text Available Herbivory activates the synthesis of allelochemicals that can mediate plant-plant interactions. There is an inverse relationship between the activity of xylophages and the abundance of epiphytes on Ipomoea murucoides. Xylophagy may modify the branch chemical constitution, which also affects the liberation of allelochemicals with defense and allelopathic properties. We evaluated the bark chemical content and the effect of extracts from branches subjected to treatments of exclusion, mechanical damage and the presence/absence of epiphytes, on the seed germination of the epiphyte Tillandsia recurvata. Principal component analysis showed that branches without any treatment separate from branches subjected to treatments; damaged and excluded branches had similar chemical content but we found no evidence to relate intentional damage with allelopathy; however 1-hexadecanol, a defense volatile compound correlated positively with principal component (PC 1. The chemical constitution of branches subject to exclusion plus damage or plus epiphytes was similar among them. PC2 indicated that palmitic acid (allelopathic compound and squalene, a triterpene that attracts herbivore enemies, correlated positively with the inhibition of seed germination of T. recurvata. Inhibition of seed germination of T. recurvata was mainly correlated with the increment of palmitic acid and this compound reached higher concentrations in excluded branches treatments. Then, it is likely that the allelopathic response of I. murucoides would increase to the damage (shade, load that may be caused by a high load of epiphytes than to damage caused by the xylophages.

  14. Crystallization and preliminary X-ray analysis of carnein, a serine protease from Ipomoea carnea.

    NARCIS (Netherlands)

    Patel, A.K.; Oosterwijk, N. van; Singh, V.K.; Rozeboom, H.J.; Kalk, K.H.; Siezen, R.J.; Jagannadham, M.V.; Dijkstra, B.W.

    2009-01-01

    Carnein is an 80 kDa subtilisin-like serine protease from the latex of the plant Ipomoea carnea which displays an exceptional resistance to chemical and thermal denaturation. In order to obtain the first crystal structure of a plant subtilisin and to gain insight into the structural determinants

  15. Bio-deterioration of sweet potato (ipomoea batatas lam) in storage ...

    African Journals Online (AJOL)

    Michael Horsfall

    ABSTRACT: The biodeterioration of sweet potato (Ipomoea batatas) was investigated at Port. Harcourt, south southern Nigeria. Aspergillus niger, Fusarium oxysporum, Rhizopus stolonifer,. Botryodiplodia theobroma and Penicillium sp. were found to be associated with deteriorating sweet potato tubers and used for ...

  16. Gamma irradiation effect on the chemical composition and the antioxidant activity of Ipomoea batatas L

    Energy Technology Data Exchange (ETDEWEB)

    Tahir, D., E-mail: dtahir@fmipa.unhas.ac.id; Halide, H., E-mail: dtahir@fmipa.unhas.ac.id; Kurniawan, D. [Department of Physics, Hasanuddin University, Makassar 90245 (Indonesia); Wahab, A. W. [Department of Chemistry, Hasanuddin University, Makassar 90245 (Indonesia)

    2014-09-25

    The chemical composition and antioxidant activity of Ipomoea batatas L. (sweet potato) were studied by x-ray fluorescence (XRF) spectroscopy, Fourier transform infrared spectroscopy, and by the 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging capacity. The irradiation treatment was performed by using Cs-137 as a gamma sources in experimental equipment. Treatment by irradiation emerges as a possible conservation technique that has been tested successfully in several food products. The amount of chemical composition was changed and resulting new chemical for absorbed dose 40 mSv. Interestingly, it was found that gamma irradiation significantly increased the antioxidant activity, as measured by DPPH radical scavenging capacity. The antioxidant activity of Ipomoea batatas L. extract was dramatically increased in the non-irradiated sample to the sample irradiated at 40 mSv. These results indicate that gamma irradiation of Ipomoea batatas L. extract can enhance its antioxidant activity through the formation of a new chemical compound. Based on these results, increased antioxidant activity of Ipomoea batatas L. extracts by gamma rays can be applied to various industries, especially cosmetics, foodstuffs, and pharmaceuticals.

  17. The use of ultrasonography to study teratogenicity in ruminants: Evaluation of Ipomoea carnea in goats

    Science.gov (United States)

    Ipomoea carnea (I. carnea) is a poisonous plant found in Brazil and other tropical countries that often poison livestock. The plant contains calystegines and swainsonine, which inhibit cellular enzymes and cause systematic cell death. The objective of this study was to evaluate the perinatal effects...

  18. Maternal ingestion of Ipomoea carnea: Effects on goat-kid bonding and behavior

    Science.gov (United States)

    Ipomoea carnea is a toxic plant found in Brazil and other tropical and subtropical countries and often causes poisoning of livestock. The plant contains the alkaloids swainsonine and calystegines, which inhibit key cellular enzymes and cause systematic cell death. This study evaluated the behavioral...

  19. Conditioned food aversion to control outbreaks of intoxication by Ipomoea carnea and Turbina cordata in goats

    Science.gov (United States)

    Conditioned food aversion is used to train livestock to avoid the ingestion of toxic plants. This technique was used to control Turbina cordata poisoning in goats in one farm, and to control Ipomoea carnea subsp. istulosa poisoning in another farm. The goats were penned at night and the next mornin...

  20. Conditioned food aversion to control poisoning by Ipomoea carnea subsp. fistulosa in goats

    Science.gov (United States)

    Ipomoea carnea is a toxic plant often ingested by livestock in Brazil. Three experiments were conducted to determine if conditioned food aversion was effective in reducing goats’ consumption of I. carnea. In the fi rst experiment, 10 mildly intoxicated goats that had been eating I. carnea were avert...

  1. Plastid genome evolution across the genus Cuscuta (Convolvulaceae): two clades within subgenus Grammica exhibit extensive gene loss.

    Science.gov (United States)

    Braukmann, Thomas; Kuzmina, Maria; Stefanovic, Sasa

    2013-02-01

    The genus Cuscuta (Convolvulaceae, the morning glory family) is one of the most intensely studied lineages of parasitic plants. Whole plastome sequencing of four Cuscuta species has demonstrated changes to both plastid gene content and structure. The presence of photosynthetic genes under purifying selection indicates that Cuscuta is cryptically photosynthetic. However, the tempo and mode of plastid genome evolution across the diversity of this group (~200 species) remain largely unknown. A comparative investigation of plastid genome content, grounded within a phylogenetic framework, was conducted using a slot-blot Southern hybridization approach. Cuscuta was extensively sampled (~56% of species), including groups previously suggested to possess more altered plastomes compared with other members of this genus. A total of 56 probes derived from all categories of protein-coding genes, typically found within the plastomes of flowering plants, were used. The results indicate that two clades within subgenus Grammica (clades 'O' and 'K') exhibit substantially more plastid gene loss relative to other members of Cuscuta. All surveyed members of the 'O' clade show extensive losses of plastid genes from every category of genes typically found in the plastome, including otherwise highly conserved small and large ribosomal subunits. The extent of plastid gene losses within this clade is similar in magnitude to that observed previously in some non-asterid holoparasites, in which the very presence of a plastome has been questioned. The 'K' clade also exhibits considerable loss of plastid genes. Unlike in the 'O' clade, in which all species seem to be affected, the losses in clade 'K' progress phylogenetically, following a pattern consistent with the Evolutionary Transition Series hypothesis. This clade presents an ideal opportunity to study the reduction of the plastome of parasites 'in action'. The widespread plastid gene loss in these two clades is hypothesized to be a

  2. Dye-sensitized solar cell using natural dyes extracted from spinach and ipomoea

    Energy Technology Data Exchange (ETDEWEB)

    Chang, H., E-mail: f10381@ntut.edu.t [Department of Mechanical Engineering, National Taipei University of Technology, No. 1. Sec. 3, Chung-Hsiao E. Rd., Taipei 10608, Taiwan (China); Wu, H.M. [Department of Materials Engineering, Tatung University, No. 40, Sec. 3, Jhongshan N. Rd. Jhongshan District, Taipei City 104, Taiwan (China); Chen, T.L. [Department of Industrial Design, National Taipei University of Technology, No. 1, Sec. 3, Chung-Hsiao E. Rd., Taipei 10608, Taiwan (China); Huang, K.D. [Department of Vehicle Engineering, National Taipei University of Technology, No. 1, Sec. 3, Chung-Hsiao E. Rd., Taipei 10608, Taiwan (China); Jwo, C.S. [Department of Energy and Air-Conditioning Refrigeration Engineering, National Taipei University of Technology, No. 1, Sec. 3, Chung-Hsiao E. Rd., Taipei 10608, Taiwan (China); Lo, Y.J. [Department of Mechanical Engineering, National Taipei University of Technology, No. 1. Sec. 3, Chung-Hsiao E. Rd., Taipei 10608, Taiwan (China)

    2010-04-16

    This study used spinach extract, ipomoea leaf extract and their mixed extracts as the natural dyes for a dye-sensitized solar cell (DSSC). Spinach and ipomoea leaves were first placed separately in ethanol and the chlorophyll of these two kinds of plants was extracted to serve as the natural dyes for using in DSSCs. In addition, the self-developed nanofluid synthesis system prepared a TiO{sub 2} nanofluid with an average particle size of 50 nm. Electrophoresis deposition was performed to let the TiO{sub 2} deposit nanoparticles on the indium tin oxide (ITO) conductive glass, forming a TiO{sub 2} thin film with the thickness of 11.61 {mu}m. This TiO{sub 2} thin film underwent sintering at 450 {sup o}C to enhance the compactness of thin film. Finally, the sintered TiO{sub 2} thin film was immersed in the natural dye solutions extracted from spinach and ipomoea leaves, completing the production of the anode of DSSC. This study then further inspected the fill factor, photoelectric conversion efficiency and incident photon current efficiency of the encapsulated DSSC. According to the experimental results of current-voltage curve, the photoelectric conversion efficiency of the DSSCs prepared by natural dyes from ipomoea leaf extract is 0.318% under extraction temperature of 50 {sup o}C and pH value of extraction fluid at 1.0. This paper also investigated the influence of the temperature in the extraction process of this kind of natural dye and the influence of pH value of the dye solution on the UV-VIS patterns absorption spectra of the prepared natural dye solutions, and the influence of these two factors on the photoelectric conversion efficiency of DSSC.

  3. Comparative Study on the Antioxidant Activity of Leaf Extract and Carotenoids Extract from Ipomoea batatas var. Oren (Sweetpotato) Leaves

    OpenAIRE

    Seow-Mun Hue; Amru Nasrulhaq Boyce; Chandran Somasundram

    2011-01-01

    Ipomoea batatas (Sweetpotato) is currently ranked sixth in the total world food production and are planted mainly for their storage roots. The present study was undertaken to evaluate and compare the antioxidant properties of the leaf and carotenoids extract from the Ipomoea batatas var. Oren leaves. Total flavonoids in the leaf extract was 144.6 ± 40.5 μg/g compared to 114.86 ± 4.35 μg/g catechin equivalent in the carotenoids extract. Total polyphenols in the leaf extrac...

  4. Somatic embryogenesis in Malaysian cultivars of sweet potato (Ipomoea batatas L.).

    OpenAIRE

    De Silva, Angela Ee

    2017-01-01

    Three Malaysian sweet potato cultivars, namely Ipomoea batatas (L.) cv. Gendut, Jalomas and Telong, were investigated for their abilities to produce somatic embryos. Shoot meristems were used as the starting materials and cultured on Murashige and Skoog basal media (Murashige and Skoog, 1962) in the presence of auxin 2,4-dichlorophenoxyacetic acid (2,4-D) or 2,4,5-trichlorophenoxyacetic acid (2,4,5-T). Auxin 2,4,5-T at 5 µM was most effective for the initiation of primary embryogenic formati...

  5. Identificación in silico de un grupo de secuencias ortólogas conservadas (COS de Ipomoea batatas

    Directory of Open Access Journals (Sweden)

    Christian Solís Calero

    2013-03-01

    Full Text Available En el presente trabajo se describe una serie de procedimientos bioinformáticos para la predicción de un grupo secuencias ortólogas conservadas (COS de Ipomoea batatas, así como la evaluación de su potencial utilidad para la generación de marcadores moleculares y estudios de diversidad en esta especie. Con ese propósito usando los programas BLAST X y TBLASTN se realizó una comparación reciproca por similaridad entre secuencias ESTs procedentes de librerías de cDNAs de Ipomoea batatas, propias o disponibles de modo público en la base de datos GenBank, con secuencias COS de Arabidopsis thaliana. La anotación funcional de las secuencias COS predichas en Ipomoea batatas se realizo usando los programas BLASTX, INTERPROSCAN y PSI-BLAST. Se obtuvieron en total 204 secuencias COS candidatos de Ipomoea batatas, siendo 16 secuencias provenientes de una librería generada a partir de raíces de reserva. Se evaluó de modo computacional el polimorfismo de las secuencias COS de raíces de reserva, obteniéndose SNPs en 8 secuencias, y secuencias repetidas en tandem en una de ellas.

  6. Bioaccumulation of metals and metalloids in medicinal plant Ipomoea pes-caprae from areas impacted by tsunami.

    Science.gov (United States)

    Kozak, Lidia; Kokociński, Mikołaj; Niedzielski, Przemysław; Lorenc, Stanisław

    2015-02-01

    Tsunami events may have an enormous impact on the functioning of aquatic and terrestrial ecosystems by altering various relationships with biotic components. Concentrations of acid-leachable fractions of heavy metals and metalloids in soils and plant samples from areas affected by the December 2004 tsunami in Thailand were determined. Ipomoea pes-caprae, a common plant species growing along the seashore of this region, and frequently used in folk medicine, was selected to assess the presence of selected elements. Elevated amounts of Cd, Pb, Zn, and As in soil samples, and Pb, Zn, As, Se, Cr, and Ni in plant samples were determined from the tsunami-impacted regions for comparison with reference locations. The flowers of Ipomoea pes-caprae contained the highest amounts of these metals, followed by its leaves, and stems. In addition, its bioaccumulation factor (BAF) supports this capability of high metal uptake by Ipomoea pes-caprae from the areas affected by the tsunami in comparison with a reference site. This uptake was followed by the translocation of these elements to the various plant components. The presence of these toxic metals in Ipomoea pes-caprae growing in contaminated soils should be a concern of those who use this plant for medicinal purposes. Further studies on the content of heavy metals and metalloids in this plant in relation to human health concerns are recommended. © 2014 SETAC.

  7. Characterization and effect of Azotobacter, Azospirillum and Pseudomonas associated with Ipomoea Batatas of Colombian Caribbean

    Directory of Open Access Journals (Sweden)

    Jazmín Vanessa Pérez-Pazos

    2017-07-01

    Full Text Available The use of plant growth promoting Rhizobacteria (PGPR is an alternative to replace chemical fertilizers for the cultivation of agricultural crops. The aim of this research was to search, selection and characterization of PGPR from the genus Azotobacter, Azospirillum and Pseudomonas natives from sweet potato (Ipomoea batatas plants and rhizosphere of representative production regions of the Colombian Caribbean. Selected isolates were identified by molecular methods and they were screened in vitro for activities related to plant growth such as phosphate solubilization, indole production and acetylene reduction. The strains were tested in the greenhouse on plants of Ipomoea batatas produced in vitro. The height, root length, dry mass of the shot and root were evaluated. Associated with sweet potato crop us finded strains identificated as Azotobacter vinelandii, Azotobacter chroococcum, Azospirillum lipoferum, Azospirillum brasilense and Pseudomonas denitrificans. The strains were able to solubilize phosphate, synthesize indole-3-acetic acid (IAA and reduce acetylene. The inoculation of bacteria selected increased growth parameters such as root length, height, dry weight root and shoot in plants of sweet potato in greenhouse. Those results catalog to the isolated obtained as possible microorganisms with potential as biofertilizers in sweet potato.

  8. Identification and characterization of an Ipomoea nil glucosyltransferase which metabolizes some phytohormones

    International Nuclear Information System (INIS)

    Suzuki, Hiroyuki; Hayase, Hiroki; Nakayama, Akira; Yamaguchi, Isomaro; Asami, Tadao; Nakajima, Masatoshi

    2007-01-01

    A glucosyltransferase gene InGTase1 was identified from the immature seeds of morning glory (Ipomoea nil), whose product shows a broad substrate-preference, including that of some phytohormones. When 2-trans-abscisic acid, indole-3-acetic acid, salicylic acid (SA) or (±)-jasmonic acid was reacted with InGTase1 and UDP-[ 14 C]-glucose, each 14 C-labeled compound with high polarity was detected after thin layer chromatography. SA metabolites were identified as SA glucosyl ester by using 1 H NMR and GC/MS. Detailed substrate-preferences of InGTase1 were examined with some analogous compounds, which elucidated that the arm length and/or orientation of a carboxyl group of the compounds or its surrounding electron density severely affected the enzymatic activity. The broad substrate-preference will greatly contribute to the synthesis of various glucoconjugates

  9. Genetic variability, correlation and path analysis of yield contributing characters in sweet potato (ipomoea batatas lam.)

    International Nuclear Information System (INIS)

    Hossain, M.D.; Rabbani, M.G.; Mollah, M.L.R.

    2000-01-01

    Evaluation of 30 sweet potato (Ipomoea batatas Lam.) genotypes for yield contributing characters and tuber yield per plant revealed high phenotypic and genotypic coefficient of variation (PCV and GCV, respectively) for number of tubers per plant, average tuber weight and tuber yield per plant. The heritability and genetic advance were higher for tuber yield per plant, average tuber weight and number of tubers per plant. These three characters also reflected high heritability as well as high genetic advance. As high positive significant correlation, as well as positive direct effect of average tuber weight and number of tubers per plant on tuber yield per plant were found, these characters should be given prime importance for selecting high yielding sweet potato genotypes. (author)

  10. Morphohistobiochemical characteristics of embryogenic and nonembryogenic callus cultures of sweet potato (Ipomoea batatas L.).

    Science.gov (United States)

    Mukherjee, A; Debata, B K; Mukherjee, P S; Malik, S K

    2001-01-01

    Ipomoea batatas callus culture raised in a medium supplemented with 2,4-D (2,4-dichlorophenoxy acetic acid) alone or 2,4-D in combination with benzyl adenine, were found to be embryogenic. Supplementation of exogenous chemicals, such as 5 g/l NaCI or 0.7 g/l proline together with a mild dose of 0.2 mg/l 2,4-D, enhanced somatic embryogenesis significantly in all the genotypes tested. Morphological, growth, physiological, histological, and biochemical characteristics of the embryogenic callus were different from the nonembryogenic callus. The former was compact, slow growing, and nodular compared with the fast growing, fragile, nonembryogenic callus. The embryogenic callus tissue had more dry matter, protein and reducing sugar contents compared with the less embryogenic callus. The somatic embryogenic response remained steady in the cultures for up to 96 weeks.

  11. Antifungal activity and isomerization of octadecyl p-coumarates from Ipomoea carnea subsp. fistulosa.

    Science.gov (United States)

    Nidiry, Eugene Sebastian J; Ganeshan, Girija; Lokesha, Ankanahalli N

    2011-12-01

    Bioassay monitored HPLC assisted isolation and purification of the chief antifungal fraction of the leaves of Ipomoea carnea subsp. fistulosa (Convulvulaceae) were achieved using Colletotrichum gloeosporioides and Cladosporium cucumerinum as test organisms. The activity of the purified fraction was further confirmed by the dose dependent inhibition of the spore germination of Alternaria alternata and A. porri. The active fraction was identified as a mixture of (E)-octadecyl p-coumarate and (Z)-octadecyl p-coumarate. The two isomers were detected on an HPLC column with substantially different retention times, but once eluted from the column, one form was partly converted to the other in daylight. Conclusive evidence for the structures and their isomerization were obtained from the HPLC behavior, IR, UV, HRESIMS, CIMS and and NMR spectral data. Important 1H NMR and 13C NMR signals could be separately assigned for the isomers using 2D NMR techniques.

  12. Caesium Radionuclide Uptake from Wet Soil to Kangkung Plant (Ipomoea sp)

    International Nuclear Information System (INIS)

    Putu Sukmabuana; Poppy Intan Tjahaja

    2009-01-01

    Caesium radionuclide transfer from soil to kangkung plant (Ipomoea sp) generally consumed by people had been examined to obtain transfer factor value for internal radiation dose assessment via soil-plant-human pathway. The kangkung plants were cultivated on watered soil medium containing 134 Cs with concentration of about 80 Bq/g, and the 134 Cs uptake by plants, i.e root, stem, and leaves, were measured using gamma spectrometer. The 134 Cs plant uptake was expressed as transfer factor, i.e. ratio of plant 134 Cs concentration to 134 Cs concentration on soil medium. From this research it was obtained transfer factor value of 134 C from soil to plant is 0.07, and the transfer factor for root, stem, and leaves are 0.34 ; 0.05 ; 0,03 respectively, after 45 days cultivation. The transfer factor values are less than one, indicate that kangkung plant do not accumulate Cs radionuclide from soil. (author)

  13. Phyotoxicity of diesel soil contamination on the germination of Lactuca sativa and Ipomoea batatas.

    Science.gov (United States)

    Fatokun, Kayode; Lewu, Francis Bayo; Zharare, Godfrey Elijah

    2015-11-01

    Phytotoxic effect of diesel contaminated soil on germination rate of Lactuca sativa and Ipomoea batatas, at two concentrations ranges (0-6ml and 0-30ml), were investigated and compared. Diesel soil contamination was simulated and soil samples were taken from contaminated soil at 1, 5,10, 15, 25, 50, 75 and 100 days should be after planting. The result showed that in both plant species, diesel inhibited germination in a concentration dependent manner, Also, the influence of diesel contamination diminished with increased time duration; suggesting possible reduction in diesel toxicity over time. However, germination of lettuce was significant and negatively correlated (r2 = -0.941) with diesel contamination as compared to sweet potato (r2 = -0.638).Critical concentration of diesel in relation to seed germination of L. sativa was lower than vegetative germination of I. batatas, indicating that germination of I. batatas was less sensitive to diesel contamination as compared to L. sativa.

  14. Bioreactor with Ipomoea hederifolia adventitious roots and its endophyte Cladosporium cladosporioides for textile dye degradation

    International Nuclear Information System (INIS)

    Patil, Swapnil M.; Chandanshive, Vishal V.; Rane, Niraj R.; Khandare, Rahul V.; Watharkar, Anuprita D.; Govindwar, Sanjay P.

    2016-01-01

    In vitro grown untransformed adventitious roots (AR) culture of Ipomoea hederifolia and its endophytic fungus (EF) Cladosporium cladosporioides decolorized Navy Blue HE2R (NB-HE2R) at a concentration of 20 ppm up to 83.3 and 65%, respectively within 96 h. Whereas the AR-EF consortium decolorized the dye more efficiently and gave 97% removal within 36 h. Significant inductions in the enzyme activities of lignin peroxidase, tyrosinase and laccase were observed in roots, while enzymes like tyrosinase, laccase and riboflavin reductase activities were induced in EF. Metabolites of dye were analyzed using UV—vis spectroscopy, FTIR and gas chromatography-mass spectrometry. Possible metabolic pathways of NB-HE2R were proposed with AR, EF and AR-EF systems independently. Looking at the superior efficacy of AR-EF system, a rhizoreactor was developed for the treatment of NB-HE2R at a concentration of 1000 ppm. Control reactor systems with independently grown AR and EF gave 94 and 85% NB-HE2R removal, respectively within 36 h. The AR-EF rhizoreactor, however, gave 97% decolorization. The endophyte colonization additionally increased root and shoot lengths of candidate plants through mutualism. Combined bioreactor strategies can be effectively used for future eco-friendly remediation purposes. - Highlights: • Endophytic fungus on Ipomoea hederifolia promotes root growth and shoot development • Endophytic Cladosporium cladosporioides synergistically degrade Navy Blue-HE2R dye • Endophyte colonized I. hederifolia roots proved superior in dye decolorization • Dye stress and toxicity was efficiently dealt by root-endophyte consortium • Root-endophyte consortium can be used as a sustainable remediation strategy

  15. Bioreactor with Ipomoea hederifolia adventitious roots and its endophyte Cladosporium cladosporioides for textile dye degradation

    Energy Technology Data Exchange (ETDEWEB)

    Patil, Swapnil M. [Department of Biotechnology, Shivaji University, Kolhapur-416004 (India); Chandanshive, Vishal V. [Department of Biochemistry, Shivaji University, Kolhapur-416004 (India); Rane, Niraj R.; Khandare, Rahul V. [Department of Biotechnology, Shivaji University, Kolhapur-416004 (India); Watharkar, Anuprita D. [Department of Biochemistry, Shivaji University, Kolhapur-416004 (India); Govindwar, Sanjay P., E-mail: spg_biochem@unishivaji.ac.in [Department of Biochemistry, Shivaji University, Kolhapur-416004 (India)

    2016-04-15

    In vitro grown untransformed adventitious roots (AR) culture of Ipomoea hederifolia and its endophytic fungus (EF) Cladosporium cladosporioides decolorized Navy Blue HE2R (NB-HE2R) at a concentration of 20 ppm up to 83.3 and 65%, respectively within 96 h. Whereas the AR-EF consortium decolorized the dye more efficiently and gave 97% removal within 36 h. Significant inductions in the enzyme activities of lignin peroxidase, tyrosinase and laccase were observed in roots, while enzymes like tyrosinase, laccase and riboflavin reductase activities were induced in EF. Metabolites of dye were analyzed using UV—vis spectroscopy, FTIR and gas chromatography-mass spectrometry. Possible metabolic pathways of NB-HE2R were proposed with AR, EF and AR-EF systems independently. Looking at the superior efficacy of AR-EF system, a rhizoreactor was developed for the treatment of NB-HE2R at a concentration of 1000 ppm. Control reactor systems with independently grown AR and EF gave 94 and 85% NB-HE2R removal, respectively within 36 h. The AR-EF rhizoreactor, however, gave 97% decolorization. The endophyte colonization additionally increased root and shoot lengths of candidate plants through mutualism. Combined bioreactor strategies can be effectively used for future eco-friendly remediation purposes. - Highlights: • Endophytic fungus on Ipomoea hederifolia promotes root growth and shoot development • Endophytic Cladosporium cladosporioides synergistically degrade Navy Blue-HE2R dye • Endophyte colonized I. hederifolia roots proved superior in dye decolorization • Dye stress and toxicity was efficiently dealt by root-endophyte consortium • Root-endophyte consortium can be used as a sustainable remediation strategy.

  16. Changes in electrophoretic profiles of Ipomoea batatas (sweet potato induced by gamma radiation

    Directory of Open Access Journals (Sweden)

    Celso Luiz Salgueiro Lage

    2002-06-01

    Full Text Available The ability of nodal segments of Ipomoea batatas to differentiate shoots and roots was evaluated after gamma irradiation. Shoot differentiation was less sensitive to irradiation than roots. However, at 90 Gy, no shoot was able to regenerate a new plant; in contrast 76 % of the roots from irradiated nodal segments continued to grow. The gamma radiation also induced changes in electrophoretic profiles of peroxidases of storage roots. Plants originated from irradiated storage roots presented changes in leaf peroxidase profiles very similar to those produced by leaves directly irradiated. The peroxidase profile of absorbent roots from irradiated storage roots was different from that obtained from directly irradiated absorbent roots.A capacidade de Ipomoea batatas diferenciar parte aérea e raízes foi avaliada após irradiação com raios gama. A diferenciação da parte aérea foi menos sensível que a das raízes. Contudo, na dose de 90 Gy nenhum broto diferenciado regenerou planta, enquanto 76 % das raízes diferenciadas dos segmentos nodais irradiados manteve o crescimento. A radiação também induziu mudanças no perfil elotroforético de isoperoxidases. Plantas originadas de raízes tuberosas irradiadas apresentaram alteração no perfil de isoperoxidases foliares semelhantes ao perfil de folhas diretamente irradiadas. O perfil de isoperoxidases de raízes absorventes irradiadas diretamente não apresentou o mesmo padrão do perfil das raízes absorventes desenvolvidas de raízes tuberosas irradiadas.

  17. Sensorial, physical and chemical evaluation of bio-fortified Ipomoea batatas

    Directory of Open Access Journals (Sweden)

    Mara N.G. Santos

    2014-08-01

    Full Text Available Context: Bio-fortified sweet potato, Ipomoea batatas (L. Lamarck beta-carotene rich, has been included in the most vulnerable population’s diet with the purpose of reducing health disturbances associated with hipovitaminosis. Aims:To evaluate a physical and chemical analysis of total carotenes and beta-carotene and to determine the antioxidant potential as well as to carry out a sensorial analysis of the bio-fortified Ipomoea batatas (L. Lamarck (BDB in nature and processed. Methods: BDB was processed as sweet (in natura, paste and syrup and physicochemical characteristics were compared, total carotenoids, beta-carotene, antioxidant activity (DPPH and microbiological and sensory analyses were performed. Results:The analysis of total carotenoids, beta-carotene and anti-oxidant potential showed the following results: BDB in nature – 11.81 mg/100 g/440.5 mg/100 g/26.30%; sweet paste – 0.61 mg/100 g/53.5 mg/100 g/53.40% and savored syrup – 0.85 mg/100 g/46.0 mg/100 g/14.30%. The methods of conservation avoided the coliforms growth at 35 and 45°C, Staphylococcus coagulasa positivo, Bacillus cereus and Salmonella in all elaborated candies. The sensorial analysis didn’t detect significant differences among the syrup or paste. Conclusions: The conservation methods have an important function keeping the physical, chemical characteristics and sensorial of BDB, although they can influence in their chemical and nutritional composition, mainly in relation to the quantity of total carotenoids and beta-carotene.

  18. Pemanfaatan Limbah Cair Industri Tahu sebagai Pupuk Cair Organik terhadap Pertumbuhan dan Produksi Tanaman Kangkung Darat (Ipomoea Reptans Poir)

    OpenAIRE

    Aliyenah, Aliyenah; A Napoleon, A Napoleon; Yudono, Bambang

    2015-01-01

    Penelitian tentang Pemanfaatan Limbah Cair Industri Tahu Sebagai Pupuk Cair Organik Terhadap Pertumbuhan Dan Produksi Tanaman Kangkung Darat (Ipomoea reptans Poir) ini telah dilaksanakan pada Ja-nuari - Maret 2013. Tujuan penelitian ini untuk mengetahui pemanfaatan limbah cair industri tahu agar dapat digunakan sebagai pupuk cair organik untuk tanaman kangkung darat. Penelitian ini dilakukan dengan meng-gunakan Rancang Acak Kelompok (RAK), dengan perlakuan konsentrasi pupuk cair organik dari ...

  19. PENGARUH PEMBERIAN PUPUK ORGANIK PADA MEDIA TANAH YANG MENGANDUNG TIMBAL (Pb) TERHADAP PERTUMBUHAN KANGKUNG DARAT (Ipomoea reptans Poir.)

    OpenAIRE

    Listiatie Budi Utami; Ulfah Rachmawati

    2016-01-01

    Kangkung darat (Ipomoea reptans Poir.) merupakan tanaman hiperakumulator  logam timbal (Pb), padahal kangkung darat banyak dikonsumsi oleh masyarakat. Penelitian ini bertujuan untuk mengetahui pertumbuhan dan kandungan timbal (Pb) kangkung darat pada berbagai dosis pupuk organik; serta untuk mengetahui dosis pupuk organik yang paling efektif untuk meningkatkan pertumbuhan dan menurunkan kandungan timbal (Pb) dalam kangkung darat. Penelitian dilakukan secara Rancangan Acak Lengkap (RAL) dengan...

  20. Likelihood analysis of the chalcone synthase genes suggests the role of positive selection in morning glories (Ipomoea).

    Science.gov (United States)

    Yang, Ji; Gu, Hongya; Yang, Ziheng

    2004-01-01

    Chalcone synthase (CHS) is a key enzyme in the biosynthesis of flavonoides, which are important for the pigmentation of flowers and act as attractants to pollinators. Genes encoding CHS constitute a multigene family in which the copy number varies among plant species and functional divergence appears to have occurred repeatedly. In morning glories (Ipomoea), five functional CHS genes (A-E) have been described. Phylogenetic analysis of the Ipomoea CHS gene family revealed that CHS A, B, and C experienced accelerated rates of amino acid substitution relative to CHS D and E. To examine whether the CHS genes of the morning glories underwent adaptive evolution, maximum-likelihood models of codon substitution were used to analyze the functional sequences in the Ipomoea CHS gene family. These models used the nonsynonymous/synonymous rate ratio (omega = d(N)/ d(S)) as an indicator of selective pressure and allowed the ratio to vary among lineages or sites. Likelihood ratio test suggested significant variation in selection pressure among amino acid sites, with a small proportion of them detected to be under positive selection along the branches ancestral to CHS A, B, and C. Positive Darwinian selection appears to have promoted the divergence of subfamily ABC and subfamily DE and is at least partially responsible for a rate increase following gene duplication.

  1. Pneumonia intersticial em bovinos associada à ingestão de batata-doce (Ipomoea batatas mofada Interstitial pneumonia in cattle fed moldy sweet potatoes (Ipomoea batatas

    Directory of Open Access Journals (Sweden)

    Rafael A. Fighera

    2003-12-01

    Full Text Available Uma doença respiratória foi diagnosticada em cinco dentre 23 bovinos (21,7% após terem sido alimentados com batata-doce (Ipomoea batatas mofada em uma pequena propriedade rural em São Vicente do Sul, Rio Grande do Sul, Brasil. Três dos cinco bovinos afetados morreram espontaneamente, e o quarto foi sacrificado para necropsia quando mostrava sinais clínicos respiratórios avançados. A manifestação clínica iniciara cerca de 24 horas após a ingestão das batatas-doces e a evolução clínica foi de 1 a 4 dias. Os sinais clínicos incluíam dispnéia (respiração laboriosa e abdominal, taquipnéia, pescoço estendido com cabeça baixa e dilatação ritmada das narinas. Dois bovinos foram necropsiados. Os achados de necropsia incluíam pulmões distendidos, pálidos e de consistência borrachenta, que não colapsavam quando o tórax era aberto; enfisema e edema acentuados eram evidentes no pulmão. Os linfonodos e o baço apresentavam alterações características de hiperplasia linfóide. Histologica-mente, as lesões eram típicas de pneumonia intersticial. Os septos alveolares estavam espessados por fibroblastos e células inflamatórias, havia hipertrofia e hiperplasia de pneumócitos tipo II; os septos interlobulares estavam distendidos por edema e enfisema. A cultura de amostras das batatas-doces mofadas produziu Fusarium solani e F. oxysporum.Cases of respiratory disease were diagnosed in five out of 23 cattle (21.7% after they were fed moldy damaged sweet potatoes (Ipomoea batatas on a small farm in the county of São Vicente do Sul, state of Rio Grande do Sul, Brazil. Of those five cattle, three died spontaneously and another one was euthanatized for necropsy while showing advanced respiratory clinical signs. The disease manifested itself approximately 24 hours after the ingestion of the sweet potatoes and lasted from 1 to 4 days. Clinical signs included dyspnea (labored breathing and abdominal respiration, tachypnea, extended

  2. IPOMOEA BATATAS)

    African Journals Online (AJOL)

    eobe

    c bowl. Six young plants of sweet potato were transplanted to each of the plastic bowl and allowed eight weeks to grow and stabilize. ... processes by bacteria and plants [5]. Petroleum and ... associated microorganisms to degrade, contain or.

  3. ipomoea batatas

    African Journals Online (AJOL)

    DJFLEX

    design with three replications was conducted at the same location as in 2005. ... alcohol, pharmaceutical and textile industries is widely .... Table 2: Number of leaves/plant and vine length (cm) of two sweet potato varieties as influenced by time ...

  4. Ipomoea Batatas

    African Journals Online (AJOL)

    Tope

    The use of plants and herbs as food supplements and medicinal additives is fast gaining grounds and recognition in the world especially in ... Southeast Asia, they can also be used as forage and the leaf has rich protein content that helps to.

  5. Characterization and development of EST-derived SSR markers in cultivated sweetpotato (Ipomoea batatas

    Directory of Open Access Journals (Sweden)

    Li Yujun

    2011-10-01

    Full Text Available Abstract Background Currently there exists a limited availability of genetic marker resources in sweetpotato (Ipomoea batatas, which is hindering genetic research in this species. It is necessary to develop more molecular markers for potential use in sweetpotato genetic research. With the newly developed next generation sequencing technology, large amount of transcribed sequences of sweetpotato have been generated and are available for identifying SSR markers by data mining. Results In this study, we investigated 181,615 ESTs for the identification and development of SSR markers. In total, 8,294 SSRs were identified from 7,163 SSR-containing unique ESTs. On an average, one SSR was found per 7.1 kb of EST sequence with tri-nucleotide motifs (42.9% being the most abundant followed by di- (41.2%, tetra- (9.2%, penta- (3.7% and hexa-nucleotide (3.1% repeat types. The top five motifs included AG/CT (26.9%, AAG/CTT (13.5%, AT/TA (10.6%, CCG/CGG (5.8% and AAT/ATT (4.5%. After removing possible duplicate of published EST-SSRs of sweetpotato, a total of non-repeat 7,958 SSR motifs were identified. Based on these SSR-containing sequences, 1,060 pairs of high-quality SSR primers were designed and used for validation of the amplification and assessment of the polymorphism between two parents of one mapping population (E Shu 3 Hao and Guang 2k-30 and eight accessions of cultivated sweetpotatoes. The results showed that 816 primer pairs could yield reproducible and strong amplification products, of which 195 (23.9% and 342 (41.9% primer pairs exhibited polymorphism between E Shu 3 Hao and Guang 2k-30 and among the 8 cultivated sweetpotatoes, respectively. Conclusion This study gives an insight into the frequency, type and distribution of sweetpotato EST-SSRs and demonstrates successful development of EST-SSR markers in cultivated sweetpotato. These EST-SSR markers could enrich the current resource of molecular markers for the sweetpotato community and would

  6. FITOREMEDIASI KADMIUM (CD PADA LEACHATE MENGGUNAKAN KANGKUNG AIR (Ipomoea aquatica Forsk. (STUDI KASUS TPA JATIBARANG

    Directory of Open Access Journals (Sweden)

    K N Zamhar

    2016-03-01

    Full Text Available Leachate TPA Jatibarang yang tercemar kadmium (Cd kemungkinan dapat dibersihkan secara fitoremediasi menggunakan kangkung air (Ipomoea aquatica Forsk.. Penelitian ini bertujuan untuk mengetahui kemampuan kangkung air sebagai fitoremediator dalam menyerap Cd dalam leachate TPA Jatibarang. Sebelum penelitian, dilakukan uji pendahuluan kandungan Cd dalam leachate maupun dalam kangkung air. Kangkung diaklimatisasi dalam air bersih selama 3 hari, selanjutnya ditimbang seberat 300 gram kemudian diletakkan ke dalam ember berisi 10 L leachate. Sampel leachate dan organ tanaman diambil setiap 2 hari sekali (2 hari, 4 hari, 6 hari, dan 8 hari. Faktor intensitas cahaya diambil setiap hari pada pukul 08.00-09.00 WIB menggunakan lux meter, sedangkan nilai pH dan suhu leachate diukur menggunakan kertas indikator pH dan termometer sebelum dan sesudah perlakuan. Perameter yang diamati adalah akumulasi Cd dalam akar, batang, dan daun kangkung air pada masing-masing lama waktu pananaman. Akumulasi Cd diukur dengan AAS (Atomic Absorption Spectrophotometry. Data penyerapan Cd dianalisis secara deskriptif. Hasil penelitian menunjukkan bahwa lama waktu kangkung air ditanam dalam leachate berpengaruh terhadap akumulasi Cd pada tanaman. Penyerapan Cd oleh kangkung air mencapai jenuh pada hari ke-8 dengan total penyerapan 0,052 ppm. Akumulasi Cd paling besar pada akar kangkung yaitu 0,023 ppm.Cadmium (Cd that contained in TPA Jatibarang’s leachate can be cleaned by phytoremediation using water spinach (Ipomoea aquatica Forsk.. This research aimed to determine the ability of the water spinach as a fitoremediator in adsorb cadmium (Cd that contained in TPA Jatibarang’s leachate. The research was conducted by using a randomized completely design (RCD factorial, with longer treatment planted time in leachate water spinach was 0 day, 2 days, 4 days, 6 days, and 8 days respectively. The observed parameters of Cd accumulation in roots, stems, and leaves of water spinach in

  7. Biología reproductiva de Convolvulus chilensis (Convolvulaceae en una población de Aucó (centro-norte de Chile Reproductive biology of Convolvulus chilensis (Convolvulaceae in a population of Aucó (north-central Chile

    Directory of Open Access Journals (Sweden)

    Lorena H. Suárez

    2004-12-01

    Full Text Available Convolvulus chilensis es una hierba perenne, única representante endémica de la familia Convolvulaceae en Chile. Se estudió el sistema de reproducción, fenología, morfología y longevidad floral de C. chilensis en una población natural ubicada en la localidad de Aucó, dentro de la Reserva Nacional Las Chinchillas, IV Región, Chile. Se montó un experimento de polinización controlada considerando los tratamientos de polinización natural, polinización cruzada, autopolinización manual, autopolinización automática y apomixis, evaluándose su efecto sobre la formación de frutos y el número de semillas producidas por fruto. Adicionalmente, se compararon los siguientes atributos de la progenie según tipo de polinización (autopolinización o polinización cruzada: peso de semilla, germinación, altura y número de hojas de plántulas de ocho semanas en condiciones de invernadero. Se encontró que C. chilensis es una especie autocompatible, parcialmente autógama (capaz de autopolinizarse sin mediador y parcialmente apomíctica (capaz de producir semillas sin participación de gameto masculino. La longevidad floral fue estimada en 5,25 h. Durante este período, aproximadamente en 1,5 h hay disponibilidad de polen en los estambres. El período de floración se extiende por 22 semanas (agosto a enero. El tratamiento de apomixis presentó el menor porcentaje de formación de frutos y la menor cantidad de semillas por flor en comparación a los tratamientos de polinización natural, cruzada manual, autopolinización automática y autopolinización manual, los cuales no mostraron diferencias entre sí en ambos atributos. El tipo de polinización (autopolinización o polinización cruzada no afecta el desempeño de la progenie en los atributos de semilla y plántula evaluadosThe perennial herb Convolvulus chilensis is the only endemic species of the Convolvulaceae in Chile. The breeding system, phenology, morphology and floral longevity of C

  8. Germination and emergence of Stachytarpheta cayennensis and Ipomoea asarifolia Germinação e emergência de Ipomea asarifolia e Stachytarpheta cayennensis

    Directory of Open Access Journals (Sweden)

    M.B. Dias Filho

    1996-01-01

    Full Text Available Understanding how weed seed germination and emergence respond to environmental factors is critical to determining their adaptive capabilities and potential for infestations, and could also aid in the development of effective control practices. Germination of Ipomoea asarifolia (Desr. Roem. & Schultz and Stachytarpheta cayennensis (Rich Vahl. decreased linearly with decreasing osmotic potentials. Also, increasing osmotic stress delayed germination of Ipomoea more than that of Stachytarpheta. Ipomoea germination was insensitive to light, while Stachytarpheta showed a positive photoblastic behavior. Nitrate had a negative effect on germination of Ipomoea seed under both light and dark conditions but stimulated dark germination of Stachytarpheta. Ipomoea emergence was not significantly affected by planting depth. However, for Stachytarpheta emergence was restrited to seeds planted at the soil surface. Emergence of Ipomoea seedlings from greater than 6cm significantly decreased the amount of biomass allocated to roots, while biomass allocated to leaves was decreased for seedlings that emerged from depths greater than 2cm. These germination and emergence responses are discussed in relation to their ecological implications and to weed control strategies.O entendimento de como a germinação e emergência de plantas daninhas respondem a fatores ambientais é de grande importância para a determinação da capacidade de adaptação e potencial de infestação, podendo ainda auxiliar no desenvolvimento de práticas de controle eficazes. A germinação de Ipomoea asarifolia (Desr. Roem. & Schultz e Stachytarpheta cayennensis (Rich Vahl. Diminuiram linearmente com o decréscimo do potencial osmótico do meio de germinação, sendo que o aumento do estresse osmótico atrasou com maior intensidade a germinação de Ipomoea do que a de Stachytarpheta. A germinação de Ipomoea foi insensível à luz; já a de Stachytarpheta mostrou ter um comportamento fotobl

  9. Maternal Ingestion of Ipomoea carnea: Effects on Goat-Kid Bonding and Behavior.

    Science.gov (United States)

    Gotardo, André T; Pfister, James A; Raspantini, Paulo C F; Górniak, Silvana L

    2016-03-16

    Ipomoea carnea is a toxic plant found in Brazil and other tropical and subtropical countries and often causes poisoning of livestock. The plant contains the alkaloids swainsonine and calystegines, which inhibit key cellular enzymes and cause systematic cell death. This study evaluated the behavioral effects of prenatal ingestion of this plant on dams and their kids. Twenty-four pregnant goats were randomly allocated into four treatment groups and received the following doses (g/kg BW) of fresh I. carnea: 0 (control group), 1.0 (IC1), 3.0 (IC3), and 5.0 (IC5) from day 27 of gestation until parturition. Dam and kid bonding and behavior were evaluated by several tests, immediately after birth until six weeks of age. Dams from IC3 and IC5 groups spent less time paying attention to the newborn. There was a lack of maternal-infant bonding due to I. carnea intoxication. Kids from treated dams had difficulty in standing, suckling, and in recognizing their mother hours after birth. I. carnea can also compromise the kids' ability to learn and to retain spatial memory. We suggest that kids from pregnant goats given I. carnea during gestation have significant behavioral alterations and developmental delays that may compromise their survival.

  10. EVALUATION OF SUBLETHAL EFFECTS OF Ipomoea cairica LINN. EXTRACT ON LIFE HISTORY TRAITS OF DENGUE VECTORS

    Directory of Open Access Journals (Sweden)

    Wan Fatma ZUHARAH

    2016-01-01

    Full Text Available Plant derived insecticides have considerable potential for mosquito control because these products are safer than conventional insecticides. This study aimed to investigate sublethal activities of Ipomoea carica or railway creeper crude acethonilic extract against life history trait of dengue vectors, Aedes albopictus and Aedes aegypti. The late third instar larvae of Ae. albopictus and Ae. aegypti were exposed to a sublethal dose at LC50 and larvae that survived were further cultured. Overall, Ipomea cairica crude extracts affected the whole life history of both Aedes species. The study demonstrated significantly lower egg production (fecundity and eggs hatchability (fertility in Ae. albopictus. The sublethal dose of crude extracts reduced significantly the width of larval head capsule and the wing length of both sexes in both Aedes species. The significance of sublethal effects of I. cairica against Aedes mosquitoes was an additional hallmark to demonstrate further activity of this plant despite its direct toxicity to the larvae. The reduced reproductive capacity as well as morphological and physiological anomalies are some of the effects that make I. cairica a potential candidate to be used as a new plant-based insecticide to control dengue vectors.

  11. Phytoextraction of cadmium by Ipomoea aquatica (water spinach) in hydroponic solution: effects of cadmium speciation.

    Science.gov (United States)

    Wang, Kai-Sung; Huang, Lung-Chiu; Lee, Hong-Shen; Chen, Pai-Ye; Chang, Shih-Hsien

    2008-06-01

    Phytoextraction is a promising technique to remediate heavy metals from contaminated wastewater. However, the interactions of multi-contaminants are not fully clear. This study employed cadmium, Triton X-100 (TX-100), and EDTA to investigate their interactions on phytotoxicity and Cd phytoextraction of Ipomoea aquatica (water spinach) in simulated wastewater. The Cd speciation was estimated by a chemical equilibrium model and MINEQL+. Statistic regression was applied to evaluate Cd speciation on Cd uptake in shoots and stems of I. aquatica. Results indicated that the root length was a more sensitive parameter than root weight and shoot weight. Root elongation was affected by Cd in the Cd-EDTA solution and TX-100 in the Cd-TX-100 solution. Both the root length and the root biomass were negatively correlated with the total soluble Cd ions. In contrast, Cd phytoextraction of I. aquatic was correlated with the aqueous Cd ions in the free and complex forms rather than in the chelating form. Additionally, the high Cd bioconcentration factors of I. aquatica (375-2227 l kg(-1) for roots, 45-144 l kg(-1) for shoots) imply that I. aquatica is a potential aquatic plant to remediate Cd-contaminated wastewater.

  12. Polyphenols and phenolic acids in sweet potato (Ipomoea batatas L. roots

    Directory of Open Access Journals (Sweden)

    Janette Musilová

    2017-01-01

    Full Text Available Sweet potato (Ipomoea batatas L. is one of the most important food crops in the world. They are rich in polyphenols, proteins, vitamins, minerals and some functional microcomponents. Polyphenols are bioactive compounds, which can protect the human body from the oxidative stress which may cause many diseases including cancer, aging and cardiovascular problems.The polyphenol content is two to three times higher than in some common vegetables. Total polyphenols (determined spectrophotometrically and phenolic acids (i.e. caffeic acid, chlorogenic acid and isomers - using high performance liquid chromatography contents were determined in three varieties of sweet potatoes (O´Henry - white, Beauregard-orange and 414-purple. Phenolic compounds contents were determined in raw peeled roots, jackets of raw roots and water steamed sweet potato roots. For all analysis lyophilised samples were used. Total polyphenol content ranged from 1161 (O´Henry, flesh-raw to 13998 (414, peel-raw mg.kg-1 dry matter, caffeic acid content from the non-detected values (414, flesh-raw to 320.7 (Beauregard, peel-raw mg.kg-1 dry matter and 3-caffeoylquinic acid content from 57.57 (O´Henry, flesh-raw to 2392 (414, peel-raw mg.kg-1 dry matter. Statistically significant differences (p ≤0.05 existed between varieties, morphological parts of the root, or raw and heat-treated sweet potato in phenolic compounds contents.

  13. Production of purple sweet potato (Ipomoea batatas L.) juice having high anthocyanin content and antioxidant activity

    Science.gov (United States)

    Dwiyanti, G.; Siswaningsih, W.; Febrianti, A.

    2018-05-01

    The purpose of the study was to retrieve procedure of production of purple sweet potato (Ipomoea batatas L.) juice with the best total anthocyanin and antioxidant activity. Purple sweet potato was processed into purple sweet potato juice through a process of heating with temperature variations of 700C, 800C, and 900C and various duration of heating, which are 5 mins, 10 mins, and 15 mins. The total anthocyanin was determined by using pH differential method. The antioxidant activity was determined by using DPPH (2,2-Diphenyl-l-picrylhydrazyl) method. Total anthocyanin of purple sweet potato juice declined in the range between 215.08 mg/L - 101.86 mg/L. The antioxidant activity of purple sweet potato juice declined in the range between 90.63% - 67.79%. Antioxidant activity and total anthocyanin purple sweet potato juice decreases with increasing temperature and duration of heating. The best characteristics found in purple sweet potato juice were made with warming temperatures of 800C. The product with the highest antioxidant activity, total anthocyanins, and good durability was prepared at 800C heating temperature for 5 mins.

  14. CNS Depressant and Antiepileptic Activities of the Methanol Extract of the Leaves of Ipomoea Aquatica Forsk

    Directory of Open Access Journals (Sweden)

    Dhanasekaran Sivaraman

    2010-01-01

    Full Text Available The central nervous system (CNS depressant and antiepileptic activities of the methanol extract of the leaves of Ipomoea aquatica Forsk (IAF were investigated on various animal models including pentobarbitone sleeping time and hole-board exploratory behavior for sedation tests and strychnine, picrotoxin and pentylenetetrazole-induced convulsions in mice. IAF (200 and 400 mg/kg, p.o., like chlorpromazine HCl (1 mg/kg, i.m., produced a dose-dependent prolongation of pentobarbitone sleeping time and suppression of exploratory behavior. IAF (200 and 400 mg/kg produced dose-dependent and significant increases in onset to clonic and tonic convulsions and at 400 mg/kg, showed complete protection against seizures induced by strychnine and picrotoxin but not with pentylenetetrazole. Acute oral toxicity test, up to 14 days, did not produce any visible signs of toxicity. These results suggest that potentially antiepileptic compounds are present in leaf extract of IAF that deserve the study of their identity and mechanism of action.

  15. Population dynamics and evolutionary history of the weedy vine Ipomoea hederacea in North America.

    Science.gov (United States)

    Campitelli, Brandon E; Stinchcombe, John R

    2014-06-03

    Disentangling the historical evolutionary processes that contribute to patterns of phenotypic and genetic variation is important for understanding contemporary patterns of both traits of interest and genetic diversity of a species. Ipomoea hederacea is a self-compatible species whose geographic origin is contested, and previous work suggests that although there are signals of adaptation (significant leaf shape and flowering time clines), no population structure or neutral genetic differentiation of I. hederacea populations was detected. Here, we use DNA sequence data to characterize patterns of genetic variation to establish a more detailed understanding of the current and historical processes that may have generated the patterns of genetic variation in this species. We resequenced ca. 5000 bp across 7 genes for 192 individuals taken from 24 populations in North America. Our results indicate that North American I. hederacea populations are ubiquitously genetically depauperate, and patterns of nucleotide diversity are consistent with population expansion. Contrary to previous findings, we discovered significant population subdivision and isolation-by-distance, but genetic structure was spatially discontinuous, potentially implicating long-distance dispersal. We further found significant genetic differentiation at sequenced loci but nearly fourfold stronger differentiation at the leaf shape locus, strengthening evidence that the leaf shape locus is under divergent selection. We propose that North American I. hederacea has experienced a recent founder event, and/or population dynamics are best described by a metapopulation model (high turnover and dispersal), leading to low genetic diversity and a patchy genetic distribution. Copyright © 2014 Campitelli and Stinchcombe.

  16. Maternal Ingestion of Ipomoea carnea: Effects on Goat-Kid Bonding and Behavior

    Science.gov (United States)

    Gotardo, André T.; Pfister, James A.; Raspantini, Paulo C. F.; Górniak, Silvana L.

    2016-01-01

    Ipomoea carnea is a toxic plant found in Brazil and other tropical and subtropical countries and often causes poisoning of livestock. The plant contains the alkaloids swainsonine and calystegines, which inhibit key cellular enzymes and cause systematic cell death. This study evaluated the behavioral effects of prenatal ingestion of this plant on dams and their kids. Twenty-four pregnant goats were randomly allocated into four treatment groups and received the following doses (g/kg BW) of fresh I. carnea: 0 (control group), 1.0 (IC1), 3.0 (IC3), and 5.0 (IC5) from day 27 of gestation until parturition. Dam and kid bonding and behavior were evaluated by several tests, immediately after birth until six weeks of age. Dams from IC3 and IC5 groups spent less time paying attention to the newborn. There was a lack of maternal-infant bonding due to I. carnea intoxication. Kids from treated dams had difficulty in standing, suckling, and in recognizing their mother hours after birth. I. carnea can also compromise the kids’ ability to learn and to retain spatial memory. We suggest that kids from pregnant goats given I. carnea during gestation have significant behavioral alterations and developmental delays that may compromise their survival. PMID:26999204

  17. Natural history of the narrow endemics Ipomoea cavalcantei and I. marabaensis from Amazon Canga savannahs.

    Science.gov (United States)

    Babiychuk, Elena; Kushnir, Sergei; Vasconcelos, Santelmo; Dias, Mariana Costa; Carvalho-Filho, Nelson; Nunes, Gisele Lopes; Dos Santos, Jorge Filipe; Tyski, Lourival; da Silva, Delmo Fonseca; Castilho, Alexandre; Fonseca, Vera Lucia Imperatriz; Oliveira, Guilherme

    2017-08-08

    Amazon comprises a vast variety of ecosystems, including savannah-like Canga barrens that evolved on iron-lateritic rock plateaus of the Carajás Mountain range. Individual Cangas are enclosed by the rain forest, indicating insular isolation that enables speciation and plant community differentiation. To establish a framework for the research on natural history and conservation management of endemic Canga species, seven chloroplast DNA loci and an ITS2 nuclear DNA locus were used to study natural molecular variation of the red flowered Ipomoea cavalcantei and the lilac flowered I. marabaensis. Partitioning of the nuclear and chloroplast gene alleles strongly suggested that the species share the most recent common ancestor, pointing a new independent event of the red flower origin in the genus. Chloroplast gene allele analysis showed strong genetic differentiation between Canga populations, implying a limited role of seed dispersal in exchange of individuals between Cangas. Closed haplotype network topology indicated a requirement for the paternal inheritance in generation of cytoplasmic genetic variation. Tenfold higher nucleotide diversity in the nuclear ITS2 sequences distinguished I. cavalcantei from I. marabaensis, implying a different pace of evolutionary changes. Thus, Canga ecosystems offer powerful venues for the study of speciation, multitrait adaptation and the origins of genetic variation.

  18. Long-distance transport of pertechnetate in the moonflower (Ipomoea alba)

    International Nuclear Information System (INIS)

    Clarke, Simon J.; Rogiers, Suzy Y.; Currie, Geoffrey M.

    2012-01-01

    The first research on the transport of metastable-technetium-99 ( 99m Tc) in the form of pertechnetate ( 99m TcO 4 − ) within plants suggested that 99m TcO 4 − may be mobile in the phloem. In contrast, more recent evidence indicates the anion is transported in the xylem. Here we demonstrate that observations of 99m Tc transport in the test subject of these initial investigations, the moonflower (Ipomoea alba L.), are incompatible with phloem flow. Rather, the presence of only minute amounts of 99m Tc in typical sinks for phloem solutes and 99m Tc transport out of labeled leaves when shaded but not when illuminated strongly suggest that the radionuclide is transported in the xylem. The study increases confidence in the identification of 99m TcO 4 − as a xylem mobile compound whose distribution in plants can be visualized using nuclear medicine scintigraphic imaging techniques. - Highlights: ► The vascular transport pathway of metastable-technetium-99 in plants is not clear. ► Nuclear medicine techniques were used to obtain images of 99m Tc in the moonflower. ► Translocation of the radionuclide is incompatible with transport by the phloem. ► 99m Tc transport characteristics are those of a xylem-mobile nutrient analog. ► The research has implications for 99m Tc as a tracer and modeling 99 Tc uptake.

  19. Wounding stimulates ALLENE OXIDE SYNTHASE gene and increases the level of jasmonic acid in Ipomoea nil cotyledons

    Directory of Open Access Journals (Sweden)

    Emilia Wilmowicz

    2016-03-01

    Full Text Available Allene oxide synthase (AOS encodes the first enzyme in the lipoxygenase pathway, which is responsible for jasmonic acid (JA formation. In this study we report the molecular cloning and characterization of InAOS from Ipomoea nil. The full-length gene is composed of 1662 bp and encodes for 519 amino acids. The predicted InAOS contains PLN02648 motif, which is evolutionarily conserved and characteristic for functional enzymatic proteins. We have shown that wounding led to a strong stimulation of the examined gene activity in cotyledons and an increase in JA level, which suggest that this compound may be a modulator of stress responses in I. nil.

  20. The Convolvulaceae of Malaysia, V

    NARCIS (Netherlands)

    Ooststroom, van S.J.

    1945-01-01

    1a. Parasitic plants with filiform, twining stems, leafless or with minute pale scales. Flowers small, in clusters or short racemes; corolla mostly with 5 episepalous fimbriate scales inside ( Cuscuteae Hall, f.) 1. Cuscuta b. Non-parasitic plants with green leaves 2 2a. Pollen spinulose (

  1. The Convolvulaceae of Malaysia, VII

    NARCIS (Netherlands)

    Ooststroom, van S.J.

    1952-01-01

    In addition to my papers on the genus Argyreia in Malaysia I can here give a few descriptions of new species, mainly from Sumatra and Borneo, and some critical notes on others. A revision of the species of Malaysia as a whole, including those of the Malay Peninsula and the Philippine Islands will be

  2. Structure of sweet potato (Ipomoea batatas diversity in West Africa covaries with a climatic gradient.

    Directory of Open Access Journals (Sweden)

    Kodjo Glato

    Full Text Available Sub-Saharan agriculture has been identified as vulnerable to ongoing climate change. Adaptation of agriculture has been suggested as a way to maintain productivity. Better knowledge of intra-specific diversity of varieties is prerequisites for the successful management of such adaptation. Among crops, root and tubers play important roles in food security and economic growth for the most vulnerable populations in Africa. Here, we focus on the sweet potato. The Sweet potato (Ipomoea batatas was domesticated in Central and South America and was later introduced into Africa and is now cultivated throughout tropical Africa. We evaluated its diversity in West Africa by sampling a region extending from the coastal area of Togo to the northern Sahelian region of Senegal that represents a range of climatic conditions. Using 12 microsatellite markers, we evaluated 132 varieties along this gradient. Phenotypic data from field trials conducted in three seasons was also obtained. Genetic diversity in West Africa was found to be 18% lower than in America. Genetic diversity in West Africa is structured into five groups, with some groups found in very specific climatic areas, e.g. under a tropical humid climate, or under a Sahelian climate. We also observed genetic groups that occur in a wider range of climates. The genetic groups were also associated with morphological differentiation, mainly the shape of the leaves and the color of the stem or root. This particular structure of diversity along a climatic gradient with association to phenotypic variability can be used for conservation strategies. If such structure is proved to be associated with specific climatic adaptation, it will also allow developing strategies to adapt agriculture to ongoing climate variation in West Africa.

  3. Structure of sweet potato (Ipomoea batatas) diversity in West Africa covaries with a climatic gradient.

    Science.gov (United States)

    Glato, Kodjo; Aidam, Atsou; Kane, Ndjido Ardo; Bassirou, Diallo; Couderc, Marie; Zekraoui, Leila; Scarcelli, Nora; Barnaud, Adeline; Vigouroux, Yves

    2017-01-01

    Sub-Saharan agriculture has been identified as vulnerable to ongoing climate change. Adaptation of agriculture has been suggested as a way to maintain productivity. Better knowledge of intra-specific diversity of varieties is prerequisites for the successful management of such adaptation. Among crops, root and tubers play important roles in food security and economic growth for the most vulnerable populations in Africa. Here, we focus on the sweet potato. The Sweet potato (Ipomoea batatas) was domesticated in Central and South America and was later introduced into Africa and is now cultivated throughout tropical Africa. We evaluated its diversity in West Africa by sampling a region extending from the coastal area of Togo to the northern Sahelian region of Senegal that represents a range of climatic conditions. Using 12 microsatellite markers, we evaluated 132 varieties along this gradient. Phenotypic data from field trials conducted in three seasons was also obtained. Genetic diversity in West Africa was found to be 18% lower than in America. Genetic diversity in West Africa is structured into five groups, with some groups found in very specific climatic areas, e.g. under a tropical humid climate, or under a Sahelian climate. We also observed genetic groups that occur in a wider range of climates. The genetic groups were also associated with morphological differentiation, mainly the shape of the leaves and the color of the stem or root. This particular structure of diversity along a climatic gradient with association to phenotypic variability can be used for conservation strategies. If such structure is proved to be associated with specific climatic adaptation, it will also allow developing strategies to adapt agriculture to ongoing climate variation in West Africa.

  4. Effect of water availability on tolerance of leaf damage in tall morning glory, Ipomoea purpurea

    Science.gov (United States)

    Atala, Cristian; Gianoli, Ernesto

    2009-03-01

    Resource availability may limit plant tolerance of herbivory. To predict the effect of differential resource availability on plant tolerance, the limiting resource model (LRM) considers which resource limits plant fitness and which resource is mostly affected by herbivore damage. We tested the effect of experimental drought on tolerance of leaf damage in Ipomoea purpurea, which is naturally exposed to both leaf damage and summer drought. To seek mechanistic explanations, we also measured several morphological, allocation and gas exchange traits. In this case, LRM predicts that tolerance would be the same in both water treatments. Plants were assigned to a combination of two water treatments (control and low water) and two damage treatments (50% defoliation and undamaged). Plants showed tolerance of leaf damage, i.e., a similar number of fruits were produced by damaged and undamaged plants, only in control water. Whereas experimental drought affected all plant traits, leaf damage caused plants to show a greater leaf trichome density and reduced shoot biomass, but only in low water. It is suggested that the reduced fitness (number of fruits) of damaged plants in low water was mediated by the differential reduction of shoot biomass, because the number of fruits per shoot biomass was similar in damaged and undamaged plants. Alternative but less likely explanations include the opposing direction of functional responses to drought and defoliation, and resource costs of the damage-induced leaf trichome density. Our results somewhat challenge the LRM predictions, but further research including field experiments is needed to validate some of the preliminary conclusions drawn.

  5. Two rubisco activase genes from ipomoea batatas have different roles in photosynthesis of arabidopsis

    International Nuclear Information System (INIS)

    Jiang, Y.

    2014-01-01

    Rubisco activase (RCA) that functions as a molecular chaperone regulates the activity of the Calvin-Benson cycle via regulation of the Rubisco activity. In plants such as Arabidopsis thaliana, Spinacia oleracea, and Oryza sativa, there are two RCA isoforms from two mRNAs that are produced from alternative splicing of the transcribed pre-mRNA of a single RCA gene. However, this research reported that the transcripts of the two IbRCA isoforms in sweet potato (Ipomoea batatas) were transcribed from two different genes. To study the roles of these two IbRCA isoforms in photosynthesis, we inserted these two IbRCA genes into the genome of Arabidopsis with deletion of RCA gene (RCA), resulting in IbRCAs- and IbRCAl-expressing plants, respectively. Analysis of these transgenic Arabidopsis indicated that the IbRCAs-expressing plants were similar to wild-type plants under ambient CO/sub 2/ concentration and 22 degree C conditions, suggesting that expression of IbRCAs gene was sufficient for functional complementation of RCA plants under normal conditions. However, IbRCAs-expressing plants were more susceptible to moderate heat stress (26 degree C) compared to wild-type plants. In contrast, although the IbRCAl-expressing plants had to grow normally in high CO/sub 2/ concentration conditions, there were almost no differences in growth and photosynthesis between normally grown and heat-treated plants, implying that IbRCAl-expressing plants had a better heat-resistance than IbRCAs-expressing plants. (author)

  6. Experimental intoxication of guinea pigs with Ipomoea carnea: behavioural and neuropathological alterations.

    Science.gov (United States)

    Cholich, Luciana A; Márquez, Mercedes; Pumarola i Batlle, Martí; Gimeno, Eduardo J; Teibler, Gladys P; Rios, Elvio E; Acosta, Ofelia C

    2013-12-15

    Ipomoea carnea is a toxic plant that affects goats, with symptoms being characterised by nervous disorders and death. Swainsonine and calystegines are the principal toxic components isolated from I. carnea, which also yields lysergic acid derivatives. The aim of this study was to improve the clinical characterisation of experimental intoxication by I. carnea in guinea pigs through the evaluation of behavioural changes and to perform a thorough histopathological analysis of the affected CNS. Leaves of I. carnea were administered to guinea pigs. Open-field gait analysis and monoamine levels were measured. The poisoned animals exhibited increased vocalisation, lethargy, and a reduction in the locomotion frequency after the fourth week of intoxication, as demonstrated in the open-field test. Significant differences were observed in hind-limb gait width by the last week of intoxication. After 65 days, the guinea pigs were euthanised, necropsied, and examined using light and electron microscopy. At the end of the experiment, plasma serotonin decreased. In contrast, dopamine decreased, and noradrenaline increased in urine. Brain sections were evaluated with conventional histological methods and immunohistochemistry (IHC), as well as by transmission electron microscopy (TEM). Vacuoles were observed throughout the brain, but they were particularly prominent in the brainstem. In addition, there were PAS-negative regions, and the Nissl substance was dispersed or absent, which was confirmed with the Kluver-Barreda stain. Moderate microgliosis was observed by immunohistochemistry. In the medulla oblongata, numerous ubiquitin-positive spheroids together with neuronal degeneration were observed in the nucleus gracilis/cuneatus. Furthermore, vacuoles were observed in astrocytes, oligodendrocytes, and endothelial cells by TEM. Our results showed that the behavioural effects may have been caused by alterations in the brain in conjunction with changes in monoamine levels. This

  7. Ipomoea aquatica Extract Shows Protective Action Against Thioacetamide-Induced Hepatotoxicity

    Directory of Open Access Journals (Sweden)

    A. Hamid A. Hadi

    2012-05-01

    Full Text Available In the Indian system of traditional medicine (Ayurveda it is recommended to consume Ipomoea aquatica to mitigate disorders like jaundice. In this study, the protective effects of ethanol extract of I. aquatica against liver damage were evaluated in thioacetamide (TAA-induced chronic hepatotoxicity in rats. There was no sign of toxicity in the acute toxicity study, in which Sprague-Dawley (SD rats were orally fed with I. aquatica (250 and 500 mg/kg for two months along with administration of TAA (i.p injection 200 mg/kg three times a week for two months. The results showed that the treatment of I. aquatica significantly lowered the TAA-induced serum levels of hepatic enzyme markers (ALP, ALT, AST, protein, albumin, bilirubin and prothrombin time. The hepatic content of activities and expressions SOD and CAT that were reduced by TAA were brought back to control levels by the plant extract supplement. Meanwhile, the rise in MDA level in the TAA receiving groups also were significantly reduced by I. aquatica treatment. Histopathology of hepatic tissues by H&E and Masson trichrome stains displayed that I. aquatica has reduced the incidence of liver lesions, including hepatic cells cloudy swelling, infiltration, hepatic necrosis, and fibrous connective tissue proliferation induced by TAA in rats. Therefore, the results of this study show that the protective effect of I. aquatica in TAA-induced liver damage might be contributed to its modulation on detoxification enzymes and its antioxidant and free radical scavenger effects. Moreover, it confirms a scientific basis for the traditional use of I. aquatica for the treatment of liver disorders.

  8. Natural selection maintains a single-locus leaf shape cline in Ivyleaf morning glory, Ipomoea hederacea.

    Science.gov (United States)

    Campitelli, Brandon E; Stinchcombe, John R

    2013-02-01

    Clines in phenotypic traits with an underlying genetic basis potentially implicate natural selection. However, neutral evolutionary processes such as random colonization, spatially restricted gene flow, and genetic drift could also result in similar spatial patterns, especially for single-locus traits because of their susceptibility to stochastic events. One way to distinguish between adaptive and neutral mechanisms is to compare the focal trait to neutral genetic loci to determine whether neutral loci demonstrate clinal variation (consistent with a neutral cline), or not. Ivyleaf morning glory, Ipomoea hederacea, exhibits a latitudinal cline for a Mendelian leaf shape polymorphism in eastern North America, such that lobed genotypes dominate northern populations and heart-shaped genotypes are restricted to southern populations. Here, we evaluate potential evolutionary mechanisms for this cline by first determining the allele frequencies at the leaf shape locus for 77 populations distributed throughout I. hederacea's range and then comparing the geographical pattern at this locus to neutral amplified fragment length polymorphism (AFLP) loci. We detected both significant clinal variation and high genetic differentiation at the leaf shape locus across all populations. In contrast, 99% of the putatively neutral loci do not display clinal variation, and I. hederacea populations show very little overall genetic differentiation, suggesting that there is a moderate level of gene flow. In addition, the leaf shape locus was identified as a major F(ST) outlier experiencing divergent selection, relative to all the AFLP loci. Together, these data strongly suggest that the cline in leaf shape is being maintained by spatially varying natural selection. © 2012 Blackwell Publishing Ltd.

  9. Capacities of Candidate Herbaceous Plants for Phytoremediation of Soil-based TNT and RDX on Ranges

    Science.gov (United States)

    2008-09-01

    installations and distribution of Sida spinosa...Lehi, UT • Forb seeds from three vendors as follows: redroot pigweed (Amaran- thus retroflexus), morning glory (Ipomoea lacunosa), and prickly sida ... Sida spinosa) from Azlin Seed Service, Leland, MS; common milk- weed (Asclepias syriaca) from Prairiemoon Nursery, Winona, WI; common purslane

  10. Suspected natural lysosomal storage disease from ingestion of pink morning glory (Ipomoea carnea) in goats in northern Argentina.

    Science.gov (United States)

    Ríos, Elvio E; Cholich, Luciana A; Chileski, Gabriela; García, Enrique N; Lértora, Javier; Gimeno, Eduardo J; Guidi, María G; Mussart, Norma; Teibler, Gladys P

    2015-07-01

    This study describes an occurrence of pink morning glory (Ipomoea carnea) intoxication in goats in northern Argentina. The clinical signs displayed by the affected animals were ataxia, lethargy, emaciation, hypertonia of the neck muscles, spastic paresis in the hind legs, abnormal postural reactions and death. The clinico-pathologic examination revealed that the affected animals were anemic and their serum level of aspartate aminotransferase was significantly increased. Cytoplasmic vacuolation in the Purkinje cells and pancreatic acinar cells was observed by histological examination. The neuronal lectin binding pattern showed a strong positive reaction to WGA (Triticum vulgaris), sWGA (succinylated T. vulgaris) and LCA (Lens culinaris). Although I. carnea is common in tropical regions, this is the first report of spontaneous poisoning in goats in Argentina.

  11. Analysis of Metabolites in Stem Parasitic Plant Interactions: Interaction of Cuscuta–Momordica versus Cassytha–Ipomoea

    Science.gov (United States)

    Furuhashi, Takeshi; Nakamura, Takemichi; Iwase, Koji

    2016-01-01

    Cuscuta and Cassytha are two well-known stem parasitic plant genera with reduced leaves and roots, inducing haustoria in their stems. Their similar appearance in the field has been recognized, but few comparative studies on their respective plant interactions are available. To compare their interactions, we conducted a metabolite analysis of both the Cassytha–Ipomoea and the Cuscuta–Momordica interaction. We investigated the energy charge of the metabolites by UFLC (ultra-high performance liquid chromatography), and conducted GC-MS (gas chromatography-mass spectrometry) analysis for polar metabolites (e.g., saccharides, polyols) and steroids. The energy charge after parasitization changed considerably in Cassytha but not in Cusucta. Cuscuta changed its steroid pattern during the plant interaction, whereas Cassytha did not. In the polar metabolite analysis, the laminaribiose increase after parasitization was conspicuous in Cuscuta, but not in Cassytha. This metabolite profile difference points to different lifestyles and parasitic strategies. PMID:27941603

  12. Analysis of Metabolites in Stem Parasitic Plant Interactions: Interaction of Cuscuta–Momordica versus Cassytha–Ipomoea

    Directory of Open Access Journals (Sweden)

    Takeshi Furuhashi

    2016-12-01

    Full Text Available Cuscuta and Cassytha are two well-known stem parasitic plant genera with reduced leaves and roots, inducing haustoria in their stems. Their similar appearance in the field has been recognized, but few comparative studies on their respective plant interactions are available. To compare their interactions, we conducted a metabolite analysis of both the Cassytha–Ipomoea and the Cuscuta–Momordica interaction. We investigated the energy charge of the metabolites by UFLC (ultra-high performance liquid chromatography, and conducted GC-MS (gas chromatography-mass spectrometry analysis for polar metabolites (e.g., saccharides, polyols and steroids. The energy charge after parasitization changed considerably in Cassytha but not in Cusucta. Cuscuta changed its steroid pattern during the plant interaction, whereas Cassytha did not. In the polar metabolite analysis, the laminaribiose increase after parasitization was conspicuous in Cuscuta, but not in Cassytha. This metabolite profile difference points to different lifestyles and parasitic strategies.

  13. Analysis of Metabolites in Stem Parasitic Plant Interactions: Interaction of Cuscuta-Momordica versus Cassytha-Ipomoea.

    Science.gov (United States)

    Furuhashi, Takeshi; Nakamura, Takemichi; Iwase, Koji

    2016-12-07

    Cuscuta and Cassytha are two well-known stem parasitic plant genera with reduced leaves and roots, inducing haustoria in their stems. Their similar appearance in the field has been recognized, but few comparative studies on their respective plant interactions are available. To compare their interactions, we conducted a metabolite analysis of both the Cassytha-Ipomoea and the Cuscuta-Momordica interaction. We investigated the energy charge of the metabolites by UFLC (ultra-high performance liquid chromatography), and conducted GC-MS (gas chromatography-mass spectrometry) analysis for polar metabolites (e.g., saccharides, polyols) and steroids. The energy charge after parasitization changed considerably in Cassytha but not in Cusucta . Cuscuta changed its steroid pattern during the plant interaction, whereas Cassytha did not. In the polar metabolite analysis, the laminaribiose increase after parasitization was conspicuous in Cuscuta , but not in Cassytha . This metabolite profile difference points to different lifestyles and parasitic strategies.

  14. Faecal and protozoan parasite contamination of water spinach (Ipomoea aquatica) cultivated in urban wastewater in Phnom Penh, Cambodia

    DEFF Research Database (Denmark)

    Anh, Vuong Tuan; Tram, Nguyen Thuy; Klank, Lise Tønner

    2007-01-01

    Objective To identify the level of contamination with thermotolerant coliforms (ThC), intestinal helminth eggs and protozoan parasites in water spinach (Ipomoea aquatica) cultivated in a wastewater-fed lake in Phnom Penh, Cambodia. Methods The investigation was carried out from July 2004 to May...... into a stream. Water spinach samples were harvested at each of the three locations with and without wastewater contact according to the normal practices of farmers, and analysed for ThC, protozoan parasites (Giardia, Cryptosporidium and Cyclospora), and helminth eggs (Ascaris lumbricoides, Trichuris trichura...... and hookworm) using standard methods. Wastewater samples were also collected at each of the three locations and analysed for ThC and helminth eggs. Results High concentrations of ThC (approximately 10(5)-10(7)/g) were found in water spinach samples. ThC mean counts did not differ significantly, neither between...

  15. Sweet potato (Ipomoea batatas L. growing in conditions of southern Slovak republic

    Directory of Open Access Journals (Sweden)

    Miroslav Šlosár

    2016-07-01

    Full Text Available The sweet potato (Ipomoea batatas L. belongs to very important crops from aspect of its world production. It is grown in large areas in Asia, on the contrary, sweet potato production in Europe presents minimal part of its total world rate. The sweet potato is less-known crop, grown only on small area in home gardens in Slovak Republic. Tubers of sweet potato are characterized by anti-diabetic, anti-oxidant and anti-proliferative properties due to the presence of valuable health-promoting components, such as carotenoids or vitamin C. The main objective of study was testing of sweet potato growing in conditions of southern Slovak Republic with focus on quantity and quality of its yield. The field trial was realised on land of the Slovak University of Agriculture in Nitra in 2015. Within trial, effect of cultivar and mulching on the selected quantitative (average tuber weight; yield per plant; yield in t.ha-1 and qualitative (total carotenoids; vitamin C parameters were tested. One certified cultivar of sweet potato 'Beauregard' was used as a comparative cultivar. Other two cultivars were marked according to the market place at which were purchased and sequentially used for seedling preparation. Tubers of first un-known cultivar were purchased in the Serbian market (marked as 'Serbian'. Tubers of next sweet potato cultivar were purchased on the market in Zagreb (marked as 'Zagrebian'. Outplating of sweet potato seedlings were realised on the 19th May 2015. The sweet potato was grown by hillock system. Each cultivar was planted in two variants (rows: non-mulching (bare soil and mulching by black non-woven textile. All variants were divided to three replications with 6 plants. Difference between rows was 1.20 m and seedlings were planted in distance of 0.30 m in row. The harvested tubers were classified in two size classes: >150 g (marketable yield and <150 g (non-marketable yield. Total carotenoid content was determined spectrophotometrically. The

  16. Experimental poisoning of goats by Ipomoea carnea subsp. fistulosa in Argentina: a clinic and pathological correlation with special consideration on the central nervous system

    Directory of Open Access Journals (Sweden)

    Elvio E. Ríos

    2012-01-01

    Full Text Available Ipomoea carnea subsp. fistulosa, aguapei or mandiyura, is responsible for lysosomal storage in goats. The shrub contains several alkaloids, mainly swansonine which inhibits lysosomal α-mannosidase and Golgi mannosidase II. Poisoning occurs by inhibition of these hydrolases. There is neuronal vacuolation, endocrine dysfunction, cardiovascular and gastrointestinal injury, and immune disorders. Clinical signs and pathology of the experimental poisoning of goats by Ipomoea carnea in Argentina are here described. Five goats received fresh leaves and stems of Ipomoea. At the beginning, the goats did not consume the plant, but later, it was preferred over any other forage. High dose induced rapid intoxication, whereas with low doses, the course of the toxicosis was more protracted. The goats were euthanized when they were recumbent. Cerebrum, cerebellum, medulla oblongata, pons and colliculi, were routinely processed for histology. In nine days, the following clinical signs developed: abnormal fascies, dilated nostrils and abnormal postures of the head, cephalic tremors and nystagmus, difficulty in standing. Subsequently, the goats had a tendency to fall, always to the left, with spastic convulsions. There was lack in coordination of voluntary movements due to Purkinje and deep nuclei neurons damage. The cochlear reflex originated hyperreflexia, abnormal posture, head movements and tremors. The withdrawal reflex produced flexor muscles hypersensitivity at the four legs, later depression and stupor. Abnormal responses to sounds were related to collicular lesions. Thalamic damage altered the withdrawal reflex, showing incomplete reaction. The observed cervical hair bristling was attributed to a thalamic regulated nociceptive response. Depression may be associated with agonists of lysergic acid contained in Ipomoea. These clinical signs were correlated with lesions in different parts of the CNS.

  17. Sweepoviruses cause disease in sweet potato and related Ipomoea spp.: fulfilling Koch's postulates for a divergent group in the genus begomovirus.

    Science.gov (United States)

    Trenado, Helena P; Orílio, Anelise F; Márquez-Martín, Belén; Moriones, Enrique; Navas-Castillo, Jesús

    2011-01-01

    Sweet potato (Ipomoea batatas) and related Ipomoea species are frequently infected by monopartite begomoviruses (genus Begomovirus, family Geminiviridae), known as sweepoviruses. Unlike other geminiviruses, the genomes of sweepoviruses have been recalcitrant to rendering infectious clones to date. Thus, Koch's postulates have not been fullfilled for any of the viruses in this group. Three novel species of sweepoviruses have recently been described in Spain: Sweet potato leaf curl Lanzarote virus (SPLCLaV), Sweet potato leaf curl Spain virus (SPLCSV) and Sweet potato leaf curl Canary virus (SPLCCaV). Here we describe the generation of the first infectious clone of an isolate (ES:MAL:BG30:06) of SPLCLaV. The clone consisted of a complete tandem dimeric viral genome in a binary vector. Successful infection by agroinoculation of several species of Ipomoea (including sweet potato) and Nicotiana benthamiana was confirmed by PCR, dot blot and Southern blot hybridization. Symptoms observed in infected plants consisted of leaf curl, yellowing, growth reduction and vein yellowing. Two varieties of sweet potato, 'Beauregard' and 'Promesa', were infected by agroinoculation, and symptoms of leaf curl and interveinal loss of purple colouration were observed, respectively. The virus present in agroinfected plants was readily transmitted by the whitefly Bemisia tabaci to I. setosa plants. The progeny virus population present in agroinfected I. setosa and sweet potato plants was isolated and identity to the original isolate was confirmed by sequencing. Therefore, Koch's postulates were fulfilled for the first time for a sweepovirus.

  18. Sweepoviruses cause disease in sweet potato and related Ipomoea spp.: fulfilling Koch's postulates for a divergent group in the genus begomovirus.

    Directory of Open Access Journals (Sweden)

    Helena P Trenado

    Full Text Available Sweet potato (Ipomoea batatas and related Ipomoea species are frequently infected by monopartite begomoviruses (genus Begomovirus, family Geminiviridae, known as sweepoviruses. Unlike other geminiviruses, the genomes of sweepoviruses have been recalcitrant to rendering infectious clones to date. Thus, Koch's postulates have not been fullfilled for any of the viruses in this group. Three novel species of sweepoviruses have recently been described in Spain: Sweet potato leaf curl Lanzarote virus (SPLCLaV, Sweet potato leaf curl Spain virus (SPLCSV and Sweet potato leaf curl Canary virus (SPLCCaV. Here we describe the generation of the first infectious clone of an isolate (ES:MAL:BG30:06 of SPLCLaV. The clone consisted of a complete tandem dimeric viral genome in a binary vector. Successful infection by agroinoculation of several species of Ipomoea (including sweet potato and Nicotiana benthamiana was confirmed by PCR, dot blot and Southern blot hybridization. Symptoms observed in infected plants consisted of leaf curl, yellowing, growth reduction and vein yellowing. Two varieties of sweet potato, 'Beauregard' and 'Promesa', were infected by agroinoculation, and symptoms of leaf curl and interveinal loss of purple colouration were observed, respectively. The virus present in agroinfected plants was readily transmitted by the whitefly Bemisia tabaci to I. setosa plants. The progeny virus population present in agroinfected I. setosa and sweet potato plants was isolated and identity to the original isolate was confirmed by sequencing. Therefore, Koch's postulates were fulfilled for the first time for a sweepovirus.

  19. Interferência de populações de Euphorbia heterophylla e Ipomoea ramosissima isoladas ou em misturas sobre a cultura de soja Interference of populations of Euphorbia heterophylla and Ipomoea ramosissima isolated or in mixture in soybean crop

    Directory of Open Access Journals (Sweden)

    M.A. Rizzardi

    2004-03-01

    Full Text Available Dentre as principais espécies daninhas que infestam as lavouras de soja do sul do Brasil, destacam-se Euphorbia heterophylla (leiteira e, mais recentemente, Ipomoea ramosissima (corda-de-viola. Objetivou-se avaliar a habilidade competitiva relativa entre espécies daninhas e soja e quantificar a interferência de infestações mistas de leiteira e corda-de-viola quando em convivência com plantas de soja. Foram conduzidos dois experimentos, comparando associações de leiteira ou corda-de-viola com soja, utilizando-se cinco proporções de plantas de leiteira e soja ou corda-de-viola e soja (0:8; 2:6; 4:4; 6:2; 8:0. Em um terceiro experimento, mantiveram-se constantes quatro plantas de soja por vaso e utilizaram-se cinco proporções de plantas de leiteira e corda-de-viola (0:8; 2:6; 4:4; 6:2; 8:0, estabelecidas em duas épocas de emergência das plantas daninhas em relação à soja. Verificou-se que a redução na biomassa da soja é mais intensa quando em presença de corda-de-viola do que de leiteira e, principalmente, em situações nas quais a planta daninha se estabelece antes que a cultura. Quando em infestação mista, corda-de-viola é mais competitiva do que leiteira.Euphorbia heterophylla (wild poinsettia, and, more recently, Ipomoea ramosissima (morningglory are among the main weeds infesting soybean crop in southern Brazil. This work aimed to evaluate the effects of wild poinsettia and morningglory as single or mixed populations in coexistence with soybean. Two experimentswere conducted to compare associations of wild poinsettia or moningglory with soybean, using five ratios of wild poinsettia plants and soybean or morningglory (0:8, 2:6, 4:4, 6:2 and 8:0. In a third experiment, four soybean plants per pot were kept constant and five ratios of of wild poinsettia and moningglory plants were used (0:8, 2:6, 4:4, 6:2 and 8:0, established in two weed emergence periods related to the soybean. The results indicated that a higher

  20. Pengaruh Penambahan Susu Bubuk Fullcream Terhadap Mutu Produk Minuman Fermentasi dari Ekstrak Ubi Jalar Merah (Ipomoea batatas L

    Directory of Open Access Journals (Sweden)

    Novelina Novelina

    2012-12-01

    Full Text Available This study was aimed to find exact volume of fullcream milk powder which added in the fermented beverage of red sweet potatoes extract (Ipomoea batatas L, as well as to investigate physical and chemical characteristics, and organoleptic. So it was obtained the fermented beverages which fulfilled the quality requirements of yogurt according to SNI 01- 2981-1992. Analysis was conducted on total Lactobacillus, total plates count, total lactic acid, pH, total solids, viscosity, and fat content. Organoleptic test of the color, texture, flavor, consistency, and taste was also carried out. The best product was analyzed for the chemical properties such as protein content, ash and crude fiber. The design used in this study was completely randomized design (CRD with four treatments of fullcream milk powder addition 5%, 10%, 15% and 20% respectively with 3 replications. The organoleptic test of the most preferred by the panelists was a fermented beverage with the addition of 10% fullcream milk powder. This product contained Lactobacillus total; 7.3 x 108 CFU/ml, total plate count; 1.4 x 107 CFU/ml, total lactic acid; 1.56%, pH; 4.42, total solids; 25.62%, viscosity; 25.5 dPa.s, fat content; 3.4%, protein content; 6.34%, ash content; 0.11%, and crude fiber content; 0.17%.ABSTRAKPenelitian ini bertujuan untuk mengetahui jumlah penambahan susu bubuk fullcream yang tepat pada minuman fermentasi ekstrak ubi jalar merah (Ipomoea batatas L, sertakarakteristik fisik, kimia dan organoleptik, sehingga diperoleh minuman fermentasi dariekstrak ubi jalar merah yang memenuhi persyaratan mutu yogurt menurut SNI 01 - 2.981- 1.992. Analisis dilakukan pada total Lactobacillus, angka lempeng total, asam laktat total, pH, total padatan, viskositas, kadar lemak dan organoleptik warna ,tekstur, rasa, konsistensi, rasa. Produk terbaik yang didapatkan dianalis sifat kimia seperti kadar protein, abu dan serat kasar. Rancangan yang digunakan dalam penelitian ini adalah rancangan

  1. Intoxicação por Ipomoea asarifolia em bovinos e ovinos no Rio Grande do Norte

    Directory of Open Access Journals (Sweden)

    Fabricio K. de L. Carvalho

    2014-11-01

    Full Text Available Ipomoea asarifolia é uma das principais plantas tóxicas para ruminantes nas regiões Norte e Nordeste. A intoxicação ocorre na época das secas quando há escassez de forragem e é mais frequente em ovinos do que em outras espécies, porem casos espontâneos também são relatados em caprinos, bovinos e búfalos. Este trabalho relata a ocorrência de 18 surtos de intoxicação em bovinos por I. asarifolia que ocorreram de agosto de 2012 a fevereiro de 2013 no estado do Rio Grande Norte. De um total de 1704 bovinos, 202 (11,8% adoeceram e 34 (2% morreram. Em seis propriedades onde havia ovinos estes também se intoxicaram. Foram observados também sinais clínicos em bezerros e cordeiros confinados, sem acesso às pastagens, que se intoxicaram pela ingestão do leite das mães que ingeriam I. asarifolia a pasto.

  2. Relationship between Processing Method and the Glycemic Indices of Ten Sweet Potato (Ipomoea batatas Cultivars Commonly Consumed in Jamaica

    Directory of Open Access Journals (Sweden)

    Perceval S. Bahado-Singh

    2011-01-01

    Full Text Available This study investigated the effect of different traditional cooking methods on glycemic index (GI and glycemic response of ten Sweet potato (Ipomoea batatas cultivars commonly eaten in Jamaica. Matured tubers were cooked by roasting, baking, frying, or boiling then immediately consumed by the ten nondiabetic test subjects (5 males and 5 females; mean age of 27 ± 2 years. The GI varied between 41 ± 5–93 ± 5 for the tubers studied. Samples prepared by boiling had the lowest GI (41 ± 5–50 ± 3, while those processed by baking (82 ± 3–94 ± 3 and roasting (79 ± 4–93 ± 2 had the highest GI values. The study indicates that the glycemic index of Jamaican sweet potatoes varies significantly with the method of preparation and to a lesser extent on intravarietal differences. Consumption of boiled sweet potatoes could minimize postprandial blood glucose spikes and therefore, may prove to be more efficacious in the management of type 2 diabetes mellitus.

  3. Element contents and food safety of water spinach (Ipomoea aquatica Forssk.) cultivated with wastewater in Hanoi, Vietnam

    DEFF Research Database (Denmark)

    Marcussen, Helle; Jørgensen, Karin; Holm, Peter E.

    2008-01-01

    Extensive aquatic or semi-aquatic production of water spinach (Ipomoea aquatica Forssk.) for human consumption takes place in Southeast Asia. The aim of this study was to assess the concentrations of 38 elements in soil and water spinach cultivated under different degrees of wastewater exposure...... in Hanoi, Vietnam. The results showed no effect of wastewater use on the overall element concentrations in soil and water spinach. Mean soil concentrations for selected potentially toxic elements at the studied field sites had the following ranges 9.11-18.7 As, 0.333-0.667 Cd, 10.8-14.5 Co, 68-122 Cr, 34...... concentrations in water spinach were 0.139 As, 0.032 Cd, 0.135 Cr, 2.01 Cu, 39.1 Fe, 57.3 Mn, 0.16 Ni, 0.189 Pb and 6.01 Zn mg kg(-1) fresh weight (f.w.). The site and soil content of organic carbon were found to have high influence on the water spinach element concentrations whereas soil pH and the total soil...

  4. Atividade alelopática dos lixiviados de Asemeia extraaxillaris (Polygalaceae sobre o crescimento de Ipomoea cordifolia

    Directory of Open Access Journals (Sweden)

    C.B. SILVA

    2016-01-01

    Full Text Available RESUMO O objetivo desse trabalho foi avaliar a atividade alelopática dos lixiviados das raízes e folhas secas de Asemeia extraaxillaris sobre o crescimento de corda de viola Ipomoea cordifolia em casa de vegetação, para avaliação dos efeitos sobre o estresse oxidativo. Nos bioensaios foram utilizadas três concentrações (0,25 - 5,00 e 10,00 g e um controle, com quatro repetições de 10 plantas, cultivadas em solo durante 30 dias. Os lixiviados possuem ação alelopática e o maior efeito foi verificado para o pó das raizes. O efeito inibitório foi dose-dependente e o aumento do estresse oxidativo foi observado pelos níveis da catalase, peroxidase, superóxido dismutase, glutationa redutase, peroxidação lipídica e síntese de formazan. Concluiu-se que A. extraaxillaris possui substâncias capazes de afetar a emergência, o crescimento e o estresse oxidativo de I. cordifolia.

  5. Photometric Characterization of the Reductive Amination Scope of the Imine Reductases from Streptomyces tsukubaensis and Streptomyces ipomoeae.

    Science.gov (United States)

    Matzel, Philipp; Krautschick, Lukas; Höhne, Matthias

    2017-10-18

    Imine reductases (IREDs) have emerged as promising enzymes for the asymmetric synthesis of secondary and tertiary amines starting from carbonyl substrates. Screening the substrate specificity of the reductive amination reaction is usually performed by time-consuming GC analytics. We found two highly active IREDs in our enzyme collection, IR-20 from Streptomyces tsukubaensis and IR-Sip from Streptomyces ipomoeae, that allowed a comprehensive substrate screening with a photometric NADPH assay. We screened 39 carbonyl substrates combined with 17 amines as nucleophiles. Activity data from 663 combinations provided a clear picture about substrate specificity and capabilities in the reductive amination of these enzymes. Besides aliphatic aldehydes, the IREDs accepted various cyclic (C 4 -C 8 ) and acyclic ketones, preferentially with methylamine. IR-Sip also accepted a range of primary and secondary amines as nucleophiles. In biocatalytic reactions, IR-Sip converted (R)-3-methylcyclohexanone with dimethylamine or pyrrolidine with high diastereoselectivity (>94-96 % de). The nucleophile acceptor spectrum depended on the carbonyl substrate employed. The conversion of well-accepted substrates could also be detected if crude lysates were employed as the enzyme source. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Study on Pb Content in 3 Week and 6 Week Old Kangkung (Ipomoea reptans Poir Planted in Pb containing Media

    Directory of Open Access Journals (Sweden)

    Poppy Hartatie Hardjo

    2005-11-01

    Full Text Available A study on the content of Pb in kangkung has been conducted. Land kangkung (Ipomoea reptans was used as the sample, and was planted in hydrophonic media, and watered with Multigrow Complete Plant Food (2000 mg/L and Pb solution (2 mg/L twice a day. Samples were taken based on the age (3 and 6 week old, and part of the plant (root and all parts without root. Inductively Coupled Plasma Spectrometer (ICPS Fison 3410+ was used to measure the Pb content. It was shown that in the plant the accumulation was mostly happened in the root. The 6 week-old plant contained Pb not just in the root (3.36 mg/kg sample but also in the other part of the plant (2.09 mg/kg sample and those were exceeded the maximum dietary allowance (2 mg/kg sample regulated by the Indonesian FDA; while in the 3 week-old plant the Pb content in the root was 1.86 mg/kg sample and in the other part of the plan was 1.13 mg/kg, which is not exceeded the dietary allowance. So it is advisable to harvest the kangkung vegetable at the most of 3 week-old.

  7. PENGARUH PEMBERIAN PUPUK ORGANIK PADA MEDIA TANAH YANG MENGANDUNG TIMBAL (Pb TERHADAP PERTUMBUHAN KANGKUNG DARAT (Ipomoea reptans Poir.

    Directory of Open Access Journals (Sweden)

    Listiatie Budi Utami

    2016-11-01

    Full Text Available Kangkung darat (Ipomoea reptans Poir. merupakan tanaman hiperakumulator  logam timbal (Pb, padahal kangkung darat banyak dikonsumsi oleh masyarakat. Penelitian ini bertujuan untuk mengetahui pertumbuhan dan kandungan timbal (Pb kangkung darat pada berbagai dosis pupuk organik; serta untuk mengetahui dosis pupuk organik yang paling efektif untuk meningkatkan pertumbuhan dan menurunkan kandungan timbal (Pb dalam kangkung darat. Penelitian dilakukan secara Rancangan Acak Lengkap (RAL dengan perlakuan pemberianpupuk organik dengan dosis 0 gram, 50 gram, 100 gram, 150 gram, 200 gram, dan 250 gram dalam 2 kg tanah dari TPA Piyungan, Bantul. Setiap perlakuan diulang 4 kali dan dilakukan selama 4 minggu. Pengamatan meliputi tinggi tanaman, jumlah daun, panjang daun, panjang akar, dan berat basah tanaman. Pada minggu ke-4, dilakukan pengukuran kadar timbal (Pb dalam daun. Dilakukan uji ANOVA dan BNT 5%. Hasil penelitian menunjukkan bahwa pemberian pupuk organik dapat meningkatkan pertumbuhan tanaman kangkung darat. Dosis yang paling efektif untuk pertumbuhan tanaman kangkung darat adalah 200 gram dalam 2 kg tanah. Pemberian pupuk organik tidak dapat menurunkan kandungan Pb dalam tanaman kangkung darat.

  8. Pengaruh Penyiraman dan Dosis Pemupukan terhadap Pertumbuhan Kangkung (Ipomoea reptans pada Komposisi Media Tanam Tanah+Pasir

    Directory of Open Access Journals (Sweden)

    AHMAD RIFQI FAUZI

    2015-09-01

    Full Text Available Effect of Water Requirment and Fertilization on Growth of Kangkong (Ipomoea reptans in media composition soil+sand. Kangkong plant is a tropical vegetable widely cultivated in Indonesia. Village has a wide adaptability to climate and soil in the tropics. This experiment aimed to see the effect of watering and fertilization on the growth of kangkong plants. Experiments was carried out in the garden experiment Cikabayan, IPB on March-April 2011. This experiment was arranged with randomized complete design which consisted of two factors are 3 levels of watering (watering every 1 day (A1, every 2 days (A2, and every 3 days (A3 and fertilization with 5 doses (100% dose recommendation (P1, 75% (P2 , 50% (P3, 25% (P4, and 0 (P5. Planting medium was a mixture of soil : sand (1:1. The results of this study indicate that the frequency of watering significant effect on plant height and weight of wet kangkong plants. Watering once every 2 days to produce the highest plant height (41.41 cm. While fertilization had no effect on all observed variables. Conclusion of the experiment is watering is one of important factor for plant production which significant effect on plant growth.

  9. Antioxidant and prebiotic activity of five peonidin-based anthocyanins extracted from purple sweet potato (Ipomoea batatas (L.) Lam.).

    Science.gov (United States)

    Sun, Hanju; Zhang, Pingping; Zhu, Yongsheng; Lou, Qiuyan; He, Shudong

    2018-03-22

    Twelve kinds of anthocyanins from the Chinese purple sweet potato cultivar (Ipomoea batatas (L.) Lam.) were extracted and identified using LC-MS/MS, which had a high content of peonidin-based anthocyanins. Five peonidin-based anthocyanin monomers (P1, P2, P3, P4 and P5) were isolated by preparative liquid chromatography with structural analyses using an Impact II Q-TOF MS/MS. Then, the functional properties of the anthocyanin monomers, such as the antioxidant activities, proliferative effects on probiotics, and their inhibition on harmful bacteria in vitro, were investigated. The peonidin-based components in purple sweet potato anthocyanins (PSPAs) showed good properties regarding scavenging 1,1-diphenyl-2-picrylhydrazyl (DPPH) radicals and superoxide anions, and had good potential in reducing the total power activity and Fe 2+ chelating ability. While the order of the antioxidant abilities was as follows: P4 > P5 > P3 > P2 > P1 > PSPAs. Microbial cultivations showed that P1, P2, P3, P4, P5 and PSPAs could induce the proliferation of Bifidobacterium bifidum, Bifidobacterium adolescentis, Bifidobacterium infantis and Lactobacillus acidophilus, and they inhibited the growth of Staphylococcus aureus and Salmonella typhimurium, suggesting the anthocyanins might have prebiotic-like activity through the modulation of the intestinal microbiota. Our results indicate that peonidin-based anthocyanins could be further utilized in health foods and pharmaceutical developments.

  10. Dust loadings on some common plants near Lucknow city. [Acacia melanoxylon, Bauhinia malabarica, Bougain-villea glabra, Calotropis procera, Catharanthus roseus, Eucalyptus globulus, Ipomoea fistulosa and Peltophorum pterocarpum

    Energy Technology Data Exchange (ETDEWEB)

    Yunus, M.; Dwivedi, A.K.; Kulshreshtha, K.; Ahmad, K.J.

    1985-01-01

    Eight plant species - Acacia melanoxylon, Bauhinia malabarica, Bougain-villea glabra, Calotropis procera, Catharanthus roseus, Eucalyptus globulus, Ipomoea fistulosa and Peltophorum pterocarpum - were collected from a newly established suburb colony of Lucknow city, where the major pollutant is dust, to study the dust cleansing efficiency of the plant canopy and also to establish the correlation between the leaf morphological characteristics and their dust trapping potential. The dust load, in milligrams per square centimeter of leaf surface, was measured and related to foliar epidermal and cuticular characteristics, and morphological features.

  11. Producción de metabolitos secundarios en cultivo de raíces in vitro y suspensiones celulares de Ipomoea carnea spp. carnea Jacq.

    OpenAIRE

    Rojas Idrogo, Consuelo; Kato, Massuo J.; Delgado-Paredes, Guillermo E.; Segal Floh, Eny Iochevet; Handro, Walter

    2014-01-01

    Ipomoea carnea spp. carnea Jacq. es un arbusto dominante en el bosque estacionalmente seco del Perú y Ecuador. Los cultivos de raíces fueron establecidos en medio MS con diferentes concentraciones de AIB, sacarosa y combinaciones de AIB-sacarosa. Diversos explantes obtenidos de plántulas in vitro y plantas silvestres se cultivaron en diferentes combinaciones de 2,4-D, AIA, ANA y BAP, para inducir callos friables, dependiendo del tipo de explante y los reguladores de creci...

  12. Eficácia de herbicidas em diferentes quantidades de palha de cana-de-açúcar no controle de Ipomoea grandifolia Effectiveness of herbicides through different amounts of sugar-cane straw on the Ipomoea grandifolia control

    Directory of Open Access Journals (Sweden)

    Patricia Andrea Monquero

    2009-01-01

    Full Text Available Este trabalho foi realizado com o objetivo de estudar o efeito de diferentes quantidades de palha de cana-de-açúcar, colhida sem queima prévia do canavial, na eficácia de alguns herbicidas no controle de Ipomoea grandifolia. O experimento foi desenvolvido em campo no Centro de Ciências Agrárias/UFSCar, em Araras (SP. Os tratamentos consistiram dos herbicidas ametryn + trifloxysulfuron-sodium (1463 + 37 g ha-1, imazapic (84 g ha-1, imazapyr (200 g ha-1, ¹diuron + hexazinone (1170 + 330 g ha-1 e ²diuron + hexazinone (1330 + 160 g ha-1 aplicados em pré-emergência de I. grandifolia e de cinco quantidades de palha de cana-de-açúcar (0, 5, 10, 15 e 20 t ha-1. A eficácia de controle das plantas daninhas foi avaliada aos 7, 14, 21 e 28 dias após a aplicação dos tratamentos (DAT. Com a adição de palha (15 e 20 t ha-1 ao solo foi reduzida a população de I. grandifolia. À medida que a quantidade de palha foi aumentada, reduziu-se a eficácia dos herbicidas; com 15 t ha-1 de palha, o controle foi considerado insatisfatório para todos os tratamentos utilizados. Com 20 t ha-1 nenhum herbicida foi eficaz, entretanto, a palha foi eficiente na supressão desta espécie, verificando-se que o número de plantas emergidas foi menor mesmo na testemunha.This work had as objective studies the effect of different amounts of sugarcane straw picked without burns about effectiveness of some herbicides in the I. grandifolia control. The experiment was conduced in field in the Centro de Ciências Agrárias/UFSCar, in Araras, SP. The treatments consisted of herbicides herbicidas ametryn + trifloxysulfuron-sodium (1463 + 37 g ha-1, imazapic (84 g ha-1, imazapyr (200 g ha-1, ¹diuron + hexazinone (1170 + 330 g ha-1 and ²diuron + hexazinone (1330 + 160 g ha-1 applied in pre emergence of Ipomoea grandifolia and on five growing amounts of sugarcane straw ( 0, 5, 10, 15 e 20 t ha-1. The effectiveness of control of weeds was evaluated to the 7, 14, 21 and 28

  13. Interferência de uma comunidade de plantas daninhas com predominância de Ipomoea hederifolia na cana-soca Interference of a weed community with predominance of Ipomoea hederifolia on sugar cane ratton

    Directory of Open Access Journals (Sweden)

    I.A.B. Silva

    2009-06-01

    Full Text Available Levantamentos recentes da flora de plantas daninhas associada à cultura da cana-de-açúcar apontaram Ipomoea hederifolia como uma das espécies mais importantes. Em virtude disso, objetivou-se determinar o potencial de redução da produtividade da cana-de-açúcar e da qualidade do caldo em resposta à interferência de uma comunidade de plantas daninhas com predomínio de I. hederifolia, bem como o período anterior à interferência (PAI. Foi instalado um experimento em Pitangueiras, SP, em que constituíram tratamentos nove períodos crescentes de convivência das plantas daninhas com a cultura (0, 16, 30, 44, 69, 97, 135, 160, 188 e 229 dias após o cultivo e adubação e início da brotação - DAB. O delineamento experimental foi em blocos casualizados, com cada tratamento em quatro repetições. Concluiu-se que o potencial de redução do número final de colmos e de produtividade foi de 34% e 46%, respectivamente. O PAI foi do início da brotação e se estendeu por 33 dias. Com o aumento do período de convivência com a comunidade infestante, houve antecipação do processo de maturação dos colmos, cujo caldo tendeu a apresentar maior valor de açúcar total recuperável (ATR. Com a redução de produtividade devido à interferência, o valor de ATR ha-1 tendeu a ser negativamente afetado.Recent surveys on weed community associated with sugar cane have pointed Ipomoea hederifolia as one of the most important species. Thus, this work aimed to determine the potential for reducing the productivity and quality of sugar cane in response to weed community interference with a predominance of I. hederifolia, and the period prior to interference (PPI. An assay was installed in Pitangueiras , Brazil, with the treatments consisting of nine periods of coexistence of the weeds with the culture (0, 16, 30, 44, 69,97, 135, 160,188 and 229 days after cultivation and fertilization and days after sprouting. The experiments were arranged in a

  14. Eficiência fotossintética e consumo de água de Ipomoea triloba após aplicação de herbicidas Photosynthetic efficiency and water consumption of Ipomoea triloba after herbicide application

    Directory of Open Access Journals (Sweden)

    R. Araldi

    2012-09-01

    Full Text Available Este trabalho foi desenvolvido com o objetivo de avaliar a fluorescência através da taxa de transporte de elétrons, consumo de água e intoxicação de plantas de Ipomoea triloba após aplicação de quatro herbicidas de diferentes mecanismos de ação. Os herbicidas aplicados foram: glyphosate, haloxyfop-methyl, diuron e amicarbazone. A aplicação foi feita com auxílio de um pulverizador estacionário instalado em laboratório; após a aplicação dos tratamentos, as plantas foram mantidas em casa de vegetação. Foi avaliada a taxa de transporte de elétrons (ETR, o consumo de água e a intoxicação das plantas em vários períodos após o início do experimento. Os dados de ETR e fitointoxicação foram expressos em porcentagem da testemunha e submetidos à análise de variância e à comparação das médias. Quanto ao consumo de água, os dados foram acumulados e ajustados por modelos de regressão. Assim, pode-se dizer que o fluorômetro é uma ferramenta adequada para verificar a intoxicação antecipada em plantas de I. triloba tratadas com os herbicidas amicarbazone e diuron, visto que a inibição da ETR foi verificada antes de qualquer intoxicação visual sofrida por essas plantas; o consumo de água está relacionado diretamente com o transporte de elétrons, com exceção das plantas submetidas ao haloxyfop-methyl, que não sofreram interferência no transporte de elétrons, mas reduziram o consumo de água.This work was carried out to evaluate fluorescence through electron transport rate (ETR, water consumption and intoxication of Ipomoea triloba after application of four herbicides with different mechanisms of action. The herbicides glyphosate, haloxyfop-methyl, diuron, and amicarbazone were applied using a stationary sprayer installed in the laboratory. After application, the plants were kept under greenhouse conditions. Electron transport rate, water consumption and plant intoxication were evaluated at various periods

  15. Germinação de sementes de plantas daninhas de pastagens cultivadas: Mimosa pudica e Ipomoea asarifolia Seed germination of weeds from cultivated pasture areas: Mimosa pudica and Ipomoea asarifolia

    Directory of Open Access Journals (Sweden)

    A.P.S. Souza Filho

    2001-04-01

    Full Text Available Malícia (Mimosa pudica e salsa (Ipomoea asarifolia são importantes plantas daninhas que infestam áreas de pastagens cultivadas da região amazônica brasileira. Neste trabalho foram analisados os efeitos de fatores relacionados ao solo e clima na variação da germinação (percentual e índice de velocidade de germinação - IVG de sementes dessas espécies. A germinação foi monitorada em um período de 15 dias, com contagens diárias e eliminação das sementes germinadas. Os resultados mostraram que os fatores de solo alumínio, pH, cálcio e magnésio não influenciam a germinação das duas espécies de plantas daninhas. A germinação das sementes de malícia e salsa pode ocorrer tanto na presença como na ausência de luz. A temperatura ótima de germinação (percentual e IVG para ambas as espécies foi de 30 ºC contínua e 25-35 ºC alternada, embora as sementes de malícia tenham germinado satisfatoriamente em temperaturas contínuas superiores e inferiores a 30 ºC e em todas as combinações de temperaturas alternadas. Comparativamente, o índice de velocidade de germinação (IVG foi mais sensível aos efeitos da temperatura do que o percentual de germinação. Ambas as espécies responderam negativamente ao aumento da salinidade, sendo a espécie malícia mais tolerante ao sal do que a salsa.Mimosa pudica and Ipomoea asarifolia are important weeds of cultivated pasture in the Brazilian Amazon Region. This research analyzes the effects of the change in soil and climate factors on the germination (percentage and germination speed index of these species. Germination was monitored for a 15-day period, with daily counting and elimination of the germinated seeds. The results showed that soil factors such as aluminum, pH, calcium, and magnesium did not influence the germination of the two weed species. The germination of both M. pudica and I. asarifolia is independent of light exposure. Optimum germination (percentage and

  16. Efficient embryogenic suspension culturing and rapid transformation of a range of elite genotypes of sweet potato (Ipomoea batatas [L.] Lam.).

    Science.gov (United States)

    Yang, Jun; Bi, Hui-Ping; Fan, Wei-Juan; Zhang, Min; Wang, Hong-Xia; Zhang, Peng

    2011-12-01

    Efficient Agrobacterium tumefaciens-mediated transformation was developed using embryogenic suspension cell cultures of elite sweet potato (Ipomoea batatas [L.] Lam.) cultivars, including Ayamurasaki, Sushu2, Sushu9, Sushu11, Wanshu1, Xushu18 and Xushu22. Embryogenic suspension cultures were established in LCP medium using embryogenic calli induced from apical or axillary buds on an induction medium containing 2 mg l(-1) 2,4-D. Suspension cultures were co-cultivated with A. tumefaciens strain LBA4404 harboring the binary plasmid pCAMBIA1301 with the hpt gene as a selectable marker and an intron-interrupted uidA gene as a visible marker. Several key steps of the sweet potato transformation system have been investigated and optimized, including the appropriate antibiotics and their concentrations for suppressing Agrobacterium growth and the optimal doses of hygromycin for transformant selection. A total of 485 putative transgenic plant lines were produced from the transformed calli via somatic embryogenesis and germination to plants under 10 mg l(-1) hygromycin and 200 mg l(-1) cefotaxime. PCR, GUS and Southern blot analyses of the regenerated plants showed that 92.35% of them were transgenic. The number of T-DNA insertions varied from one to three in most transgenic plant lines. Plants showed 100% survival when 308 transgenics were transferred to soil in the greenhouse and then to the field. Most of them were morphologically normal, with the production of storage roots after 3 months of cultivation in the greenhouse or fields. The development of such a robust transformation method suitable to a range of sweet potato genotypes not only provides a routine tool for genetic improvement via transgenesis but also allows us to conduct a functional verification of endogenous genes in sweet potato. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

  17. Application of IBA in environmental remediation using skins of cocoa (Theobroma cacao) and sweet potatoes (Ipomoea batatas)

    Energy Technology Data Exchange (ETDEWEB)

    Sumbu, K. [Department of Chemistry, Cape Peninsula University of Technology, PO Box 1906, Bellville, 7535 (South Africa); Mars, J.A.; Gihwala, D. [Department of Biomedical Sciences, Cape Peninsula University of Technology, PO Box 1906, Bellville, 7535 (South Africa)

    2013-07-01

    Full text: The industrial sector is one of the most dynamic sectors of the economy and is of cardinal importance in economic development and poverty alleviation. Furthermore, economies with low levels of industrialisation are gradually shifting dependence from agriculture to the industrial sector, while developed economies, with a high level of industrialisation, are shifting from the industrial to the service sector [1]. Amongst the various industrial sectors, a substantial portion of effluents containing heavy metals are generated by electroplating (nickel, lead, zinc and copper), tanneries (chrome) and other chemical industries. Many engineering processes have been designed to remove the heavy metals from the polluted parts of the ecosystem. These processes are however highly capital intensive. To establish a less costly means of removal of heavy metal pollution, the dried skins of cocoa (Theobroma cacao) and sweet potato (Ipomoea batatas) were pulverized and used in the absorption of the heavy metals Ni and Pb. After adsorption by the metals, the powders were dried and then pressed into tablets. For quantification of the elemental adsorption, PIXE, using the Geo PIXE computational software, is a versatile multi-element analytical technique, and has minimum detection limits down to concentration ranges as low as 0.1 parts per million [2,3]. To determine the composition of the major elements such as C, O and N, Backscattering Spectrometry, using SimNRA software, [4] was used. In this study we report on the economic viability of using the skins of cocoa and sweet potato in the removal of Ni and Pd from polluted waters. (author)

  18. Digital gene expression analysis based on integrated de novo transcriptome assembly of sweet potato [Ipomoea batatas (L. Lam].

    Directory of Open Access Journals (Sweden)

    Xiang Tao

    Full Text Available BACKGROUND: Sweet potato (Ipomoea batatas L. [Lam.] ranks among the top six most important food crops in the world. It is widely grown throughout the world with high and stable yield, strong adaptability, rich nutrient content, and multiple uses. However, little is known about the molecular biology of this important non-model organism due to lack of genomic resources. Hence, studies based on high-throughput sequencing technologies are needed to get a comprehensive and integrated genomic resource and better understanding of gene expression patterns in different tissues and at various developmental stages. METHODOLOGY/PRINCIPAL FINDINGS: Illumina paired-end (PE RNA-Sequencing was performed, and generated 48.7 million of 75 bp PE reads. These reads were de novo assembled into 128,052 transcripts (≥ 100 bp, which correspond to 41.1 million base pairs, by using a combined assembly strategy. Transcripts were annotated by Blast2GO and 51,763 transcripts got BLASTX hits, in which 39,677 transcripts have GO terms and 14,117 have ECs that are associated with 147 KEGG pathways. Furthermore, transcriptome differences of seven tissues were analyzed by using Illumina digital gene expression (DGE tag profiling and numerous differentially and specifically expressed transcripts were identified. Moreover, the expression characteristics of genes involved in viral genomes, starch metabolism and potential stress tolerance and insect resistance were also identified. CONCLUSIONS/SIGNIFICANCE: The combined de novo transcriptome assembly strategy can be applied to other organisms whose reference genomes are not available. The data provided here represent the most comprehensive and integrated genomic resources for cloning and identifying genes of interest in sweet potato. Characterization of sweet potato transcriptome provides an effective tool for better understanding the molecular mechanisms of cellular processes including development of leaves and storage roots

  19. Application of IBA in environmental remediation using skins of cocoa (Theobroma cacao) and sweet potatoes (Ipomoea batatas)

    International Nuclear Information System (INIS)

    Sumbu, K.; Mars, J.A.; Gihwala, D.

    2013-01-01

    Full text: The industrial sector is one of the most dynamic sectors of the economy and is of cardinal importance in economic development and poverty alleviation. Furthermore, economies with low levels of industrialisation are gradually shifting dependence from agriculture to the industrial sector, while developed economies, with a high level of industrialisation, are shifting from the industrial to the service sector [1]. Amongst the various industrial sectors, a substantial portion of effluents containing heavy metals are generated by electroplating (nickel, lead, zinc and copper), tanneries (chrome) and other chemical industries. Many engineering processes have been designed to remove the heavy metals from the polluted parts of the ecosystem. These processes are however highly capital intensive. To establish a less costly means of removal of heavy metal pollution, the dried skins of cocoa (Theobroma cacao) and sweet potato (Ipomoea batatas) were pulverized and used in the absorption of the heavy metals Ni and Pb. After adsorption by the metals, the powders were dried and then pressed into tablets. For quantification of the elemental adsorption, PIXE, using the Geo PIXE computational software, is a versatile multi-element analytical technique, and has minimum detection limits down to concentration ranges as low as 0.1 parts per million [2,3]. To determine the composition of the major elements such as C, O and N, Backscattering Spectrometry, using SimNRA software, [4] was used. In this study we report on the economic viability of using the skins of cocoa and sweet potato in the removal of Ni and Pd from polluted waters. (author)

  20. KORELASI KARAKTER ANATOMI DAUN UBI JALAR (Ipomoea batatas L. KULTIVAR TAHAN DAN TIDAK TAHAN TERHADAP INTENSITAS PENYAKIT KUDIS DAUN

    Directory of Open Access Journals (Sweden)

    Ade Winda Pradana

    2017-03-01

    Full Text Available Sweet potato (Ipomoea batatas L. is one of alternative food sources beside than rice. Sweet potatoes are contains minerals, nutrients, sources of energy, protein, vitamins A and C. Sweet potatoes have lower productivity than rice and cassava. The low productivity of sweet potatoes due to several factors, which one of them is a leaf scab disease caused by pathogens Sphaceloma batatas Saw. The purpose of this study is to determine the character of the anatomy of sweet potato leaf cultivars that resistant and unresistant to the intensity of leaf scab disease, as well as the correlations between the anatomy character of sweet potato leaves with leaf scab disease intensity. The method used in this study is an experimental method with factorial completely randomized design. The first factor is the character of the anatomy of four cultivars sweet potato leaves, Cangkuang and Sukuh cultivars (cultivars resistant, cultivars Cilembu and Beta (unresistant cultivars. The second factor is the inoculation treatment S. batatas Saw. The parameters were observed thickness of cuticle, epidermis, mesophyll, the size (length and width stomata, density of stomata and trikomata as well as the intensity of the disease were analyzed using analysis of variance (ANOVA. To determine the correlation between the anatomy character leaves with disease intensity using regression correlation analysis. The results showed that Cangkuang cultivar has cuticle, epidermis and mesophyll thickest. Beta cultivars have stomata size of the longest and widest. Cilembu cultivar has the highest density of stomata. Sukuh cultivars has the highest density. The anatomy characters include of a thick cuticle, epidermis, stomata size (length and width, as well as the density of stomata and trikomata correlated with intensity of leaf scab disease.

  1. Improved tolerance to various abiotic stresses in transgenic sweet potato (Ipomoea batatas expressing spinach betaine aldehyde dehydrogenase.

    Directory of Open Access Journals (Sweden)

    Weijuan Fan

    Full Text Available Abiotic stresses are critical delimiters for the increased productivity and cultivation expansion of sweet potato (Ipomoea batatas, a root crop with worldwide importance. The increased production of glycine betaine (GB improves plant tolerance to various abiotic stresses without strong phenotypic changes, providing a feasible approach to improve stable yield production under unfavorable conditions. The gene encoding betaine aldehyde dehydrogenase (BADH is involved in the biosynthesis of GB in plants, and the accumulation of GB by the heterologous overexpression of BADH improves abiotic stress tolerance in plants. This study is to improve sweet potato, a GB accumulator, resistant to multiple abiotic stresses by promoted GB biosynthesis. A chloroplastic BADH gene from Spinacia oleracea (SoBADH was introduced into the sweet potato cultivar Sushu-2 via Agrobacterium-mediated transformation. The overexpression of SoBADH in the transgenic sweet potato improved tolerance to various abiotic stresses, including salt, oxidative stress, and low temperature. The increased BADH activity and GB accumulation in the transgenic plant lines under normal and multiple environmental stresses resulted in increased protection against cell damage through the maintenance of cell membrane integrity, stronger photosynthetic activity, reduced reactive oxygen species (ROS production, and induction or activation of ROS scavenging by the increased activity of free radical-scavenging enzymes. The increased proline accumulation and systemic upregulation of many ROS-scavenging genes in stress-treated transgenic plants also indicated that GB accumulation might stimulate the ROS-scavenging system and proline biosynthesis via an integrative mechanism. This study demonstrates that the enhancement of GB biosynthesis in sweet potato is an effective and feasible approach to improve its tolerance to multiple abiotic stresses without causing phenotypic defects. This strategy for trait

  2. POTENSI BAKTERI ENDOFIT AKAR UBI JALAR (IPOMOEA BATATAS L. ASAL KABUPATEN SORONG PAPUA BARAT SEBAGAI AGENSIA BIOKONTROL MELOIDOGYNE SPP.

    Directory of Open Access Journals (Sweden)

    Tuminem .

    2016-03-01

    Full Text Available Potency of sweetpotato (Ipomoea batatas L. root endophytic bacteria from Sorong District West Papua as biocontrol agent of Meloidogyne spp. Root knot nematodes/RKN, Meloidogyne spp. is one of the important pathogens in sweet potato plant. The disease incidence rate by the RKN on sweetpotato crop in Sorong District reached 88.77%. This study aims to get the sweet potato root endophytic bacteria that have potential as biocontrol agents against Meloidogyne spp. Endophytic bacteria was isolated from the roots of healthy sweet potato sampled from Sorong District, West Papua Province. Isolation and selection of bacteria using TSA media. Selected bacterial isolates, which were non-pathogenic to plants and humans then were identified with PCR technique using universal primer 63-F / 1387-R. The ability of bacteria to produce the lipase enzyme was selected using the media NB agar and rhodamine B. The protease enzyme-producing bacteria were selected using skim milk media. The chitinase enzyme-producing bacteria were selected using the colloidal chitin media. Production of cyanide was detected using filter paper soaked in a solution of CDS. The effectiveness of culture filtrate of bacteria as biocontrol agents was measured based on the percentage of 2nd juvenile mortality and egg hatching of Meloidogyne spp. Four isolates of endophytic bacteria, that were Enterobacter sp EAS (1a, Enterobacter sp. EAS (3a Enterobacter ludwigii EAS (4, and Burkholderia cepacia EAS (6 produced lipase and protease. In addition, B. cepacia EAS (6 also produced chitinase. Those isolates caused mortality of the 2nd juvenile 81.4 to 95.2% and inhibited the egg hatching of Meloidogyne spp. 53.13 to 81.92%.

  3. On the origin of sweet potato (Ipomoea batatas (L.) Lam.) genetic diversity in New Guinea, a secondary centre of diversity.

    Science.gov (United States)

    Roullier, C; Kambouo, R; Paofa, J; McKey, D; Lebot, V

    2013-06-01

    New Guinea is considered the most important secondary centre of diversity for sweet potato (Ipomoea batatas). We analysed nuclear and chloroplast genetic diversity of 417 New Guinea sweet potato landraces, representing agro-morphological diversity collected throughout the island, and compared this diversity with that in tropical America. The molecular data reveal moderate diversity across all accessions analysed, lower than that found in tropical America. Nuclear data confirm previous results, suggesting that New Guinea landraces are principally derived from the Northern neotropical genepool (Camote and Batata lines, from the Caribbean and Central America). However, chloroplast data suggest that South American clones (early Kumara line clones or, more probably, later reintroductions) were also introduced into New Guinea and then recombined with existing genotypes. The frequency distribution of pairwise distances between New Guinea landraces suggests that sexual reproduction, rather than somaclonal variation, has played a predominant role in the diversification of sweet potato. The frequent incorporation of plants issued from true seed by farmers, and the geographical and cultural barriers constraining crop diffusion in this topographically and linguistically heterogeneous island, has led to the accumulation of an impressive number of variants. As the diversification of sweet potato in New Guinea is primarily the result of farmers' management of the reproductive biology of their crop, we argue that on-farm conservation programmes that implement distribution of core samples (clones representing the useful diversity of the species) and promote on-farm selection of locally adapted variants may allow local communities to fashion relatively autonomous strategies for coping with ongoing global change.

  4. Effect of Ipomoea aquatica ethanolic extract in streptozotocin (STZ) induced diabetic rats via1H NMR-based metabolomics approach.

    Science.gov (United States)

    Abu Bakar Sajak, Azliana; Mediani, Ahmed; Maulidiani; Mohd Dom, Nur Sumirah; Machap, Chandradevan; Hamid, Muhajir; Ismail, Amin; Khatib, Alfi; Abas, Faridah

    2017-12-01

    Ipomoea aquatica (locally known as "kangkung") has previously been reported to have hypoglycemic activities on glucose level in diabetes patients. However, the effect of I. aquatica ethanolic extract on the metabolites in the body has remained unknown. This study provides new insights on the changes of endogenous metabolites caused by I. aquatica ethanolic extract and improves the understanding on the therapeutic efficacy and mechanism of I. aquatica ethanolic extract. By using a combination of 1 H nuclear magnetic resonance (NMR) with multivariate analysis (MVDA), the changes of metabolites due to I. aquatica ethanolic extract administration in obese diabetic-induced Sprague Dawley rats (OB+STZ+IA) were identified. The results suggested 19 potential biomarkers with variable importance projections (VIP) above 0.5, which include creatine/creatinine, glucose, creatinine, citrate, carnitine, 2-oxoglutarate, succinate, hippurate, leucine, 1-methylnicotinamice (MNA), taurine, 3-hydroxybutyrate (3-HB), tryptophan, lysine, trigonelline, allantoin, formiate, acetoacetate (AcAc) and dimethylamine. From the changes in the metabolites, the affected pathways and aspects of metabolism were identified. I. aquatica ethanolic extract increases metabolite levels such as creatinine/creatine, carnitine, MNA, trigonelline, leucine, lysine, 3-HB and decreases metabolite levels, including glucose and tricarboxylic acid (TCA) intermediates. This implies capabilities of I. aquatica ethanolic extract promoting glycolysis, gut microbiota and nicotinate/nicotinamide metabolism, improving the glomerular filtration rate (GFR) and reducing the β-oxidation rate. However, the administration of I. aquatica ethanolic extract has several drawbacks, such as unimproved changes in amino acid metabolism, especially in reducing branched chain amino acid (BCAA) synthesis pathways and lipid metabolism. Copyright © 2017 Elsevier GmbH. All rights reserved.

  5. Sweet potato Ipomoea Batatas Modulates Radiation-induced Oxidative damage in Liver and kidney of Male Albino Rats

    International Nuclear Information System (INIS)

    Darwish, M. M.; Farag, M. F. S.; Osman, N. N.

    2010-01-01

    Sweet potato Ipomoea Batatas, one of the major vegetable crops consumed worldwide, is rich in phytochemicals, which displayed antioxidant activities. This work aims at assessing the radio-protective properties of sweet potato tubers on liver and kidney tissues. Male albino rats were whole body exposed to 0.5 Gy day after day for a period of 20 days. Animal received orally prepared aqueous extract of sweet potato tubers (100 mg kg/body weight), one week before irradiation and during the period of radiation exposure. The results demonstrated that irradiation of rats induced a significant increase in lipid peroxides level measured as thiobarbituric acid reactive substances (TBARS) concomitant with a significant decrease in superoxide dismutase (SOD), and catalase (CAT) activity and glutathione (GSH) content in liver and kidney tissues. Administration of a freshly prepared aqueous extract of sweet potato tubers to rats, one week pre-irradiation and during the period of radiation exposure has significantly of ameliorated the oxidative stress in both tissues. The significant amelioration in oxidative stress was substantiated by improvement of liver and kidney enzymes Treatment of rats with sweet potato has significantly reduced the increase in serum alanine amino transferase (ALT), aspartate amino transferase (AST) and lactate dehydrogenase (LDH) activity, serum creatinine and urea levels. Furthermore, hyperglycemia and alteration in lipid profile manifested by a significant increase in triglycerides (TG), total cholesterol (TC), and low density lipoprotein cholesterol (LDL-C), and a significant decrease in high density lipoprotein cholesterol (HDL-C), were improved in sweet potato-treated irradiated rats compared to those only irradiated. According to the results obtained in the present study, it could be concluded that sweet potato through its antioxidant activities could protect cellular membrane from radiation induced oxidative damage in animals and preserve the

  6. Influence of diesel contamination in soil on growth and dry matter partitioning of Lactuca sativa and Ipomoea batatas.

    Science.gov (United States)

    Fatokun, Kayode; Zharare, Godfrey Elijah

    2015-09-01

    Phytotoxic effect of diesel contaminated soil was investigated on growth and dry matter partitioning in Lactuca sativa and Ipomoea batatas in greenhouse pot experiment at two concentration range (0-30 ml and 0-6 ml diesel kg(-1) soil) for 14 weeks. The results indicated thatwhole plant biomass, stem length, root length, number of leaves and leaf chlorophyll in two plants were negatively correlated with increasing diesel concentrations. The critical concentration of diesel associated with 10% decrease in plant growth was 0.33 ml for lettuce and 1.50 ml for sweet potato. Thus, growth of lettuce in diesel contaminated soil was more sensitive than sweet potato. The pattern of dry matter partitioning between root and shoot in both plants were similar. In 0-6 ml diesel contamination range, allocation of dry matter to shoot system was favoured resulting in high shoot: root ratio of 4.54 and 12.91 for lettuce and sweet potato respectively. However, in 0-30 ml diesel contamination range, allocation of dry matter to root was favoured, which may have been an adaptive mechanism in which the root system was used for storage in addition to increasing the capacity for foraging for mineral nutrients and water. Although lettuce accumulated more metals in its tissue than sweet potato, the tissue mineral nutrients in both species did not vary to great extent. The critical diesel concentration for toxicity suggested that the cause of mortality and poor growth of sweet potato and lettuce grown in diesel contaminated soil was due to presence of hydrocarbons in diesel.

  7. H+ -pyrophosphatase IbVP1 promotes efficient iron use in sweet potato [Ipomoea batatas (L.) Lam.].

    Science.gov (United States)

    Fan, Weijuan; Wang, Hongxia; Wu, Yinliang; Yang, Nan; Yang, Jun; Zhang, Peng

    2017-06-01

    Iron (Fe) deficiency is one of the most common micronutrient deficiencies limiting crop production globally, especially in arid regions because of decreased availability of iron in alkaline soils. Sweet potato [Ipomoea batatas (L.) Lam.] grows well in arid regions and is tolerant to Fe deficiency. Here, we report that the transcription of type I H + -pyrophosphatase (H + -PPase) gene IbVP1 in sweet potato plants was strongly induced by Fe deficiency and auxin in hydroponics, improving Fe acquisition via increased rhizosphere acidification and auxin regulation. When overexpressed, transgenic plants show higher pyrophosphate hydrolysis and plasma membrane H + -ATPase activity compared with the wild type, leading to increased rhizosphere acidification. The IbVP1-overexpressing plants showed better growth, including enlarged root systems, under Fe-sufficient or Fe-deficient conditions. Increased ferric precipitation and ferric chelate reductase activity in the roots of transgenic lines indicate improved iron uptake, which is also confirmed by increased Fe content and up-regulation of Fe uptake genes, e.g. FRO2, IRT1 and FIT. Carbohydrate metabolism is significantly affected in the transgenic lines, showing increased sugar and starch content associated with the increased expression of AGPase and SUT1 genes and the decrease in β-amylase gene expression. Improved antioxidant capacities were also detected in the transgenic plants, which showed reduced H 2 O 2 accumulation associated with up-regulated ROS-scavenging activity. Therefore, H + -PPase plays a key role in the response to Fe deficiency by sweet potato and effectively improves the Fe acquisition by overexpressing IbVP1 in crops cultivated in micronutrient-deficient soils. © 2016 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  8. Producción de alcohol a partir de genotipos de batata (Ipomoea batatas (L. Lam. en medios fermentativos

    Directory of Open Access Journals (Sweden)

    Amanda Cantos Lopes

    2018-04-01

    Full Text Available El etanol es uno de los combustibles más prometedores en Brasil, pero su producción está centralizada en el cultivo de la caña de azúcar, y actualmente se están buscando otras fuentes de biomasa productora de alcohol para reemplazar el monocultivo de la caña de azúcar. El objetivo de este estudio fue evaluar las variables del proceso de fermentación como el tiempo de fermentación (72 y 96 horas, adición de nutrientes (con y sin adición y levaduras (levadura orgánica seca y fresca empleadas en la producción de etanol a partir de dos genotipos de batata (Ipomoea batatas L.: UGA 05 y UGA 77. El contenido del alcohol evaluado en °GL se realizó en un diseño completamente al azar según dos esquemas factoriales (22 y 23, y los resultados obtenidos se analizaron con el software Design Expert® versión 8. Los resultados del diseño factorial 22 indican que el tiempo de fermentación en la producción de alcohol tuvo un efecto significativo en el proceso, lo que sugiere que la producción de alcohol es más eficiente en 72 horas de fermentación y sin la inclusión de nutrientes. En el diseño factorial 23, las interacciones entre el tiempo de fermentación con genotipos, y entre el tiempo y la inclusión de la levadura mostraron efectos significativos y alteraron la producción de alcohol. El proceso de fermentación muestra una diferencia significativa en función del material genético y las levaduras utilizadas, señalando la fermentación del mosto de harina del genotipo UGA 77 bajo acción de levadura fresca y 72 horas de fermentación.

  9. In vitro antiplasmodial effiacy of mangrove plant, Ipomoea pes-caprae against Plasmodium falciparum (3D7 strain

    Directory of Open Access Journals (Sweden)

    Veera Venkata Satish Pothula

    2015-12-01

    Full Text Available Objective: To evaluate the antiplasmodial activity of mangrove plant, Ipomoea pes-caprae (I. pes-caprae (leaves, stems, flowers and roots against chloroquine-sensitive Plasmodium falciparum (3D7 strain (P. falciparum and cytotoxicity against brine shrimp larvae and THP-1 cell line. Methods: The plants (I. pes-caprae were collected from Machilipatnam mangrove forest (latitude 16°17′ N and longitude 81 °13′ E of Krishna District, Andhra Pradesh, India. Crude extracts from dried leaves, stems, flowers and roots of I. pes-caprae were prepared through Soxhlet extraction using methanol, chloroform, hexane, ethyl acetate and aqueous sequentially. These extracts were tested in vitro against P. falciparum (3D7 strain adopted in laboratory. The crude extracts were also tested for their cytotoxicity against brine shrimp larvae and THP-1 cell line. The phytochemical screenings were also conducted with standard methods. As the part of the study, the extracts were checked for any chemical injury to erythrocytes. Results: Out of these extracts, methanolic and aqueous extracts of all plant parts and chloroform extract of stems were active, and the ethyl acetate extracts were weekly active against P. falciparum. The extracts of chloroform (except stems and hexane were inactive. Amongst these extracts, the methanolic extract of root showed excellent antimalarial activity with the IC 50 value of 15.00 µg/mL. Cytotoxic evaluation revealed that methanolic, aqueous and ethyl acetate extracts were slightly cytotoxic whereas chloroform and hexane extracts were more toxic against brine shrimp. All extracts were non-toxic to THP-1 cells. The chemical injury to erythrocytes was also evaluated and it did not show any morphological changes in erythrocytes due to the effect of plant extracts of I. pes-caprae after 48 h of incubation. The phytochemical screening of the extracts revealed the presence of alkaloids, triterpenes, flavonoids, tannins, coumarins

  10. A foundation monograph of Convolvulus L. (Convolvulaceae).

    Science.gov (United States)

    Wood, John R I; Williams, Bethany R M; Mitchell, Thomas C; Carine, Mark A; Harris, David J; Scotland, Robert W

    2015-01-01

    A global revision of Convolvulus L. is presented, Calystegia R.Br. being excluded on pragmatic grounds. One hundred and ninety species are recognised with the greatest diversity in the Irano-Turanian region. All recognised species are described and the majority are illustrated. Distribution details, keys to species identification and taxonomic notes are provided. Four new species, Convolvulusaustroafricanus J.R.I.Wood & R.W.Scotland, sp. nov., Convolvulusiranicus J.R.I.Wood & R.W.Scotland, sp. nov., Convolvuluspeninsularis J.R.I.Wood & R.W.Scotland, sp. nov. and Convolvulusxanthopotamicus J.R.I.Wood & R.W.Scotland, sp. nov., one new subspecies Convolvuluschinensissubsp.triangularis J.R.I.Wood & R.W.Scotland, subsp. nov., and two new varieties Convolvulusequitansvar.lindheimeri J.R.I.Wood & R.W.Scotland, var. nov., Convolvulusglomeratusvar.sachalitarum J.R.I.Wood & R.W.Scotland, var. nov. are described. Convolvulusincisodentatus J.R.I.Wood & R.W.Scotland, nom. nov., is provided as a replacement name for the illegitimate Convolvulusincisus Choisy. Several species treated as synonyms of other species in recent publications are reinstated including Convolvuluschinensis Ker-Gawl., Convolvulusspinifer M.Popov., Convolvulusrandii Rendle and Convolvulusaschersonii Engl. Ten taxa are given new status and recognised at new ranks: Convolvulusnamaquensis (Schltr. ex. A.Meeuse) J.R.I.Wood & R.W.Scotland, stat. nov., Convolvulushermanniaesubsp.erosus (Desr.) J.R.I.Wood & R.W.Scotland, stat. nov., Convolvuluscrenatifoliussubsp.montevidensis (Spreng.) J.R.I.Wood & R.W.Scotland, stat. nov., Convolvulusfruticulosussubsp.glandulosus (Webb) J.R.I.Wood & R.W.Scotland, stat. nov., Convolvuluscapituliferussubsp.foliaceus (Verdc.) J.R.I.Wood & R.W.Scotland, stat. nov., Convolvulushystrixsubsp.ruspolii (Dammer ex Hallier f.) J.R.I.Wood & R.W.Scotland, stat. nov., Convolvulushystrixsubsp.inermis (Chiov.) J.R.I.Wood & R.W.Scotland, stat. nov., Convolvulusrottlerianussubsp.stocksii (Boiss.) J.R.I.Wood & R.W.Scotland, comb. et stat. nov., Convolvuluscalvertiisubsp.ruprechtii (Boiss.) J.R.I.Wood & R.W.Scotland, stat. nov., Convolvuluscephalopodussubsp.bushiricus (Bornm.) J.R.I.Wood & R.W.Scotland, stat. nov. The status of various infraspecific taxa is clarified and numerous taxa are lectotypified. This account represents a new initiative in terms of taxonomic monography, being an attempt to bring together the global approach of the traditional monograph with the more pragmatic and identification-focussed approach of most current floras while at the same time being informed by insights from molecular systematics.

  11. A new Merremia from New Guinea (Convolvulaceae)

    NARCIS (Netherlands)

    Ooststroom, van S.J.

    1964-01-01

    Planta herbacea, caulibus gracilibus, scandentibus vel prostratis?, sparse patule pilosis, glabrescentibus. Folia breviter petiolata, petiolis 3—5 mm longis, sparse patule pilosis, lanceolata vel lineari-lanceolata vel interdum oblonga, (2.5—)5—7 cm longa, 6—10 mm lata, basi rotundata, apice acuta

  12. "allometry" Deterministic Approaches in Cell Size, Cell Number and Crude Fiber Content Related to the Physical Quality of Kangkong (Ipomoea reptans) Grown Under Different Plant Density Pressures

    Science.gov (United States)

    Selamat, A.; Atiman, S. A.; Puteh, A.; Abdullah, N. A. P.; Mohamed, M. T. M.; Zulkeefli, A. A.; Othman, S.

    Kangkong, especially the upland type (Ipomoea reptans) is popularly consumed as a vegetable dish in the South East Asian countries for its quality related to Vitamins (A and C) and crude fiber contents. Higher fiber contents would prevent from the occurrence of colon cancer and diverticular disease. With young stem edible portion, its cell number and size contribute to the stem crude fiber content. The mathematical approach of allometry of cell size, number, and fiber content of stem could be used in determining the 'best' plant density pressure in producing the quality young stem to be consumed. Basically, allometry is the ratio of relative increment (growth or change) rates of two parameters, or the change rate associated to the log of measured variables relationship. Kangkog grown equal or lower than 55 plants m-2 produced bigger individual plant and good quality (physical) kangkong leafy vegetable, but with lower total yield per unit area as compared to those grown at higher densities.

  13. Construction of a genetic map using EST-SSR markers and QTL analysis of major agronomic characters in hexaploid sweet potato (Ipomoea batatas (L.) Lam).

    Science.gov (United States)

    Kim, Jin-Hee; Chung, Il Kyung; Kim, Kyung-Min

    2017-01-01

    The Sweet potato, Ipomoea batatas (L.) Lam, is difficult to study in genetics and genomics because it is a hexaploid. The sweet potato study not have been performed domestically or internationally. In this study was performed to construct genetic map and quantitative trait loci (QTL) analysis. A total of 245 EST-SSR markers were developed, and the map was constructed by using 210 of those markers. The total map length was 1508.1 cM, and the mean distance between markers was 7.2 cM. Fifteen characteristics were investigated for QTLs analysis. According to those, the Four QTLs were identified, and The LOD score was 3.0. Further studies need to develop molecular markers in terms of EST-SSR markers for doing to be capable of efficient breeding. The genetic map created here using EST-SSR markers will facilitate planned breeding of sweet potato cultivars with various desirable traits.

  14. Ipomoea batatas (L.)

    African Journals Online (AJOL)

    La patate douce est une culture négligée alors que sa contribution dans la sécurité alimentaire est importante au Bénin. Ce travail a permis ... l'alimentation animale (Owori et al., 2007). Dans l'industrie, les tubercules servent à la ... douce et la valorisation des tubercules par la fabrication de farines infantiles ont été ...

  15. ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    containing ... varieties vary depending on the soil type, soil pH and the type of minerals in the soil. The value of ... Countries such as USA, Canada, Australia, South. Africa and ..... Sugar Estate, located in the Ethiopian Rift Valley. According to ...

  16. ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    ISSN: 0379–2897. CHARACTERIZATION OF FUNGAL EXTRACTS FROM TRICHODERMA ISOLATES: .... agents include mycoparasitism, antibiosis, com- petition, lytic enzyme ..... isolates formed coiled structures around the hyphae of the test ...

  17. Etude comparative de la digestibilité in vivo de l'herbe de guinée (Panicum maximum Jacq.) associée aux feuilles et tiges de patate douce (Ipomoea batatas (L.) Lam) (régime Panipo) ou à l'herbe de lait (Euphorbia heterophylla L.) (régime Paneuph) chez le lapin (Oryctolagus cuniculus L.) et le cobaye (Cavia porcellus L.)

    OpenAIRE

    Kouakou, NGDV.; Kouba, M.; Thys, E.

    2016-01-01

    Digestibility of Guinea grass (Panicum maximum Jacq.) associated with sweet potato leaves and stems (Ipomoea batatas (L.) Lam) (Panipo diet) or poison milk (Euphorbia heterophylla L.) (Paneuph diet) in Rabbits (Oryctolagus cuniculus L.) and in Guinea Pigs (Cavia porcellus L.). A comparative study of in vivo digestibility of Guinea grass (Panicum maximum Jacq.) associated with sweet potato leaves and stems (Ipomoea batatas (L.) Lam) (Panipo diet) or with poison milk (Euphorbia heterophylla L.)...

  18. Bioethanol production from sweet potato (Ipomoea batatas L. flour using co-culture of Trichoderma sp. and Saccharomyces cerevisiae in solid-state fermentation

    Directory of Open Access Journals (Sweden)

    Manas Ranjan Swain

    2013-04-01

    Full Text Available The aim of this work was to study the optimiation of co-culturing of Trichoderma sp. and Saccharomyces cerevisiae (1:4 ratio on sweet potato (Ipomoea batatas L. flour (SPF for the production of bio-ethanol in solid-state fermentation (SSF. Maximum ethanol (172 g/kg substrate was produced in a medium containing 80% moisture, ammonium sulphate 0.2%, pH 5.0, inoculuted with 10% inoculum size and fermented at 30ºC for 72h. .Concomitant with highest ethanol concentration, maximum ethanol productivity (2.8 g/kg substrate/h, microbial biomass (23×10(8 CFU/ g substrate, ethanol yield (47 g/100g sugar consumed and fermentation efficiency (72% were also obtained under these conditions. Cell interaction was observed familiar between the viable cells of Trichoderma sp. and S. cerevisiae when co-cultured. Ethanol production ability by the co-culture was 65 % higher than the single culture of S. cerevisiae from un-saccharified SPF.

  19. The effect of partial substitution of roasted soybean seed with graded levels of sweet potato (Ipomoea batatas) leaf meal on growth performances and carcass characteristics of broiler chickens.

    Science.gov (United States)

    Melesse, Aberra; Alemu, Temesgen; Banerjee, Sandip; Berihun, Kefyalew

    2016-06-30

    This study was designed to assess the effects of partial substitution of roasted soybean seed with sweet potato (Ipomoea batatas) leaf meal (SPLM) on growth performances and carcass components of broiler chickens. The experiment was a completely randomized design consisting of five dietary treatments replicated four times with ten chicks each. The control diet (treatment 1, T1) contained roasted soybean seed as the major protein source without SPLM and treatment diets containing SPLM at the levels of 30 g/kg (treatment 2, T2), 60 g/kg (treatment 3, T3), 90 g/kg (treatment 4, T4) and 120 g/kg (treatment 5, T5) by partially substituting the roasted soybean seed in the control diet. The results indicated that the body weight gain in chickens reared in T1 was (pchickens reared in T1 was (pchickens fed on T1 was (pChickens fed with T2 diet had numerically higher values of slaughter, dressed carcass and breast than those reared in T4 and T5 diets. It can be concluded that the partial substitution of roasted soybean seed with sweet potato leaf might be economically feasible feeding strategy of broiler chickens in smallholder poultry farm settings.

  20. Effects of inorganic nitrogen forms on growth, morphology, nitrogen uptake capacity and nutrient allocation of four tropical aquatic macrophytes (Salvinia cucullata, Ipomoea aquatica, Cyperus involucratus and Vetiveria zizanioides)

    DEFF Research Database (Denmark)

    Jampeetong, Arunothai; Brix, Hans; Kantawanichkul, Suwasa

    2012-01-01

    This study assesses the growth and morphological responses, nitrogen uptake and nutrient allocation in four aquatic macrophytes when supplied with different inorganic nitrogen treatments (1) NH4+, (2) NO3−, or (3) both NH4+ and NO3−. Two free-floating species (Salvinia cucullata Roxb. ex Bory...... and Ipomoea aquatica Forssk.) and two emergent species (Cyperus involucratus Rottb. and Vetiveria zizanioides (L.) Nash ex Small) were grown with these N treatments at equimolar concentrations (500 M). Overall, the plants responded well to NH4+. Growth as RGR was highest in S. cucullata (0.12±0.003 d−1......) followed by I. aquatica (0.035 ±0.002 d−1), C. involucratus (0.03±0.002 d−1) and V. zizanioides (0.02±0.003 d−1). The NH4+ uptake rate was significantly higher than the NO3− uptake rate. The free-floating species had higher nitrogen uptake rates than the emergent species. The N-uptake rate differed between...

  1. Study on The Content of Pb in Twigs And Leaves of Kangkung (Ipomoea reptans Poir Boiled With The Addition of NaCl And Acetic Acid

    Directory of Open Access Journals (Sweden)

    Poppy Hartatie Hardjo

    2004-12-01

    Full Text Available Kangkung is a kind of favorable vegetables that used to grow near a river, and is cultivated and watered with water from the river. If the river is polluted by heavy metals, there is a risk that the plant is contaminated too. A study on the content of Pb in kangkung planted in Pb contaminated media has been conducted, and it was proven that Pb was found in the plant. Land kangkung (Ipomoea reptans was used as sample, and was planted in hydrophonic media, and watered with Multigrow Complete Plant Food (2000 mg/L and Pb solution (2 mg/L twice a day. Samples were taken based on the age of 54 days, then the twigs and leaves were boiled in different ways: I. Boiled with no addition, II. Boiled with addition of NaCl , and III. Boiled with addition of acetic acid. IV. Unboiled sample as the control. Inductively Coupled Plasma Spectrometer (ICPS Fison 3410+ was used to measure the Pb content. It was shown that boiling the kangkung reduced the Pb content in the leaves as well as in the twigs; however, the acetic acid addition showed the least effect. In the leaves the three different ways of boiling did not show significant different, while in twigs the different was significant.

  2. AMIDO DE BATATA DOCE (Ipomoea batatas L, Lam: II – CARACTERIZAÇÃO MORFOLÓGICA E ESTUDO DE ALGUMAS PROPRIEDADES FUNCIONAIS

    Directory of Open Access Journals (Sweden)

    José Paschoal BATISTUTI

    2009-07-01

    Full Text Available

    RESUMO: O objetivo deste trabalho foi caracterizar morfologicamente e estudar a relação estrutura: função do grânulo de amido extraído de tubérculos, de diferentes cultivares de batata-doce (Ipomoea batatas L, Lam. Nas condições do experimento e mediante os resultados obtidos, observou-se que o amido dos diferentes cultivares estudados mostrou diferenças acentuadas na sua morfologia. Foram observadas, também, diferenças nas propriedades viscoamilográficas, devidas particularmente à heterogeneidade de forças envolvidas na manutenção da estrutura do grânulo. O amido obtido, dos cultivares estudados, mostrou maior resistência à desintegração mecânica, durante a gelatinização, quando comparado aos padrões comerciais testados. Apenas um cultivar mostrou pico de viscosidade máxima. PALAVRAS-CHAVE: Batata-doce; amido; funcionalidade; morfologia.

  3. Distributions, ex situ conservation priorities, and genetic resource potential of crop wild relatives of sweetpotato [Ipomoea batatas (L. Lam., I. series Batatas

    Directory of Open Access Journals (Sweden)

    Colin Kahlil Khoury

    2015-04-01

    Full Text Available Crop wild relatives of sweetpotato [Ipomoea batatas (L. Lam., I. series Batatas] have the potential to contribute to breeding objectives for this important root crop. Uncertainty in regard to species boundaries and their phylogenetic relationships, the limited availability of germplasm with which to perform crosses, and the difficulty of introgression of genes from wild species has constrained their utilization. Here we compile geographic occurrence data on relevant sweetpotato wild relatives and produce potential distribution models for the species. We then assess the comprehensiveness of ex situ germplasm collections, contextualize these results with research and breeding priorities, and use ecogeographic information to identify species with the potential to contribute desirable agronomic traits. The fourteen species that are considered the closest wild relatives of sweetpotato generally occur from the central United States to Argentina, with richness concentrated in Mesoamerica and in the extreme southeastern United States. Currently designated species differ among themselves and in comparison to the crop in their adaptations to temperature, precipitation, and edaphic characteristics and most species also show considerable intraspecific variation. With 79% of species identified as high priority for further collecting, we find that these crop genetic resources are highly under-represented in ex situ conservation systems and thus their availability to breeders and researchers is inadequate. We prioritize taxa and specific geographic locations for further collecting in order to improve the completeness of germplasm collections. In concert with enhanced conservation of sweetpotato wild relatives, further taxonomic research, characterization and evaluation of germplasm, and improving the techniques to overcome barriers to introgression with wild species are needed in order to mobilize these genetic resources for crop breeding.

  4. Development and identification of SSR markers associated with starch properties and β-carotene content in the storage root of sweet potato (Ipomoea batatas L.

    Directory of Open Access Journals (Sweden)

    Kai eZhang

    2016-03-01

    Full Text Available Sweet potato (Ipomoea batatas L. is a nutritious food crop and, based on the high starch content of its storage root, a potential bioethanol feedstock. Enhancing the nutritional value and starch quantity of storage roots are important goals of sweet potato breeding programs aimed at developing improved varieties for direct consumption, processing, and industrial uses. However, developing improved lines of sweet potato is challenging due to the genetic complexity of this plant and the lack of genome information. Short sequence repeat (SSR markers are powerful molecular tools for tracking important loci in crops and for molecular-based breeding strategies; however, few SSR markers and marker-trait associations have hitherto been identified in sweet potato. In this study, we identified 1,824 SSRs by using a de novo assembly of publicly available ESTs and mRNAs in sweet potato, and designed 1,476 primer pairs based on SSR-containing sequences. We mapped 214 pairs of primers in a natural population comprised of 239 germplasms, and identified 1,278 alleles with an average of 5.972 alleles per locus and a major allele frequency of 0.7702. Population structure analysis revealed two subpopulations in this panel of germplasms, and phenotypic characterization demonstrated that this panel is suitable for association mapping of starch-related traits. We identified 32, 16, and 17 SSR markers associated with starch content, β-carotene content, and starch composition in the storage root, respectively, using association analysis and further evaluation of a subset of sweet potato genotypes with various characteristics. The SSR markers identified here can be used to select varieties with desired traits and to investigate the genetic mechanism underlying starch and carotenoid formation in the starchy roots of sweet potato.

  5. Bocadito con alto contenido proteico: un extruido a partir de quinua (Chenopodium quinoa Willd., tarwi (Lupinus mutabilis Sweet y camote (Ipomoea batatas L.

    Directory of Open Access Journals (Sweden)

    Katherine Pérez Ramos

    2017-01-01

    Full Text Available La presente investigación tuvo como objetivo la elaboración de un bocadito extruido de elevado tenor proteico, a partir de quinua ( Chenopodium quinoa Willd., tarwi ( Lupinus mutabilis Sweet y fécula de camote ( Ipomoea batatas L.. Para su formulación se aplicó el método de diseño de mezclas usando la herramienta computacional - estadíst ica Design Expert® versión 7.0, siendo las variables independientes las harinas de quinua, tarwi y fécula de camote; y las variables dependientes el contenido de proteína, índice de expansión, densidad aparente y dureza de los extruidos. La formulación ópt ima se determinó aplicando la prueba de deseabilidad basada en los modelos de regresión ajustado, dicha formulación se obtuvo maximizando el contenido de proteína e índice de expansión; y minimizando la dureza y densidad aparente de los extruidos. La formu lación óptima tuvo un porcentaje de quinua, tarwi y fécula de camote de 57%, 26% y 17 % respectivamente. El análisis fisicoquímico de la fórmula óptima dio como resultado 20,16% de proteína, 2,19 de índice de expansión, 0,220 g/cm 3 densidad aparente y 9,31 N de dureza. La calidad proteica de la formulación óptima fue determinada mediante los ensayos de digestibilidad verdadera y valor biológico verdadero en ratas, obteniéndose 83,5% y 62,9% respectivamente.

  6. Distributions, ex situ conservation priorities, and genetic resource potential of crop wild relatives of sweetpotato [Ipomoea batatas (L.) Lam., I. series Batatas].

    Science.gov (United States)

    Khoury, Colin K; Heider, Bettina; Castañeda-Álvarez, Nora P; Achicanoy, Harold A; Sosa, Chrystian C; Miller, Richard E; Scotland, Robert W; Wood, John R I; Rossel, Genoveva; Eserman, Lauren A; Jarret, Robert L; Yencho, G C; Bernau, Vivian; Juarez, Henry; Sotelo, Steven; de Haan, Stef; Struik, Paul C

    2015-01-01

    Crop wild relatives of sweetpotato [Ipomoea batatas (L.) Lam., I. series Batatas] have the potential to contribute to breeding objectives for this important root crop. Uncertainty in regard to species boundaries and their phylogenetic relationships, the limited availability of germplasm with which to perform crosses, and the difficulty of introgression of genes from wild species has constrained their utilization. Here, we compile geographic occurrence data on relevant sweetpotato wild relatives and produce potential distribution models for the species. We then assess the comprehensiveness of ex situ germplasm collections, contextualize these results with research and breeding priorities, and use ecogeographic information to identify species with the potential to contribute desirable agronomic traits. The fourteen species that are considered the closest wild relatives of sweetpotato generally occur from the central United States to Argentina, with richness concentrated in Mesoamerica and in the extreme Southeastern United States. Currently designated species differ among themselves and in comparison to the crop in their adaptations to temperature, precipitation, and edaphic characteristics and most species also show considerable intraspecific variation. With 79% of species identified as high priority for further collecting, we find that these crop genetic resources are highly under-represented in ex situ conservation systems and thus their availability to breeders and researchers is inadequate. We prioritize taxa and specific geographic locations for further collecting in order to improve the completeness of germplasm collections. In concert with enhanced conservation of sweetpotato wild relatives, further taxonomic research, characterization and evaluation of germplasm, and improving the techniques to overcome barriers to introgression with wild species are needed in order to mobilize these genetic resources for crop breeding.

  7. Development and Identification of SSR Markers Associated with Starch Properties and β-Carotene Content in the Storage Root of Sweet Potato (Ipomoea batatas L.).

    Science.gov (United States)

    Zhang, Kai; Wu, Zhengdan; Tang, Daobin; Lv, Changwen; Luo, Kai; Zhao, Yong; Liu, Xun; Huang, Yuanxin; Wang, Jichun

    2016-01-01

    Sweet potato (Ipomoea batatas L.) is a nutritious food crop and, based on the high starch content of its storage root, a potential bioethanol feedstock. Enhancing the nutritional value and starch quantity of storage roots are important goals of sweet potato breeding programs aimed at developing improved varieties for direct consumption, processing, and industrial uses. However, developing improved lines of sweet potato is challenging due to the genetic complexity of this plant and the lack of genome information. Short sequence repeat (SSR) markers are powerful molecular tools for tracking important loci in crops and for molecular-based breeding strategies; however, few SSR markers and marker-trait associations have hitherto been identified in sweet potato. In this study, we identified 1824 SSRs by using a de novo assembly of publicly available ESTs and mRNAs in sweet potato, and designed 1476 primer pairs based on SSR-containing sequences. We mapped 214 pairs of primers in a natural population comprised of 239 germplasms, and identified 1278 alleles with an average of 5.972 alleles per locus and a major allele frequency of 0.7702. Population structure analysis revealed two subpopulations in this panel of germplasms, and phenotypic characterization demonstrated that this panel is suitable for association mapping of starch-related traits. We identified 32, 16, and 17 SSR markers associated with starch content, β-carotene content, and starch composition in the storage root, respectively, using association analysis and further evaluation of a subset of sweet potato genotypes with various characteristics. The SSR markers identified here can be used to select varieties with desired traits and to investigate the genetic mechanism underlying starch and carotenoid formation in the starchy roots of sweet potato.

  8. Ekstrak Daun Pepaya dan Kangkung untuk Meningkatkan Daya Tetas Telur dan Kelangsungan Hidup Larva Lele (EXTRACTS OF CARICA PAPAYA AND IPOMOEA AQUATICA FOR IMPROVING EGG HATCHABILITY AND LARVAL VIABILITY OF CATFISH

    Directory of Open Access Journals (Sweden)

    Gina Saptiani

    2016-07-01

    Full Text Available This research was aimed to investigate the potential use of leaf extract of Carica papaya and Ipomoeaaquatica lto improve egg hatchability and larval viability of catfish. Dried leaves of Carica papaya andIpomoea aquatica were macerated and extracted in water and ethanol. Eggs and larvae were tested in theaquarium size of 10 L with a a diameter of 28 cm. The extracts in concentration 600, 800 and 1.000 ppmwere tested on the egg hatchability of catfish with immersion method, and challed with Aeromonashydrophyla, Pseudomonas sp., and Saprolegnia spp. The extracts in concentration 800 and 1.000 ppm weretested on the larval viability with immersion method, and challed with pathogens. Water or ethanolextract of Carica papaya and Ipomoea aquatica can improve egg hatchability 67±8% until 90±6% andlarval viability of catfish 77±0,5 until 90±9%. Eight hundred ppm ethanol extract of Carica papaya has thebest egg hatchability and 1000 ppm can improve larval viability of catfish.

  9. Characterisation and performance evaluation of twenty accessions of sweet potato (Ipomoea batatas (L.) Lam.) in the coastal savannah agro-ecological zone of Ghana

    International Nuclear Information System (INIS)

    Sossah, F.L.

    2012-01-01

    This study assessed the genetic diversity, using morphological and protein markers, as well as incidence of viral diseases among 20 accessions of sweet potato. Morphological analysis was carried out using 47 traits while protein analysis was performed with sodium dodecyl sulphate polyacrylamide gel electrophoresis (SDS-PAGE). Sample plants collected from the field were tested for viruses using nitrocellulose membrane enzyme-linked immuno-sorbent assay (NCM-ELISA) and PCR for a DNA virus (Sweet potato Leaf curl virus). Scions from symptomatic plants were grafted onto Ipomoea setosa, a nearly universal indicator plant for sweet potato viruses, and leaves were tested using NCM-ELISA. From the cluster analysis, the accessions were grouped into two clusters at a genetic similarity index of 61.6%. The accessions ER001 and HMA2 were shown to be possible duplicates. Accession US 020 recorded the highest total root yield and harvest index of 56.32 t/ha and 57.11% respectively. Similarly, two pairs of accession SA/BNARI and UE 007 as well as HMA I and US 029 were identified as duplicates based on their protein banding patterns. While, three entries, LOCAL I, US 004 and UK/BNARI were also identified as a single entity based on their banding patterns for leaf and tuber proteins. Symptoms observed in the field varied from vein clearing, chlorosis, leaf reduction to stunting and the highest index of symptom severity for only diseased plants (ISSdp) was 3.63 recorded for US 029. The highest disease incidence (100%) was recorded at 11 WAP and 12 WAP. NCM-ELISA test detected eight viruses out of ten, with SA/BNARI exhibiting all the eight viruses. Mixed infections ranged from duplet to octaplet. The indicator plant I. setosa grafted with scions from sweet potato showed clear symptoms similar to those observed on the field. PCR test using SPG3/SPG4 primers detected SPLCV in the UK/BNARI accessions. Based on the morphological characters as well as response to virus infection, two

  10. Efeito do déficit hídrico na eficiencia de herbicidas e nas características bioquímicas de Ipomoea grandifolia Effect of water stress on the efficiency of herbicides and on the biochemical characteristics of Ipomoea grandifolia

    Directory of Open Access Journals (Sweden)

    H.S. Vitorino

    2012-03-01

    Full Text Available O objetivo deste estudo foi avaliar a eficácia dos herbicidas inibidores da ALS e PROTOX no controle de Ipomoea grandifolia sob dois níveis de déficit hídrico, bem como determinar a influência desse déficit hídrico sobre o conteúdo de carboidratos solúveis, proteínas totais e aminoácidos livres da planta daninha. O trabalho foi conduzido em casa de vegetação, no delineamento experimental inteiramente casualizado, com os tratamentos dispostos em esquema fatorial 4 x 2, sendo quatro herbicidas (fomesafen, lactofen, chlorimuron-ethyl e imazethapyr e dois níveis de déficit hídrico (com e sem déficit: -0,5 MPa e -0,01 MPa, respectivamente. Aos 7, 14, 21 e 28 dias após a aplicação, o controle foi avaliado de forma visual, e a determinação dos solutos orgânicos foi feita 24, 48, 72 e 96 horas após a aplicação dos herbicidas. À exceção de chlorimuron-ethyl, os demais herbicidas controlaram eficientemente I. grandifolia. A eficiência de controle dos herbicidas foi afetada pela condição de déficit hídrico. Os herbicidas elevaram o conteúdo de carboidratos solúveis, independentemente da condição hídrica, e proporcionaram redução de proteínas solúveis nas plantas de I. grandifolia, bem como aumentaram as concentrações de aminoácidos livres.The objective of this work was to evaluate the efficacy of ALS and PROTOX inhibiting herbicides in the control of Ipomoea grandifolia under two levels of water deficit, as well as to determine the influence of drought on the content of the soluble carbohydrates, protein and free amino acids of the weed. The study was conducted in a greenhouse in a completely randomized design with treatments in a factorial scheme 4 x 2, with four herbicides (fomesafen, lactofen, chlorimuron-ethyl and imazethapyr, and two levels of water deficit (with and without deficit, - 0.5 MPa and -0.01 MPa, respectively. At 7, 14, 21, and 28 days after application, the control was evaluated visually and

  11. Estudos anatômicos de folhas de espécies de plantas daninhas de grande ocorrência no Brasil: III - Galinsoga parviflora, Crotalaria incana, Conyza bonariensis e Ipomoea cairica Leaf anatomical studies in weed species widely common in Brazil: III - Galinsoga parviflora, Crotalaria incana, Conyza bonariensis and Ipomoea cairica

    Directory of Open Access Journals (Sweden)

    S.O. Procópio

    2003-04-01

    Full Text Available O objetivo deste trabalho foi estudar a anatomia das folhas das espécies de plantas daninhas de grande ocorrência no Brasil: Galinsoga parviflora, Crotalaria incana, Conyza bonariensis e Ipomoea cairica, visando melhor entendimento sobre as barreiras que cada espécie impõe à penetração dos herbicidas e, assim, fornecer subsídios à busca de estratégias para superar esses obstáculos. As folhas completamente expandidas do terceiro ao quinto nó foram coletadas de plantas de ocorrência espontânea no campo. Das folhas de cada espécie foram obtidas três amostras da região central, com aproximadamente 1 cm², as quais foram utilizadas em estudos da estrutura e clarificação e em observações em microscópio eletrônico de varredura (MEV. Todas as espécies avaliadas são anfiestomáticas. A principal barreira foliar potencial à penetração de herbicidas observada na planta daninha G. parviflora foi a baixa densidade estomática na face adaxial. C. incana apresentou como possível principal obstáculo foliar à penetração de herbicidas o alto teor de cera epicuticular. Já em relação a C. bonariensis, alta densidade tricomática, grande espessura da cutícula da face adaxial e baixa densidade estomática na face adaxial foram as principais barreiras detectadas. Grande espessura da cutícula da face adaxial e baixa densidade estomática na face adaxial foram os possíveis obstáculos constatados nas folhas de I. cairica.This research aimed to study the leaf anatomy of the weed species Galinsoga parviflora, Crotalaria incana, Conyza bonariensis and Ipomoea cairica, , widely known in Brazil, to acquire a better understanding of the barriers each species imposes upon herbicide penetration, and to find strategies to overcome these obstacles. The completely expanded leaves from the third to the fifth nodes were collected from spontaneous plants in the field. Three samples with approximately 1 cm² were taken from the leaves of each

  12. Interferência e nível de dano econômico de Brachiaria plantaginea e Ipomoea nil na cultura do feijão comum Interference and economic threshold of Brachiaria plantaginea and Ipomoea nil in the common bean crop

    Directory of Open Access Journals (Sweden)

    Ribas Antonio Vidal

    2010-08-01

    Full Text Available As pesquisas acerca do impacto da interferência das plantas daninhas sobre as culturas normalmente são realizadas com uma única espécie infestante, quando na realidade podem ocorrer diversas. Os objetivos deste trabalho foram avaliar a interferência de Brachiaria plantaginea e Ipomoea nil sobre o rendimento de grãos do feijoeiro (Phaseolus vulgaris e determinar o nível de dano econômico (NDE de cada espécie na cultura. Foram realizados dois experimentos a campo com as cultivares de feijão 'IPR Graúna' (Grupo Preto e 'UTF-06' (Grupo Carioca em convivência com infestações mistas em diferentes proporções aleatórias das espécies B. plantaginea e I. nil. Modelos de regressão múltiplos foram utilizados para determinar a capacidade de interferência de cada espécie daninha sobre a produtividade da cultura. O impacto de interferência de cada planta de I. nil correspondeu a 2,6 e 0,25 quando comparada a cada planta de B. plantaginea, dependente das proporções relativas na comunidade infestante e das condições de cada experimento. A cultivar 'IPR Graúna' apresentou maior habilidade competitiva do que 'UTF-06'. O NDE foi dependente da proporção relativa de cada espécie daninha na comunidade e foi obtido sob baixas infestações (The researches about the impact of weed interference on crops are usually performed with a single weed species, when in reality there are numerous. The objective of this study was to evaluate the interference of Brachiaria plantaginea and Ipomoea nil on the grain yield of French beans (Phaseolus vulgaris and to determine the economic weed threshold (EWT of each species on the crop. Two field experiments were conducted with bean cultivars 'IPR Graúna' (Black group and 'UTF-06' (Carioca group in coexistence with random proportions of mixed infestations of B. plantaginea and I. nil. Multiple regression models were used to determine the interference abi1lity of each weed species on crop productivity. The

  13. Processamento de barras de cereais com adição de farinha de batata-doce (Ipomoea batatas L.) Processing of cereal bars with added sweet potato flour (Ipomea batatas L.)

    OpenAIRE

    Bezerra, José Raniere Mazile Vidal; UNICENTRO; Rigo, Maurício; UNICENTRO; Teixeira, Ângela Moraes; UNICENTRO; Angelo, Mariana Alves; UNICENTRO; Czaikoski, Aline; Graduanda em Engenharia de Alimentos, bolsista Fundação Araucária. BIC/Universidade Estadual do Centro Oeste - UNICENTRO.

    2015-01-01

    Considerando o crescimento do segmento de barras de cereais, a importância da cultura da batata-doce (Ipomoea batatas L.) e seu valor nutricional, este trabalho teve por objetivo a elaboração de barras de cereais com adição de diferentes teores de farinha de batata-doce e sua avaliação de aceitação sensorial, e ainda, a determinação da composição proximal da formulação melhor avaliada sensorialmente. A farinha da batata-doce e as barras de cereais adicionadas a farinha foram submetidas às det...

  14. Photosynthesis and fluctuating asymmetry as indicators of plant response to soil disturbance in the Fall-Line Sandhills of Georgia: a case study using Rhus copallinum and Ipomoea pandurata

    Science.gov (United States)

    Freeman, D. Carl; Brown, Michelle L.; Duda, Jeffrey J.; Graham, John H.; Emlen, John M.; Krzysik, Anthony J.; Balbach, Harold E.; Kovacic, David A.; Zak, John C.

    2004-01-01

    We examined net photosynthesis, transpiration, stomatal conductance, and leaf fluctuating asymmetry on two species (Rhus copallinum and Ipomoea pandurata) as indicators of stress at nine sites across a gradient of soil disturbance at Fort Benning, Georgia. There were three sites for each of three disturbance levels. Physical habitat disturbance was caused by activities associated with infantry training, including mechanized elements (tanks and personnel carriers) and foot soldiers. In addition, we examined the influence of prescribed burns and microhabitat effects (within meter‐square quadrats centered about the plant) on these measures of plant stress. Net photosynthesis declined with increasing disturbance in the absence of burning for both species. However, when sites were burned the previous year, net photosynthesis increased with increasing disturbance. Developmental instability in Rhus, as measured by fluctuating asymmetry, also declined with increasing disturbance in the absence of burning but increased with disturbance if sites were burned the previous year. Developmental instability was much less sensitive to burning in Ipomoea and in general was lowest at intermediate disturbance sites. Microenvironmental and microhabitat effects were weakly correlated with measures of plant stress when all sites were combined. However, higher correlations were obtained within site categories, especially when the recent history of prescribed burning was used as a category. Finally, using all of the combined data in a discriminant function analysis allowed us to correctly predict the disturbance level of more than 80% of the plants. Plant stress is responsive to both large‐scale perturbations, such as burning, and microhabitat parameters. Because of this, it is important to include macro‐ and microhabitat parameters when assessing stress. Similarly, we found a combination of developmental and physiological indicators of stress was superior to using them

  15. Aversão alimentar condicionada para o controle da intoxicação por Ipomoea carnea subsp. fistulosa em caprinos

    Directory of Open Access Journals (Sweden)

    Luciano A. Pimentel

    2013-06-01

    Full Text Available A aversão alimentar condicionada é uma técnica que pode ser utilizada em animais para evitar a ingestão de plantas tóxicas. O presente estudo teve como objetivo testar a eficiência e durabilidade da aversão alimentar condicionada em caprinos para evitar o consumo de Ipomoea carnea subsp. fistulosa. Foram utilizados 14 caprinos jovens da raça Moxotó, que foram adaptados ao consumo da planta. Inicialmente foi administrada I. carnea subsp. fistulosa dessecada e triturada misturada à ração concentrada por 30 dias e, posteriormente, foi fornecida a planta verde por mais 10 dias. Para constatação da adaptação ao consumo da planta os caprinos foram colocados a pastar em um piquete de 510 m² onde tinha sido plantada I. carnea subsp. fistulosa em uma área de 30m² (10 plantas/m². No 42º dia de experimento, após a constatação do consumo espontâneo os animais receberam a planta verde individualmente na baia por alguns minutos, e todos os animais que consumiam qualquer quantidade da planta foram tratados com uma solução de LiCl na dose 175mg por kg de peso vivo. Este procedimento repetiu-se por mais dois dias. Posteriormente, os caprinos foram divididos em dois grupos: Grupo 1 com seis animais, quatro deles avertidos e dois não avertidos (facilitadores; e o Grupo 2, com oito caprinos, todos avertidos. Para constatar a eficiência e duração da aversão e a influência de animais facilitadores na durabilidade da aversão, os caprinos foram colocados a pastar, em dias alternados, três dias por semana, durante duas horas, no piquete plantado com I. carnea subsp. fistulosa. Por 12 meses os animais foram monitorados durante o pastejo, identificando-se o consumo e a preferência dos animais pelas plantas presentes no piquete. No Grupo 1 tanto os caprinos avertidos quanto os não avertidos iniciaram a ingerir a planta em 1-6 semanas e gradualmente foram aumentando a planta consumida, mas nunca a ingeriram exclusivamente. Nenhum caprino

  16. (Convolvulaceae) extracts and fractions on larvae of Spodoptera f

    African Journals Online (AJOL)

    USER

    2010-06-14

    Jun 14, 2010 ... both seed extracts were isolated by gravity column chromatography over silica gel and analyzed for ... weighed and stored at 4°C in amber glass flasks before used. ..... probably had less energy for the production of biomass.

  17. Parallel evolution of storage roots in Morning Glories (Convolvulaceae)

    Science.gov (United States)

    Storage roots are an ecologically and agriculturally important plant trait. In morning glories, storage roots are well characterized in the crop species sweetpotato. Storage roots have evolved numerous times across the morning glory family. This study aims to understand whether this was through para...

  18. Evolvulus alsinoides (Convolvulaceae): an American herb in the Old World.

    Science.gov (United States)

    Austin, Daniel F

    2008-05-08

    People in the Indian region often apply shankhapushpi and vishnukranti, two Sanskrit-based common names, to Evolvulus alsinoides. These are pre-European names that are applied to a medicinal American species transported into the area. The period of introduction is uncertain, but probably took place in the 1500s or 1600s. Examination of relationships of Evolvulus alsinoides, geographic distribution, its names in Asia, medical uses, and chemical and laboratory analysis indicates that the alien plant was adopted, given an ancient Indian name, and incorporated into some Old World pharmacopoeias. The herb apparently was included in medicines because it not only reminded people of certain aspects of their gods and goddesses, but also because the chemicals it contained were useful against some maladies.

  19. Florae Malesianae Precursores II. The Convolvulaceae of Malaysia IX

    NARCIS (Netherlands)

    Hoogland, R.D.

    1953-01-01

    Erycibe beccariana Hoogl. sp. nov. — Frutex scandens, ramulis junioribus sparsim stellato-hirsutis, adultioribus glabrescentibus cortice rimis longitudinalibus fisso. Folia elliptica ad elliptico-oblonga, 9—13 X 4— 71/2 cm, apice breviter acuminata, basi rotundata vel minute cordata, supra glabra,

  20. Effects of feeding sweet potato (Ipomoea batatas) vines as a supplement on feed intake, growth performance, digestibility and carcass characteristics of Sidama goats fed a basal diet of natural grass hay.

    Science.gov (United States)

    Megersa, Tadesse; Urge, Mengistu; Nurfeta, Ajebu

    2013-02-01

    The objective of this study was to investigate the effects of substituting sweet potato [Ipomoea batatas (L) Lam] vines for concentrate on growth performance, digestibility, and carcass characteristics. Thirty yearling bucks (15.3 ± 1.64 kg) were assigned into six treatments in a randomized complete block design: natural grass hay alone (T1) or supplemented with 100 % sweet potato vines (SPV) (T2), 65 % SPV + 35 % concentrate (T3), 35 % SPV + 65 % concentrate (T4), and 100 % concentrate (T5) on dry matter (DM) basis. Supplemented goats (T2, T3, T4, and T5) consumed higher (p goats (349 g/day). The crude protein (CP) intake (32.0, 48.6, 54.7, and 69.2 g/day) increased with increasing levels of the concentrate in the diet for T2, T3, T4, and T5, respectively. The DM digestibility in T2, T3, T4, and T5, respectively, was higher (P goats lost weight (-19.5 g/day). Slaughter weight, empty body weight, hot carcass weight, dressing percentage, rib-eye muscle area, and total edible offals were higher (P goats compared with nonsupplemented ones. Therefore, it could be concluded that sweet potato vine can replace the conventional concentrate and could be fed with poor quality hay to prevent body weight loss of animal in the absence of other feed supplements.

  1. Involvement of an ABI-like protein and a Ca2+-ATPase in drought tolerance as revealed by transcript profiling of a sweetpotato somatic hybrid and its parents Ipomoea batatas (L.) Lam. and I. triloba L.

    Science.gov (United States)

    Yang, Yufeng; Wang, Yannan; Jia, Licong; Yang, Guohong; Xu, Xinzhi; Zhai, Hong; He, Shaozhen; Li, Junxia; Dai, Xiaodong; Qin, Na; Zhu, Cancan; Liu, Qingchang

    2018-01-01

    Previously, we obtained the sweetpotato somatic hybrid KT1 from a cross between sweetpotato (Ipomoea batatas (L.) Lam.) cv. Kokei No. 14 and its drought-tolerant wild relative I. triloba L. KT1 not only inherited the thick storage root characteristic of Kokei No. 14 but also the drought-tolerance trait of I. triloba L. The aim of this study was to explore the molecular mechanism of the drought tolerance of KT1. Four-week-old in vitro-grown plants of KT1, Kokei No. 14, and I. triloba L. were subjected to a simulated drought stress treatment (30% PEG6000) for 0, 6, 12 and 24 h. Total RNA was extracted from samples at each time point, and then used for transcriptome sequencing. The gene transcript profiles of KT1 and its parents were compared to identify differentially expressed genes, and drought-related modules were screened by a weighted gene co-expression network analysis. The functions of ABI-like protein and Ca2+-ATPase, two proteins screened from the cyan and light yellow modules, were analyzed in terms of their potential roles in drought tolerance in KT1 and its parents. These analyses of the drought responses of KT1 and its somatic donors at the transcriptional level provide new annotations for the molecular mechanism of drought tolerance in the somatic hybrid KT1 and its parents.

  2. Produção da batata-doce adubada com esterco bovino e biofertilizante Yield of sweet potato (Ipomoea batatas (L. Lam. fertilized with cattle manure and biofertilizer

    Directory of Open Access Journals (Sweden)

    Ademar Pereira de Oliveira

    2007-12-01

    Full Text Available Objetivou-se avaliar a produção da batata-doce (Ipomoea batatas (L. Lam. adubada com esterco bovino e biofertilizante, conduziu-se um experimento no período de Janeiro a Junho de 2004, em NEOSSOLO REGOLÍTICO, psamítico típico, na Universidade Federal da Paraíba, em Areia-PB. O delineamento experimental empregado foi de blocos casualisados, com quatro repetições com os tratamentos distribuídos em arranjo fatorial 6 x 2, sendo seis doses de esterco bovino (0, 10, 20, 30, 40, 50 t ha-1 e ausência e presença de biofertilizante. As parcelas foram constituídas por 80 plantas, espaçadas de 80 x 30 cm. O número de raízes comerciais por planta atingiu valores máximos estimados de 2,0 e 1,7 raízes, respectivamente, nas doses de 26 e 25 t ha-1 de esterco bovino na presença e ausência de biofertilizante. O peso médio de raízes comerciais da batata-doce aumentou com elevação das doses de esterco bovino, atingindo na maior dose 360 e 224 g na presença e ausência de biofertilizante. As doses de 25,6 e 24,4 t ha-1 de esterco bovino foram responsáveis pela máxima produção total de raízes de 21,4 e 21,2 t ha-1, respectivamente, na presença e ausência de biofertilizante. As máximas produções de raízes comerciais, 15,2 e 12,9 t ha-1 foram alcançadas com 25,5 e 21,3 t ha-1 de esterco bovino, na presença e ausência de biofertilizante, respectivamente.Aiming to evaluate the sweet potato (Ipomoea batatas (L. Lam. yield fertilization with bovine manure and biofertilizer, an experiment was carried out from January to July, 2004, on ustipsamment soil, at Universidade Federal da Paraíba, Areia-PB. The Experimental outline used was randomized blocks, with four replications and, treatments distributed in factorial arrangement 6 x 2, being six levels of bovine manure (0, 10, 20, 30, 40, 50 t ha-1 and absence and presence of biofertilizer. Plots were constituted by 80 plants, spaced 80 x 30 cm. Commercial roots number per plant reached

  3. Suppression of the invasive plant mile-a-minute (Mikania micrantha) by local crop sweet potato (Ipomoea batatas) by means of higher growth rate and competition for soil nutrients.

    Science.gov (United States)

    Shen, Shicai; Xu, Gaofeng; Clements, David Roy; Jin, Guimei; Chen, Aidong; Zhang, Fudou; Kato-Noguchi, Hisashi

    2015-01-28

    There are a variety of ways of increasing crop diversity to increase agricultural sustainability and in turn having a positive influence on nearby natural ecosystems. Competitive crops may provide potent management tools against invasive plants. To elucidate the competitive mechanisms between a sweet potato crop (Ipomoea batatas) and an invasive plant, mile-a-minute (Mikania micrantha), field experiments were carried out in Longchuan County of Yunnan Province, Southwest China, utilizing a de Wit replacement series. The trial incorporated seven ratios of sweet potato and mile-a-minute plants in 25 m(2) plots. In monoculture, the total biomass, biomass of adventitious root, leafstalk length, and leaf area of sweet potato were all higher than those of mile-a-minute, and in mixed culture the plant height, branch, leaf, stem node, adventitious root, flowering and biomass of mile-a-minute were suppressed significantly (P competition was less than interspecific competition. The competitive balance index of sweet potato demonstrated a higher competitive ability than mile-a-minute. Except pH, other soil nutrient contents of initial soil (CK) were significantly higher than those of seven treatments. The concentrations of soil organic matter, total N, total K, available N, available P, available K, exchange Ca, exchange Mg, available Mn, and available B were significantly greater (P competition of sweet potato in the mixture. Evidently sweet potato has a competitive advantage in terms of plant growth characteristics and greater absorption of soil nutrients. Thus, planting sweet potato is a promising technique for reducing infestations of mile-a-minute, providing weed management benefits and economic returns from harvest of sweet potatoes. This study also shows the potential value of replacement control methods which may apply to other crop-weed systems or invaded natural ecosystems.

  4. Potencial productivo de esquejes de boniato (Ipomoea batatas (L. Lam. procedentes de una nueva tecnología de producción de semilla agámica.

    Directory of Open Access Journals (Sweden)

    Roberto Díaz Hernández

    2012-01-01

    Full Text Available RESUMEN El trabajo se realizó en el Instituto de Investigaciones en Viandas Tropicales durante el periodo de septiembre del 2008 a abril 2009, con los objetivos de determinar la cantidad de esquejes que proporciona el vivero y la frecuencia de corte, así como comparar el potencial productivo de cada corte. El Experimento consistió en el montaje de cámaras de aproximadamente 1m de ancho y 15m de largo, se utilizaron raíces tuberosas del clon comercial INIVIT B2-2005 como material de plantación. Se comprobó que durante la fase del vivero este proporcionó un total de nueve cortes tanto en la época frío como en primavera con un total de 764 y 1390 esquejes respectivamente. Después de cortados los esquejes fueron llevados al campo donde se realizó un estudio para determinar los rendimientos correspondientes a cada tratamiento (número de cortes. Se utilizó un diseño de bloques al azar con cuatros réplicas. Los resultados mostraron que en pequeñas áreas de viveros se puede obtener un número significativo de esquejes y de muy buena calidad productiva además de que los esquejes procedentes de diferentes momentos de cortes presentan igual comportamiento en cuanto al rendimiento. Productive potential of sweetpotato (Ipomoea batatas (L. Lam cuttings from a new technology for agamic seed production. ABSTRACT The work was conducted at the Research Institute of Tropical Root and Tuber Crops from September 2008 to April 2009 with the objectives of determining the amount of cuts provided by the nursery and cut frequency, as well as, to compare the productive potential of each cut. The experiment consisted of mounting chambers about 1m wide and 15m long. Tuberous roots from the commercial clone INIVIT B2-2005 were used as planting seeds. During the nursery stage, nine cuts were provided in the winter and rainy seasons with a total of 764 and 1390 cuttings respectively. Cuttings were transferred to field conditions to determine corresponding

  5. Efeito da chuva na eficiência de herbicidas aplicados em pós-emergência sobre corda-de-viola Effect of rainfall on the efficiency of herbicides applied in post-emergence on Ipomoea grandifolia

    Directory of Open Access Journals (Sweden)

    G.S.F Souza

    2013-03-01

    Full Text Available O objetivo deste trabalho foi avaliar a influência da chuva na eficiência de herbicidas aplicados em pós-emergência em plantas de Ipomoea grandifolia. As plantas de I. grandifolia foram cultivadas em vasos plásticos com capacidade de 2,5 L, em casa de vegetação, com uma planta por vaso. O delineamento experimental utilizado foi o inteiramente casualizado, com quatro repetições, com os tratamentos dispostos em um esquema fatorial 7x8 (sete tratamentos químicos e oito períodos para ocorrência de chuva após a aplicação dos tratamentos. Os tratamentos químicos constaram da aplicação de glyphosate em cinco formulações comerciais (Roundup Original, Roundup WG, Roundup Transorb, Roundup Transorb R e Roundup Ultra a 1.080 g e.a. ha-1, amônio-glufosinate (Finale a 400 g i.a. ha-1 e 2,4-D (DMA 806 a 1.000 g e.a. ha-1 e de oito intervalos de tempo para simulação de uma chuva de 15 mm, com duração de cinco minutos: 15', 30', 1h, 2h, 4h, 6h, 8h após a aplicação dos tratamentos e uma testemunha sem chuva, Foram realizadas avaliações visuais de controle das plantas aos 7, 14, 21, 28 e 35 dias após a aplicação e, por ocasião da última avaliação, determinou-se a massa seca das plantas. A ocorrência de chuvas após a aplicação de 2,4-D não alterou a sua eficiência no controle das plantas de I. grandifolia; já os herbicidas amônio-glufosinate e glyphosate, em todas suas formulações testadas, apresentaram redução na eficiência de controle quando da ocorrência de chuvas em até oito horas após a aplicação dos tratamentos.The objective of this study was to evaluate the influence of rainfall on the efficiency of herbicides applied in post-emergence on Ipomoea grandifolia plants. I. grandifolia plants were sown in plastic pots with a capacity of 2.5L under greenhouse conditions, with only one plant per pot. The experiment was arranged in a completely randomized design, with four replications, with the treatments

  6. Carfentrazone-ethyl aplicado em pós-emergência para o controle de Ipomea spp. e Commelina benghalensis na cultura da cana-de-açúcar Carfentrazone-ethyl applied in post-emergence to control Ipomoea spp. and Commelina benghalensis in sugarcane crop

    Directory of Open Access Journals (Sweden)

    P.J. Christoffoleti

    2006-01-01

    Full Text Available Este trabalho teve como objetivos determinar a eficácia e seletividade do carfentrazone-ethyl no controle de plantas daninhas na cultura da cana-de-açúcar e avaliar curvas de dose-resposta desse herbicida em Ipomoea spp. e Commelina benghalensis. Desenvolveu-se um ensaio de campo, em pós-emergência das plantas daninhas e da cultura (cv. RB72-454. O delineamento experimental utilizado foi do tipo blocos ao acaso, com os seguintes tratamentos: carfentrazone a 5, 10, 20, 30 e 50 g ha-1 e metribuzin a 2.400 g ha-1. As plantas daninhas que infestavam a área eram Ipomoea nil, I. grandifolia, I. quamoclit, Momordica charantia e C. benghalensis. As avaliações de controle visual e fitotoxicidade foram realizadas aos 15, 30 e 45 dias após a aplicação dos herbicidas. Para elaboração das curvas de dose-resposta, um experimento foi instalado em casa de vegetação, com as plantas daninhas I. nil, I. hederifolia, I. grandifolia, I. quamoclit e C. benghalensis. As doses do herbicida carfentrazone foram: 10D, 4D, 2D, D, 0,5D, 0,25D, 0,125D, 0,1D e 0,01D, em que D = 20 g ha¹. Os dados foram analisados a partir de curvas de dose-resposta de controle visual e massa fresca. No experimento de campo, observou-se excelente controle das plantas daninhas, sendo a dose de 50 g ha-1 de carfentrazone a mais eficiente. Nenhum tratamento causou danos à cana-de-açúcar. O experimento de casa de vegetação permitiu concluir que a ordem decrescente de sensibilidade das espécies de corda-de-viola ao carfentrazone-ethyl é: I. hederifolia > I. quamoclit > I. nil > I. grandifolia; e que C. benghalensis é controlada pelo carfentrazone a partir da dose de 5 g ha-1.This work aimed to evaluate the efficacy and selectivity of the herbicide carfentrazone-ethyl applied in post-emergence to control weeds in sugarcane crop and to evaluate dose-response curves of this herbicide in four species of Ipomoea spp. and Commelina benghalensis. Field experiment was carried out in

  7. The key role of peltate glandular trichomes in symbiota comprising clavicipitaceous fungi of the genus periglandula and their host plants.

    Science.gov (United States)

    Steiner, Ulrike; Kucht, Sabine Hellwig neé; Ahimsa-Müller, Mahalia A; Grundmann, Nicola; Li, Shu-Ming; Drewke, Christel; Leistner, Eckhard

    2015-04-16

    Clavicipitaceous fungi producing ergot alkaloids were recently discovered to be epibiotically associated with peltate glandular trichomes of Ipomoea asarifolia and Turbina corymbosa, dicotyledonous plants of the family Convolvulaceae. Mediators of the close association between fungi and trichomes may be sesquiterpenes, main components in the volatile oil of different convolvulaceous plants. Molecular biological studies and microscopic investigations led to the observation that the trichomes do not only secrete sesquiterpenes and palmitic acid but also seem to absorb ergot alkaloids from the epibiotic fungal species of the genus Periglandula. Thus, the trichomes are likely to have a dual and key function in a metabolic dialogue between fungus and host plant.

  8. Sweet Potato [Ipomoea batatas (L.) Lam].

    Science.gov (United States)

    Song, Guo-qing; Yamaguchi, Ken-ichi

    2006-01-01

    Among the available transformation methods reported on sweet potato, Agrobacterium tumefaciens-mediated transformation is more successful and desirable. Stem explants have shown to be ideal for the transformation of sweet potato because of their ready availability as explants, the simple transformation process, and high-frequency-regeneration via somatic embryogenesis. Under the two-step kanamycin-hygromycin selection method and using the appropriate explants type (stem explants), the efficiency of transformation can be considerably improved in cv. Beniazuma. The high efficiency in the transformation of stem explants suggests that the transformation protocol described in this chapter warrants testing for routine stable transformation of diverse varieties of sweet potato.

  9. The anthocyanidin synthase gene from sweetpotato [Ipomoea ...

    African Journals Online (AJOL)

    USER

    2010-06-21

    Jun 21, 2010 ... The tissue expression profiles of IbANS indicated that it could be expressed in all tissues but at different ... al., 1997). Likewise, transcripts of the apple ANS gene are detected ... electrophoresis (EC250-90, E-C Apparatus Corporation) and ... Instruments Inc.) analyses and the RNA samples were stored in a.

  10. Etude comparative de la digestibilité in vivo de l'herbe de guinée (Panicum maximum Jacq. associée aux feuilles et tiges de patate douce (Ipomoea batatas (L. Lam (régime Panipo ou à l'herbe de lait (Euphorbia heterophylla L. (régime Paneuph chez le lapin (Oryctolagus cuniculus L. et le cobaye (Cavia porcellus L.

    Directory of Open Access Journals (Sweden)

    Kouakou, NGDV.

    2016-01-01

    Full Text Available Digestibility of Guinea grass (Panicum maximum Jacq. associated with sweet potato leaves and stems (Ipomoea batatas (L. Lam (Panipo diet or poison milk (Euphorbia heterophylla L. (Paneuph diet in Rabbits (Oryctolagus cuniculus L. and in Guinea Pigs (Cavia porcellus L.. A comparative study of in vivo digestibility of Guinea grass (Panicum maximum Jacq. associated with sweet potato leaves and stems (Ipomoea batatas (L. Lam (Panipo diet or with poison milk (Euphorbia heterophylla L. (Paneuph diet was conducted involving 16 rabbits and 16 weaned guinea pigs fed ad libitum. Paneuph was significantly better ingested (P0.05 for guinea pigs. Poison milk was better ingested than the leaves and stems of sweet potato (P0.05. The ADC of DM, OM and MAT of Paneuph exceeded 80% and were higher than those of Panipo in rabbits and guinea pigs (P<0.05. Based on the results obtained, the effects of the distribution of the Guinea grass associated with the poison milk during rabbits growing have to be further studied before recommending this new diet to farmers in areas where poison milk and Guinea grass are present and rabbit breeding enough developed.

  11. Effect of Bacillus spp. on seed germination of selected species of the genus Cuscuta (Convolvulaceae

    Directory of Open Access Journals (Sweden)

    Fatemeh Hadizadeh

    2014-04-01

    Full Text Available Species of the genus Cuscuta are annual angiospermic rootless and leafless (achlorophyllous parasitic plants. Bacillus is an example of PGPR bacteria exhibiting plant growth promoting activity. In this study the effects of bacterial suspension on germination of dodder’s seed has been determinated. Seeds of three Cuscuta species were collected from field for evaluating effects of three different Bacillus on its germination. Results show that seed germination of the C. monogyna and C. campestris is inhibited by all three bacterial species. Based on Tukey analysis, the highest inhibitory activity on seed germination of C. monogyna was shown with B. pumilus (68.88%; as well as C. campestris with B. megaterium (95.76% and B. pumilus (91.53%, whilst seed germination of C. europaea was almost identically inhibited by all three bacterial species. This paper reports the variable effects of Bacillus species on the seed germination of selected Cuscuta species.

  12. Phylogeny, character evolution, and biogeography of Cuscuta (dodders; Convolvulaceae) inferred from coding plastid and nuclear sequences.

    Science.gov (United States)

    García, Miguel A; Costea, Mihai; Kuzmina, Maria; Stefanović, Saša

    2014-04-01

    The parasitic genus Cuscuta, containing some 200 species circumscribed traditionally in three subgenera, is nearly cosmopolitan, occurring in a wide range of habitats and hosts. Previous molecular studies, on subgenera Grammica and Cuscuta, delimited major clades within these groups. However, the sequences used were unalignable among subgenera, preventing the phylogenetic comparison across the genus. We conducted a broad phylogenetic study using rbcL and nrLSU sequences covering the morphological, physiological, and geographical diversity of Cuscuta. We used parsimony methods to reconstruct ancestral states for taxonomically important characters. Biogeographical inferences were obtained using statistical and Bayesian approaches. Four well-supported major clades are resolved. Two of them correspond to subgenera Monogynella and Grammica. Subgenus Cuscuta is paraphyletic, with section Pachystigma sister to subgenus Grammica. Previously described cases of strongly supported discordance between plastid and nuclear phylogenies, interpreted as reticulation events, are confirmed here and three new cases are detected. Dehiscent fruits and globose stigmas are inferred as ancestral character states, whereas the ancestral style number is ambiguous. Biogeographical reconstructions suggest an Old World origin for the genus and subsequent spread to the Americas as a consequence of one long-distance dispersal. Hybridization may play an important yet underestimated role in the evolution of Cuscuta. Our results disagree with scenarios of evolution (polarity) previously proposed for several taxonomically important morphological characters, and with their usage and significance. While several cases of long-distance dispersal are inferred, vicariance or dispersal to adjacent areas emerges as the dominant biogeographical pattern.

  13. Heterochromatin and rDNA sites distribution in the holocentric chromosomes of Cuscuta approximata Bab. (Convolvulaceae).

    Science.gov (United States)

    Guerra, Marcelo; García, Miguel A

    2004-02-01

    Cuscuta is a widely distributed genus of holoparasitic plants. Holocentric chromosomes have been reported only in species of one of its subgenera (Cuscuta subg. Cuscuta). In this work, a representative of this subgenus, Cuscuta approximata, was investigated looking for its mitotic and meiotic chromosome behaviour and the heterochromatin distribution. The mitotic chromosomes showed neither primary constriction nor Rabl orientation whereas the meiotic ones exhibited the typical quadripartite structure characteristic of holocentrics, supporting the assumption of holocentric chromosomes as a synapomorphy of Cuscuta subg. Cuscuta. Chromosomes and interphase nuclei displayed many heterochromatic blocks that stained deeply with hematoxylin, 4',6-diamidino-2-phenylindole (DAPI), or after C banding. The banded karyotype showed terminal or subterminal bands in all chromosomes and central bands in some of them. The single pair of 45S rDNA sites was observed at the end of the largest chromosome pair, close to a DAPI band and a 5S rDNA site. Two other 5S rDNA site pairs were found, both closely associated with DAPI bands. The noteworthy giant nuclei of glandular cells of petals and ovary wall exhibited large chromocentres typical of polytenic nuclei. The chromosomal location of heterochromatin and rDNA sites and the structure of the endoreplicated nuclei of C. approximata seemed to be similar to those known in monocentric nuclei, suggesting that centromeric organization has little or no effect on chromatin organization.

  14. A stem anatomical investigation of Cuscuta L. (Convolvulaceae species in Khorassan provinces

    Directory of Open Access Journals (Sweden)

    Jamil Vaezi

    2014-04-01

    C. epithymum, C. pedicellata, C. lehmanniana var. lehmanniana and C. babylonica var. babylonica distributed in Khorassan provinces were investigated using the blue toluidine staining. Cross sections were provided by hand. Results showed that anatomical characters including stem diameter, position and distribution of vessels, number and size of vessels and number of parenchymatous layers were effective traits to taxonomically separate the species under study. Furthermore, the anatomical relationship between parasite and its host plant was examined.

  15. Avaliação da atividade laxante de Operculina macrocarpa L. Urban (Convolvulaceae

    Directory of Open Access Journals (Sweden)

    D. C. Michelin

    Full Text Available O objetivo deste trabalho foi avaliar os efeitos sobre a motilidade intestinal de Operculina macrocarpa L. Urban, popularmente conhecida como batata-de-purga ou jalapa, nativa do nordeste brasileiro, que é indiscriminadamente utilizada pela população como laxante. O extrato hidroetanólico e suas frações diclorometano, acetato de etila, n-butanol e final foram avaliados quanto a sua atividade laxante, através do teste da motilidade intestinal em camundongos, assim como de uma preparação com o pó da planta, como é utilizada pela população. Os resultados mostraram que as frações diclorometano, acetato de etila, final e o pó da planta possuem efeito laxante no modelo experimental adotado.

  16. Utilization effect of cassava (Manihot esculenta and potatoe (Ipomoea batatas on pigmentation, carotenoids pull on egg yolk and performance yield hens Influencia de harinas de yuca y de batata sobre pigmentación, contenido de carotenoides en la yema y desempeño productivo de aves en postura

    Directory of Open Access Journals (Sweden)

    Ceballos L Hernán

    2006-09-01

    Full Text Available

    Utilization effect of cassava (Manihot esculenta and potatoe (Ipomoea batatas on pigmentation, carotenoids pull on egg yolk and performance yield hens. Eight diets (T1:without pigment, T2: commercial pigment, T3: cassava meal 15%, T4: cassava meal 30%, T5: sweet potato meal 15%, T6: sweet potato meal 30%, T7: cassava and sweet potato meal 15% each, T8: cassava and sweet potato meal 25% each in a randomized design using four replicates of three hens each during seven experimental periods were evaluated. Diets were iso-energetics (2.9 kcal/g and iso-proteis (14.5% CP. Carotenoid concentrations (UV-visible chromatography had differences (P<0.01 among diets. Pigmentation (Fan Roche and carotenoid concentration in egg yoks to come from cassava and sweet potato diets did not show differences (P>0.05 A comparison with egg yolk to come from test diets significant differences (P<0.01 were detected. Diet with commercial pigment showed the highest pigmentation and carotenoid concentration in egg yolk. The other hand, there saw not differences (P>0.05. A comparison with egg yolk to come from test diets significant differences (P<0.01 were detected. Diet with commercial pigment showed the highest pigmentation and carotenoid concentration in egg yolk. The other hand, there saw not differences (P>0.05 between egg yolk to come from diet without pigment and cassava and sweet potato diets. Lutein, -carotene, -carotene, and 9-cis-- carotene were the

  17. Phylogenetic relationships in Solanaceae and related species based on cpDNA sequence from plastid trnE-trnT region

    Directory of Open Access Journals (Sweden)

    Danila Montewka Melotto-Passarin

    2008-01-01

    Full Text Available Intergenic spacers of chloroplast DNA (cpDNA are very useful in phylogenetic and population genetic studiesof plant species, to study their potential integration in phylogenetic analysis. The non-coding trnE-trnT intergenic spacer ofcpDNA was analyzed to assess the nucleotide sequence polymorphism of 16 Solanaceae species and to estimate its ability tocontribute to the resolution of phylogenetic studies of this group. Multiple alignments of DNA sequences of trnE-trnT intergenicspacer made the identification of nucleotide variability in this region possible and the phylogeny was estimated by maximumparsimony and rooted with Convolvulaceae Ipomoea batatas, the most closely related family. Besides, this intergenic spacerwas tested for the phylogenetic ability to differentiate taxonomic levels. For this purpose, species from four other families wereanalyzed and compared with Solanaceae species. Results confirmed polymorphism in the trnE-trnT region at different taxonomiclevels.

  18. Potential for seed bank formation of two weed species from Brazilian Amazonia Potencial para a formação de banco de sementes de duas espécies de plantas daninhas da Amazônia brasileira

    Directory of Open Access Journals (Sweden)

    Moacyr B. Dias-Filho

    1999-08-01

    Full Text Available The potential for seed bank formation of two perennial weed species, Ipomoea asarifolia (Desr. Roem. & Schult. (Convolvulaceae and Stachytarpheta cayennensis (Rich. M. Vahl (Verbenaceae, both common in Amazonia , was evaluated in a degraded pasture area in eastern Brazilian Amazonia . Seeds were enclosed in nylon mesh packets and placed at the soil surface or buried at 5 or 10 cm deep. The number of viable seeds was recorded at 6, 10, 14 and 18 months after burial. Results showed that S. cayennensis has the ability to form persistent soil seed bank, while I. asarifolia seeds do not build up in the soil seed bank. For S. cayennensis and, to some extent, for I. asarifolia, seed survival was highest at greater burial depths.O potencial para a formação de banco de sementes de duas espécies perenes de plantas daninhas, Ipomoea asarifolia (Desr. Roem. & Schult. (Convolvulaceae e Stachytarpheta cayennensis (Rich. M. Vahl (Verbenaceae, ambas comuns na Amazônia, foi avaliado em uma área de pastagem degradada na Amazônia oriental brasileira. As sementes foram inseridas em envelopes de tela de nylon e colocadas na superfície do solo ou enterradas a cinco ou 10 cm de profundidade. O número de sementes viáveis foi avaliado aos 6, 12, 14 e 18 meses após o início do ensaio. Os resultados mostraram que S. cayennensis tem o potencial para formar banco de sementes persistente, enquanto que as sementes de I. asarifolia não apresentam esse potencial. Em S. cayennensis e, de certo modo, em I. asarifolia, a sobrevivência de sementes foi maior nas maiores profundidades.

  19. Diversity analysis of sweet potato (Ipomoea batatas [L.] Lam ...

    African Journals Online (AJOL)

    aghomotsegin

    2014-02-05

    Feb 5, 2014 ... for genetic diversity assessment on sweet potato germplasm (Jarret et al., 1992; ..... method using arithmetic average (UPGMA) algorithm of. DARwin5.0.158 ..... McKnight Foundation for the additional support. REFERENCES.

  20. (Ipomoea batatas L.) AS INFLUENCED BY PROPAGULE LENGTH

    African Journals Online (AJOL)

    Key words: economic analysis, growth variables, organic fertilizer, tuber yield. INTRODUCTION ..... ns - not significant at 5% level of probability. Table 3: Vine girth (cm) of sweet ..... production couple with longer vines. The significant increase ...

  1. Possibilities of sweet potato [ Ipomoea batatas (L.) Lam] value chain ...

    African Journals Online (AJOL)

    Sweet potato is one of the most important food security promoted root crops in the world, especially in sub-Saharan Africa. Unfortunately, the crop is still neglected and underutilized in Benin Republic. To establish baseline data for its better utilization for upgrading its value chain, 10 selected local varieties (01 cream, ...

  2. Agronomic performance of locally adapted sweet potato ( Ipomoea ...

    African Journals Online (AJOL)

    Tissue culture techniques have opened a new frontier in agricultural science by addressing food security and agricultural production issues. A study was conducted to compare growth and yield characteristics between the tissue culture regenerated and conventionally propagated sweet potato cultivars. Five locally adapted ...

  3. Green synthesis of zinc nanoparticles using Ipomoea asarifolia

    African Journals Online (AJOL)

    ... and Eriochrome black T (EBT) dyes. Isotherms, kinetics and thermodynamics of the adsorption process were studied with the view to understand the adsorption mechanism. The adsorption isotherms were closely described by Freundlich isotherm model with correlation coefficient (R2) of 0.99. The adsorption kinetics data ...

  4. Genetic Fingerprinting of Sweet Potato [ Ipomoea batatas (L.) Lam ...

    African Journals Online (AJOL)

    Sweet potato is an important staple crop and many varieties have been released into farmers' fields in Nigeria, but no reliable means in tracking their identity, thus causing multiple naming of these varieties among farmers. The objective of the study is to establish objectively and reliable means of identifying released, local ...

  5. Genetic Fingerprinting of Sweet Potato [Ipomoea batatas (L.) Lam ...

    African Journals Online (AJOL)

    Prof. Ogunji

    Sweet potato is an important staple crop and many varieties have been released into farmers' fields in Nigeria, ..... Tib 4 is distinct and did not form cluster while ... V. P HP P P W. Tis 2154. 5. DG DG V V. V. 1 NL. V. NP NP P P W. Tib 11. 6. P. P.

  6. Aqueous Extract of Ipomoea batatas Reduces Food Intake in Male ...

    African Journals Online (AJOL)

    have examined the effects on satiety, that is, how fixed amounts of carbohydrate or ... can reduce food intake: High-fiber foods take longer to eat; fiber decreases ... oxidative stress and to prevent the development of chronic diseases (such as ...

  7. [ipomoea batatas (l.) lam] by meristem culture and thermotherapy

    African Journals Online (AJOL)

    Preferred Customer

    infection, Hawassa Agricultural Research Centre ... personal communication). ... Production of disease-free planting material by ... into sterile Magenta boxes for multiplication and ... added to MS medium (E) and multiple shoot growth of Awassa-83 in 2 mg/l BAP added to MS ..... Africa. DFID crop protection program, a paper.

  8. Genetic Fingerprinting of Sweet Potato [Ipomoea batatas (L.) Lam ...

    African Journals Online (AJOL)

    Prof. Ogunji

    at a space of 1m x 1m in a randomized complete block design in two replications. High genetic diversity was observed among the sweet potato genotypes examined. The morphological data revealed three distinctive clusters. In cluster I, purple vine, green petiole and light pink storage root colour were the dominant traits.

  9. An Overview of Ipomoea carnea subspecies fistulosa toxicosis in ...

    African Journals Online (AJOL)

    It contains two toxic principles, swainsonine and calystegines causing neurological condition called acquired lysosomal storage disease. Its toxicological status is not determined in the region despite risk of poisoning. Therefore it is being reviewed for its toxic effects, epidemiology, pathogenesis, clinical presentations, ...

  10. Effects of feeding sweet potato (Ipomoea batatas) leaves on growth ...

    African Journals Online (AJOL)

    Dr Abonyi

    2012-02-21

    Feb 21, 2012 ... the cost of production of sheep, cattle and poultry which has implored .... Weende method, while calcium (Ca) and phosphorus (P) contents .... chemical compositions of cassava hay and its supplementation on lactating dairy ...

  11. Protective Effect of Purple Sweet Potato (Ipomoea batatas Linn ...

    African Journals Online (AJOL)

    ISSN: 1596-5996 (print); 1596-9827 (electronic) ... oxide (NO) levels were measured using Griess assay. Inducible NO synthase (iNOS) ... IBE also scavenged DPPH radicals in a dose-dependent manner (p < 0.05 at 10 μg/ml ... filtered and lyophilized to obtain ethanol extract concentrate. ... temperature, 298 °K. Cell culture ...

  12. evaluation of the performance of improved sweet potato (ipomoea

    African Journals Online (AJOL)

    IKUMOINEIN W. KURO

    combat a widespread vitamin A deficiency that results in blindness and ... and 500,000 ha from China, Nigeria, Uganda and. Tanzania ... healthy plants. Extending this to all of China's sweet ... the country's reliance on cereal imports for livestock feed. In Kwara ..... Center (CIP) Programme Report 1995-1996, Lima, Peru.

  13. Characterization of non-coding DNA satellites associated with sweepoviruses (genus Begomovirus, Geminiviridae - definition of a distinct class of begomovirus-associated satellites

    Directory of Open Access Journals (Sweden)

    Gloria eLozano

    2016-02-01

    Full Text Available Begomoviruses (family Geminiviridae are whitefly-transmitted, plant-infecting single-stranded DNA viruses that cause crop losses throughout the warmer parts of the World. Sweepoviruses are a phylogenetically distinct group of begomoviruses that infect plants of the family Convolvulaceae, including sweet potato (Ipomoea batatas. Two classes of subviral molecules are often associated with begomoviruses, particularly in the Old World; the betasatellites and the alphasatellites. An analysis of sweet potato and Ipomoea indica samples from Spain and Merremia dissecta samples from Venezuela identified small non-coding subviral molecules in association with several distinct sweepoviruses. The sequences of 18 clones were obtained and found to be structurally similar to tomato leaf curl virus–satellite (ToLCV-sat, the first DNA satellite identified in association with a begomovirus, with a region with significant sequence identity to the conserved region of betasatellites, an A-rich sequence, a predicted stem-loop structure containing the nonanucleotide TAATATTAC, and a second predicted stem-loop. These sweepovirus-associated satellites join an increasing number of ToLCV-sat-like non-coding satellites identified recently. Although sharing some features with betasatellites, evidence is provided to suggest that the ToLCV-sat-like satellites are distinct from betasatellites and should be considered a separate class of satellites, for which the collective name deltasatellites is proposed.

  14. Estudios citotaxonómicos en las especies ibéricas del género Cuscuta (Convolvulaceae

    Directory of Open Access Journals (Sweden)

    Castroviejo, Santiago

    2002-06-01

    Full Text Available Cuscuta is a genus of parasitic plants with great diversity in size, number and type of chromosomes. All the species included in Cuscuta subgenus Cuscuta are characterized by the holocentric chromosomes whereas they are monocentric in the species of subgenera Grammica and Monogyna. In this paper we summarize the data previously published on the karyology of the genus. study the chromosomic characterization of the Iberian species and identify new chromosome numbers for the genus and for several species. The chromosome numbers found in some species such as C. epithymum indícate the possibility of agmatoploidy and simploidy in the genus.Cuscuta es un género de plantas parásitas en el que hay una gran diversidad en tamaño, número y tipo de cromosomas. Todas las especies de Cuscuta subgén. Cuscuta se caracterizan por tener cromosomas holocéntricos, mientras que son monocéntricos en los subgéneros Grammica y Monogyna. En este trabajo se analizan los datos conocidos sobre la cariología del género, se estudia la caracterización cromosomática de las especies ibéricas y se aportan números que son nuevos tanto a nivel genérico como específico. Se han encontrado una serie de números cromosomáticos en C. epithymum que sugieren la posible existencia de agmatoploidía y simploidía en el género.

  15. Notes on Two Newly Naturalized Plants in Taiwan: Evolvulus nummularius (L. L. (Convolvulaceae and Acalypha aristata Kunth (Euphorbiaceae

    Directory of Open Access Journals (Sweden)

    Shih-Huei Chen

    2009-09-01

    Full Text Available Evolvulus nummularius (L. L. and Acalypha aristata Kunth, originally native to tropical America, were recently found naturalized in disturbed sites of Taiwan. The present study gives the taxonomic description and line drawings of the two species. In addition, their distributions and notes on ecology are provided.

  16. Analisis Kandungan Timbal (Pb) Dan Kadmium (Cd) Pada Kangkung Air (Ipomoea aquatica Forssk) DAN kangkung Darat (Ipomoea reptans Poir) Di Daerah Mabar-Kim Secara Spektrofotometri Serapan Atom

    OpenAIRE

    Sari, Arisa Dian

    2011-01-01

    Kangkung is a kind of vegetables that is commonly consumed by people and it contains a lot of vitamin A. Surrounding the Industry Area in Medan such as Mabar, vegetables are planted by people, one of them is kangkung. Since the industries growth in the area of the vegetables are expanded, it is wondered that the kangkung has been contaminated by lead and cadmium metals. The purpose of this research is to know the lead and cadmium metals of water kangkung and land kangkung planted in Mabar the...

  17. Acetylcholinesterase inhibition by somes promising Brazilian medicinal plants.

    Science.gov (United States)

    Feitosa, C M; Freitas, R M; Luz, N N N; Bezerra, M Z B; Trevisan, M T S

    2011-08-01

    A microplate assay and a thin-layer chromatography (TLC) "in situ" assay based on the Ellman assay was used to screen for acetylcholinesterase inhibitors from ethyl acetate and methanol extracts of Brazilian medicinal plants of families that, according to the literature, have traditional uses that might be connected with acetylcholinesterase inhibition. Eighteen species belonging to Convolvulaceae, Crassulaceae, Euphorbiaceae, Leguminosae, Malvaceae, Moraceae, Nyctaginaceae and Rutaceae families were tested. The most active plants were Ipomoea asarifolia (IC50 = 0.12 mg/mL), Jatropha curcas (IC50 = 0.25 mg/mL), Jatropha gossypiifolia (IC50 = 0.05 mg/mL), Kalanchoe brasiliensis (IC50 = 0.16 mg/mL) and Senna alata (IC50 = 0.08 mg/mL). The most promising extracts were the Jatropha gossypiifolia and Senna alata species assuming there were compounds with a similar activity to galanthamine, which should contain about 1% of an active compound, or if present at lower levels even more active compounds than galanthamine (IC50 = 0.37 x 10-3 mg/mL) should be present.

  18. Developmental biology, polymorphism and ecological aspects of Stiretrus decemguttatus (Hemiptera, Pentatomidae, an important predator of cassidine beetles

    Directory of Open Access Journals (Sweden)

    Lucia Maria Paleari

    2013-03-01

    Full Text Available Developmental biology, polymorphism and ecological aspects of Stiretrus decemguttatus (Hemiptera, Pentatomidae, an important predator of cassidine beetles. Stiretrus decemguttatus is an important predator of two species of cassidine beetles, Botanochara sedecimpustulata (Fabricius, 1781 and Zatrephina lineata (Fabricius, 1787 (Coleoptera, Cassidinae, on the Marajó Island, Brazil. It attacks individuals in all development stages, but preys preferentially on late-instar larvae. Its life cycle in the laboratory was 43.70 ± 1.09 days, with an egg incubation period of six days and duration from nymph and adult stages of 16.31 ± 0.11 and 22.10 ± 1.67 days, respectively. The duration of one generation (T was 12.65 days and the intrinsic population growth rate (r 0.25. These data reveal the adjustment of the life cycle of S. decemgutattus with those of the two preys, but suggest greater impact on Z. lineata. However, no preference over cassidine species was shown in the laboratory. Up to 17 different color patterns can be found in adults of S. decemguttatus, based on combinations of three basic sets of color markings. Some of them resemble the markings of chrysomelids associated with Ipomoea asarifolia (Convolvulaceae and are possibly a mimetic ring. Three color patterns were identified in nymphs, none of which was associated with any specific adult color pattern.

  19. Acetylcholinesterase inhibition by somes promising Brazilian medicinal plants

    Directory of Open Access Journals (Sweden)

    CM. Feitosa

    Full Text Available A microplate assay and a thin-layer chromatography (TLC "in situ" assay based on the Ellman assay was used to screen for acetylcholinesterase inhibitors from ethyl acetate and methanol extracts of Brazilian medicinal plants of families that, according to the literature, have traditional uses that might be connected with acetylcholinesterase inhibition. Eighteen species belonging to Convolvulaceae, Crassulaceae, Euphorbiaceae, Leguminosae, Malvaceae, Moraceae, Nyctaginaceae and Rutaceae families were tested. The most active plants were Ipomoea asarifolia (IC50 = 0.12 mg/mL, Jatropha curcas (IC50 = 0.25 mg/mL, Jatropha gossypiifolia (IC50 = 0.05 mg/mL, Kalanchoe brasiliensis (IC50 = 0.16 mg/mL and Senna alata (IC50 = 0.08 mg/mL. The most promising extracts were the Jatropha gossypiifolia and Senna alata species assuming there were compounds with a similar activity to galanthamine, which should contain about 1% of an active compound, or if present at lower levels even more active compounds than galanthamine (IC50 = 0.37 x 10-3 mg/mL should be present.

  20. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    and extensive inland fisheries aside from being causes of human ... water. All collected fish specimens were examined within a day while still in the field. Records of the ..... due to change in diet from weeds, seeds, phyto- plankton and .... Narendra Publishing House, India, pp 207–. 292. 3. ... Aspects of Climate and. Water ...

  1. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    ABSTRACT: Epiphytic recruitment of trees on trees is a form of facilitation allowing trees to escape herbivory and abiotic stress. In terms of survival and reaching the upper canopy sooner, this form of recruitment may be more successful than recruitment from the ground. Hence epiphytic recruitment may play a major role in ...

  2. Pengaruh Macam dan Waktu Aplikasi Bahan Organik pada Tanaman Ubi Jalar (Ipomoea batatas L. Var. Kawi

    Directory of Open Access Journals (Sweden)

    Nur Edy Suminarti

    2015-07-01

    Full Text Available Diversifikasi pangan merupakan langkah tepat untuk mengantisipasi kondisi rawan pangan.  Hal ini menjadi penting karena setiap tahun luas lahan basah telah mengalami penyusutan sekitar 0,1% dari total luas lahan di Indonesia. Sehubungan dengan hal tersebut, dan dalam upaya untuk memenuhi kebutuhan pangan nasional, maka pemanfaatan ubi jalar sebagai sumber bahan pangan alternatif perlu dilakukan. Penelitian yang bertujuan untuk mendapatkan informasi tentang macam dan waktu aplikasi bahan organik yang tepat telah dilakukan di Desa Landungsari, Kabupaten Malang. Rancangan yang digunakan adalah Petak Terpisah, macam bahan organik ditempatkan pada petak utama, terdiri dari 3 macam, yaitu  pupuk kandang sapi, kompos azolla dan kompos sampah kota.  Waktu aplikasi bahan organik sebagai anak petak, terdiri dari 3 macam, yaitu : 30 hari sebelum tanam, 15 hari sebelum tanam dan bersamaan tanam. Pengumpulan data dilakukan secara destruktif, meliputi  komponen pertumbuhan dan panen, analisis pertumbuhan tanaman dan analisis tanah. Uji F taraf 5% ditujukan untuk menguji pengaruh perlakuan, sedang perbedaan diantara rata-rata perlakuan didasarkan pada nilai BNT taraf 5%. Interaksi nyata terjadi pada sebagian besar parameter yang diamati, dan hasil umbi tertinggi didapatkan pada kompos sampah kota yang waktu aplikasinya dilakukan 30 hari sebelum tanam : 28,03 ton umbi ha-1. Food diversification is a precise step to anticipate food shortage condition. It becomes important because wetland area is decreasing of approximately 0,1% each year of total area in Indonesia. Related to that point, also in order to meet food national demand, utilization of sweet potato as alternative food resource needs to be done. Research aimed to get information about proper kind and application time of organic matter had been done at Landungsari, Malang. The design used was Split Plot, kind of organic matter was placed as main plot, consisting of 3 kinds, ie: cow manure, azzola compost, and urban waste compost. Application time was set as subplot, consisting of 3 times, ie: 30 days before planting, 15 days before planting, and simultaneous with planting. Data collection was carried out destructively, including growth and yield components, plant growth analysis and soil analysis. F test on 5% level intended to test treatment effect, meanwhile difference between mean values based on LSD 5%. Real interaction occurred on almost all parameters observed, moreover the highest tuber yield was on urban waste compost which time application was 30 days before planting : 28,03 ton tuber ha-1.

  3. Isozyme modifications and plant regeneration through somatic embryogenesis in sweet potato (Ipomoea batatas (L.) Lam.).

    Science.gov (United States)

    Cavalcante Alves, J M; Sihachakr, D; Allot, M; Tizroutine, S; Mussio, I; Servaes, A; Ducreux, G

    1994-05-01

    The potential of somatic embryogenesis was evaluated for 10 cultivars of sweet potato through extensive embryogenic response and isozyme analysis. Embryogenic callus was induced by incubating lateral buds on Murashige and Skoog medium containing 10 μM 2,4-dichlorophenoxyacetic acid for 6-8 weeks. The frequency of embryogenic response was low, and varied with genotypes, ranging from 0 to 17%. Embryo to plantlet formation could be enhanced by the use of the combination of 2,4-dichlorophenoxyacetic acid with kinetin, both used at 0.01 μM. Embryogenic callus with its potential of plantlet formation has constantly been maintained for over two years. However, after several subcultures, 0.5 to 12% of embryogenic callus reverted irreversibly into friable fast-growing non-embryogenic callus whose ability to regenerate shoots was then definitively lost. The isozymes of esterase, peroxidase, glutamate oxaloacetate transaminase and acid phosphatase investigated in this study were found appropriate to distinguish compact embryogenic from friable non-embryogenic callus in sweet potato. In fact, the callus reversion was associated with a loss of bands or a decline in isozyme activity. On the contrary, very small changes in isozyme activity or no specific changes at all were observed during the differentiation of embryogenic callus into globular embryos.

  4. Heritability of regeneration in tissue cultures of sweet potato (Ipomoea batatas L.).

    Science.gov (United States)

    Templeton-Somers, K M; Collins, W W

    1986-03-01

    A population of open-pollinated progeny from 12 parents, and the 12 parents, was surveyed for in vitro growth and regeneration characteristics. Four different tissue culture procedures involving different media and the use of different explants to initiate the cultures were used. Petiole explants from young leaves were used as explants for initiation of callus cultures. These were evaluated for callus growth rate, friability, and callus color and texture, before transferring to each of three different regeneration media for evaluation of morphogenetic potential. Small shoot tips also were used to initiate callus cultures, which were evaluated for the same growth characteristics and transferred to growth-regulator free regeneration media. Regeneration occurred through root or shoot regeneration or through embryogenesis. Tissue culture treatment effects, as well as genotypic effects, were highly significant in determining: the types of callus produced, callus growth rates, color and texture on the two types of media used for the second and third subcultures. The family x treatment interaction was generally not statistically significant, affecting only callus color. Estimates of narrow sense heritability for callus growth rate in both the second and third subcultures were high enough (0.35 and 0.63, respectively) for the evaluation of parental lines for selection procedures. These characteristics were also the only early culture callus traits that were consistently correlated with later morphogenesis of the cultures. They were negatively correlated with root or shoot regeneration. The occurence of somatic embryogenesis was not correlated with early callus growth characteristics. Genetic and treatment effects were highly significant in the evaluation of morphogenetic potential, through root or shoot regeneration, or through embryogenesis. Regeneration of all types was of low frequency for all procedures, expressed in ≦ 11% of the cultures of the total population.

  5. KARAKTERISTIK KIMIA, FISIK DAN INDERAWI TEPUNG UBI JALAR UNGU (Ipomoea batatas Poiret DAN PRODUK OLAHANNYA

    Directory of Open Access Journals (Sweden)

    Ade Krisna Nindyarani

    2012-05-01

    Full Text Available The objectives of the research were to determine the chemical and physical characteristics of purple-flesh sweet potato flour as base of suitability for processed foods production, and to determine the acceptability of products by panelists. Cookies and pound cake were made by using purple-flesh sweet potato flour as raw material and using stages of process as follows: dough preparation, molding, shaping and baking. The results showed that purple-flesh sweet potato flour contain moisture 10.92 ± 0.09 % (db, protein 6.44 ± 0.27 % (db, starch 74.57 ± 0.32 % (db, amylose 24.79 ± 0.94 % (db, reducing sugar 3.15 ± 0.30 % (db, and crude fiber 2.40 ± 0.35 % (db. Peak viscosity at 65 oC was 6.17 dPa.s and setback viscosity was similar to the peak viscosity. Starch granules of purple-flesh sweet potato were  polygonal with size of 10-25 μm. The cookies made by using mixture of 25 % wheat flour and 75 % purple-flesh sweet potato flour, and pound cake made by using 100 % purple-flesh sweet potato flour were acceptable for panelists. Keywords: Purple-flesh sweet potato flour, cookies, pound cake   Abtrak Tujuan penelitian adalah untuk mengetahui karakteristik kimia dan fisik tepung ubi jalar ungu sebagai dasar penentuan kesesuaian untuk pembuatan pangan olahan berbasis tepung ubi jalar ungu serta untuk mengetahui tingkat penerimaan panelis. Tepung ubi jalar ungu diolah menjadi cookies dan pound cake mengikuti tahap penyiapan adonan, pencetakan, dan pemanggangan. Dilakukan uji inderawi cookies dan pound cake melalui uji kesukaan oleh panelis yang  meliputi parameter warna, aroma, cita-rasa, tekstur, dan kesukaan keseluruhan serta uji deskriptif. Hasil penelitian menunjukkan bahwa tepung ubi jalar ungu memiliki berturut-turut komponen kadar air 10,92 ± 0,09 % (bk, protein 6,44 ± 0,27 % (bk, pati 74,57 ± 0,32 % (bk, amilosa 24,79 ± 0,94 % (bk, gula reduksi 3,15 ± 0,30 % (bk, dan serat kasar 2,40 ± 0,35 % (bk. Viskositas puncak tepung ubi jalar ungu pada suhu 65 oC sebesar 6,17 dPa.s, dan viskositas baliknya relatif sama dengan viskositas puncak. Granula pati tepung ubi jalar ungu berbentuk poligonal dengan ukuran 10-25 μm. Cookies yang dibuat dari kombinasi antara tepung terigu 25 % dan tepung ubi jalar ungu 75 %, dan  pound cake yang dibuat dari tepung ubi jalar ungu 100 % (tanpa tepung terigu cukup disukai panelis. Kata kunci: Tepung ubi jalar ungu, cookies, pound cake

  6. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    1 Department of Biology, Adigrat University, PO Box 50, Adigrat, Ethiopia. E-mail: mebrahtuhishe@gmail.com. 2 Department of Biology, Bahir Dar University, PO Box 79, Bahir Dar Ethiopia. E-mail: berhanu.tsegay@yahoo.com. ABSTRACT: ..... increment of mistletoes. Sometimes non-host species could be infected under ...

  7. EVALUACIÓN AGRONÓMICA DE TRECE GENOTIPOS DE CAMOTE (Ipomoea batatas L.

    Directory of Open Access Journals (Sweden)

    Rolbin Castillo Matamoros

    2014-01-01

    Full Text Available El objetivo del presente trabajo fue caracterizar desde el punto de vista agronómico, 13 genotipos de camote para su cultivo en Costa Rica. Diez fueron introducidos de la Unidad de Micropropagación de la Universidad Estatal de Carolina del Norte, y cultivados por primera vez en Costa Rica, 2 conocidos como “Exportación y Zanahoriaˮ son de introducción reciente, pero se han cultivado en el país por al menos 5 años y el restante Criollo es el que ocupa actualmente la mayor área de siembra. El trabajo se llevó a cabo en la Estación Experimental Fabio Baudrit de la Universidad de Costa Rica, ubicada en la provincia de Alajuela. Los tratamientos se dispusieron en el campo en un diseño de bloques completos al azar, con 13 genotipos y 4 repeticiones. El análisis de varianza mostró que los genotipos difirieron significativamente (p=0,0001 en todas las variables evaluadas: peso fresco y seco foliar; peso fresco y seco de raíz reservante; número de raíces reservantes; peso de raíz reservante/ planta; contenido de materia seca y rendimiento (t.ha-1. Todos los cultivares evaluados superaron el rendimiento de la variedad Criollo (6 t.ha-1 y el promedio nacional (5 a 7,8 t.ha-1, con rendimientos entre 12 y 48 t.ha-1. Algunos de los cultivares son promisorios para su cultivo en Costa Rica, no solo con base en su rendimiento, sino debido a su color de pulpa, amarilla o anaranjada, asociado a un mayor contenido de carotenos

  8. Effects of incorporating nonmodified sweet potato (Ipomoea batatas) flour on wheat pasta functional characteristics.

    Science.gov (United States)

    Saleh, Mohammed; Lee, Youngseung; Obeidat, Hayat

    2017-12-28

    The effects of substituting wheat flour using fractions of blanched or nonblanched sweet potato flour on produced pasta functional characteristics were investigated. The use of sweet potato flour to replace fractions of wheat flour, regardless of blanching treatment, resulted in significant (p pasta water uptake and solid leaching out and freeze-thaw stability of produced pasta. For instance, treatment containing 40% of nonblanched sweet potato flour and held at 55C resulted in 27% point increase in WHC compared to the control. Sweet potato flour was also contributed to the decrease in treatments pasting viscosities and in cooked pasta hardness. Cooked pasta hardness was significantly (p pasta made using fractions of sweet potato were equivalent to or sometimes superior to that of the control sample. Results indicated the possible enhancement of pasta nutritional quality including firmness, cooking loss, and water uptake without impairing consumer acceptability. The use of sweet potato flour in pasta would enhance the nutritional and physicochemical properties of developed pasta and pasta products. Furthermore, since sweet potato is not cultivated most of the year; sweet potato flour pasta would be better utilized in food processing and is expected to enhance sweet potato consumption year around. © 2017 Wiley Periodicals, Inc.

  9. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    fluoride in cereal and legume grain samples were determined by fluoride ion selective electrode. Fluoride levels in .... dered to be beneficial in the prevention of dental caries and ...... for Toxic Substances and Disease Registry. (ATSDR) ...

  10. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    YIELD STABILITY OF BREAD WHEAT ... Key words/phrases: AMMI model, ANOVA, Genotype-by-Environment Interaction, main effects, ... and environments in multi-environment trials. ... Interaction Principal Component Axis (IPCA), and so on.

  11. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    direct impact (Kebu Balemie and Fassil Kebebew,. 2006; Tigist ..... making and medicine (Azene Bekele, 2007;. Demel Teketay et al. ..... tourist attraction centre, but also a major plant biodiversity .... positive/negative perception for their edibility.

  12. Sweet potato (Ipomoea batatas) attenuates diet-induced aortic stiffening independent of changes in body composition.

    Science.gov (United States)

    Garner, Tyler; Ouyang, An; Berrones, Adam J; Campbell, Marilyn S; Du, Bing; Fleenor, Bradley S

    2017-08-01

    We hypothesized a sweet potato intervention would prevent high-fat (HF) diet-induced aortic stiffness, which would be associated with decreased arterial oxidative stress and increased mitochondrial uncoupling. Young (8-week old) C57BL/6J mice were randomly divided into 4 groups: low fat (LF; 10% fat), HF (60% fat), low-fat sweet potato (LFSP; 10% fat containing 260.3 μg/kcal sweet potato), or high-fat sweet potato diet (HFSP; 60% fat containing 260.3 μg/kcal sweet potato) for 16 weeks. Compared with LF and LFSP, HF- and HFSP-fed mice had increased body mass and percent fat mass with lower percent lean mass (all, P Sweet potato intervention did not influence body composition (all, P > 0.05). Arterial stiffness, assessed by aortic pulse wave velocity and ex vivo mechanical testing of the elastin region elastic modulus (EEM) was greater in HF compared with LF and HFSP animals (all, P sweet potato attenuates diet-induced aortic stiffness independent of body mass and composition, which is associated with a normalization of arterial oxidative stress possibly due to mitochondrial uncoupling.

  13. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    College of Natural Sciences, Addis Ababa University, 2015 ... 3 Department of Mathematics, College of Sciences, Botswana International University of Science ...... Mappings with Application. .... Bulletin of the Malaysian Mathematical Sciences.

  14. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    Porter and Orcutt (1980) and Lampert (1987) have shown that three general characteristics of blue greens, manageability, nutritional inadequacy and toxicity, tend to limit their exploitation by zoo- plankton. In addition, these algae interfere with filtration processes of grazers (Jarvis, 1986; De. Bernardi and Guissani, 1990).

  15. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    the critical factor for the growth and enzyme production by Trichoderma isolates. Therefore, these cellulase producing Trichoderma isolates can be used in food industries, animal feed industries, brewing and wine ... However, the cost of cellulase production and optimization profoundly influences the economics of the entire.

  16. Therapeutic effects of the traditional medicinal plant Ipomoea stolonifera for the treatment of liver diseases

    NARCIS (Netherlands)

    Bai, Xueting

    2016-01-01

    Liver diseases are categorized into acute liver failure (ALF) and chronic liver failure (CLF). Massive cell death is a hallmark of ALF and leads to a dramatic loss of liver function. Therefore, specific interventions targeted to prevent or attenuate this massive cell death may be very effective in

  17. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    lake since grazing by zooplankton does not control the common large and filamentous cyanobacteria in Lake ... zooplankton. The objective of this work was to determine the ... where V is volume of the container in ml and N is density of grazers ...

  18. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    Due to the regional nature of the work, morphometric ... tion of elongate volcanic cones can be attributed to subsurface .... multiple eruptions, thus actually being poly- genetic. In this ..... Acocella, V., Bekele Abebe and Tesfaye Korme. (2011).

  19. Mycoflora of sun-dried sweet potato (Ipomoea batatas L.) slices in ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-07-20

    Jul 20, 2009 ... The composition of the fungal species which will be es- tablished on exposed ... fungi associated with sun-dried sweet potato slices with a view to highlighting ..... Valero A, Sanchis V, Ramos AJ, Marin S (2007). Studies on the.

  20. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    E-mail: Henok.Tiruneh@mines.sdsmt.edu. 2 School of Earth Sciences, College of Natural Sciences, PO Box 1176, Addis Ababa University, Addis ... Landslides are significant natural hazards in mountainous terrain all around the world. ...... for the purpose of agriculture and dwelling. Figure 9. Landslide hazard zonation of ...

  1. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    K), which were moist to 60% water holding capacity of the soil every day, 34-44% of the applied ... biologically active soils these fertilizers pass ... 1955); organic carbon (Black, 1965); total nitrogen .... granular sst/pl n/o. Few Mn-Fe nodules. * = moist value; d/w = diffuse and .... supplying potential of Typic Hapl-udert if the.

  2. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    ISSN: 0379–2897. GENETIC DIVERSITY OF COLLETOTRICHUM SUBLINEOLUM ISOLATES ... given due consideration in future breeding programs. Such a diversity calls for ... diverse gene pools. Effective and sustainable control strategies.

  3. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    ABSTRACT: Studies on experimental infection of Leishmania aethiopica are very limited due to lack of laboratory animal models. It was previously reported that the African green monkey (grivet monkey) could serve as a non–human primate model of L. aethiopica infection. This report provides preliminary data on the ...

  4. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    vestors in Ethiopia, lowland riverine ungulates and their corresponding predators are becoming threatened. African buffalo is one of the most threatened ungulates in the upper Blue Nile. Valley of Ethiopia due to trophy hunting and bush meat trade in addition to habitat destruc- tion and fragmentation. Conservation activities.

  5. Studies on mutation breeding in sweet potato (Ipomoea batatas (L.) Lam.)

    International Nuclear Information System (INIS)

    Kukimura, H.; Kouyama, Y.

    1982-01-01

    Different genotypes were subjected to gamma rays and EMS to examine the effects on tuber skin colour mutation. Different mutation rates were obtained according to the genotypes. The gamma irradiation induced larger sector size of skin colour mutation than EMS. Gamma rays had an effect on inducing flowering in MV 1 which is utilized in cross breeding. Mutagenic treatment by gamma rays and EMS on the hybrid true seed which segregates in a Mendelian ratio for pigmentation in leaf, stem and tuber and for shape of leaf gave some bias to their segregation ratios. Effects of gamma-ray irradiation on quantitative characters, such as dry matter content and total sugar content in tubers, were also investigated in hybrid populations. The treatments enlarged genetic variations on both the characters, being more effective on total sugar content. Clonal progenies derived from mutagenic treatment by gamma rays and EI were investigated for their quantitative MV 4 -MV 6 characters (tuber yield, dry matter content and total sugar content) in MV 4 -MV 6 . Heritabilities in a broad sense and phenotypic variances were estimated from the measurements on derivative strains obtained by random selection from mutagenic treatment plots. Artificial selection was effective only for tuber yield. Mutant clones with short stem length decreased their tuber yield and vice versa. A few mutant clones were found to excel the originals in dry matter content and total sugar content. Some aspects of mutation breeding in sweet potato are also discussed

  6. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    ABSTRACT: The phylogeny of the East African Hippopotamidae is problematic. A particularly controversial relationship is that between aff. Hippopotamus protamphibius and aff. .... ficient reconstruction of the symphysis, corpora, and canine processes has been completed to warrant a preliminary description of the fossil.

  7. Pemberian Macam Konsorsium Bakteri Hasil Isolasi Tumbuhan Pantai pada Kangkung (Ipomoea reptans Poirs.

    Directory of Open Access Journals (Sweden)

    Umul Aiman

    2017-06-01

    Full Text Available Bacteria consortium isolated from coastal plant was used as Plant Growth Promoting Rhizobacteria (PGPR which can improve the growth and yield of plant. The purpose of this research was to understand the effects of various bacteria consortium application on the growth and yield of water spinach. The research was conducted on June-September 2016 in Microbiology Laboratory, Agroindustry Laboratory and Agriculture Land, University of Mercu Buana Yogyakarta. The study used a single factor experiment with 16 treatments and 3 blocks which arranged using completely randomized design (CRD. The treatment was desinged by soaking the water spinach seed on the various PGPR consorcium. All treatments were control (seed soaking on the water or without PGPR, the seed soaking on the various PGPR consorsium including K2, K9, K15, C7, K2K9, K2K15, K2C7, K9K15, K9C7, K15C7, K2K9K15, K2K9C7, K9K15C7, K2K15C7, and K2K9K15C7. The economic weight of water spinach which soaking on K2K9K15C7 consorcium was the best treatments compare to other treatments. Application of single isolate including K2, K9, K15, C7 and rhizobacteria consortium including K2K9, K2K15, K2C7, K9K15, K9C7, K15C7, K2K9K15, K2K9C7, K9K15C7, K2K15C7 can improved the yield of water spinach compare to the treatment without application of rhizobacteria.

  8. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    G3pdh is under diversifying selection in both populations. This may indicate the importance for isoamylase1 in starch quality traits ... a low copy, nuclear housekeeping gene involved in glycolysis, a central ... Plant material and DNA extraction.

  9. EVALUATION OF ELASTICITY AND MECHANICAL PROPERTIES OF BREAD DOUGH MADE WITH REPLACED FLOUR POTATO (IPOMOEA BATATA

    Directory of Open Access Journals (Sweden)

    Ely Fernando Sacón Vera

    2016-10-01

    Full Text Available The effect of the incorporation of sweet potato flour, with 30% replacement in 1kg of wheat flour was evaluated to determine the behavior of elastic and mechanical properties during the kneading and baking stage of bread. For the evaluation the following varieties were studied: Morado Brazil, Morado Ecuador, Guayaco Morado, Ina and Toquecita, and the evaluated properties were: texture (hardness, elasticity, firmness, chewiness measured by a texture meter Bloomfield and volume was measured by INEN standard (NTE INEN 0530: 80. The design employed was completely at random, using analysis of variance at 5% significance level. The results obtained showed that elasticity attribute in texture variable presented significant differences (P <0.05. Analysis concluded that including Toquecita flour in the mixture to form the dough, had the highest elasticity of 13.32mm. However, Morado Ecuador variety flour presented a 6.24 mm elasticity value, ideal for both the malleability of the dough and the freshness of the bread, and concerning volume, the inclusion of Ecuador Morado flour and Ina in the formulation of bread, showed an increase in volume at 93.30 and 93.67cm3 respectively, close to the normed value for wheat flour bread.

  10. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    eration and differentiation of cells. ... resistance, the current focus is, therefore, on RNA- ... Tobacco, as a model crop and as one of the cash ... confirmation was done by polymerase chain .... was discontinued only because of the high cost to.

  11. The effect of gamma radiation on the ultrastructure of sweet potatoes (Ipomoea batatas)

    International Nuclear Information System (INIS)

    Brown, A.

    1986-12-01

    Radiation is being used to increase the storage life of fresh foods. Various doses of gamma radiation were administered to Jewel cultivar sweet potatoes and the effects were monitored by direct observation and by scanning and transmission electron microscopy. Potatoes were divided into two groups: those irradiated immediately after harvest (doses = 0 kGy - 0.4 KGy) and those irradiated one week after harvest (doses = 0 kGy - 0.4 kGy). Potatoes were examined and viewed each month for 7 months. Gross observations included weight, color and texture of the sweet potatoes. Those potatoes irradiated immediately after harvest spoiled faster than those irradiated one week after harvest. Scanning electron microscopy demonstrated several cellular modifications accompanying spoilage. Cell collapse was greatest at the higher radiation doses during the periods of 1 to 5 months post-irradiation. The shape and size of starch granules varied with storage time and radiation levels. The mitochondria, cell walls and plasma membranes appeared normal as seen by transmission electron microscopy until 6 months post-irradiation for potatoes irradiated both immediately after harvest and one week after harvest. Thereafter, degradative changes were observed

  12. Quantitative genetic variance and multivariate clines in the Ivyleaf morning glory, Ipomoea hederacea.

    Science.gov (United States)

    Stock, Amanda J; Campitelli, Brandon E; Stinchcombe, John R

    2014-08-19

    Clinal variation is commonly interpreted as evidence of adaptive differentiation, although clines can also be produced by stochastic forces. Understanding whether clines are adaptive therefore requires comparing clinal variation to background patterns of genetic differentiation at presumably neutral markers. Although this approach has frequently been applied to single traits at a time, we have comparatively fewer examples of how multiple correlated traits vary clinally. Here, we characterize multivariate clines in the Ivyleaf morning glory, examining how suites of traits vary with latitude, with the goal of testing for divergence in trait means that would indicate past evolutionary responses. We couple this with analysis of genetic variance in clinally varying traits in 20 populations to test whether past evolutionary responses have depleted genetic variance, or whether genetic variance declines approaching the range margin. We find evidence of clinal differentiation in five quantitative traits, with little evidence of isolation by distance at neutral loci that would suggest non-adaptive or stochastic mechanisms. Within and across populations, the traits that contribute most to population differentiation and clinal trends in the multivariate phenotype are genetically variable as well, suggesting that a lack of genetic variance will not cause absolute evolutionary constraints. Our data are broadly consistent theoretical predictions of polygenic clines in response to shallow environmental gradients. Ecologically, our results are consistent with past findings of natural selection on flowering phenology, presumably due to season-length variation across the range. © 2014 The Author(s) Published by the Royal Society. All rights reserved.

  13. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    fusion matrix or a contingency table is the most appropriate ... addition, a discrete multivariate statistical model of 'Kappa ... index application to report CAA because this in- .... that no matter how small a LULC class is in size or ...... and Business Media, Inc., Dordrecht. 13. ... International Organizations for Standardizations.

  14. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    species diversity where the native habitats are heavily diminished and/or merit conservation. ... richness was influenced by distance to major roads, wealth status, farm size and family size. ...... avoid weaver birds, and to reduce competition of.

  15. Isolation and Abiotic Stress Resistance Analyses of a Catalase Gene from Ipomoea batatas (L.) Lam.

    Science.gov (United States)

    Yong, Bin; Wang, Xiaoyan; Xu, Pan; Zheng, Haiyan; Fei, Xueting; Hong, Zixi; Ma, Qinqin; Miao, Yuzhi; Yuan, Xianghua; Jiang, Yusong; Shao, Huanhuan

    2017-01-01

    As an indicator of the antioxidant capability of plants, catalase can detoxify reactive oxygen species (ROS) generated by environmental stresses. Sweet potato is one of the top six most important crops in the world. However, its catalases remain largely unknown. In this study, a catalase encoding gene, IbCAT2 (accession number: KY615708), was identified and cloned from sweet potato cv. Xushu 18. It contained a 1479 nucleotides' open reading frame (ORF). S-R-L, Q-K-L, and a putative calmodulin binding domain were located at the C-terminus of IbCAT2, which suggests that IbCAT2 could be a peroxisomal catalase. Next-generation sequencing (NGS) based quantitative analyses showed that IbCAT2 was mainly expressed in young leaves and expanding tuberous roots under normal conditions. When exposed to 10% PEG6000 or 200 mmol/L NaCl solutions, IbCAT2 was upregulated rapidly in the first 11 days and then downregulated, although different tissues showed different degree of change. Overexpression of IbCAT2 conferred salt and drought tolerance in Escherichia coli and Saccharomyces cerevisiae . The positive response of IbCAT2 to abiotic stresses suggested that IbCAT2 might play an important role in stress responses.

  16. Evaluation of the effects of sweet potato (Ipomoea batatas (L.) Lam) in broiler diets.

    Science.gov (United States)

    Pandi, J; Glatz, P; Forder, R; Komolong, B; Chousalkar, K

    2018-02-01

    Cereal grains such as maize and wheat are used extensively in feed formulations for poultry as the primary source of carbohydrates. High cost of these grains in many developing countries necessitates the evaluation of other ingredients that are grown locally. Sweet potato is one such crop. The study was conducted as a proof of concept experiment to test the hypothesis that in the presence and absence of enzyme, sweet potato roots when included in diets of broiler chickens may affect the total metabolisable energy content of the diets which may exert certain influences on dry matter digestibility of these diets as well as impacting on production and certain gut parameters. A total of 120 chicks were raised on a commercial starter feed from day 0 to 19. On day 22, the birds were individually weighed and allocated to 96 single bird metabolism cages to conduct a 7-day classical apparent metabolisable energy (AME) assay. The test diets contained 0% and 25% sweet potato flour (SPF) with and without enzyme supplementation (Rovabio Excel AP T-flex) and replicated 24 times. AME of the control diet with and without enzyme was 14.05 and 13.91 MJ/kg whilst the AME of the SPF diets with and without enzymes were 13.45 and 13.43 MJ/kg respectively. AME of SPF was 12.08 MJ/kg. Birds fed the SPF had significantly reduced end weights (p = .002) and weight gains (p < .001) leading to significantly higher intake (p = .004) and FCRs (p < .001) in birds. These effects in growth parameters highlight the need to balance dietary protein and total amino acids when using SPF in broiler diets and may not be a negative effect of SPF per say as AME and dry matter digestibility of SPF diets were comparable to the control diet. The level of sucrase activity in the jejunum was significantly (p < .001) lower due to enzyme inclusion. Use of SPF in the current study did not negatively influence the activities of the brush border enzymes maltase and sucrase, gut morphology in the jejunum of broilers or the load of Enterobacteriaceae in the caecal of birds. This finding is promising in that the gut parameters associated with digestive capacity and gut health were not compromised with feeding of SPF to broilers. © 2017 Blackwell Verlag GmbH.

  17. Physiological responses of sweet potato (Ipomoea batatas L. plants due to different copper concentrations

    Directory of Open Access Journals (Sweden)

    Cristina Copstein Cuchiara

    2015-12-01

    Full Text Available At low concentrations, Cu is considered as an essential micronutrient for plants and as a constituent and activator of several enzymes. However, when in excess, Cu can negatively affect plant growth and metabolism. Therefore, the aim of this study was to evaluate physiological responses of sweet potato plants at different Cu concentrations by measuring morphological parameters, antioxidant metabolism, stomatal characteristics, and mineral profile. For this purpose, sweet potato plants were grown hydroponically in complete nutrient solution for six days. Then, the plants were transferred to solutions containing different Cu concentrations, 0.041 (control, 0.082, and 0.164 mM, and maintained for nine days. The main effect of increased Cu concentration was observed in the roots. The sweet potato plants grown in 0.082 mM Cu solution showed increased activity of antioxidant enzymes and no changes in growth parameters. However, at a concentration of 0.164 mM, Cu was transported from the roots to the shoots. This concentration altered morpho-anatomical characteristics and activated the antioxidant system because of the stress generated by excess Cu. On the basis of the results, it can be concluded that the sweet potato plants were able to tolerate Cu toxicity until 0.082 mM.

  18. Genetic variability and evolutionary implications of RNA silencing suppressor genes in RNA1 of sweet potato chlorotic stunt virus isolates infecting sweetpotato and related wild species.

    Directory of Open Access Journals (Sweden)

    Arthur K Tugume

    Full Text Available BACKGROUND: The bipartite single-stranded RNA genome of Sweet potato chlorotic stunt virus (SPCSV, genus Crinivirus; Closteroviridae encodes a Class 1 RNase III (RNase3, a putative hydrophobic protein (p7 and a 22-kDa protein (p22 from genes located in RNA1. RNase3 and p22 suppress RNA silencing, the basal antiviral defence mechanism in plants. RNase3 is sufficient to render sweetpotato (Ipomoea batatas virus-susceptible and predisposes it to development of severe diseases following infection with unrelated virus. The incidence, strains and gene content of SPCSV infecting wild plant species have not been studied. METHODOLOGY/PRINCIPAL FINDINGS: Thirty SPCSV isolates were characterized from 10 wild Ipomoea species, Hewittia sublobata or Lepistemon owariensis (family Convolvulaceae in Uganda and compared with 34 local SPCSV isolates infecting sweetpotatoes. All isolates belonged to the East African (EA strain of SPCSV and contained RNase3 and p7, but p22 was not detected in six isolates. The three genes showed only limited genetic variability and the proteins were under purifying selection. SPCSV isolates lacking p22 synergized with Sweet potato feathery mottle virus (SPFMV, genus potyvirus; Potyviridae and caused severe symptoms in co-infected sweetpotato plants. One SPCSV isolate enhanced accumulation of SPFMV, but no severe symptoms developed. A new whitefly-transmitted virus (KML33b encoding an RNase3 homolog (<56% identity to SPCSV RNase3 able to suppresses sense-mediated RNA silencing was detected in I. sinensis. CONCLUSIONS/SIGNIFICANCE: SPCSV isolates infecting wild species and sweetpotato in Uganda were genetically undifferentiated, suggesting inter-species transmission of SPCSV. Most isolates in Uganda contained p22, unlike SPCSV isolates characterized from other countries and continents. Enhanced accumulation of SPFMV and increased disease severity were found to be uncoupled phenotypic outcomes of RNase3-mediated viral synergism in

  19. Recovering more than tree cover: herbivores and herbivory in a restored tropical dry forest.

    Directory of Open Access Journals (Sweden)

    Iris Juan-Baeza

    Full Text Available Intense and chronic disturbance may arrest natural succession, reduce environmental quality and lead to ecological interaction losses. Where natural succession does not occur, ecological restoration aims to accelerate this process. While plant establishment and diversity is promoted by restoration, few studies have evaluated the effect of restoration activities on ecological processes and animal diversity. This study assessed herbivory and lepidopteran diversity associated with two pioneer tree species growing in 4-year-old experimental restoration plots in a tropical dry forest at Sierra de Huautla, in Morelos, Mexico. The study was carried out during the rainy season of 2010 (July-October in eleven 50 x 50 m plots in three different habitats: cattle-excluded, cattle-excluded with restoration plantings, and cattle grazing plots. At the beginning of the rainy season, 10 juveniles of Heliocarpus pallidus (Malvaceae and Ipomoea pauciflora (Convolvulaceae were selected in each plot (N = 110 trees. Herbivory was measured in 10 leaves per plant at the end of the rainy season. To evaluate richness and abundance of lepidopteran larvae, all plants were surveyed monthly. Herbivory was similar among habitats and I. pauciflora showed a higher percentage of herbivory. A total of 868 lepidopteran larvae from 65 morphospecies were recorded. The family with the highest number of morphospecies (9 sp. was Geometridae, while the most abundant family was Saturnidae, with 427 individuals. Lepidopteran richness and abundance were significantly higher in H. pallidus than in I. pauciflora. Lepidopteran richness was significantly higher in the cattle-excluded plots, while abundance was significantly higher in the non-excluded plots. After four years of cattle exclusion and the establishment of plantings, lepidopteran richness increased 20 -fold in the excluded plots compared to the disturbed areas, whereas herbivory levels were equally high in both restored and

  20. Effect of crude plant extracts from some Oaxacan flora on two deleterious fungal phytopathogens and extract compatibility with a biofertilizer strain.

    Science.gov (United States)

    Lira-De León, Karla I; Ramírez-Mares, Marco V; Sánchez-López, Vladimir; Ramírez-Lepe, Mario; Salas-Coronado, Raúl; Santos-Sánchez, Norma F; Valadez-Blanco, Rogelio; Hernández-Carlos, Beatriz

    2014-01-01

    The antimicrobial activity of 12 plant extracts was tested against the phytopathogens Alternaria alternata and Fusarium solani. In addition, the compatibility of the extracts toward Bacillus liqueniformis, a biofertilizer and a non-target microorganism, was assessed. Plants tested belong to the Euphorbiaceae, Asteraceae, Crassulaceae, Rubiaceae, Convolvulaceae, Verbenaceae, Orchidaceae, Nyctaginaceae, Boraginaceae, and Tiliaceae families and were collected in the State of Oaxaca. The antifungal activity of the plant extracts (50-100 mg/mL) against A. alternata and F. solani, was determined by measuring the mycelium radial growth and obtaining the minimum inhibitory concentration (MIC) of fungal growth. In addition, with the aim of finding plant extracts which are compatible with a B. licheniformis biofertilizer strain and to test the non-toxic nature of the treatments, the toxicity of the extracts toward this strain was evaluated using the agar diffusion method. Azoxystrobin (12 μg) and chloramphenicol (30 μg) were used as positive controls for the pathogens and for the non-target bacteria, respectively. Plant extracts inhibited fungal growth in the ranges of 0.76-56.17% against F. solani and 2.02-69.07% against A. alternata. The extracts of Acalypha subviscida, Ipomoea murucoides, Tournefortia densiflora and Lantana achyranthifolia showed MIC values between 5.77-12.5 mg/mL for at least one of the fungal species. The best treatment, Adenophyllum aurantium, exhibited a maximum inhibition for both F. solani (56.17%, MIC = 7.78 mg/mL) and A. alternata (68.64% MIC = 7.78 mg/mL), and resulted innocuous toward B. licheniformis. Therefore, this plant has an outstanding potential for the agroecological control of fungal phytopathogens in industrial crops.

  1. Snakebites and ethnobotany in the northwest region of Colombia. Part III: neutralization of the haemorrhagic effect of Bothrops atrox venom.

    Science.gov (United States)

    Otero, R; Núñez, V; Barona, J; Fonnegra, R; Jiménez, S L; Osorio, R G; Saldarriaga, M; Díaz, A

    2000-11-01

    Thirty-one of 75 extracts of plants used by traditional healers for snakebites, had moderate or high neutralizing ability against the haemorrhagic effect of Bothrops atrox venom from Antioquia and Chocó, north-western Colombia. After preincubation of several doses of every extract (7.8-4000 microg/mouse) with six minimum haemorrhagic doses (10 microg) of venom, 12 of them demonstrated 100% neutralizing capacity when the mixture was i.d. injected into mice (18-20 g). These were the stem barks of Brownea rosademonte (Caesalpiniaceae) and Tabebuia rosea (Bignoniaceae); the whole plants of Pleopeltis percussa (Polypodiaceae), Trichomanes elegans (Hymenophyllaceae) and Senna dariensis (Caesalpiniaceae); rhizomes of Heliconia curtispatha (Heliconiaceae); leaves and branches of Bixa orellana (Bixaceae), Philodendron tripartitum (Araceae), Struthanthus orbicularis (Loranthaceae) and Gonzalagunia panamensis (Rubiaceae); the ripe fruits of Citrus limon (Rutaceae); leaves, branches and stem of Ficus nymphaeifolia (Moraceae). Extracts of another 19 species showed moderate neutralization (21-72%) at doses up to 4 mg/mouse, e.g. the whole plants of Aristolochia grandiflora (Aristolochiaceae), Columnea kalbreyeriana (Gesneriaceae), Sida acuta (Malvaceae), Selaginella articulata (Selaginellaceae) and Pseudoelephantopus spicatus (Asteraceae); rhizomes of Renealmia alpinia (Zingiberaceae); the stem of Strychnos xinguensis (Loganiaceae); leaves, branches and stems of Hyptis capitata (Lamiaceae), Ipomoea cairica (Convolvulaceae), Neurolaena lobata (Asteraceae), Ocimum micranthum (Lamiaceae), Piper pulchrum (Piperaceae), Siparuna thecaphora (Monimiaceae), Castilla elastica (Moraceae) and Allamanda cathartica (Apocynaceae); the macerated ripe fruits of Capsicum frutescens (Solanaceae); the unripe fruits of Crescentia cujete (Bignoniaceae); leaves and branches of Piper arboreum (Piperaceae) and Passiflora quadrangularis (Passifloraceae). When the extracts were independently administered

  2. Screening for sweet potato (Ipomoea batatas (L.)) viruses and their elimination using thermotheraphy-meristem tip culture technique

    International Nuclear Information System (INIS)

    Arkorful, E.

    2012-11-01

    Despite its high potential for food security, production of sweet potato is constrained by viruses which reduce yield by 90%. It is therefore essential to screen for, identify and eliminate these viruses in elite clones before dissemination to farmers. In this study, visual symptomatology and PCR-based techniques were used to identify sweet potato viruses. Visual symptomatology revealed virus associated symptoms ranging from vein clearing, interveinal chlorosis, chlorotic spots, upward curling on leaf edges, leaf narrowing and distortion, purpling, blistering, reduction of the leaf blades and general leaf yellowing in all 22 accessions grown on the field. Disease Incidence (DI) significantly (p≤0.05) varied between accessions with US003 having the lowest (20%) while ten accessions had 90% DI at the end of the study. Index of symptom severity of all plants (ISSap) ranged from 1.08±0.09 to 3.67 ±0.11 with VOTCR003 having the lowest suggesting that it is a moderately susceptible accession while VOTCR002 had the highest suggesting that it is susceptible to viral diseases. Contrarily, index of symptom severity of diseased plants (ISSdp) ranged from 2.00±0.25 to 3.75±0.32. The accession VOTCR002 had the highest ISSdp. Visual symptomatology showed that VOTCR002 had the highest DI, ISSap and ISSdp suggesting that it is highly susceptible to viral diseases. Ten severely infected accessions were tested for Sweet Potato leaf curl virus (SPLCV), Sweet Potato chlorotic stunt virus (SPCSV), Sweet potato feathery mottle virus (SPFMV) and Sweet Potato mild mottle virus (SPMMV) using PCR and RT-PCR techniques. RT-PCR did not amplify any of the virus genomes due to prolonged storage enzymes, In contrast, PCR detected SPLCV in 30% of the accessions. Plants infected with SPLCV were grown in the chamber at 35 degrees celsius for 4 weeks followed by meristem top culture. The regenerants were indexed after ten weeks for SPLCV. Fifty two percent (52.385 od the regenerants were successfully cleaned of the virus and these are being multiplied for farmers. Virus indexing will enhance the dissemination of disease-free plants to farmers. [au

  3. Comparative analysis of phytochemicals and nutrient availability in two contrasting cultivars of sweet potato (Ipomoea batatas L.).

    Science.gov (United States)

    Shekhar, Shubhendu; Mishra, Divya; Buragohain, Alak Kumar; Chakraborty, Subhra; Chakraborty, Niranjan

    2015-04-15

    Sweet potato ranks as the world's seventh most important food crop, and has major contribution to energy and phytochemical source of nutrition. To unravel the molecular basis for differential nutrient availability, and to exploit the natural genetic variation(s) of sweet potato, a series of physiochemical and proteomics experiment was conducted using two contrasting cultivars, an orange-fleshed sweet potato (OFSP) and a white-fleshed sweet potato (WFSP). Phytochemical screening revealed high percentage of carbohydrate, reducing sugar and phenolics in WFSP, whereas OFSP showed increased levels of total protein, flavonoids, anthocyanins, and carotenoids. The rate of starch and cellulose degradation was found to be less in OFSP during storage, indicating tight regulation of gene(s) responsible for starch-degradation. Comparative proteomics displayed a cultivar-dependent expression of proteins along with evolutionarily conserved proteins. These results suggest that cultivar-specific expression of proteins and/or their interacting partners might play a crucial role for nutrient acquisition in sweet potato. Copyright © 2014 Elsevier Ltd. All rights reserved.

  4. Effect of gamma radiation on different explants of sweet potato (Ipomoea batatas L. (Lam)) to induce NaCl tolerance

    International Nuclear Information System (INIS)

    Gutierrez-Rosati, A.

    1997-01-01

    Clonal lines tolerant to NaCl were obtained by combining in vitro culture and gamma radiation in two Peruvian varieties 'Amarillo de Quillabamba' and 'Nemanete'. The most suitable explants were pedicel sections and leaf blades. Embryogenic callus was induced on basal MS basal medium containing 0.5 ppm 2,4-D. The embryogenic calli were irradiated with 5 Gy from a 137 Cs source. Several putative mutants appeared to be stable. (author). 9 refs, 3 tabs

  5. Effect of genotype, gelling agent, and auxin on the induction of somatic embryogenesis in sweet potato (Ipomoea batatas Lam.).

    Science.gov (United States)

    El Abidine Triqui, Zine; Guédira, Abdelkarim; Chlyah, Averil; Chlyah, Hassane; Souvannavong, Vongthip; Haïcour, Robert; Sihachakr, Darasinh

    2008-03-01

    Lateral buds of six cultivars of sweet potato were induced to form embryogenic callus in a culture medium solidified with two types of gelling agents, Agar or Gelrite, and supplemented with various concentrations of auxins, 2,4-D, 2,4,5-T and Picloram. Of the six cultivars screened, only three gave an embryogenic response. Best results with an average of 3.53% embryogenic response were obtained with the medium solidified with Agar, while in Gelrite only 0.45% of lateral buds gave rise to embryogenic callus. The interaction between the genotype and auxins was highly significant; particularly the optimal response was obtained with cv. Zho and 865 yielding 10.7 and 14.7% somatic embryogenesis, respectively, in the medium containing 2,4,5-T or Picloram. The plant conversion was dramatically improved by subculture of the embryogenic callus on the medium with the combination of 1 microM 2,4-D and 1 microM Kinetin or 5 microM ABA alone before transfer of mature embryos onto hormone-free medium. The embryogenic callus of sweet potato and its sustained ability to further regenerate plants have regularly been maintained for several years by frequent subculture in 5 microM 2,4,5-T or the combination of 10 microM 2,4-D and 1 microM BAP or kinetin. The embryo-derived plants seemed apparently genetically stable and similar to the hexaploid parental plants, based on morphological analysis and their ploidy level determined by using flow cytometry.

  6. Efeitos embriotóxicos do tratamento pré-natal com extrato aquoso de Ipomoea carnea em ratos

    Directory of Open Access Journals (Sweden)

    Rosana Zoriki Hosomi

    2008-02-01

    Full Text Available Os efeitos embriotóxicos da exposição diária pré-natal a 0,0, 0,7, 3,0 ou 15,0mg/kg do extrato aquoso da I. carnea nos dias 5 a 21 de gestação foram estudados. Foram avaliados a performance reprodutiva materna, anormalidades esqueléticas e viscerais e malformações. Além disso, após o tratamento foram encontrados achados anatomopatológicos. Em relação às ratas mães, nossos resultados mostraram que a exposição às diferentes doses não afetou o peso corporal, ganho de peso, consumos de água e ração e performance reprodutiva. Apesar disso, apresentaram vacuolização citoplasmática de forma dose-dependente em fígado, rins, tireóide e glândula adrenal. Exames fetais não mostraram anormalidades externas ou malformações, sendo somente encontradas evidências de anormalidades esqueléticas e viscerais após altas doses do extrato. Foi observada redução dos centros de ossificação. Os presentes dados mostram que a ingestão prenatal do extrato de I. carnea induz embriotoxicidade. Estes efeitos são atribuídos à ação na homeostase maternal ou diretamente na concepção.

  7. IPOMOEA BATATAS SYRUP DECREASE MALONDIALDEHYDE AND INCREASE NITROUS OXIDE PLASMA LEVELS AMONGST MODERATE SMOKER WORKERS AT DENPASAR

    Directory of Open Access Journals (Sweden)

    I Dewa Ayu Intan Dwi-Primayanti

    2012-09-01

    Full Text Available Objective: Cells and tissues are continuously damaged by reactive oxygen species. Cigarette smoke is one of an exogenous source of free radical containing more than 4000 chemical compounds, that triggering the formation of free radicals related to diseases and aging process. Anthocyanins are potent antioxidants that are widely distributed in fruit, vegetables, red wines and Ipomea batatas. The aim of this study was to determine the effect of Ipomea batatas as a source of antioxidants in decreasing levels of alondialdehyde (MDA and increasing of Nitrous oxide (nitrite/nitrate/NOxplasma in moderate smokers of workers at Denpasar.Method: This was an experimental study with a pretest-posttest control groups design. There are 33 moderate smokers who were divided into three groups, control group (placebo, treatment group with 15 ml purple sweet potato syrup (P1 and 30 ml (P2, for 14 days. All groups were performed the laboratory examinations for MDA and NOx plasma before and after the treatment.Results: This study showed that there were significant differences (p<0.05 both in MDA and NOx plasma levels in the control group, P1 and P2. The decrease of MDAlevels on P1 was 35.39% and on P2 was 49.87%. The increase of NOx plasma levels was 7.78% for P1 and 14.68% for P2.Conclusion: From this study, it can be concluded that Ipomea batatas syrup contains of 8mg/mL anthocyanins, probably play a role in reducing the free radical and thus reducingthe risk of disease and slowing the aging process.

  8. Improvement of sperm density in neem-oil induced infertile male albino rats by Ipomoea digitata Linn.

    Directory of Open Access Journals (Sweden)

    Ghanashyam Keshav Mahajan

    2015-06-01

    Full Text Available Aim: Investigation has been carried out to validate folkloric claim of the potential of ID based on reproductive health status in experimentally induced male albino rats. Materials and Methods: Emulsified neem oil (ENO fed albino rats were orally administered root powder of ID suspended in water for the doses of 250 and 500 mg/kg body weight for 40 days. Change in organ weight, sperm density and motility, serum hormonal levels and histomorphological changes were evaluated. Results: Significant increase in the sperm density and the sperm motility (P< 0.01 along with increase in the testis, and epididymes weight in neem-oil induced infertile rats treated with ID at both dose levels. This effect is vis- and agrave;-vis to serum hormonal levels. Presence of beta-sitosterol in the root of ID likely to enhance the process of spermatogenesis as it is evident from histomorphological studies. Conclusion: Results of the present investigation reveal that ID is a good candidate for the management of male infertility. [J Intercult Ethnopharmacol 2015; 4(2.000: 125-128

  9. Adaptation to mid-season drought in a sweetpotato (Ipomoea batatas [L.] Lam germplasm collection grown in Mozambique

    Directory of Open Access Journals (Sweden)

    Makunde Godwill S.

    2017-02-01

    Full Text Available Drought has negative effects on sweetpotato production. Two experiments with two watering treatments (irrigated and water-stressed were conducted at Umbeluzi Research Station in 2015. The objectives were to (i determine response of 48 sweetpotato germplasms to mid-season drought, (ii determine best traits for improvement of storage root yield under mid-season drought and (iii assess the selection criteria for identifying drought tolerance in sweetpotato germplasms. The irrigated and water- stressed trials received 640 and 400 mm of water, respectively, throughout the season. Water stress was imposed from 30 to 70 days after planting. Each treatment had two replicates arranged in a randomized complete block design. Data collected on storage root and vine yield and derived drought tolerance indices including harvest index were subjected to analysis of variance in R. Sweetpotato germplasms with high storage root yield under mid-season drought were associated with a high harvest index. Harvest index stability and the geometric mean are key to identifying cultivars with high and stable storage root yield under both treatments. MUSGP0646-126, Irene and Ivone combined both low TOL, SSI, HI and high yield storage root yield across the treatments and over seasons. The use of drought and harvest indices is encouraged for selecting improved cultivars for varied production environments and their regular use in accelerated breeding schemes is suggested.

  10. Antioxidant activity, phenolic and flavonoids total of ethanolic extract of Ipomoea batata L. leaves (white, yellow, orange, and purple)

    Science.gov (United States)

    Dewijanti, Indah Dwiatmi; Banjarnahor, Sofna D.; Triyuliani, Maryani, Faiza; Meilawati, Lia

    2017-11-01

    Antioxidant activity, phenolic and total flavonoids from sweet potato ethanol extract (Ipomea batatas L.) of different varieties (white, yellow, orange and purple) were studied. Sweet potatoes were collected from Research Centre for Chemistry. Sweet potato leaves have been used for numerous oxidative-associated diseases such as cancer, allergy, aging, HIV and cardiovascular. 1,1-diphenyl-2-picryl hydrazyl (DPPH) method was used to investigate antioxidant activity in leaves, in which the yellow and purple varieties showed the highest and the lowest scavenging activities of 47.65 µg/ ml (IC50) and 87.402 µg/ ml (IC50), respectively. In this study, the yellow leaves showed the highest concentrations of total phenolic and flavonoids contents at 11.293 µg/g and 44.963 µg/g, respectively. Therefore, sweet potato leaves can be used as a prospective natural antioxidant.

  11. Effect of gamma radiation on different explants of sweet potato (Ipomoea batatas L. (Lam)) to induce NaCl tolerance

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez-Rosati, A [Biology Dept., National Agriculture Univ., La Molina, Lima (Peru)

    1997-07-01

    Clonal lines tolerant to NaCl were obtained by combining in vitro culture and gamma radiation in two Peruvian varieties `Amarillo de Quillabamba` and `Nemanete`. The most suitable explants were pedicel sections and leaf blades. Embryogenic callus was induced on basal MS basal medium containing 0.5 ppm 2,4-D. The embryogenic calli were irradiated with 5 Gy from a {sup 137}Cs source. Several putative mutants appeared to be stable. (author). 9 refs, 3 tabs.

  12. Characterization and hepatoprotective activity of anthocyanins from purple sweet potato (Ipomoea batatas L. cultivar Eshu No. 8

    Directory of Open Access Journals (Sweden)

    Lin Wang

    2017-07-01

    Full Text Available The hepatoprotective activity of anthocyanin-rich purple sweet potato extract (APSPE was demonstrated. Sixty mice were randomly divided into six groups: control group [without carbon tetrachloride (CCl4 or APSPE]; model group (with CCl4 only; positive control group (50 mg/kg body weight silymarin; low-dose group (100 mg/kg body weight APSPE; medium-dose group (200 mg/kg body weight APSPE; and high-dose group (400 mg/kg body weight APSPE. After 10 days intragastric administration of the respective supplements, the mice in all groups except control were injected intraperitoneally with CCl4 (0.15% in arachis oil, 10 mL/kg body weight, intravenous. Twelve hours after CCl4 injection, the mice were measured in terms of liver index, levels of aspartate aminotransferase and alanine aminotransferase in serum, as well as glutathione, superoxide dismutase, and malondialdehyde in liver homogenate. Additionally, the livers of mice were stained with hematoxylin and eosin and sectioned for observation. Nineteen purple sweet potato anthocyanins were identified from the purple sweet potato cultivar Eshu No. 8 and analyzed by liquid chromatography– electrospray ionization–tandem mass spectrometry. Peonidin 3-coumaryl-p-hydroxybenzoyl sophoroside-5-glucoside was first identified in purple sweet potato. The results showed that anthocyanins in Eshu No. 8 had good hepatoprotective activity.

  13. The Effect of Seed Soaking with Rhizobacteria Pseudomonas alcaligenes on the Growth of Swamp Cabbage (Ipomoea reptans Poir)

    Science.gov (United States)

    Widnyana, I. K.; Ngga, M.; Sapanca, P. L. Y.

    2018-01-01

    The research was conducted to determine the effect of seed soaking with suspense of P. alcaligenes isolate KtSl, TrN2, and TmAl to the growth of swamp cabbage. The research has been initially developed on tomatoes. In this research, Randomized Block Design was chosen as its model while the data analysis was performed by using SPSS v.17 for Windows. Three types of treatment were administered towards P. alcaligenes, namely isolating, soaking, and growing the medium. Some observed parameters were germination and growth. The results showed that seed soaking treatments with suspense P. alcaligenes fostered the germination 25% faster, enhanced the crop up to 24.4%, increased the number of leaves up until 23.15%, lengthen stems to 25%, lengthen the roots up to 46.90%, and increase the fresh weight of stems up until 67.07% and oven-dry weight of stem up to 84.21% compared to the control treatment. The best response of treatment for germination speed was soaking seeds with P. alcaligenes TrN2 for 20 minutes on both NB (Natrium Broth) and PDB (Potato Dextrose Broth) media.

  14. Orange-fleshed sweet potato (Ipomoea batatas) composite bread as a significant source of dietary vitamin A.

    Science.gov (United States)

    Awuni, Victoria; Alhassan, Martha Wunnam; Amagloh, Francis Kweku

    2018-01-01

    Refining food recipes with orange-fleshed sweet potato (OFSP) has the potential to improve dietary intake of vitamin A. The objectives of this study were to utilize OFSP in the development of two composite bread types and to assess their contribution to dietary intake of vitamin A using the dietary reference intake of lactating mothers. Two composite OFSP-wheat flour bread recipes-vita butter bread and vita tea bread-were developed by incorporating 46% OFSP puree in existing 100% wheat flour bread recipes consumed by Ghanaians. A paired-preference test was used to profile the appearance, aroma, sweetness, and overall degree of liking of the vita butter bread and vita tea bread and their respective 100% wheat flour bread types. Weighed bread intake by lactating mothers ( n  =   50) was used to estimate the contribution to dietary vitamin A based on the trans β-carotene content. The developed vita butter bread and vita tea bread were most preferred by at least 77% ( p  bread was 247 g, and for vita tea bread was 196 g. The trans β-carotene content of vita butter bread and vita tea bread were found to be 1.333 mg/100 g and 0.985 mg/100 g, respectively. The estimated trans-β-carotene intake was 3,293 μg/day (vita butter) and 1,931 μg/day (vita tea) based on the weighed bread intake, respectively, meeting 21% and 12% of the daily requirement (1,300 μg RAE/day) for lactating mothers, the life stage group with the highest vitamin A requirement. OFSP therefore could composite wheat flour to bake butter and tea bread, and will contribute to significant amount of dietary intake of vitamin A.

  15. Orange‐fleshed sweet potato (Ipomoea batatas) composite bread as a significant source of dietary vitamin A

    OpenAIRE

    Awuni, Victoria; Alhassan, Martha Wunnam; Amagloh, Francis Kweku

    2017-01-01

    Abstract Refining food recipes with orange‐fleshed sweet potato (OFSP) has the potential to improve dietary intake of vitamin A. The objectives of this study were to utilize OFSP in the development of two composite bread types and to assess their contribution to dietary intake of vitamin A using the dietary reference intake of lactating mothers. Two composite OFSP–wheat flour bread recipes—vita butter bread and vita tea bread—were developed by incorporating 46% OFSP puree in existing 100% whe...

  16. Keamanan Pemberian Berulang Ekstrak Kangkung Darat (Ipomoea Reptans,poir) Terstandar Terhadap Fungsi Ginjal Dan Hepar Mencit Betina

    OpenAIRE

    Hayati, Farida; Murwanti, Retno; Zabrina, Ginna

    2013-01-01

    Kangkung darat terbukti memiliki aktifitas antihiperglikemia pada mencit betina galur Swiss yang diinduksi streptozotosin. Penelitian ini dilakukan untuk mendapatkan kajian keamanan pemberian berulang ekstrak kangkung darat terstandar terhadap fungsi ginjal dan hepar pada mencit betina. Dua puluh hewan uji dibagi ke dalam 4 kelompok, yaitu kelompok kontrol (akuades 10 ml/ kg), dosis I (ekstrak etanolik kangkung darat 480 mg/ kg), dosis II (ekstrak etanolik kangkung darat 759 mg/ kg), dan dos...

  17. PENGARUH PEMBERIAN PUPUK ORGANIK PADA MEDIA TANAH YANG MENGANDUNG TIMBAL (Pb TERHADAP PERTUMBUHAN KANGKUNG DARAT (Ipomoea reptans Poir.

    Directory of Open Access Journals (Sweden)

    Listiatie Budi Utami

    2016-06-01

    pupuk organik dengan dosis 0 gram, 50 gram, 100 gram, 150 gram, 200 gram, dan 250 gram dalam 2 kg tanah dari TPA Piyungan, Bantul. Setiap perlakuan diulang 4 kali dan dilakukan selama 4 minggu. Pengamatan meliputi tinggi tanaman, jumlah daun, panjang daun, panjang akar, dan berat basah tanaman. Pada minggu ke-4, dilakukan pengukuran kadar timbal (Pb dalam daun. Dilakukan uji ANOVA dan BNT 5%. Hasil penelitian menunjukkan bahwa pemberian pupuk organik dapat meningkatkan pertumbuhan tanaman kangkung darat. Dosis yang paling efektif untuk pertumbuhan tanaman kangkung darat adalah 200 gram dalam 2 kg tanah. Pemberian pupuk organik tidak dapat menurunkan kandungan Pb dalam tanaman kangkung darat.

  18. Differences in morphology and sugar content of purple sweet potato (Ipomoea batatas L.) with potassium treatment at several altitudes

    Science.gov (United States)

    Sulistiani, R.; Rosmayati; Siregar, L. A. M.; Harahap, F.

    2018-02-01

    This research was conducted at three locations in low, medium and high plains. This study was aimed to determine the morphological changes and sugar content of sweet potato caused by potassium dose treatment and climate change. Data was analyzed by factorial randomized block design in time series with two factors. The first factor was Altitude: A1 (50 meter above sea level (MASL)), A2 (750 MASL) and A3 (1450 MASL). The second factor was Potassium: K0 (0 kg/ha), K1 (50 kg/ha), K2 (100 kg/ha) and K3 (150 kg/ha). The data of plant morphology change and sugar content was descriptively analized, while agronomic and harvest component data analysis by F test and continued with Duncan Multiple Range Test. The results of morphological observations showed different types of plant growth, which in the lowlands and medium plant growth types spread, twisted, more branches, wider leaf area. However, the plateau of plant growth was relatively dwarf, erect, no twist, huddled and short rods and small leaf area. The tuber weight per plant, number of tuber yield and tuber weight per plot in high altitude were significantly higher than lowland and medium. Similarly, increased altitude will be increased the sugar content significantly.

  19. Rapid quantitative determination of maltose and total sugars in sweet potato (Ipomoea batatas L. [Lam.]) varieties using HPTLC.

    Science.gov (United States)

    Lebot, Vincent

    2017-03-01

    When a raw sweet potato root is analysed, only sucrose, glucose and fructose are present but during cooking, starch is hydrolysed into maltose giving the sweet flavour to cooked roots. This study aimed at developing an HPTLC protocol for the rapid quantitative determination of maltose and total sugars in four commercial varieties and to compare them to 243 hybrids grouped by flesh colour (white, orange, purple). In commercial varieties, mean maltose content varied from 10.26 to 15.60% and total sugars from 17.83 to 27.77% on fresh weight basis. Hybrids showed significant variation in maltose content within each group, with means ranging from 7.65% for white-fleshed, to 8.53% in orange- and 11.98% in purple-fleshed. Total mean sugars content was 20.24, 22.11 and 26.84% respectively for white, orange and purple flesh hybrids. No significant correlations were detected between individual sugars but maltose and total sugars content were highly correlated. Compared to the best commercial variety ( Baby ), 25 hybrids (10.3%) presented a higher maltose content and 40 (16.5%) showed a higher total sugars content. HPTLC was observed as an attractive, cost efficient, high-throughput technique for quantitating maltose and total sugars in sweet potatoes. Perspectives for improving sweet potato quality for consumers' requirements are also discussed.

  20. A comparative metabolomics study of flavonoids in sweet potato with different flesh colors (Ipomoea batatas (L.) Lam).

    Science.gov (United States)

    Wang, Aimin; Li, Rensai; Ren, Lei; Gao, Xiali; Zhang, Yungang; Ma, Zhimin; Ma, Daifu; Luo, Yonghai

    2018-09-15

    To study the diversity and cultivar-specific of phytochemicals in sweet potato, Liquid Chromatography-Electrospray Ionization-Mass Spectrometry was used to analyze the metabolic profiles of five sweet potato cultivars exhibiting different flesh colors: purple, yellow/orange, and white. A total of 213 metabolites, including 29 flavonoids and 27 phenolic acids, were characterized. The flavonoid profiles of the five different cultivars were distinguished using PCA, the results suggested the flesh color accounted for the observed metabolic differences. In addition to anthocyanins, quinic acids and ferulic acids were the prominent phenolic acids, O-hexoside of quercetin, chrysoeriol were the prominent flavonoids in sweet potato tubers, and they were all higher in the OFSP and PFSP than WFSP. The main differential metabolic pathways between the OFSP, PFSP and the WFSP included those relating to phenylpropanoid and flavonoid biosynthesis. This study provides new insights into the differences in metabolite profiles among sweet potatoes with different flesh colors. Copyright © 2018 Elsevier Ltd. All rights reserved.

  1. Fungos micorrízicos vesículo-arbusculares em rizosferas de plantas em dunas do Parque Estadual da Ilha do Cardoso, São Paulo, Brasil: (1 Taxonomia Vesicular-arbuscular mycorrhizal fungi from rhizospheres of dunes plants of Parque Estadual da Ilha do Cardoso, São Paulo State, Brazil (1: taxonomy

    Directory of Open Access Journals (Sweden)

    S. F. B Trufem

    1989-01-01

    . (Legumiosae, Hydrocotyle bonariensis Lam. (Umbelliferae, Ipomoea pes-caprae (L. Sweet (Convolvulaceae, Polygala cyparisseas St. Hill & Moq. (Polygalaceae; Gramineae, Cyperaceae and other plants were occasionaly collected. The soil was prepared according the wet sieving and decanting technique. It was observed the following 14 taxa of VA M fungüs: Acaulospora scrobiculata Trappe, Acaulospora tuberculata Janos & Trappe, Gigaspora gigantea (Nicol. & Gerd Gerd & Trappe, Glomus fasciculatum (Thaxter Gerd. & Trappe emend. Walker & Koske, Glomus globiferum Koske & Walker, Glomus monosporum Gerd. & Trappe, Sclerocystís sinuosa Gerd. & Bakshi, Scutellospora calospora (Nicol. & Gerd. Walker & Sanders, Scutellospora collaroidea (Trappe, Gerd. & Ho Walker & Sanders, Scutellospora gilmorei (Trappe & Gerd. Walker & Sanders, Scutellospora gregaria (Schénck & Nicol. Walker & Sanders, Scutellospora pérsica (Koske & Walker Walker & Sanders, Scutellospora verrucosa (Koske & Walker Walker & Sanders and Scutellospora sp. Are presented taxonomical, coments and muronyms of the studied taxa.

  2. Sugarcane crop residue and bagasse allelopathic impact on oat (Avena sative L.), morningglory (Ipomoea purpurea L.), and redroot pigweed (Amaranthus retroflexus L.) germination

    Science.gov (United States)

    Allelopathy, the chemical interaction between plants, may result in the inhibition of plant growth and development, and can include compounds released from a crop that adversely impact crop or weed species. The objective of this research was to determine the allelopathic impact of sugarcane (Sacchar...

  3. Caracterización postcosecha y composición química de la batata (Ipomoea batatas (L. Lamb. variedad Topera.

    Directory of Open Access Journals (Sweden)

    Auris Damely García-Méndez

    2016-06-01

    Full Text Available El objetivo de este trabajo fue caracterizar la composición química y calidad postcosecha de la batata variedad Topera proveniente de una producción semi-mecanizada con buenas prácticas agrícolas (BPA. El estudio se realizó en el Laboratorio de Procesamiento Primario de Productos Agrícolas y Bioquímica de Alimentos de la Facultad de Agronomía (FAGRO de la Universidad Central de Venezuela (UCV durante el año 2014. La metodología permitió determinar algunas características físicas, texturales y composición química por los métodos de AOAC (Association of Official Analytical Chemists. Se obtuvieron batatas con un menor coeficiente de variabilidad en el peso (CV: 20,12%, forma (CV: 5,63% y tamaño (CV: 12,80%. Esta respuesta permitió establecer tres categorías de calidad con una baja incidencia de defectos (2,15% y daños físico-mecánicos (30,25%, esta última asociada a la alta resistencia del material (6,25+0,05 kgf/mm. Las batatas presentaron contenidos de azúcares reductores de 9,88%, fibra de 6,19% y proteína de 4,13%; estas características nutricionales sugieren su uso como suplemento alimenticio. La producción semi-mecanizada con la implementación de las técnicas de las BPA, permitió obtener batatas con características de importancia para la agroindustria procesadora de alimentos IV Gama y, a nivel del consumidor, con una calidad física homogénea.

  4. Eradication programs of two sweetpotato [Ipomoea batatas] pests, Cylas formicarius and Euscepes postfasciatus, in Japan with special reference to their dispersal ability

    International Nuclear Information System (INIS)

    Moriya, S.; Miyatake, T.

    2001-01-01

    Eradication programs are being implemented for 2 sweetpotato weevil pests, Cylas formicarius and Euscepes postfasciatus, in the Ryiikyu Islands located in the southernmost part of Japan by the application of the sterile insect technique (SIT). As it is essential for the implementation of the programs to assess the dispersal ability of the weevils, recent studies were reviewed. Both the flight and walking ability of C. formicarius was much higher in males than in females when determined in the laboratory. Synthesized sex pheromone of C. formicarius has been used as a strong lure to capture the males in the field. Results of the mark-recapture experiments suggest that a distance of at least 2 km is needed for the range of the buffer zone to separate the SIT target area from others. Since E. postfasciatus is unable to fly, only the walking ability was evaluated in the laboratory, indicating that the females exhibited a fairly higher locomotion activity compared with the males. Since no effective attractant for E. postfasciatus has been identified yet, information on the dispersal activity in the field is limited. Fundamental studies should be conducted to determine the dispersal ability of both weevil pests to implement successfully the eradication programs

  5. Ocorrência da broca do coleto (Megastes spp. no banco de germoplasma de batata-doce (Ipomoea batatas (L. Lam do SMGP-CECA/UFAL

    Directory of Open Access Journals (Sweden)

    Jair Tenório Cavalcante

    2013-09-01

    Full Text Available O presente trabalho teve como objetivo avaliar a ocorrência da Broca do Coleto (Megastes spp. no banco de germoplasma de batata doce (Ipomea batatas (L.Lam.  do Setor de Melhoramento Genético de Plantas do Centro de Ciências Agrárias da Universidade Federal de Alagoas (SMPG/CECA/UFAL, no município de Rio Largo – AL, no ano de 2011. Utilizou-se o delineamento inteiramente casualizado com 14 tratamentos, em duas épocas de plantio (estação chuvosa e estação seca e com cinco avaliações (aos 30, 45, 60, 75 e 90 dias após o plantio - DAP. Os genótipos avaliados foram: 12 clones obtidos pelo SMGP e duas variedades: Sergipana e Rainha de Penedo. As avaliações foram realizadas após o trigésimo dia do plantio através de escala de notas segundo a metodologia idealizada por Azevedo et. al., (1996. Os resultados permitiram concluir que há um ataque mais intenso da broca durante a época estação seca, a maior ocorrência aos 90 dias após o plantio, certamente não causará redução significativa na produção de raízes tuberosas, pois nesta fase a cultura praticamente já se encontra em condições de colheita. Os clones 2, 4, 6 e 14 e as variedades Sergipana e Rainha de Penedo, são de grande valia para o programa de melhoramento genético da cultura da batata-doce. 

  6. Simulation of transient heat transfer during cooling and heating of whole sweet potato (Ipomoea batatas (L.) Lam.) roots under forced-air conditions

    International Nuclear Information System (INIS)

    Korese, Joseph Kudadam; Sturm, Barbara; Román, Franz; Hensel, Oliver

    2017-01-01

    Highlights: • Heat transfer of whole sweet potato roots under forced-air cooling and heating is investigated. • Experiments were carried out in a cooling and heating chamber. • The cooling and heating rate and time was clearly depended on air velocity and roots size. • Simulated and experimental data on cooling and heating times were compared for validation. • Simulation results quantitatively agreed with experimental results. - Abstract: In this work, we investigated how different air velocity and temperature affect the cooling and heating rate and time of individual sweet potato roots. Additionally, we modified and applied a simulation model which is based on the fundamental solution of the transient equations for estimating the cooling and heating time at the centre of sweet potato roots. The model was adapted to receive input parameters such as thermo-physical properties of whole sweet potato roots as well as the surrounding air properties, and was verified with experimental transient temperature data. The experimental results showed that the temperature at the centre and the under skin of sweet potato roots is almost homogeneous during forced convection cooling and heating. The cooling and heating time was significantly (P < 0.05) affected by high air velocity and sweet potato root size. The simulation results quantitatively agreed with the experimental transient data. This research, thus provides a reliable experimental and theoretical basis for understanding the temperature variations as well as estimating the cooling and heating times in individual sweet potato roots under forced convection cooling and heating. The result from this study could be applied to design and optimize forced-air treatment equipments with improved energy efficiency as well as ensuring safety and the maintenance of sweet potato roots quality.

  7. Effect of including sweet potato (Ipomoea batatas Lam) meal in finishing pig diets on growth performance, carcass traits and pork quality.

    Science.gov (United States)

    Pietrosemoli, Silvana; Moron-Fuenmayor, Oneida Elizabeth; Paez, Angel; Villamide, Maria Jesús

    2016-10-01

    The partial replacement of a commercial concentrate at 10-20% and 15-30% (the first percentage of each dietary treatment corresponded to weeks 1-3 and the second to weeks 4-7 of the experiment, respectively) by sweet potato meal (SPM; 70% foliage: 30% roots) was evaluated for growth performance, carcass yield, instrumental and sensory pork quality using 36 commercial crossbred pigs (56.8 ± 1.3 kg initial body weight). Three dietary treatments were compared in a randomized complete block design. Most growth, carcass traits and pork quality variables were not affected by the SPM inclusion. Growth performance averaged 868 g/day and feed efficiency 0.24 kg/kg. However, feed intake increased 2.2% (P = 0.04) in pigs fed the 10-20% SPM diets, in a similar order of magnitude as the decrease in dietary energy. Despite an increase in gastrointestinal tract as a percent of hot carcass weight (+14.7%) (P = 0.03) with SPM inclusion, carcass yield averaged 69.4%. Conversely, decreases in loin yield (-4.2%) (P = 0.05), backfat thickness (-6.0%) (P < 0.01) and pork tenderness (-13%) (P = 0.02) were observed with 15-30% SPM inclusion. Results suggest that up to 20% SPM inclusion is a viable feed strategy for finishing pigs, easily replicable in small farm settings. © 2016 Japanese Society of Animal Science. © 2016 Japanese Society of Animal Science.

  8. VARIACIÓN DE LA DIFUSIVIDAD TÉRMICA DEL LOCHE (Cucurbita moschata Duch.), LA PAPA (Solanum tuberosum L.) Y EL CAMOTE (Ipomoea batatas L.) DURANTE EL CALENTAMIENTO

    OpenAIRE

    Solano-Corenjo, Miguel Ángel; Universidad Señor de Sipan; Vidaurre-Ruiz, Julio Mauricio; Universidad Señor de Sipan

    2017-01-01

    El objetivo de esta investigación fue evaluar la variación de la difusividad térmica del loche, la papa y el camote durante el calentamiento. También se evaluó la bondad de ajuste con los diferentes modelos predictivos que relacionan la variación de la difusividad térmica con respecto a la temperatura. Los valores de difusividad térmica efectiva se obtuvieron utilizando la curva de calentamiento de las muestras a las temperaturas de 40, 50, 60, 70, 80 y 90°C y se compararon los valores experi...

  9. The potential of computer vision, optical backscattering parameters and artificial neural network modelling in monitoring the shrinkage of sweet potato (Ipomoea batatas L.) during drying.

    Science.gov (United States)

    Onwude, Daniel I; Hashim, Norhashila; Abdan, Khalina; Janius, Rimfiel; Chen, Guangnan

    2018-03-01

    Drying is a method used to preserve agricultural crops. During the drying of products with high moisture content, structural changes in shape, volume, area, density and porosity occur. These changes could affect the final quality of dried product and also the effective design of drying equipment. Therefore, this study investigated a novel approach in monitoring and predicting the shrinkage of sweet potato during drying. Drying experiments were conducted at temperatures of 50-70 °C and samples thicknesses of 2-6 mm. The volume and surface area obtained from camera vision, and the perimeter and illuminated area from backscattered optical images were analysed and used to evaluate the shrinkage of sweet potato during drying. The relationship between dimensionless moisture content and shrinkage of sweet potato in terms of volume, surface area, perimeter and illuminated area was found to be linearly correlated. The results also demonstrated that the shrinkage of sweet potato based on computer vision and backscattered optical parameters is affected by the product thickness, drying temperature and drying time. A multilayer perceptron (MLP) artificial neural network with input layer containing three cells, two hidden layers (18 neurons), and five cells for output layer, was used to develop a model that can monitor, control and predict the shrinkage parameters and moisture content of sweet potato slices under different drying conditions. The developed ANN model satisfactorily predicted the shrinkage and dimensionless moisture content of sweet potato with correlation coefficient greater than 0.95. Combined computer vision, laser light backscattering imaging and artificial neural network can be used as a non-destructive, rapid and easily adaptable technique for in-line monitoring, predicting and controlling the shrinkage and moisture changes of food and agricultural crops during drying. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  10. Chemical composition, nitrogen degradability and in vitro ruminal biological activity of tannins in vines harvested from four tropical sweet potato (Ipomoea batatas L.) varieties.

    Science.gov (United States)

    Ali, R; Mlambo, V; Mangwe, M C; Dlamini, B J

    2016-02-01

    This study investigated the potential of vines from four sweet potato varieties (Tia Nong 57, Tia Nong 66, Ligwalagwala and Kenya) as alternative feed resources for ruminant livestock. The chemical composition [neutral detergent fibre (NDF), acid detergent fibre (ADF), crude protein (CP) and acid detergent insoluble nitrogen (ADIN)], in vitro ruminal nitrogen (N) degradability and in vitro ruminal biological activity of tannins in the vines, harvested at 70 and 110 days after planting (DAP), were determined. Variety and harvesting stage did not (p > 0.05) influence CP and NDF content of the vines. Concentration of CP ranged from 104.9 to 212.2 g/kg DM, while NDF ranged from 439.4 to 529.2 g/kg DM across harvesting stages and varieties. Nitrogen degradability (ND) at 70 and 110 DAP was highest (p ruminal cumulative gas production parameters (a, b and c). The in vitro ruminal biological activity of tannins, as measured by increment in gas production parameters upon PEG inclusion, had a maximum value of 18.2%, suggesting low to moderate antinutritional tannin activity. Ligwalagwala vines, with highly degradable N, would be the best protein supplement to use during the dry season when ruminant animals consume low N basal diets and maintenance is an acceptable production objective. Tia Nong 66 and Kenya varieties, with less degradable N, may be more suitable for use as supplements for high-producing animals such as dairy goats. Journal of Animal Physiology and Animal Nutrition © 2015 Blackwell Verlag GmbH.

  11. Water-Deficit Tolerance in Sweet Potato [Ipomoea batatas (L. Lam.] by Foliar Application of Paclobutrazol: Role of Soluble Sugar and Free Proline

    Directory of Open Access Journals (Sweden)

    Suravoot Yooyongwech

    2017-08-01

    Full Text Available The objective of this study was to elevate water deficit tolerance by improving soluble sugar and free proline accumulation, photosynthetic pigment stabilization, photosynthetic abilities, growth performance and storage root yield in sweet potato cv. ‘Tainung 57’ using a foliar application of paclobutrazol (PBZ. The experiment followed a Completely Randomized Block Design with four concentrations of PBZ: 0 (control, 17, 34, and 51 μM before exposure to 47.5% (well irrigation, 32.3% (mild water deficit or 17.5% (severe water deficit soil water content. A sweet potato cultivar, ‘Japanese Yellow’, with water deficit tolerance attributes was the positive check in this study. Total soluble sugar content (sucrose, glucose, and fructose increased by 3.96-folds in ‘Tainung 57’ plants treated with 34 μM PBZ grown under 32.3% soil water content (SWC compared to the untreated plants, adjusting osmotic potential in the leaves and controlling stomatal closure (represented by stomatal conductance and transpiration rate. In addition, under the same treatment, free proline content (2.15 μmol g-1 FW increased by 3.84-folds when exposed to 17.5% SWC. PBZ had an improved effect on leaf size, vine length, photosynthetic pigment stability, chlorophyll fluorescence, and net photosynthetic rate; hence, delaying wilting symptoms and maintaining storage root yield (26.93 g plant-1 at the harvesting stage. A positive relationship between photon yield of PSII (ΦPSII and net photosynthetic rate was demonstrated (r2 = 0.73. The study concludes that soluble sugar and free proline enrichment in PBZ-pretreated plants may play a critical role as major osmoprotectant to control leaf osmotic potential and stomatal closure when plants were subjected to low soil water content, therefore, maintaining the physiological and morphological characters as well as storage root yield.

  12. Physical, chemical and sensory properties of brownies substituted with sweet potato flour (Ipomoea batatas L.) with addition of black cumin oil (Nigella sativa L.)

    Science.gov (United States)

    Ligarnasari, I. P.; Anam, C.; Sanjaya, A. P.

    2018-01-01

    Effect of addition black cumin oil on the physical (hardness) characteristics, chemical (water, ash, fat, protein, carbohydrate, antioxidant IC50, total phenol and active component) characteristics and sensory (flavor, taste, texture, overall) characteristics of brownies substituted sweet potato flour were investigated. Substituted brownies was added with 0.05%, 0.10%, 0.15%, 0.20% and 0.25% of nigella sativa oil. The result showed that water content, ash, protein, fat, total phenol were increased and carbohydrate, antioxidant IC50 was decreased by the addition of nigella sativa oil. Due to the sensory characteristics, panelist gave the high score for substituted brownies which was added 0.05% nigella sativa oil. The result showed that the best formula of substituted brownies which was added 0.05% of nigella sativa oil had 24.89% water content, 1.19% ash content, 7.54% protein content, 37.79% fat content, 53.06% carbohydrate contain, 1043.6 ppm IC50 antioxidant and 0.22% total phenol. The active component on the brownies using GCMS identification were palmitic acid, oleic acid, lauric acid, theobromine and vitamin E.

  13. Physical Characteristics of White Sweet Potato (Ipomoea batatas L.), Rice (Oryza sativa L.), and Tapioca (Manihot esculenta) Flours - Based Seasoning Composite Flour

    Science.gov (United States)

    Alfani, NNA; Ishartani, D.; Anam, C.; Praseptiangga, D.; Manuhara, G. J.

    2017-04-01

    The objective of this study was to determine the physical characteristics of seasoning composite flour that made from white sweet potato, rice, and tapioca flours, and determined the best formula of seasoning composite flour. A completely randomized design (CRD) with formula as the single factor was used. The data were analyzed by one-way ANOVA method and followed by Duncan Multiple Range Test (DMRT) at significance 5% if there was a significant difference. The best formula of seasoning composite flour was 30% tapioca flour, 30% rice flour, and 40% white sweet potato flour. The physical characteristics of the best formula were 5.689 ml/g of swelling power, 2.681 g/g of water absorption capacity, 0.887 ml/g of oil absorption capacity, and 22.03% cooking loss. Physical characteristics of the best seasoning composite flour were significantly different from the commercial seasoning flour and showed a better cooking loss, oil absorption capacity, and swelling power than commercial seasoning flour.

  14. Anthocyanins from purple sweet potato (Ipomoea batatas (L.) Lam.) and their color modulation by the addition of phenolic acids and food-grade phenolic plant extracts.

    Science.gov (United States)

    Gras, Claudia C; Nemetz, Nicole; Carle, Reinhold; Schweiggert, Ralf M

    2017-11-15

    Anthocyanin profiles and contents of three purple sweet potato provenances were investigated by HPLC-DAD-MS n . In contrast to widely uniform profiles, the contents of total (558-2477mg/100gDM) and individual anthocyanins varied widely. Furthermore, quantitative and qualitative effects of intermolecular co-pigmentation were studied by adding chlorogenic and rosmarinic acids, and food-grade phenolic apple and rosemary extracts at various dosages to a diluted purple sweet potato concentrate at pH 0.9, 2.6, 3.6, and 4.6. Addition of co-pigments generally increased pK H estimate -values of anthocyanins from 3.28 (without co-pigments) to up to 4.71, thus substantially broadening the pH range wherein colored forms prevail. The most pronounced hyperchromic shift by up to +50.5% at the absorption maximum was observed at pH 4.6. Simply by blending the co-pigments with purple sweet potato anthocyanins at pH-values ranging from 2.6 to 4.6, purplish-blue, light pink, magenta, brick-red, and intense red hues were accessible as expressed by CIE-L ∗ a ∗ b ∗ color values. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Water-Deficit Tolerance in Sweet Potato [Ipomoea batatas (L.) Lam.] by Foliar Application of Paclobutrazol: Role of Soluble Sugar and Free Proline.

    Science.gov (United States)

    Yooyongwech, Suravoot; Samphumphuang, Thapanee; Tisarum, Rujira; Theerawitaya, Cattarin; Cha-Um, Suriyan

    2017-01-01

    The objective of this study was to elevate water deficit tolerance by improving soluble sugar and free proline accumulation, photosynthetic pigment stabilization, photosynthetic abilities, growth performance and storage root yield in sweet potato cv. 'Tainung 57' using a foliar application of paclobutrazol (PBZ). The experiment followed a Completely Randomized Block Design with four concentrations of PBZ: 0 (control), 17, 34, and 51 μM before exposure to 47.5% (well irrigation), 32.3% (mild water deficit) or 17.5% (severe water deficit) soil water content. A sweet potato cultivar, 'Japanese Yellow', with water deficit tolerance attributes was the positive check in this study. Total soluble sugar content (sucrose, glucose, and fructose) increased by 3.96-folds in 'Tainung 57' plants treated with 34 μM PBZ grown under 32.3% soil water content (SWC) compared to the untreated plants, adjusting osmotic potential in the leaves and controlling stomatal closure (represented by stomatal conductance and transpiration rate). In addition, under the same treatment, free proline content (2.15 μmol g -1 FW) increased by 3.84-folds when exposed to 17.5% SWC. PBZ had an improved effect on leaf size, vine length, photosynthetic pigment stability, chlorophyll fluorescence, and net photosynthetic rate; hence, delaying wilting symptoms and maintaining storage root yield (26.93 g plant -1 ) at the harvesting stage. A positive relationship between photon yield of PSII (Φ PSII ) and net photosynthetic rate was demonstrated ( r 2 = 0.73). The study concludes that soluble sugar and free proline enrichment in PBZ-pretreated plants may play a critical role as major osmoprotectant to control leaf osmotic potential and stomatal closure when plants were subjected to low soil water content, therefore, maintaining the physiological and morphological characters as well as storage root yield.

  16. Caracterização química e informação nutricional de fécula de batata-doce (Ipomoea batatas L. orgânica e biofortificada.

    Directory of Open Access Journals (Sweden)

    Kamila de Oliveira do Nascimento

    2013-04-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE O consumo de alimentos de alta qualidade nutricional é uma das melhores estratégias para combater as carências nutricionais, como a hipovitaminose A. Essas carências afetam numerosos grupos populacionais, fato que demanda pesquisas para elucidação da composição química de vegetais de baixo custo, cuja produção seja sustentável, para contribuir com o tratamento de indivíduos acometidos por essas desordens nutricionais. O presente trabalho teve como objetivo determinar a composição química e a informação nutricional de fécula de batata-doce orgânica e biofortificada. Em cada 100 gramas de amostra úmida foram encontrados 7,05 g de água, 2,8 g de cinzas, 5,4 g de proteínas, 0,6 g de lipídeos, 65,1 g de carboidratos e 18,8 g de fibras. O rendimento do processo de obtenção da fécula foi de 13,8% em massa. O teor de carotenoides totais também foi expressivo, igual a 18 x103 µg/100 g. O consumo de uma porção de 20 g da fécula foi suficiente para fornecer 54 Kcal e satisfazer a 100% das necessidades diárias de vitamina A de um homem adulto. Considerando os resultados encontrados, é possível afirmar que a fécula apresentou um elevado potencial de utilização na biofortificação de alimentos da merenda escolar, contribuindo, dessa forma, com o fortalecimento da agricultura familiar orgânica.

  17. KARAKTERISTIK FISIKO-KIMIA TEPUNG UBI JALAR (Ipomoea batatas VARIETAS SUKUH DENGAN VARIASI PROSES PENEPUNGAN [Physico-Chemical Characteristics of Sukuh Variety Sweet Potatoes (Ipomea batatas Flours Made with Various Methods

    Directory of Open Access Journals (Sweden)

    Trifena Honestin

    2009-12-01

    Full Text Available Sweet potato has considerable potencies to support food diversification program based on flour and starch product. Various processing methods in the flour processing show great effect on alteration of the physicochemical properties of sweet potato flour. This research investigated the effects of different flour processing methods on the physicochemical properties of sweet potato flour. The results showed that processing method had a significant effect on water content, bulk density, colour (L, a, b, microscopic properties of starch granule, water absorption index, water soluble index and pasting properties of the sweet potato flour.

  18. KARAKTERISASI TEPUNG UBI JALAR (Ipomoea batata L. VARIETAS SHIROYUTAKA SERTA KAJIAN POTENSI PENGGUNAANNYA SEBAGAI SUMBER PANGAN KARBOHIDRAT ALTERNATIF [Characterization of Sweet Potato Flour (Ipomea batatas L. var. Shiroyutaka and Assesment of the potential as Alternative Carbohydrate Source For Food Product

    Directory of Open Access Journals (Sweden)

    Beni Hidayat 1

    2007-06-01

    Full Text Available This research was aimed to characterize sweet potato flour var. shiroyutaka and assessment of its potential as alternative carbohydrate source on food product. Characterization was conducted on flour processed from sweet potato var. shiroyutaka harvested at four months was characteristic, these included whiteness degree and water absorption of the flour, ratio of amylase-amylopectin, form and size of starch granule, and starch digestibility.The research showed that whiteness degree and water absorption of the flour were 78,82% ( 0,52 and 1,25 g/g ( 0,12 respectively. The ratio of amylase-amylopectin, gelatinization temperature, maximum viscosity and invitro starch digest ability were 69.82%: 30.18%, 78-900C and 84,78% respectively. The granule of its starch was round form and with size 2-4 micron.The main potential of the flour is related with its specific characteristics which were the amylose-amylopectin ratio, the starch amylograph profile, form and size of starch granule, and the starch digest ability. These parameters implied that, the flour should be utilized in the production specific food products.

  19. Contenido de ß-caroteno, hierro y zinc en genotipos de camote (Ipomoea batatas L.) durante el almacenamiento, cocción y elaboración de pan

    OpenAIRE

    Carpio Ramos, Rosmery Violeta

    2016-01-01

    Universidad Nacional Agraria La Molina. Escuela de Posgrado. Maestría en Tecnología de Alimentos El camote es uno de los alimentos básicos que han sido asignados para combatir la deficiencia de micronutrientes en especial la deficiencia de vitamina A, hierro y zinc. El presente estudio pretende contribuir con la selección de genotipos para el mejoramiento de la calidad nutricional del camote principalmente en el contenido de β-caroteno, materia seca, hierro y zinc, ayudando a reducir los p...

  20. Efecte de l'aplicació d'ultrasons en tubercles: Impacte sobre les propietats físiques i sensorials del moniato (Ipomoea batata) mínimament processat

    OpenAIRE

    Rafí Cruz, Adriana Alexandra

    2014-01-01

    The general trend that nowadays the food consumers have is to avoid the chemical products that can harm the health and the environment. The food processing industry of vegetables seeks, with the innovation, to involve this sector that every day has more weight on the market. This way the alternative technologies arise as ultrasounds, a method of microbial reduction that allows to avoid the use of chemical disinfectants. The aim of this study is to verify the effect of low frequency ultrasound...

  1. Composición mineral y comparación de raíces reservantes de variedades de batatas (Ipomoea batatas (L. Lam. cultivadas en la isla de La Palma, España

    Directory of Open Access Journals (Sweden)

    Adriana Isabel Montes Hernández

    2010-07-01

    Full Text Available Los minerales Na, K, Ca, Mg, Fe, Cu, Zn y Mn fueron determinados, mediante espectrofotometría de absorción atómica, en raíces de 15 variedades de batatas cultivadas en La Palma (De papa o maní, Parado, Cubana, Cubana de baselo gordo, Cubana de hoja redonda, Blanquita, Saucero o Lanzarotero, Pata de Gallo, Padrón de Seda, Alicantina, Amarillo de Año, De Lanzarote, Matojo, Matojo Fino y Rajada; las 5 primeras de cultivo corto y las 10 restantes de cultivo largo. Se realizó análisis de varianza y prueba de rango múltiple de Duncan a los datos de las variables estudiadas. Se calcularon los coeficientes de correlación de Pearson (r para establecer grados de relación de los minerales entre las variedades; prueba de t de Student para comparar clasificando a las muestras según ciclo de recolección (Temprana y Tardía; análisis factorial para interpretar las relaciones existentes a través factores y análisis discriminantes (de paso a paso con criterio de selección la lambda de Wilks (λ e introduciendo todas las variables validados a través de análisis de validación cruzada. El elemento mineral (en mg/kg presente en mayor concentración en la totalidad de las muestras fue K (2086 ± 418, seguido de Ca (974 ± 486 y Mg (244 ± 70, siendo el Zn el menos presente (1,12 ± 0,61. Las variedades con mayor contenido mineral fueron Alicantina (Ca: 1809 ± 327 y Cu: 2,97 ± 0,23 y Padrón de Seda (Mg: 435 ± 46 y Mn: 3,08 ± 0,49 y la de menor aporte fue Parado (Cu, Mn, Ca, K y Mg. Las variedades Tardías presentaron mayores concentraciones de Cu, Fe, Mn, Ca, K, Mg y menores de Zn y Na en relación a las variedades Tempranas (p < 0,05. Se evidenció que las concentraciones de Cu, Zn y Na presentaron alto número de correlaciones significativas. El análisis factorial permitió deducir que Mg, K y Fe son las variables que permiten caracterizar el sistema perdiendo un mínimo de información total. El porcentaje de casos originales correctamente clasificados después de aplicar análisis discriminantes a las variedades de ciclo de recolección Temprana fue del 98 % de los casos originales y 96 % luego de la validación cruzada, mientras que para las variedades de ciclo de recolección Tardía fue del 100 % de los casos originales y 99 % después de la validación.

  2. Composición mineral y comparación de raíces reservantes de variedades de batatas (Ipomoea batatas (L. Lam. cultivadas en la isla de La Palma, España

    Directory of Open Access Journals (Sweden)

    Adriana Isabel Montes Hernández

    2010-06-01

    Full Text Available Los minerales Na, K, Ca, Mg, Fe, Cu, Zn y Mn fueron determinados, mediante espectrofotometría de absorción atómica, en raíces de 15 variedades de batatas cultivadas en La Palma (De papa o maní, Parado, Cubana, Cubana de baselo gordo, Cubana de hoja redonda, Blanquita, Saucero o Lanzarotero, Pata de Gallo, Padrón de Seda, Alicantina, Amarillo de Año, De Lanzarote, Matojo, Matojo Fino y Rajada; las 5 primeras de cultivo corto y las 10 restantes de cultivo largo. Se realizó análisis de varianza y prueba de rango múltiple de Duncan a los datos de las variables estudiadas. Se calcularon los coeficientes de correlación de Pearson (r para establecer grados de relación de los minerales entre las variedades; prueba de t de Student para comparar clasificando a las muestras según ciclo de recolección (Temprana y Tardía; análisis factorial para interpretar las relaciones existentes a través factores y análisis discriminantes (de paso a paso con criterio de selección la lambda de Wilks (λ e introduciendo todas las variables validados a través de análisis de validación cruzada. El elemento mineral (en mg/kg presente en mayor concentración en la totalidad de las muestras fue K (2086 ± 418, seguido de Ca (974 ± 486 y Mg (244 ± 70, siendo el Zn el menos presente (1,12 ± 0,61. Las variedades con mayor contenido mineral fueron Alicantina (Ca: 1809 ± 327 y Cu: 2,97 ± 0,23 y Padrón de Seda (Mg: 435 ± 46 y Mn: 3,08 ± 0,49 y la de menor aporte fue Parado (Cu, Mn, Ca, K y Mg. Las variedades Tardías presentaron mayores concentraciones de Cu, Fe, Mn, Ca, K, Mg y menores de Zn y Na en relación a las variedades Tempranas (p < 0,05. Se evidenció que las concentraciones de Cu, Zn y Na presentaron alto número de correlaciones significativas. El análisis factorial permitió deducir que Mg, K y Fe son las variables que permiten caracterizar el sistema perdiendo un mínimo de información total. El porcentaje de casos originales correctamente clasificados después de aplicar análisis discriminantes a las variedades de ciclo de recolección Temprana fue del 98 % de los casos originales y 96 % luego de la validación cruzada, mientras que para las variedades de ciclo de recolección Tardía fue del 100 % de los casos originales y 99 % después de la validación.

  3. Influência da adição da fécula de batata-doce (Ipomoea batatas L. sobre a viscosidade do permeado de soro de queijo Influence of sweet potato starch at permeate whey viscosity

    Directory of Open Access Journals (Sweden)

    Rafael Leite Pinto de Andrade

    2002-12-01

    Full Text Available A viscosidade é um parâmetro importante na aceitabilidade de bebidas lácteas. O presente trabalho teve como objetivo principal fornecer dados relativos ao comportamento da viscosidade uma base de permeado de soro de queijo adicionada de fécula de batata-doce, dados que poderão ser utilizados na elaboração de uma nova bebida láctea. A fécula de batata-doce utilizada apresentou um grau de gelatinização de 72,64%, umidade média de 7,88% e a seguinte composição centesimal média em base seca: 82,59% de amido, 9,33% de fibras dietéticas totais, 4,90% de proteínas, 2,08% de cinzas e 1,11% de lipídios. O permeado de soro foi adicionado a três diferentes concentrações de fécula e submetido a diferentes tratamentos térmicos. A viscosidade mais adequada, em função dos dados obtidos junto aos produtos comerciais, estaria no intervalo de 45mPa.s a 70mPa.s. Assim sendo, a porcentagem de 6% de fécula de batata-doce e um tratamento térmico de 90ºC por cerca de 5 minutos mostrou-se ser o mais adequado. O fluido obtido apresentou um comportamento pseudoplástico.Viscosity is an important parameter of milky drinks acceptability. This work supply data of the viscosity properties of permeate whey plus sweet potato starch basis; these data will may be used at development of a new milky beverage. The used sweet potato starch presented 72.64% of gelatinization, 7.88% of humidity and the following dry composition: 82.59% starch, 9.33% total dietary fibres, 4.90% proteins, 2.08% ashes and 1.10% lipids. The permeate whey had mixed at three different percentages of potato starch and had submitted at various thermal treatments. The most appropriate viscosity, in accord of commercial products, it would be in the interval of 45mPa.s to 70mPa.s. Therefore, the percentage of 6% of sweet potato starch and a thermal treatment of 90ºC for about 5 minutes it was shown to be the most appropriate. The fluid presented a pseudoplastic properties.

  4. A Regional Guidebook for Applying the Hydrogeomorphic Approach to Assessing the Functions of Tidal Fringe Wetlands Along the Mississippi and Alabama Gulf Coast

    Science.gov (United States)

    2007-04-01

    philoxeroides Alligatorweed Alabama Class C noxious weed Imperata cylindrica Cogongrass Alabama Class A noxious weed; Mississippi noxious weed Ipomoea...Invasive Species Alternanthera philoxeroides Phragmites australis Cuscuta spp. Imperata cylindrica...weed Cuscuta spp. Dodder Alabama Class A noxious weed Imperata cylindrica Cogongrass Alabama Class A noxious weed; MS noxious weed Ipomoea

  5. New floristic records in the Balkans: 8

    DEFF Research Database (Denmark)

    Tan, Kit; Issigoni, Margarita

    2008-01-01

    -56), Campanulaceae (10), Caryophyllaceae (11, 27, 57), Chenopodiaceae (12), Convolvulaceae (13, 58), Crassulaceae (14, 59, 60), Cucurbitaceae (28), Cupressaceae (19), Cuscutaceae (49), Dryopteridaceae (2), Ephedraceae (20), Fabaceae (42- 48, 50, 61-69, 84), Gesneriaceae (85), Iridaceae (77, 88), Lamiaceae (70...

  6. SPINIFICI-SCAEVOLETEA SERICEAE, A NEW VEGETATION CLASS FOR PSAMMOPHYTIC DUNE VEGETATION IN THAILAND

    Directory of Open Access Journals (Sweden)

    S. PIGNATII

    1996-04-01

    Full Text Available This is a short account on the coastal dune vegetation of the Gulf of Siam in Thailand. Vegetation is mainly composed by succulent creeping plants with herbaceous habit as to Canavalia maritima (Papilionaceae and Iponwea pes-caprae (Convolvulaceae and the robust stoloniferous grass Spinijex littoreus, the last having an important function for the fonnation of coastal dunes.

  7. SPINIFICI-SCAEVOLETEA SERICEAE, A NEW VEGETATION CLASS FOR PSAMMOPHYTIC DUNE VEGETATION IN THAILAND

    Directory of Open Access Journals (Sweden)

    S. PIGNATII

    1996-01-01

    Full Text Available This is a short account on the coastal dune vegetation of the Gulf of Siam in Thailand. Vegetation is mainly composed by succulent creeping plants with herbaceous habit as to Canavalia maritima (Papilionaceae and Iponwea pes-caprae (Convolvulaceae and the robust stoloniferous grass Spinijex littoreus, the last having an important function for the fonnation of coastal dunes.

  8. 2430-IJBCS-Article-Kouakou Theodore Kouadio+

    African Journals Online (AJOL)

    hp

    Euphorbiaceae. 1. 2. Deeringiana pruerens. Fabaceae. 1. 1. Dioscorea alata. Dioscoreaceae. 6. 56. Dioscorea cayenensis-rotundata. Dioscoreaceae. 5. 11. Glycine max. Fabaceae. 2. 16. Ipomea batatas. Convolvulaceae. 1. 10. Justicia tenela. Acanthaceae. 1. 1. Lactuca sativa. Asteraceae. 2. 11. Lycopersicon esculentum.

  9. Morning glory species interference on the development and yield of soybeans

    Directory of Open Access Journals (Sweden)

    Fortunato De Bortoli Pagnoncelli

    2017-08-01

    Full Text Available ABSTRACT Plants from the genus ipomoea are among the most important weeds in Brazil. The objective of this study was to determine the impact of different densities of 2 species of Ipomoea (I. grandifolia and I. purpurea under different environments (counties of Pato Branco and Renascença, Paraná state, Brazil on soybean biometric variables, yield components and crop yield loss. Field experiments in 2 distinct places were conducted in a randomized block design, where 1 factor consisted of 8 plant densities (0, 2, 4, 6, 8, 10, 15 and 20 plants∙m−2, whereas the other factor consisted of the 2 Ipomoea species. Joint analysis of the data was performed considering the factors environment, Ipomoea densities and species. The impact of one Ipomoea plant∙m−2 was very high, reaching 26%, on average, of species and environments. The maximum soybean yield loss experienced with the Ipomoea density of 20 plants∙m−2 was close to 80%. The impact of Ipomoea density was more important than the species and environment. This result highlights the importance of correct management of plants of these weed species in soybean crop.

  10. Metabolitos secundarios, letalidad y actividad antimicrobiana de seis esponjas marinas de la Bahía de Mochima, Venezuela

    OpenAIRE

    Cedeño-Ramos, Raul; Armas, Haydelba D'; Amaro, María; Martínez, Rosa

    2015-01-01

    ResumenEspecímenes de las esponjas Aplysina lacunosa, Aplysina fulva, Cliona varians, Cinachyrella kuekenthali, Amphimedon viridis y Aaptos pernucleata, se recolectaron en la Bahía de Mochima, Venezuela en octubre del 2009, con el propósito de identificar las familias de metabolitos secundarios y evaluar las propiedades antibacterianas, antifúngicas y letales en Artemia salina de las fracciones solubles en acetato de etilo. La evaluación química evidenció la presencia de alcaloides, esteroles...

  11. Molecular characterization of two isolates of sweet potato leaf curl ...

    African Journals Online (AJOL)

    Jane

    2011-08-17

    Aug 17, 2011 ... related to that of sweet potato leaf curl virus (SPLCV) from United States with nucleotide sequence identity of ... species including Ipomoea indica, are grown orna- mentally all .... and AC4 were closely related to that of SPLCV-.

  12. Compatibility and economic assessment of sweetpotato and garden ...

    African Journals Online (AJOL)

    ecological zone of Nigeria, to determine the compatibility and economic viability of sweetpotato (Ipomoea batatas) and garden egg (Solanum gelio) intercrop during 2011 and 2012 cropping seasons. Two sweetpotato varieties; NR05/022 and ...

  13. Volume 9 Number 1

    African Journals Online (AJOL)

    OLUWOLE

    PHYSICOCHEMICAL PROPERTIES OF SORGHUM-PIGEON PEA COMPOSITE. BLEND USED FOR THE .... after cleaned, sorted was milled into flour, stored and designated as a ...... L. verdc) and sweet potato (Ipomoea batatas) flour.

  14. EXPLOITATION OF GENETIC POTENTIAL OF SWEETPOTATO FOR ...

    African Journals Online (AJOL)

    USER

    Sweetpotato (Ipomoea batatas Lam) is a staple food globally, but it has remained ... The strong positive genetic association between dry matter and starch .... Storage roots selected were approximately 3 cm ...... gelatinisation properties.

  15. C Chang foliar co es in g applic owpea growth cation cultiva h and n ...

    African Journals Online (AJOL)

    sunny

    solutions is an important factor in controlling the severity of specific ion toxicities, ..... grown under hydroponic culture. J. Plant Physiol. 161:921-928. ... Zealand spinach (Tetragonia tretragonioides) and water spinach. (Ipomoea aquatica).

  16. Studies on Agrobacterium-mediated genetic transformation of ...

    African Journals Online (AJOL)

    SERVER

    2008-03-04

    Mar 4, 2008 ... Sweet potato (Ipomoea batatas) is the sixth most impor- tant crop in the world after ... mediated transformation system does not involve sophis- .... (w/v) agarose gel. .... This work was supported by National Natural Science.

  17. Mite (Acari) fauna of some cultivated plants from Kahramanmaraş ...

    African Journals Online (AJOL)

    user

    2011-03-14

    Mar 14, 2011 ... and fruit trees, the common weed Ipomoea indica (Burman) Merrill ... Mites were removed from the ... 2004). This species was also recorded from the bark of ..... the family Tetranychidae, damaging fruit trees in Central Anatolia.

  18. Tropical Journal of Pharmaceutical Research - Vol 13, No 8 (2014)

    African Journals Online (AJOL)

    Enhancement of In Vitro Skin Transport and In Vivo Hypoglycemic Efficacy of ... of Liquid Paraffin, White Soft Paraffin and Initial Hydration on Viscosity of Corticosteroid Cream ... Protective Effect of Purple Sweet Potato (Ipomoea batatas Linn, ...

  19. Integrated water quality, emergy and economic evaluation of three bioremediation treatment systems for eutrophic water

    Science.gov (United States)

    This study was targeted at finding one or more environmentally efficient, economically feasible and ecologically sustainable bioremediation treatment modes for eutrophic water. Three biological species, i.e. water spinach (Ipomoea aquatica), loach (Misgurus anguillicaudatus) and ...

  20. Sweetpotato breeding for northeastern Uganda: farmer varieties, farmer-participatory selection, and stability of performance

    NARCIS (Netherlands)

    Abidin, P.E.

    2004-01-01

    Keywords: Agro-biodiversity, farmer varieties, indigenous knowledge, farmer-participatory research, genetic diversity, genotype-by-environment interaction, germplasm collection, Ipomoea batatas , specific adaptation, yield stability, sweetpotato, variance component

  1. Fytochemický výzkum Evolvulus alsinoides IV.

    OpenAIRE

    Svačinová, Jana

    2006-01-01

    Svačinová Jana: Rigorous thesis (2006) PHYTOCHEMICAL STUDY OF EVOLVULUS ALSINOIDES IV. This thesis deals with phytochemical research of plant Evolvulus alsinoides from family Convolvulaceae. Petrolether extract of leaves was separated by column and preparative TLC chromatography. Mixture of esters of 3-methoxy-4-hydroxycinnamic acid with long linear alcohols has been isolated and confirmed by 1 H NMR and MS spectrum. Its antiradical and platelet antiaggregatory activity was established.

  2. Archaeological Testing of the Bauman Site (23STG158) Ste. Genevieve County, Missouri.

    Science.gov (United States)

    1985-05-01

    with exception of the absence of black walnut, hazelnut and acorn remains. Identified remains include those of Carya illinoensis (pecan), Carya spp...spp.), black walnut (Juglans nigra), hickory nut ( Carya spp.), maize (Zea mays), knotweed (Polygonum erectum), and morning glory (Convolvulaceae). While...shagbark group), Carya spp. (kingnut group), and Juglandaceae (Table 24). Differen- " tiations among Carya taxa were made employing Lopinot’s (1983

  3. Efficacy of oxyfluorfen with straw cover in controlling weeds

    OpenAIRE

    Negrisoli, E. [UNESP; Correa, M. R. [UNESP; Rossi, C. V. S. [UNESP; Carbonari, Caio Antonio [UNESP; Velini, Edivaldo Domingues [UNESP; Perim, L. [UNESP

    2009-01-01

    A palha pode alterar a dinâmica do herbicida oxyfluorfen no sistema de cana-crua; assim, este trabalho teve por objetivo avaliar a eficácia do oxyfluorfen em condições de casa de vegetação, com a cobertura de palha, no controle das plantas daninhas que ocorrem em cana-crua. Foram avaliadas as espécies de Brachiaria decumbens, Ipomoea grandifolia, Ipomoea quamoclit e Merremia cissoides. A dose utilizada do oxyfluorfen foi de 3 L ha-1 (720 g i.a. ha-1). Os tratamentos constaram de diferentes po...

  4. African Journal of Biotechnology - Vol 11, No 27 (2012)

    African Journals Online (AJOL)

    Phosphate uptake and growth characteristics of transgenic rice with phosphate transporter 1 (OsPT1) gene overexpression under high phosphate soils · EMAIL FREE ... Studies on antioxidant capacity of anthocyanin extract from purple sweet potato (Ipomoea batatas L.) EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  5. TRANSIENT EXPRESSION OF β-GLUCURONIDASE IN ...

    African Journals Online (AJOL)

    ACSS

    2014-08-28

    Aug 28, 2014 ... production des cultivars de résistance adaptée aux charançons de la patate douce. Mots Clés: Agrobacterium tumefaciens, β-glucuronidase, Ipomoea batatas. INTRODUCTION. Plant transformation through Agrobacterium species is the most commonly used system since the transferred DNA has minimal ...

  6. Arabidopsis CDS blastp result: AK069900 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK069900 J023035E20 At5g23420.1 high mobility group (HMG1/2) family protein similar to high mobility... group protein 2 HMG2 [Ipomoea nil] GI:1052956; contains Pfam profile PF00505: HMG (high mobility group) box 8e-32 ...

  7. Liver biopsy as diagnostic method for poisoning by swainsonine-containing plants

    Science.gov (United States)

    With the aim to investigate the use of hepatic biopsies for the diagnosis of poisoning by swainsonine-containing plants, dry leaves of Ipomoea marcellia containing 0.02% of swainsonine were administered to goats. Group I, with six goats, ingested 4g/kg of dry plant (0.8mg of swainsonina/kg) until th...

  8. Exploitation of genetic potential of sweetpotato for end-user traits ...

    African Journals Online (AJOL)

    Sweetpotato (Ipomoea batatas Lam) is a staple food globally, but it has remained underutilised resource in Ghana due to lack of consumer preferred cultivars. There is the need to develop staple-type sweetpotato cultivars which are preferred by consumers to increase sweetpotato use as a food security, health and industrial ...

  9. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 444 ... Vol 39, No 1 (2006), Effect of storage time on microbial quality of some spices ... for the storage of sweet potato (Ipomoea batatas) in Ghana, Abstract ... on the dry matter, starch gelatinization properties and the cooking ...

  10. Phytochemical Screening, Proximate and Mineral Composition of ...

    African Journals Online (AJOL)

    Leaves of sweet potato (Ipomoea batatas) grown in Tepi area was studied for their class of phytochemicals, mineral and proximate composition using standard analytical methods. The phytochemical screening revealed the presence of alkaloids, flavonoid, terpenoids, saponins, quinones, phenol, tannins, amino acid and ...

  11. Plants diversity and phytoaccumulators identification on the ...

    African Journals Online (AJOL)

    The dominant taxa on the old waste dumpsite having an average density superior to 5 plants/m2 and occurring less frequently on the control site were Alternanthera sessilis, Amaranthus spinosus, Cyperus rotundus, Cyperus iria, Eleusine indica, Euphorbia glomerifera, Ipomoea triloba, Portulaca oleracea and Trianthema ...

  12. Toxic plants affecting the nervous system of ruminants and horses in Brazil

    Science.gov (United States)

    This review updates information about neurotoxic plants affecting ruminants and equidae in Brazil. Currently in the country, there are at least 131 toxic plants belonging to 79 genera. Thirty one of these poisonous plants affect the nervous system. Swainsonine-containing plants (Ipomoea spp., Turbin...

  13. Quality evaluation of 'gari' produced from cassava and sweet potato ...

    African Journals Online (AJOL)

    The quality evaluation of gari produced from mixes of cassava (Manihot esculenta, Crantz) and Sweet potato (Ipomoea batatas) tubers were investigated and reported. This is done to allow for the establishment of the best mixes of cassava and potato tubers to be adopted in the composite gari produced. Gari was produced ...

  14. Untitled

    African Journals Online (AJOL)

    recorded the highest AUDPC. These results suggest that Sweetpotato landraces from low SPVD incidence areas are not necessarily resistant but should be evaluated at disease "hotspots" areas to confirm their resistance and yield potential. Key Words: Disease resistance, hotspots, infection areas, Ipomoea batatas, SPVD.

  15. thidiazuron improves adventitious bud and shoot regeneration

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    Induction of adventitious buds and shoots from intact leaves and stem internode segments of two recalcitrant. Ugandan sweetpotato (Ipomoea batatas L.) cultivars was investigated in vitro on Murashige and Skoog (MS) medium, supplemented with 3 different levels (0.5, 2.0 and 4.0 µM) of Thidiazuron (TDZ). Shoots were.

  16. Cloning and characterization of ATP synthase CF1 α gene from ...

    African Journals Online (AJOL)

    ATP synthase CF1 α subunit protein is a key enzyme for energy metabolism in plant kingdom, and plays an important role in multiple cell processes. In this study, the complete atpA gene (accession no. JN247444) was cloned from sweet potato (Ipomoea batatas L. Lam) by reverse transcriptasepolymerase chain reaction ...

  17. AcEST: DK944889 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 27-F10, full insert seque... 264 2e-69 tr|Q40093|Q40093_IPONI PNIL34 OS=Ipomoea nil GN=PNIL 34 PE=2 SV=1 263...LVY 487 VKNL+R+P Y M P++SGSVD AEFEPQLVY Sbjct: 367 VKNLKRIPHVAALVSEIIAAYLMPPIESGSVDFAEFEPQLVY 408 >tr|Q40093|Q40093_IPONI PNIL34

  18. Diversity and evolutionary relationship of nucleotide binding site ...

    Indian Academy of Sciences (India)

    PRAKASH KUMAR

    site-encoding disease-resistance gene analogues in sweet potato. (Ipomoea batatas Lam.) ... terminal domain of the protein, this class of R-genes can be subdivided into TIR ... from young leaflets using the modified 2.0% (w/v) cetyl trimethyl ...

  19. Physicochemical composition and antioxidant properties of a ...

    African Journals Online (AJOL)

    Physicochemical composition and antioxidant properties of a sweetpotato variety ( Ipomoea batatas L) commercially sold in South Eastern Nigeria. ... Results show that this sweet potato variety has potentials of biological properties and could have wide utility in food, alcohol and sugar industries. In addition, it could serve as ...

  20. Algal communities associated with aquatic macrophytes in some ...

    African Journals Online (AJOL)

    This study describes the algal communities of six ponds colonised by aquatic macrophytes in Nyanza Province, Kenya. Plankton samples were collected from the water column and epiphytic samples from macrophytes such as Azolla, Pistia, Nymphaea, Ipomoea and Ludwigia. Pond pH, temperature, conductivity, ...

  1. 2106-IJBCS-Article-Mtaita Tuarira

    African Journals Online (AJOL)

    hp

    Available online at http://ajol.info/index.php/ijbcs ... Nutrient content of water spinach (Ipomoea aquatica) under different ... methods of food analysis were used. ... site has an elevation of 1104 m above the sea level. Rainfall in this region is ...

  2. Biochemical response of sweet potato to bemul-wax coating ...

    African Journals Online (AJOL)

    Sweet potato (Ipomoea batatas Linn) tuber is a very nutritious but highly perishable crop that is subject to high wastages due to non-availability of appropriate storage techniques. This work assessed the effectiveness of treating the tubers with calcium chloride dip (CCD), bemul-wax (B-wax) and their combinations ...

  3. Arabidopsis CDS blastp result: AK241480 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241480 J065165O08 At4g27250.1 68417.m03912 dihydroflavonol 4-reductase family / dihydrokaempferol... 4-reductase family similar to dihydrokaempferol 4-reductase, Ipomoea purpurea (GI:4239849), Medicago sativa, PIR2:S61416 4e-31 ...

  4. Arabidopsis CDS blastp result: AK062499 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062499 001-104-A06 At4g27250.1 dihydroflavonol 4-reductase family / dihydrokaempferol... 4-reductase family similar to dihydrokaempferol 4-reductase, Ipomoea purpurea (GI:4239849), Medicago sativa, PIR2:S61416 8e-45 ...

  5. Arabidopsis CDS blastp result: AK242505 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK242505 J080309P03 At4g27250.1 68417.m03912 dihydroflavonol 4-reductase family / dihydrokaempferol... 4-reductase family similar to dihydrokaempferol 4-reductase, Ipomoea purpurea (GI:4239849), Medicago sativa, PIR2:S61416 3e-38 ...

  6. Arabidopsis CDS blastp result: AK067272 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK067272 J013098D22 At4g27250.1 dihydroflavonol 4-reductase family / dihydrokaempferol... 4-reductase family similar to dihydrokaempferol 4-reductase, Ipomoea purpurea (GI:4239849), Medicago sativa, PIR2:S61416 7e-40 ...

  7. Arabidopsis CDS blastp result: AK099340 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK099340 J033024N22 At4g27250.1 dihydroflavonol 4-reductase family / dihydrokaempferol... 4-reductase family similar to dihydrokaempferol 4-reductase, Ipomoea purpurea (GI:4239849), Medicago sativa, PIR2:S61416 2e-40 ...

  8. Sweet potato yields and nutrient dynamics after short-term fallows in the humid lowlands of Papua New Guinea

    NARCIS (Netherlands)

    Hartemink, A.E.

    2003-01-01

    Shifting cultivation is common in the humid lowlands of Papua New Guinea but little is known about the effect of different fallows on sweet potato (Ipomoea batatas) yield and nutrient flows and pools in these systems. An experiment was conducted in which two woody fallow species (Piper aduncum and

  9. Download this PDF file

    African Journals Online (AJOL)

    J. S. Nyombo Luboya

    P.O. Box 3006, Chuo Kikuu, Morogoro, TANZANIA. 2. Applied Human ... INTRODUCTION. Sweet potato (Ipomoea batatas L) is grown as a food crop in most parts of the world, ... diet and health status. .... Effect of drying on ascorbic acid, carotenoids, iron, calcium, oxalates and polyphenols ..... 1983; 10: 205-210. 28. Garman ...

  10. Effects of elevated CO2 on growth of the industrial sweet potato cultivar CX-1

    Science.gov (United States)

    The rising concentration of atmospheric carbon dioxide (CO2) is known to directly affect plants, increasing growth, yield, and resource use efficiency. Further, it has been shown that sweet potatoes (Ipomoea batatas) represent a potential as a source of bioethanol production, particularly industrial...

  11. Author Details

    African Journals Online (AJOL)

    Banso, A. Vol 21 (2010) - Articles The Effect of Allium Sativum and Xylopia Aethiopica Extracts on the Growth of Fungi in Sweet Potato (Ipomoea Batatas) Juice Abstract PDF · Vol 21 (2010) - Articles Inhibition of Growth of Fungi Isolated From Deteriorating Melon Seed By Extracts of Punica Granatum and Cymbopogon ...

  12. Annals of Medical and Health Sciences Research - Vol 4, No 4 (2014)

    African Journals Online (AJOL)

    Effect of Diuretics on Salivary Flow, Composition and Oral Health Status: A ... Relationships between CD4+ Counts and the Presence of Oral Lesions in Human ... Cell Nuclear Antigen Protein Expression in Plaque, Reticular and Erosive Types of ... Aqueous Extract of Ipomoea batatas Reduces Food Intake in Male Wistar ...

  13. Effet de l'herbe de Guinée ( Panicum maximum Jacq.) associée à l ...

    African Journals Online (AJOL)

    Effet de l'herbe de Guinée ( Panicum maximum Jacq.) associée à l'herbe de lait ( Euphorbia heterophylla L.) ou aux feuilles de patate douce ( Ipomoea batatas (L.) Lam) sur la croissance des lapins ( Oryctolagus cuniculus L.)

  14. Genetic diversity of sweet potatoes collection from Northeastern Brazil

    African Journals Online (AJOL)

    The sweet potato, Ipomoea batatas (L.) Lam has its origin in Tropical America. In Sergipe State (Brazil), its production is very important, and to explore its potential in local agriculture in the State, the Embrapa Coastal Tableland created a collection with 52 accessions located in Umbaúba City. Some accessions were from ...

  15. An updated review on the parasitic herb of Cuscuta reflexa Roxb.

    Science.gov (United States)

    Patel, Satish; Sharma, Vikas; Chauhan, Nagendra S; Dixit, Vinod K

    2012-03-01

    Cuscuta reflexa Roxb. is a golden yellow, leafless, perennial, parasitic herb of the family Convolvulaceae. C. reflexa has been investigated for antispasmodic, hemodynamic, anticonvulsant, anti steroidogenic, antihypertensive, muscle relaxant, cardiotonic, antiviral, antibacterial, antioxidant, cholinergic, diuretic and hair growth activities. Many chemical constituents have been isolated from C. reflexa such as cuscutin, amarbelin, β-sitosterol, stigmasterol, kaempferol, dulcitol, myricetin, quercetin, coumarin and oleanolic acid. This review presents a detailed survey of the literature on pharmacognosy, phytochemistry and traditional and biological medicinal uses of C. reflexa.

  16. Complete genome sequence of jacquemontia yellow vein virus, a novel begomovirus infecting Jacquemontia tamnifolia in Venezuela.

    Science.gov (United States)

    Fiallo-Olivé, Elvira; Chirinos, Dorys T; Geraud-Pouey, Francis; Navas-Castillo, Jesús

    2017-08-01

    Wild plants of the family Convolvulaceae are hosts for a few New World begomoviruses (genus Begomovirus, family Geminiviridae). In this work, we report the complete genome sequence of a new begomovirus infecting the wild convolvulaceous plant Jacquemontia tamnifolia in Venezuela. The cloned bipartite genome showed the organization of typical New World begomoviruses and was found to be phylogenetically related to those of begomoviruses from Venezuela and other Caribbean countries. Several recombination events have been shown to have occurred involving genome fragment exchange with related begomoviruses infecting crops such as tomato and cucurbits and wild plants, including Jacquemontia sp. We propose the name jacquemontia yellow vein virus (JacYVV) for this new begomovirus.

  17. PEMANFAATAN TEPUNG KOMPOSIT UBI JALAR PUTIH (Ipomea batatas L. KECAMBAH KEDELAI (Glycine max Merr DAN KECAMBAH KACANG HIJAU (Virginia radiata L SEBAGAI SUBSTITUEN PARSIAL TERIGU DALAM PRODUK PANGAN ALTERNATIF BISKUIT KAYA ENERGI PROTEIN [Utilization of Composite Flour from White Sweet Potatoes (Ipomoea batatas L, Germinated Soybeans (Glycine max Merr., and Germinated Mung Beans (Virginia radiata L as Wheat Flour Partial Substituent of Alternative Food, High Energy-Protein Biscuit

    Directory of Open Access Journals (Sweden)

    Ferry H Sunandar2

    2006-04-01

    Full Text Available An emergency food based biscuit product was formulated by utilizing composite flour from white sweet potatoes, germinated soybeans, and germinated mung beans. This product was designed to meet high protein and energy wich contain protein as minimum as 12% and 50% carbohydrate. Sweet potatoes, germinated soybeans, and germinated mung beans flour were obtained by using drum dryer. The flour characteristics determination showed that there were positive corelation between bulk density and wettability, and had negative corelation with stack angle. The bulk density number of sweet potatoes, germinated soybeans, and germinated mung beans flour were 0.56, 0.38, 0.45 g/m; compact density 0.63, 0.54, and 0.56 g/ml; whiteness degree 49.77, 29.82 and 34.41%; stack angle 30.56, 41.77 and 31.16 degree; wettability 1.104, 345, 20 second; and dispersibility 1.98, 1.06 and 0.70%. Wheat flour could be substituted by sweet potatoes flour as much as 80%. The range utilization of germinated soybeans and germinated mung beans flour were 12-28 % which combined with 25-44% sweet potatoes flour. The nutritional composition of high energy and protein biscuit were within average range of protein 12.34%, fat 24.56%, carbohydrate 60.65 %, and also total dietary fiber 15.01%. The result of organoleptic test showed that high energy and protein biscuit was accepted by consument, so that its very potential to ben as alternative food.

  18. Plantas invasoras da cultura do feijoeiro (Phaseolus vulgaris L. no Estado de Minas Gerais

    Directory of Open Access Journals (Sweden)

    Julio Pedro Laca-Buendia

    1989-01-01

    Full Text Available Nas áreas de cultura do feijoeiro (Phaseolus vulgaris L., no Estado de Minas Gerais, foram coletadas e identificadas 222 espécies de plantas invasoras (= plantas daninhas, pertencentes a 35 famílias botânias, representando 118 gêneros, sendo que as famílias Compositae, Leguminosae, Gramineae, Malvaceae, Convolvulaceae, Rubiaceae, Euphorbiaceae, Amaranthaceae, Cyperaceae e Solanaceae, são as mais importantes em relação à cultura. As plantas coletadas, devidamente etiquetadas e identificadas, foram anexadas no PAMG (Herbário da Empresa de Pesquisa Agropecuária de Minas Gerais, Belo Horizonte - (MG..A survey in the cultivation area of bean in the state of Minas Gerais, Brazil, resulted in the determination of 222 weeds species, of 118 genera belonging to 35 families presenting a greater number of species areas: Compositae, Leguminosae, Gramineae, Malvaceae, Convolvulaceae, Rubiaceae, Euphorbiaceae, Amaranthaceae, Cyperaceae and Solanaceae, with 33, 30, 25, 21, 12, 10. 10, 10, 9. 8 species respectively.

  19. A flórula invasora da cultura do café (Coffea arabica L. no Estado de Minas Gerais, Brasil Weeds in coffee (Coffea arabica L. plantations in the state of Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Manuel Losada Gavilanes

    1988-01-01

    Full Text Available Nas áreas de cultura de café (Coffea arábica L., no Estado de Minas Gerais, foram coletadas e identificadas 388 espécies de plantas invasoras (= plantas daninhas, pertencentes a 51 famílias botânicas, representando 182 gêneros, sendo que as famílias Compositae, Gramineae, Leguminosae, Malvaceae, Solanaceae, Euphorbiaceae, Rubiaceae, Amaranthaceae, Convolvulaceae e Verbenaceae, são as mais importantes em relação à cultura. As plantas coletadas, devidamente etiquetadas e identificadas, foram anexadas, parte delas no PAMG (Herbário da EPAMIG, Belo Horizonte, MG e, a outra parte, no Herbarium ESAL (Herbário do Departamento de Biologia da Escola Superior de Agricultura de Lavras - ESAL, Lavras - MG.A survey in the cultivation area of coffee in the State of Minas Gerais, Brazil, has resulted in the determination of 388 weed species, of 182 genera belonging to 51 families; the families presenting a greater number of espécies are: Compositae, Leguminosae, Gramineae, Malvaceae, Solanaceae, Rubiaceae, Convolvulaceae, Euphorbiaceae, Amaranthaceae and Verbenaceae with 65, 48, 42, 30, 19, 17, 16, 14, 12, 10 species, respectively.

  20. LEVANTAMENTO DA FLORA MELÍFERA DE INTERESSE APÍCOLA NO MUNICÍPIO DE PETROLINA-PE

    Directory of Open Access Journals (Sweden)

    Rafael Francisco Santos

    2006-01-01

    Full Text Available This study had the objective of surveying the apicultural potential in the municipality of Petrolina flora (9o9'S; 40o22'W, aiming at identifying the nectariferous or polliniferous species visited by Apis mellifera. The observations were carried out from January 2004 to May 2005, in areas of hyperxerophilous Caatinga native vegetation and of irrigated fruit crops of Embrapa Tropical Semi-Arid. Fifty one species were observed, belonging to 42 genera and 25 botanic families. The families Leguminosae, Anacardiaceae, Convolvulaceae, Rubiaceae and Sterculiaceae were the most visited species by Apis mellifera, including 47.08% of the total visited plants. Among the species visited by Apis mellifera, 41.17% are herbaceous, showing the importance of this stratum as an apicultural source. Regarding the flora resource used as food source by the bees, it was found that A. mellifera made several visits for exclusive nectar extraction to 72.55% of the plants considered nectariferous. Among the remaining plants, it was found that in 19.60% the bee collecte pollen, being these species considered polliniferous, and in 7.85% there was pollen and nectar withdrawal. Among the herbaceous species, Borreria verticillata (L. G.Mey., Diodia teres Walter (Rubiaceae, Waltheria rotundifolia Schrank (Sterculiaceae, Merremia aegyptia (L. Hallier, Jacquemontia confusa Meisn. (Convolvulaceae, Hypenia salzmanni (Benth. Hanley (Lamiaceae distinguished as nectariferous source during the raining season, while the arboreal species Schinopsis brasiliensis Engl. and Myracrodruon urundeuva Allemão. are considered apicultural source for the dry season.

  1. Polen de las Mieles de la Patagonia Andina (Chubut-Argentina Pollen of honeys from the Andean Patagonia (Chubut-Argentina

    Directory of Open Access Journals (Sweden)

    Alicia Forcone

    2006-07-01

    Full Text Available Se describen e ilustran mediante fotomicrografías tomadas con MO y MEB, 30 tipos polínicos, determinados en las mieles producidas en la región andina de Chubut (Patagonia Argentina. Los tipos morfológicos descriptos pertenecen a las siguientes familias: Alstroemeriaceae, Apiaceae, Buddlejaceae, Caryophyllaceae, Caprifoliaceae, Celastraceae, Clusiaceae, Convolvulaceae, Ericaceae, Elaeocarpaceae, Fabaceae, Fagaceae, Lamiaceae, Papaveraceae, Polemoniaceae, Polygalaceae, Proteaceae, Ranunculaceae, Rosaceae, Saxifragaceae, Solanaceae, Thymelaceae y Verbenaceae. La mayoría de los tipos polínicos descriptos fueron hallados en las mieles como polen de menor importancia o traza con excepción de Aristotelia chilensis y Escallonia sp., que alcanzaron la categoría de polen dominante, y de Lomatia hirsuta, hallada como polen secundario.Thirty pollen types identified in the honeys from the Andean region of Chubut are described and illustrated by means of LM and SEM photomicrographs. Pollen types belong to the following families: Alstroemeriaceae, Apiaceae, Buddlejaceae, Caryophyllaceae, Caprifoliaceae, Celastraceae, Clusiaceae, Convolvulaceae, Ericaceae, Elaeocarpaceae, Fabaceae, Fagaceae, Lamiaceae, Papaveraceae, Polemoniaceae, Polygalaceae, Proteaceae, Ranunculaceae, Rosaceae, Saxifragaceae, Solanaceae, Thymelaceae, and Verbenaceae. Most pollen types described were found in the honeys as minor important pollen or traces, except Aristotelia chilensis, Escallonia sp., which reached the category of dominant pollen, and Lomatia hirsuta, which was found as secondary pollen.

  2. Metabolite variability in Caribbean sponges of the genus Aplysina

    Directory of Open Access Journals (Sweden)

    Monica Puyana

    Full Text Available Abstract Sponges of the genus Aplysina are among the most common benthic animals on reefs of the Caribbean, and display a wide diversity of morphologies and colors. Tissues of these sponges lack mineralized skeletal elements, but contain a dense spongin skeleton and an elaborate series of tyrosine-derived brominated alkaloid metabolites that function as chemical defenses against predatory fishes, but do not deter some molluscs. Among the earliest marine natural products to be isolated and identified, these metabolites remain the subject of intense interest for commercial applications because of their activities in various bioassays. In this study, crude organic extracts from 253 sponges from ten morphotypes among the species Aplysina archeri,Aplysina bathyphila,Aplysina cauliformis,Aplysina fistularis,Aplysina fulva,A. insularis, and Aplysina lacunosa were analyzed by liquid chromatography–mass spectrometry (LC–MS to characterize the pattern of intra- and interspecific variabilities of the twelve major secondary metabolites present therein. Patterns across Aplysina species ranged from the presence of mostly a single compound, fistularin-3, in A. cauliformis, to a mixture of metabolites present in the other species. These patterns did not support the biotransformation hypothesis for conversion of large molecular weight molecules to smaller ones for the purpose of enhanced defense. Discriminant analyses of the metabolite data revealed strong taxonomic patterns that support a close relationship between A. fistularis,A. fulva and A. insularis, while two morphotypes of A. cauliformis (lilac creeping vs. brown erect were very distinct. Two morphotypes of A. lacunosa, one with hard tissue consistency, the other soft and thought to belong to a separate genus (Suberea, had very similar chemical profiles. Of the twelve metabolites found among samples, variation in fistularin-3, dideoxyfistularin-3 and hydroxyaerothionin provided the most predictive

  3. Inquérito epidemiológico sobre plantas tóxicas das mesoregiões Central e Oeste do Rio Grande do Norte

    Directory of Open Access Journals (Sweden)

    Severino Antonio Geraldo Neto

    2013-07-01

    Full Text Available Foi realizado um estudo para determinar as plantas tóxicas incriminadas como de interesse zootécnico em 35 municípios das mesorregiões Central e Oeste do estado do Rio Grande do Norte (RN. Foram entrevistados 180 produtores, 20 médicos veterinários, 12 técnicos agrícolas e 5 agrônomos. Os dados obtidos nas entrevistas foram compilados e analisados com auxílio do programa Epi Info versão 6.04. As plantas tóxicas relatadas pelos entrevistados como causadoras de diversos surtos foram Ipomoea asarifolia, Aspidosperma pyrifolium, Indigofera suffruticosa, Manihot carthaginensis subsp. glaziovii, Amorimia septentrionalis, Tephrosia cinerea, Anadenanthera colubrina var. cebil, Marsdenia megalantha, Anacardium occidentale, Cnidoscolus quercifolius, Crotalaria retusa, Froelichia humboldtiana, Ipomoea carnea, Leucaena leucocephala, Manihot esculenta, Mimosa tenuiflora, Nerium oleander, Prosopis juliflora, Ricinus communis, Sorghum bicolor, Sorghum halepense e Urochloa (Brachiaria decumbens.

  4. A comparative study of cadmium phytoextraction by accumulator and weed species

    International Nuclear Information System (INIS)

    Ghosh, Moyukh; Singh, S.P.

    2005-01-01

    Phytoextraction has shown great potential as an alternative technique for the remediation of metal contaminated soils. The objective of this study was to investigate cadmium (Cd) phytoextraction ability of high biomass producing weeds in comparison to indicator plant species. The pot study conducted with 10 to 200 mg Cd kg -1 soil indicated that Ipomoea carnea was more effective in removing Cd from soil than Brassica juncea. Among the five species, B. juncea accumulated maximum Cd, but I. carnea followed by Dhatura innoxia and Phragmytes karka were the most suitable species for phytoextraction of cadmium from soil, if the whole plant or above ground biomass is harvested. In the relatively short time of this experiment, I. carnea produced more than 5 times more biomass in comparison to B. juncea. There were significant differences (p < 0.05) between the shoot length and shoot mass of control and treated plants. - Ipomoea carnea was more effective in extracting cadmium than was Brassica juncea

  5. The Influence of the Ratio of Nitrate to Ammonium Nitrogen on Nitrogen Removal in the Economical Growth of Vegetation in Hybrid Constructed Wetlands

    Directory of Open Access Journals (Sweden)

    Haq Nawaz Abbasi

    2017-03-01

    Full Text Available Growing vegetables economically in the use of constructed wetland for wastewater treatment can play a role in overcoming water and food scarcity. Allium porrum L., Solanum melongena L., Ipomoea aquatica Forsk., and Capsicum annuum L. plants were selected to grow in hybrid constructed wetland (CW under natural conditions. The impact of the ratio of nitrate to ammonium nitrogen on ammonium and nitrate nitrogen removal and on total nitrogen were studied in wastewater. Constructed wetland planted with Ipomoea aquatica Forsk. and Solanum melongena L. showed higher removal efficiency for ammonium nitrogen under higher ammonium concentration, whereas Allium porrum L.-planted CW showed higher nitrate nitrogen removal when NO3–N concentration was high in wastewater. Capsicum annuum L.-planted CW showed little efficiency for both nitrogen sources compared to other vegetables.

  6. Epigenetic regulation of photoperiodic flowering

    OpenAIRE

    Takeno, Kiyotoshi

    2010-01-01

    The cytidine analogue 5-azacytidine, which causes DNA demethylation, induced flowering in the non-vernalization-requiring plants Perilla frutescens var. crispa, Silene armeria and Pharbitis nil (synonym Ipomoea nil) under non-inductive photoperiodic conditions, suggesting that the expression of photoperiodic flowering-related genes is regulated epigenetically by DNA methylation. The flowering state induced by DNA demethylation was not heritable. Changes in the genome-wide methylation state we...

  7. AcEST: DK949288 [AcEST

    Lifescience Database Archive (English)

    Full Text Available e dehydrogenase (Fragment) OS=Arab... 50 7e-05 tr|Q84JM5|Q84JM5_IPONI Angustifolia OS=Ipomoea nil GN=IAN PE=... 0.015 tr|B6U1W6|B6U1W6_MAIZE Angustifolia OS=Zea mays PE=2 SV=1 42 0.015 tr|A3C6

  8. AcEST: BP916224 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 70 5e-11 tr|A3C6S4|A3C6S4_ORYSJ Putative uncharacterized protein OS=Oryza... 70 5e-11 tr|B6U1W6|B6U1W6_MAIZE Angus...ent) OS=Arab... 65 2e-09 tr|Q84JM5|Q84JM5_IPONI Angustifolia OS=Ipomoea nil GN=IA

  9. Alimentation des lapins ( Oryctolagus cuniculus L.) à base de Azolla ...

    African Journals Online (AJOL)

    Les systèmes intégrés de production constituent l'une des voies essentielles pour une agriculture durable. Cette étude a pour but d'évaluer l'effet d'une alimentation à base de Azolla filiculoïdes, Elaeis guineensis, Ipomoea aquatica et Panicum maximum sur les performances zootechniques des lapins et le potentiel nutritif ...

  10. The Significance of Wild Plants in the Evolutionary Ecology of Three Major Viruses Infecting Cultivated Sweetpotato in Uganda

    OpenAIRE

    Tugume Kajungu, Arthur

    2010-01-01

    The studies presented in this thesis contribute to the understanding of evolutionary ecology of three major viruses threatening cultivated sweetpotato (Ipomoea batatas Lam) in East Africa: Sweet potato feathery mottle virus (SPFMV; genus Potyvirus; Potyviridae), Sweet potato chlorotic stunt virus (SPCSV; genus Crinivirus; Closteroviridae) and Sweet potato mild mottle virus (SPMMV; genus Ipomovirus; Potyviridae). The viruses were serologically detected and the positive results confirmed b...

  11. Distribución e identificación de especies hospedantes de Heterodera glycines Ichinohe raza 3 en el Valle del Cauca

    Directory of Open Access Journals (Sweden)

    Varón de Agudelo Francia

    1988-06-01

    Full Text Available Se dividió la parte plana del Valle del Cauca en tres zonas (norte, centro y sur, habiéndose visitado 33 fincas. En la zona norte las malezas con mayor porcentaje de frecuencia y distribución en los cultivos de soya fueron Digitaria horizontalis, Echinochloa colonum y Leptochloa filiformis; en la zona centro Ipomoea hirta, Amaranthus dubius y Echinochloa colonum y en la zona sur predominaron Ipomoea hirta, Portulaca oleracea Cyperus rotundus. Los análisis de muestras de suelo y raíces indicaron que H. glycines se encuentra distribuido en todo el Valle del Cauca, presentando la zona sur (Candelaria, Palmira y Puerto Tejada las mayores poblaciones. Entre las especies evaluadas (malezas, cultivos, leguminosas forrajeras y silvestres, solamente Glycine max y Phaseolus vulgaris se consideraron como susceptibles a H. glycines raza 3. y P. angularis y P. multiflora permitieron muy poca infección y multiplicación del nemátodo.A nematode recognition of Heterodera glycines was focused on crops of soybean. Valle del Cauca was divided in three zones (northen, central and southern and 33 farms were visited. The results of the analysis on samples of soils and roots showe that Heterodera glycines is scattered throughout Valle del Cauca, being the southern zone (Palmira, Candelaria and Puerto Tejada the one having the highest standards in nematode population. Weeds showing a greater frequency percentage were : Digitaria horizontalis, Echinochloa colonum and Leptochloa filiformis, in the northen zone; Ipomoea hirta, Amaranthus dubius and Echinochloa colonum, in the central zone, and Ipomoea hirta, Portulaca oleracea and Cyperus rotundus, in the southern zone , From among the whole species evaluated (weeds, crops, leguminous a n d fodder plants, Glycine max and Phaseolus vulgaris were considered to be susceptible to H. Glycines race 3. Phaseolus angularis y P. multiflora let low population levels.

  12. Tuber Storage Proteins

    OpenAIRE

    SHEWRY, PETER R.

    2003-01-01

    A wide range of plants are grown for their edible tubers, but five species together account for almost 90 % of the total world production. These are potato (Solanum tuberosum), cassava (Manihot esculenta), sweet potato (Ipomoea batatus), yams (Dioscorea spp.) and taro (Colocasia, Cyrtosperma and Xanthosoma spp.). All of these, except cassava, contain groups of storage proteins, but these differ in the biological properties and evolutionary relationships. Thus, patatin from potato exhibits act...

  13. AcEST: DK960896 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ke protein OS=Ipomoea b... 57 4e-07 tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 57 6...SNC C DPC C Sbjct: 45 KATEGGHACKCGSNCPC-DPCNC 66 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla

  14. AcEST: BP912573 [AcEST

    Lifescience Database Archive (English)

    Full Text Available protein OS=Ipomoea b... 55 2e-06 tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 54 3e-0...DPCTC 217 + T G+ACKCGSNC C DPC C Sbjct: 45 KATEGGHACKCGSNCPC-DPCNC 66 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azoll

  15. AcEST: DK958586 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Ipomoea b... 57 3e-07 tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla ... 57 6e-07 tr|O8...PC C Sbjct: 45 KATEGGHACKCGSNCPC-DPCNC 66 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla f

  16. Hilly grasses and leaves: a promising unconventional feed resource for livestock.

    OpenAIRE

    Hossain M.E.; Karim M.H.; Ahmed M.I.; Sultana S.A.

    2016-01-01

    The study was undertaken to find out the chemical composition of different hilly grasses and leaves available in Bandarban areas of Bangladesh. Total 10 different hilly grasses and leaves such as Bottle gourd leaf (Lagenaria siceraria), Castor bean leaf (Ricinus communis), Cogon grass (Imperata cylindrica), Dhol kolmi (Ipomoea carnea), Giant reed leaf (Arundo donax), Hilly grass (Cynodon dactylon), Pithraj leaf (Aphanamixis polystachya), Sal leaf (Shorea robusta), Shegun leaf (Tectona grandis...

  17. Uptake of Mn and Cd by Wild Water Spinach and Their Bioaccumulation and Translocation Factors

    OpenAIRE

    Billy Teck Huat Guan; Ferdaus Mohamat-Yusuff; Normala Halimoon; Christina Seok Yien Yong

    2017-01-01

    Polluted ponds and lakes close to agricultural activities become the exposure route of manganese (Mn) and cadmium (Cd) to aquatic plants in near vicinity. Therefore, a study of the uptake, bioaccumulation, and translocation of Mn and Cd by the water spinach (Ipomoea aquatica) is presented in this paper. Different concentrations of Mn and Cd were added to the hydroponic nutrient solution that was used to grow the plants for the heavy metal uptake experiment under greenhouse conditions. The pla...

  18. AcEST: DK944467 [AcEST

    Lifescience Database Archive (English)

    Full Text Available sults ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit_id O24339 Definition sp|O24339|CATA_SOLAP........................done Score E Sequences producing significant alignments: (bits) Value sp|O24339|CATA_SOLAP...TA_IPOBA Catalase OS=Ipomoea batatas PE=2 SV=1 248 2e-65 >sp|O24339|CATA_SOLAP Ca

  19. Floral traits driving reproductive isolation of two co-flowering taxa that share vertebrate pollinators

    Science.gov (United States)

    Queiroz, Joel A.; Quirino, Zelma G. M.; Machado, Isabel C.

    2015-01-01

    Floral attributes evolve in response to frequent and efficient pollinators, which are potentially important drivers of floral diversification and reproductive isolation. In this context, we asked, how do flowers evolve in a bat–hummingbird pollination system? Hence, we investigated the pollination ecology of two co-flowering Ipomoea taxa (I. marcellia and I. aff. marcellia) pollinated by bats and hummingbirds, and factors favouring reproductive isolation and pollinator sharing in these plants. To identify the most important drivers of reproductive isolation, we compared the flowers of the two Ipomoea taxa in terms of morphometry, anthesis and nectar production. Pollinator services were assessed using frequency of visits, fruit set and the number of seeds per fruit after visits. The studied Ipomoea taxa differed in corolla size and width, beginning and duration of anthesis, and nectar attributes. However, they shared the same diurnal and nocturnal visitors. The hummingbird Heliomaster squamosus was more frequent in I. marcellia (1.90 visits h−1) than in I. aff. marcellia (0.57 visits h−1), whereas glossophagine bats showed similar visit rates in both taxa (I. marcellia: 0.57 visits h−1 and I. aff. marcellia: 0.64 visits h−1). Bat pollination was more efficient in I. aff. marcellia, whereas pollination by hummingbirds was more efficient in I. marcellia. Differences in floral attributes between Ipomoea taxa, especially related to the anthesis period, length of floral parts and floral arrangement in the inflorescence, favour reproductive isolation from congeners through differential pollen placement on pollinators. This bat–hummingbird pollination system seems to be advantageous in the study area, where the availability of pollinators and floral resources changes considerably throughout the year, mainly as a result of rainfall seasonality. This interaction is beneficial for both sides, as it maximizes the number of potential pollen vectors for plants and

  20. Notas sobre la flora de Colombia y países vecinos, II

    Directory of Open Access Journals (Sweden)

    Dugand Armando

    1968-09-01

                       Lonchocarpus dipteroneurus Pittier.                                                ∆Pterocarpus acapulcensis Rose. Rhamnaceae.                     Colubrina heteroneura (Griseb. StandI.                                                Ziziphus cyclocardia Blake.                                                ∆Ziziphus saeri Pittier. Simaroubaceae.                 Simaba ferruginea St. Hil. B. - Especies que ya habían sido anotadas anteriormente en la flora Colombiana:Boraginaceae.                     Tournefortia maculata Jacq.                                                Tournefortia volubilis L. Cactaceae.                           Acanthocereus sicariguensis Croiz. & Tamayo.                                                Pilosocereus lanuginosus (L. Byl. & Rowl. Celastraceae.                      Schaefferia frutescens Jacq. Convolvulaceae.                 Ipomoea incarnata (Vahl Choisy. Euphorbiaceae.                   *Chamaesyce sanmartensis (Rushy Dugand. Leguminosae- Faboideae.                           Flemingia strobilifera (L. R. Br.                                                Machaerium bondaense Pittier.                                                Pterocarpus floribundus Pittier. Leguminosae- Mimosoideae.                      Senegalia guacamayo Britt. & Killip. Loranthaceae.                     Phthirusa adunca (Mey. Maguire.                                

  1. The physical growth of Oreochromis niloticus and three plant species on the aquaponic technology

    Science.gov (United States)

    Mustikasari, A.; Marwoto, P.; Iswari, R. S.

    2018-03-01

    The physical growth of Oreochromis niloticus fish and three types of plants consist of Ipomoea Aquatica, Brassica rapa, and Capsicum annuum on the aquaponic technology have been studied. The aquaponic technology system has been done with 200 fishes m-3, water pump with 15 watts solar energy panel, physical and biological filter, and deep flow technique (DFT). In this study, we have reported that the specific growth rate (SGR), survival (SR), Feed conversion ratio (FCR), and Wet weight (W) are used as the physical growth indicator of Oreochromis niloticus fish, while the length and the number of leaves of plants are used as the physical growth indicator of plants. The physical growth of Oreochromis niloticus fish showed that SGR is 5,56% day-1, SR is 97,67%, FCR is 0,92g and the wet weight is 1220g. The physical growth of the plant in aquaponic technology systems has been compared with the hydroponic treatment systems as controls. Analysis with t-test shows that physical growth of Ipomoea Aquatica and Brassica rapa has no significant difference respectively, whereas Capsicum annuum has significant differences compared with controls. Also, Brassica rapa in the aquaponic technology system shows a more yellow leaf color than the control. Based on these results, we conclude that aquaponic technology system provides effective results for the physical growth of Oreochromis niloticus with Ipomoea Aquatica, while additional nutrients for the both Brassica rapa and Capsicum annuum are required.

  2. Reactivity of bacterial and fungal laccases with lignin under alkaline conditions.

    Science.gov (United States)

    Moya, Raquel; Saastamoinen, Päivi; Hernández, Manuel; Suurnäkki, Anna; Arias, Enriqueta; Mattinen, Maija-Liisa

    2011-11-01

    The ability of Streptomyces ipomoea laccase to polymerize secoisolariciresinol lignan and technical lignins was assessed. The reactivity of S. ipomoea laccase was also compared to that of low redox fungal laccase from Melanocarpus albomyces using low molecular mass p-coumaric, ferulic and sinapic acid as well as natural (acetosyringone) and synthetic 2,2,6,6-tetramethylpiperidine 1-oxyl (TEMPO) mediators as substrates. Oxygen consumption measurement, MALDI-TOF MS and SEC were used to follow the enzymatic reactions at pH 7, 8, 9 and 10 at 30°C and 50°C. Polymerization of lignins and lignan by S. ipomoea laccase under alkaline reaction conditions was observed, and was enhanced in the presence of acetosyringone almost to the level obtained with M. albomyces laccase without mediator. Reactivities of the enzymes towards acetosyringone and TEMPO were similar, suggesting exploitation of the compounds and low redox laccase in lignin valorization under alkaline conditions. The results have scientific impact on basic research of laccases. Copyright © 2011 Elsevier Ltd. All rights reserved.

  3. Toxic plants affecting the nervous system of ruminants and horses in Brazil

    Directory of Open Access Journals (Sweden)

    Franklin Riet-Correa

    Full Text Available ABSTRACT: This review updates information about neurotoxic plants affecting ruminants and equidae in Brazil. Currently in the country, there are at least 131 toxic plants belonging to 79 genera. Thirty one of these poisonous plants affect the nervous system. Swainsonine-containing plants (Ipomoea spp., Turbina cordata and Sida carpinifolia cause numerous outbreaks of poisoning, mainly in goats, but cattle and horses are occasionally affected. The poisoning by Ipomoea asarifolia, a tremorgenic plant, is very common in sheep, goats and cattle in the Northeastern region and in the Marajo island. Poisoning by the pods of Prosopis juliflora are frequent in cattle in Northeastern Brazil; occasionally this poisoning affects goats and more rarely sheep. Some poisonings by plants, such as Hybanthus calceolaria, Ipomoea marcellia and Talisia esculenta in ruminants and Indigofera lespedezioides in horses were recently described and needs to be accurately investigated about its occurrence and importance. Other plants poisonings causing nervous signs in ruminants and equidae are less important, but should be considered for the differential diagnosis of neurologic diseases.

  4. Zanclean/Piacenzian transition on Cyprus (SE Mediterranean): calcareous nannofossil and Sea Surface Temperatures evidence of sapropel formation

    Science.gov (United States)

    Athanasiou, Maria; Triantaphyllou, Maria; Bouloubassi, Ioanna; Dimiza, Margarita; Gogou, Alexandra; Klein, Vincent; Parinos, Constantine; Theodoroyu, George

    2016-04-01

    Quantitative analyses of calcareous nannofossils in the sediments of Pissouri South section on the island of Cyprus have produced a paleoceanographic record reflecting the paleoclimatic conditions during Zanclean/Piacenzian transition. According to the performed calcareous nannofossil biostratigraphy the studied section is correlated with MNN14/15 and MNN16 calcareous nannofossil biozones and is astronomically dated between 4.065 and 3.217 Ma. Intervals of increased organic carbon content along with the positive values of Florisphaera profunda, Helicosphaera sellii, Discoaster spp. and the subsequent increase of stratification S-index correspond to the sapropel deposition during periods of wetter climate and intense continental runoff especially from the river Nile. These layers are alternating with grey marly intervals, featured by the increased values of small placoliths of Reticulofenestra and Gephyrocapsa species, which are indicative of eutrophic conditions during intense surface waters mixing. Pissouri South section comprises a SSTs sequence using alkenone unsaturation index (Uk 37) providing with the first continuous record from SE Mediterranean covering the Zanclean/Piacenzian (Pliocene) transition (~ 4.1-3.2 Ma). Correlation of the total alkenone concentration to the calcareous nannofossil assemblage and especially representatives among Noelaerhabdaceae family revealed that Pseudoemiliania lacunosa probably had similar temperature sensitivity to that of Emiliania huxleyi, currently producing alkenones in present day oceans.Our data support the prevalence of a generally warm phase characterized by the absence of high-frequency climate variations in the southeastern Mediterranean during the Zanclean/Piacenzian (Early/Late Pliocene) transition.

  5. Phytochemical study and evaluation of the antimicrobial activity and cytotoxicity of Cuscuta racemosa

    Directory of Open Access Journals (Sweden)

    Helena O. Ferraz

    2011-02-01

    Full Text Available Cuscuta racemosa Mart. is a parasitic plant of the Convolvulaceae family, used in popular medicine as an anti-inflammatory and a diuretic, for stomach and hepatic disorders, and for treating fresh wounds. This plant is popularly known as "cipó-chumbo" and "fios-de-ovos". In this study, it was chemically investigated and tested for its antimicrobial activity and cytotoxicity. The flavonoid and tannin content of the dried plant were 2.79% and 2.01%, respectively. Furthermore, the 4'-methoxyquercetin flavanoid compound was isolated from the ethanolic fraction. The minimum inhibiting concentration in the antimicrobial test was 2.0 mg/ml for Staphylococcus aureus, and a DL50 of 0.231 mg/mL was obtained in the cytotoxicity experiment. The fraction directed to alkaloids was able to eliminate 100% of the brine shrimp used for the test.

  6. Hepatoprotective and antioxidant effects of Cuscuta chinensis against acetaminophen-induced hepatotoxicity in rats.

    Science.gov (United States)

    Yen, Feng-Lin; Wu, Tzu-Hui; Lin, Liang-Tzung; Lin, Chun-Ching

    2007-04-20

    Tu-Si-Zi, the seeds of Cuscuta chinensis Lam. (Convolvulaceae), is a traditional Chinese medicine that is commonly used to nourish and improve the liver and kidney conditions in China and other Asian countries. As oxidative stress promotes the development of acetaminophen (APAP)-induced hepatotoxicity, the aim of the present study was to evaluate and compare the hepatoprotective effect and antioxidant activities of the aqueous and ethanolic extracts of C chinensis on APAP-induced hepatotoxicity in rats. The C chinensis ethanolic extract at an oral dose of both 125 and 250mg/kg showed a significant hepatoprotective effect relatively to the same extent (PCuscuta chinensis can prevent hepatic injuries from APAP-induced hepatotoxicity in rats and this is likely mediated through its antioxidant activities.

  7. Ipomea hederacea Jacq.: A Medicinal Herb with Promising Health Benefits

    Directory of Open Access Journals (Sweden)

    Vincenzo De Feo

    2012-11-01

    Full Text Available Ipomea hederacea Jacq. (kaladana or ivy leaf morning-glory, a member of the family Convolvulaceae, is used primarily for its seeds and recognized for its medicinal properties, especially in Asian countries. This medicinal herb contains various valuable chemical constituents such as ecdysteriods, steroidal glycosides, aromatic acids, triterpenes, amino acids, organic acids, mineral elements and vitamins. A number of pharmacological properties such as diuretic, anthelmintic, blood purifier, deobstruent, laxative, carminative and anti-inflammatory actions have been ascribed to this plant, besides its use to treat abdominal diseases, fevers, headache and bronchitis. This review focuses on compositional, medicinal and therapeutic properties of this plant, as a potential sources of bioactive molecules for medicinal and nutraceutical applications.

  8. Fitossociologia de comunidades de plantas daninhas em agroecossistema cana-crua Phytosociology of weed community in no-burn sugar cane agroecosystems

    Directory of Open Access Journals (Sweden)

    M.A. Kuva

    2007-09-01

    Full Text Available Objetivou-se neste trabalho estudar a fitossociologia de comunidades de plantas daninhas de canaviais colhidos no sistema mecanizado, sem queima prévia da palha, e a similaridade entre talhões quanto à composição de espécies. Os levantamentos foram realizados em 28 talhões comerciais na região de Ribeirão Preto-SP. Em cada talhão foram demarcadas áreas de coleta e avaliação, na proporção de duas por hectare, mantidas sem controle, e que serviram de local para as amostragens de plantas daninhas. As amostragens foram feitas com quadrados vazados (0,5 x 0,5 m, lançados aleatoriamente duas vezes em cada uma das áreas. Essas amostragens foram realizadas determinando-se a densidade e a biomassa específica aos 120 dias após o corte da cana. Cyperus rotundus foi a principal espécie, destacando-se quanto aos valores de importância relativa (IR. As plantas dicotiledôneas anuais de propagação por sementes também se destacaram, dentre as quais diversas espécies das famílias Euphorbiaceae e Convolvulaceae. Em contrapartida, as gramíneas tradicionais de áreas de cana colhida queimada tiveram pouco destaque. O índice de Shannon (H de diversidade de espécies das comunidades variou de 0 a 1,61, e o índice de similaridade entre os talhões (S foi muito variável. A maioria das espécies ou grupo de espécies apresentou padrão agregado (V/m > 1,00, com valores relativamente altos de índice de agregação (V/m. Entretanto, na maioria dos casos, Cyperus rotundus e as Convolvulaceas apresentaram os maiores índices.A study was carried out in northeastern São Paulo, Brazil to evaluate the similarity between species composition and phytosociological index in weed communities of no-burn sugar cane crop harvest at different times and number of cut-cycles. Assessments were carried out in twenty-eight sugar cane plots in the Ribeirao Preto-SP region. In each plot, collection and evaluation areas were established, two per hectare, kept

  9. Floral preferences of a neotropical stingless bee, Melipona quadrifasciata Lepeletier (Apidae: Meliponina) in an urban forest fragment.

    Science.gov (United States)

    Antonini, Y; Costa, R G; Martins, R P

    2006-05-01

    Species of plants used by Melipona quadrifasciata Lepeletier for pollen and nectar gathering in an urban forest fragment were recorded in Belo Horizonte, Minas Gerais, Brazil. Melipona quadrifasciata visited 22 out of 103 flowering plant species. The plant species belonged mainly to Myrtaceae, Asteraceae, and Convolvulaceae (64% of the visits). Melipona quadrifasciata tended to collect pollen or nectar each time, except for Myrtaceae species, from which both pollen and nectar were collected. Bee abundance at flowers did not significantly correlate to food availability (expressed by flowering plant richness). We found a relatively high similarity (50%) between plant species used by M. quadrifasciata, which was also found in studies carried out in São Paulo State. However, low similarity (17%) was found between the results of this study and those of another done in Bahia State, Brazil.

  10. Floral preferences of a neotropical stingless bee, Melipona quadrifasciata Lepeletier (Apidae: Meliponina in an urban forest fragment

    Directory of Open Access Journals (Sweden)

    Y. Antonini

    Full Text Available Species of plants used by Melipona quadrifasciata Lepeletier for pollen and nectar gathering in an urban forest fragment were recorded in Belo Horizonte, Minas Gerais, Brazil. Melipona quadrifasciata visited 22 out of 103 flowering plant species. The plant species belonged mainly to Myrtaceae, Asteraceae, and Convolvulaceae (64% of the visits. Melipona quadrifasciata tended to collect pollen or nectar each time, except for Myrtaceae species, from which both pollen and nectar were collected. Bee abundance at flowers did not significantly correlate to food availability (expressed by flowering plant richness. We found a relatively high similarity (50% between plant species used by M. quadrifasciata, which was also found in studies carried out in São Paulo State. However, low similarity (17% was found between the results of this study and those of another done in Bahia State, Brazil.

  11. Phytochemical study and evaluation of the antimicrobial activity and cytotoxicity of Cuscuta racemosa

    Directory of Open Access Journals (Sweden)

    Helena O. Ferraz

    2010-11-01

    Full Text Available Cuscuta racemosa Mart. is a parasitic plant of the Convolvulaceae family, used in popular medicine as an anti-inflammatory and a diuretic, for stomach and hepatic disorders, and for treating fresh wounds. This plant is popularly known as "cipó-chumbo" and "fios-de-ovos". In this study, it was chemically investigated and tested for its antimicrobial activity and cytotoxicity. The flavonoid and tannin content of the dried plant were 2.79% and 2.01%, respectively. Furthermore, the 4'-methoxyquercetin flavanoid compound was isolated from the ethanolic fraction. The minimum inhibiting concentration in the antimicrobial test was 2.0 mg/ml for Staphylococcus aureus, and a DL50 of 0.231 mg/mL was obtained in the cytotoxicity experiment. The fraction directed to alkaloids was able to eliminate 100% of the brine shrimp used for the test.

  12. Phytotoxic activity of flavonoids from Dicranostyles ampla.

    Science.gov (United States)

    Castro, Amaya; Cantrell, Charles L; Hale, Amber L; Duke, Stephen O

    2010-08-01

    Crude extracts from over 16 species of plants from the family Convolvulaceae were evaluated for phytotoxic activity against Agrostis stolonifera (bentgrass) and Lactuca sativa (lettuce) at 1000 microg/mL. Ethanol extracts of Dicranostyles ampla Ducke were among the most active of those species tested. Systematic bioassay-guided fractionation of the ethanol extract of the aerial parts from this species was performed to identify specifically the phytotoxic compounds. Two phytotoxic flavonoids, dihydromyricetin (1) and myricetin-3-O-alpha-rhamnoside or myricetrin (2), were found to be responsible for much of the activity of the extract as a whole in the A. stolonifera and L. sativa bioassay. In a Lemna paucicostata bioassay, 1 and 2 had no activity at 100 microM.

  13. Floristic diversity and survival strategies of climbers in a Caatinga fragment in the municipality of Porto da Folha, Sergipe, Brazil

    Directory of Open Access Journals (Sweden)

    Diogo Gallo Oliveira

    2015-03-01

    Full Text Available A floristic survey of climbing species in a Caatinga fragment in the municipality of Porto da Folha, state of Sergipe, Northeast Brazil, was conducted to determine their survival strategies during unfavorable seasons. Forty-five angiosperm species belonging to 29 genera and 14 families were counted. Species richness was higher than that recorded in other Caatinga areas. The most representative families were Convolvulaceae (8, Fabaceae (6, Apocynaceae (5, and Dioscoreaceae (5. Most of the climbers (64.4% were herbaceous. Therophytes represented the dominant lifestyle (51.1% and represented the main dry-season escape strategy. Climbers are important biological groups that require more studies on their autoecological aspects and their role in ecological communities and should be considered in the establishment of biodiversity conservation strategies.

  14. Floristic diversity and survival strategies of climbers in a Caatinga fragment in the municipality of Porto da Folha, Sergipe, Brazil

    Directory of Open Access Journals (Sweden)

    Diogo Gallo de Oliveira

    2015-05-01

    Full Text Available A floristic survey of climbing species in a Caatinga fragment in the municipality of Porto da Folha, state of Sergipe, Northeast Brazil, was conducted to determine their survival strategies during unfavorable seasons. Forty-five angiosperm species belonging to 29 genera and 14 families were counted. Species richness was higher than that recorded in other Caatinga areas. The most representative families were Convolvulaceae (8, Fabaceae (6, Apocynaceae (5, and Dioscoreaceae (5. Most of the climbers (64.4% were herbaceous. Therophytes represented the dominant lifestyle (51.1% and represented the main dry-season escape strategy. Climbers are important biological groups that require more studies on their autoecological aspects and their role in ecological communities and should be considered in the establishment of biodiversity conservation strategies.

  15. ANGIOSPERMAS DE LOS ARBUSTALES XERÓFILOS UBICADOS EN LOS ALREDEDORES DEL COMPLEJO LAGUNAR BOCARIPO-CHACOPATA, PENÍNSULA DE ARAYA, ESTADO SUCRE, VENEZUELA | ANGIOSPERMAE OF A XEROPHYTIC SHRUBLAND LOCATED AROUND BOCARIPO-CHACOPATA LAGOON COMPLEX, ARAYA PENINSULA, SUCRE STATE, VENEZUELA

    Directory of Open Access Journals (Sweden)

    Jesús Bello Pulido

    2016-08-01

    Full Text Available As a contribution to the floristic knowledge of xeric zones of the country, a list of angiospermae species is presented that are found forming part of a xerophytic shrubland, located around the Bocaripo-Chacopata lagoon complex, in Araya Peninsula, Sucre state. A total of 56 families was identified which comprised 142 genus, 180 species and 3 intraspecific taxa. The most dominant families regarding to the species number were: Fabaceae (24 spp., Poaceae (15 spp., Cactaceae (10 spp., Asteraceae, Euphorbiaceae (9 spp. c/u, Malvaceae (8 spp., Convolvulaceae (7 spp., Cyperaceae, Amaranthaceae (6 spp. c/u, Portulacaceae and Bromeliaceae (5 spp. c/u. Among the most important genera, were: Senna (4 spp., Capparis, Cyperus, Opuntia, Sida and Tillandsia (3 spp. c/u. The more common biotype was herbaceous vegetation, followed by shrubs, trees, climber, epiphytes and hemiparasites. The list includes two endemic species and 8 other included in the Red Book of the Flora of Venezuela.

  16. Vascular flora of an inselberg in the state of Paraíba, in Northeast Brazil

    Directory of Open Access Journals (Sweden)

    Elisabeth Emília Augusta Dantas Tölke

    2011-12-01

    Full Text Available This study characterized the floristic composition of an inselberg in the Puxinanã municipality, of Paraíba, in Northeast Brazil. Ninety-seven species were recorded that belong to 35 families: Asteraceae (12 spp., Euphorbiaceae and Fabaceae (nine spp. each, Rubiaceae and Convolvulaceae (eight spp. each were the richest families, comprising 47.42% of the total species registered. The herbaceous habit was predominant, occurring in 39% of the species, followed by species of shrubs (22%, vines (20%, rupicolous plants (6%, subshrubs (5%, trees (4% and epiphytes (1%. Passiflora luetzelburgii Harms (Passifloraceae is a new record for the flora of the state. The data from this study provides information that could be used in the conservation and rational use of the study area, and contributes to what is known about the flora and vegetation of the Caatinga.

  17. Intoxicações por plantas diagnosticadas em ruminantes e equinos e estimativa das perdas econômicas na Paraíba Plant poisonings diagnosed in ruminants and horses and estimation of the economical losses in Paraíba

    Directory of Open Access Journals (Sweden)

    Tales S. Assis

    2010-01-01

    Full Text Available Foi realizado um levantamento dos surtos de intoxicações por plantas em ruminantes e equinos diagnosticados no Laboratório de Patologia Veterinária (LPV, do Hospital Veterinário da Universidade Federal de Campina Grande, Campus de Patos, Paraíba, no período de 2000-2007. Em bovinos 7,4% dos diagnósticos realizados pelo LPV foram intoxicações por plantas. Foram diagnosticadas intoxicações por Centhraterum brachylepis (um surto, Brachiaria spp. (um surto, Crotalaria retusa (dois surtos, Ipomoea batatas (um surto, Marsdenia sp. (um surto, gramíneas contendo nitratos e nitritos (um surto por Echinochloa polystachya e dois surtos por Pennisetum purpureum, Palicourea aeneofusca (um surto, Prosopis juliflora (três surtos, Nerium oleander (um surto e Mimosa tenuiflora (sete surtos. Na espécie ovina 13% dos diagnósticos foram intoxicações por plantas. Os surtos foram causados por Ipomoea asarifolia (quatro surtos, Brachiaria spp. (três surtos, Crotalaria retusa (dois surtos, Tephrosia cinerea (dois surtos, Panicum dichotomiflorum (um surto, Mascagnia rigida (um surto e malformações associadas à ingestão de Mimosa tenuiflora (20 surtos. Nos caprinos, 6,4% dos diagnósticos corresponderam à intoxicação por plantas. Sete surtos foram causados por Mimosa tenuiflora, um por Ipomoea asarifolia, um por Ipomoea carnea, um por Ipomoea riedelli, três por Prosopis juliflora, um por Arrabidaea corallina, dois por Aspidosperma pyrifolium, dois por Turbina cordata e um por Opuntia ficus-indica. Na espécie equina 14% das doenças diagnosticadas foram devidas a intoxicações por plantas, sendo 12 surtos por Crotalaria retusa e um por Turbina cordata. As perdas na Paraíba por plantas tóxicas são estimadas em 3.895 bovinos, 8.374 ovinos, 6.390 caprinos e 366 equinos, que representam uma perda econômica anual, por morte de animais, de R$ 2.733.097,00. São relatados alguns aspectos epidemiológicos, sinais clínicos e patologia de surtos de

  18. Doenças do sistema nervoso central em caprinos e ovinos no semi-árido Diseases of the central nervous system in goats and sheep of the semiarid

    Directory of Open Access Journals (Sweden)

    Karla M.R. Guedes

    2007-01-01

    Full Text Available O conhecimento das doenças dos animais domésticos, nas diferentes regiões do Brasil é importante para determinar formas eficientes de profilaxia e controle. Este trabalho tem como objetivo descrever a epidemiologia, sinais clínicos e patologia das enfermidades do sistema nervoso central (SNC de caprinos e ovinos, que ocorreram de janeiro de 2000 a maio de 2006 no semi-árido, principalmente do estado da Paraíba. Durante o período, 365 casos ou surtos foram diagnosticados em caprinos e 270 em ovinos. Desses, 63 (9,92% eram doenças do SNC, sendo 34 (9,31% em caprinos e 29 (10,7% em ovinos. As principais enfermidades foram abscessos (19,04%, tétano (15,9%, raiva (9,52% intoxicação por Ipomoea asarifolia (7,93%, listeriose (6,34%, trauma (6,34%, polioencefalomalacia (4,77%, toxemia da prenhez (3,17%, ataxia enzoótica (3,17% e meningite (3,17%. Outras doenças diagnosticadas numa única oportunidade (1,59% foram intoxicações por Crotalaria retusa, Ipomoea carnea, Ipomoea sericophylla e Prosopis juliflora, otite com encefalite, malformação, linfossarcoma linfoblástico, meduloblastoma e necrose simétrica focal. Em 6,34% dos casos o diagnóstico foi inconclusivo.The knowledge of the diseases of domestic animals in the different Brazilian regions is important to determine measures for their control and prevention. The objective of this paper is to report the epidemiology, clinical signs and pathology of the diseases of the central nervous system (CNS of goats and sheep in the Brazilian semiarid, mainly in the state of Paraíba, diagnosed at the Veterinary Hospital of the Federal University of Campina Grande, from January 2000 to May 2006. During the period, 365 cases or outbreaks were diagnosed in goats and 270 in sheep. From these, 63 (9.92% were of diseases of the CNS, being 34 (9.31% in goats and 29 (10.7% in sheep. The main diseases were abscesses (19.04%, tetanus (15.9%, rabies (9.52% poisoning by Ipomoea asarifolia (7

  19. Impacts of environmental factors on the climbing behaviors of herbaceous stem-twiners.

    Science.gov (United States)

    Hu, Liang; Chen, Youfang; Liu, Meicun

    2017-11-01

    The curvature of the helical trajectory formed by herbaceous stem-twiners has been hypothesized to be constant on uniformly sized cylindrical supports and remains constant on different supports varying in diameter. However, experimental studies on the constant curvature hypothesis have been very limited. Here, we tested the hypothesis in a series of experiments on five herbaceous stem-twiners ( Ipomoea triloba , Ipomoea nil , Phaseolus vulgaris , Vigna unguiculata, and Mikania micrantha ). We investigated how internode characteristics (curvature [β], diameter [ d ], and length [ L ]) and success rate (SR) of twining shoots would be affected by support thickness ( D ), temperature ( T ), illumination, and support inclination. The results showed that: (1) the SR of tested species decreased, but d increased with increasing support thickness. The β of the twining shoots on erect cylindrical poles was not constant, but it decreased with increasing d or support thickness. (2) The SR of tested species was not obviously reduced under low-temperature conditions, but their β was significantly higher and d significantly lower when temperature was more than 5°C lower. (3) The SR , d, and L of two tested Ipomoea species significantly declined, but β increased under 50% shading stress. (4) The curvatures of upper semicycles of I. triloba shoots on 45° inclined supports were not significantly different from curvatures of those shoots climb on erect supports, whereas the curvatures of lower semicycles were 40%-72% higher than curvatures of upper semicycles. Synthesis : Our study illustrates that stem curvatures of a certain herbaceous stem-twiners are not constant, but rather vary in response to external support, temperature, and illumination conditions. We speculate that herbaceous stem-twiners positively adapt to wide-diameter supports by thickening their stems and by reducing their twining curvatures. This insight helps us better understand climbing processes and

  20. A reappraisal of the role of abscisic acid and its interaction with auxin in apical dominance.

    Science.gov (United States)

    Cline, Morris G; Oh, Choonseok

    2006-10-01

    Evidence from pea rms1, Arabidopsis max4 and petunia dad1 mutant studies suggest an unidentified carotenoid-derived/plastid-produced branching inhibitor which moves acropetally from the roots to the shoots and interacts with auxin in the control of apical dominance. Since the plant hormone, abscisic acid (ABA), known to inhibit some growth processes, is also carotenoid derived/plastid produced, and because there has been indirect evidence for its involvement with branching, a re-examination of the role of ABA in apical dominance is timely. Even though it has been determined that ABA probably is not the second messenger for auxin in apical dominance and is not the above-mentioned unidentified branching inhibitor, the similarity of their derivation suggests possible relationships and/or interactions. The classic Thimann-Skoog auxin replacement test for apical dominance with auxin [0.5 % naphthalene acetic acid (NAA)] applied both apically and basally was combined in similar treatments with 1 % ABA in Ipomoea nil (Japanese Morning Glory), Solanum lycopersicum (Better Boy tomato) and Helianthus annuus (Mammoth Grey-striped Sunflower). Auxin, apically applied to the cut stem surface of decapitated shoots, strongly restored apical dominance in all three species, whereas the similar treatment with ABA did not. However, when ABA was applied basally, i.e. below the lateral bud of interest, there was a significant moderate repression of its outgrowth in Ipomoea and Solanum. There was also some additive repression when apical auxin and basal ABA treatments were combined in Ipomoea. The finding that basally applied ABA is able partially to restore apical dominance via acropetal transport up the shoot suggests possible interactions between ABA, auxin and the unidentified carotenoid-derived branching inhibitor that justify further investigation.

  1. Biomonitoring of selected freshwater macrophytes to assess lake trace element contamination: a case study of Nal Sarovar Bird Sanctuary, Gujarat, India

    Directory of Open Access Journals (Sweden)

    Rita N. KUMAR

    2006-02-01

    Full Text Available A biomonitoring study was carried out at Nal Sarovar Bird Sanctuary, a proposed Ramsar site, Gujarat State, India, to ascertain the degree of trace element contamination. The study focused on assessment of trace element contamination in certain aquatic macrophytes to be used as biomonitors, in comparison with the sediments (abiotic monitor for heavy metal pollution. Good information was provided by analyzing roots, stems and leaves of native aquatic plants (biomonitors represented by eight species: Bergia odorata, Hydrilla verticillata, Ipomoea aquatica, Najas graminea, Nelumbo nucifera, Phragmites karka, Typha angustata and Vellisnaria spiralis, alongwith surface sediments and water, were analyzed for Cd, Co, Cu, Cu, Ni, Pb and Zn contamination. The highest concentrations of the trace elements were measured in Ipomoea aquatica and the lowest in Bergia odorata. Based on the concentration and toxicity status observed in the lake's vegetation, the six metals are arranged in the following decreasing order: Zn > Cu > Ni > Co > Pb > Cd. Compared with the standard, normal and critical toxicity range in plants, the detected values of Cd and Pb falls within normal range, while that of Co, Ni and Cu were within the critical range. However, Zn showed the highest concentration and alarming toxicity levels, which is considered as one of the most hazardous pollutants in Nal Sarovar Bird Sanctuary. Certain aquatic macrophytes species are also proposed as biomonitors for the investigated heavy metal pollutants. Such result was significant in the plant species such as Ipomoea aquatica and Phragmites karka, which are the two most useful species in biomonitoring studies due to their ability to accumulate elements in high concentration in the roots and their availability throughout the year. The results showed the significant difference in accumulation rate of some metals like Zn, Cu and Ni in different plant organs, which showed more accumulation in root than

  2. Density and Seasonal Dynamics of Bemisia tabaci (Gennadius) Mediterranean on Common Crops and Weeds around Cotton Fields in Northern China

    DEFF Research Database (Denmark)

    Zhang, Xiao-ming; Yang, Nian-wan; Wan, Fang-hao

    2014-01-01

    theophrasti Medicus), sunflower (Helianthus annuus L.), sweet potato (Ipomoea batatas L.), soybean (Glycine max L.), and maize (Zea mays L.). The whitefly species identity was repeatedly tested and confirmed; seasonal dynamics on the various host plants was standardized by the quartile method. B. tabaci MED......The density seasonal dynamics of Bemisia tabaci MED were evaluated over two-years in a cotton-growing area in Langfang, Hebei Province, northern China on cotton (Gossypium hirsutum L.) and six other, co-occurring common plants: common ragweed (Ambrosia artemisiifolia L.), piemarker (Abutilon...

  3. Embryogenesis in sweet potato, Ipomea batatas (L.) Lam

    International Nuclear Information System (INIS)

    Sonnino, A.; Mini, P.

    1997-01-01

    Sweet potato (Ipomoea batatas (L.) Lam) ranks sixth among the cultivated crops of the world. In fact, it represents a major staple food in many tropical countries. Recently this crop has been proposed as a source of starch for industrial utilization. Somatic embryogenesis could prove useful as an alternative to traditional propagation by cuttings, which is labour intensive and can transmit diseases. Somatic embryos are reported to originate from single cells, so that, if regenerated from mutagenized tissues, should give rise to solid mutants. 2 refs

  4. Composição e distribuição da vegetação herbácea em três áreas com fisionomias distintas na Praia do Peró, Cabo Frio, RJ, Brasil Composition and distribution of herbaceous vegetation in three areas of different aspect in Praia do Peró, Cabo Frio, Rio de Janeiro State, Brazil

    Directory of Open Access Journals (Sweden)

    Sandra Zorat Cordeiro

    2005-12-01

    Full Text Available A composição e a distribuição da vegetação herbácea da Praia do Peró foram caracterizadas em três áreas com topografias e fisionomias distintas, pelo método de parcelas. As três áreas são ocupadas pela comunidade psamófila-reptante, visualmente dividida em duas regiões: frontal, com espécies estoloníferas e suculentas, e posterior, com predomínio de espécies graminóides. Foram amostradas 38 espécies, das quais Paspalum maritimum Trim, Ipomoea imperati (Vahl. Griseb, Ipomoea pes-caprae (L. Sweet, Sporobolus virginicus (L. Kunth e Panicum racemosum (Beauv. Spreng. alcançaram os maiores valores de importância (VI. A topografia do ambiente, intimamente relacionada com a dinâmica de ondas de maré e tempestades, com aporte de areia oriunda dos ventos e das marés e com a ação antrópica, não influencia a distribuição das espécies vegetais encontradas, sendo considerada apenas como um componente influente na paisagem, estabelecido em conjunto com a comunidade vegetal, sendo esta última fortemente determinada pela distância em que se encontra em relação ao mar.The composition and the distribution of herbaceous vegetation of Praia do Peró were characterized in three areas with different topographic and aspect, by using the method of quadrats. The three areas are occupied by the creeping-psamophyte community, being visually divided into two regions: frontal, with stolonipherae and succulent species, and posterior, with predominance of grass species. Thirty-eight species were sampled, from which Paspalum maritimum Trim, Ipomoea imperati (Vahl. Griseb, Ipomoea pes-caprae (L. Sweet, Sporobolus virginicus (L. Kunth and Panicum racemosum (Beauv. Spreng. attained the highest values of importance (VI. The topography, intimately related with the dynamics of tidal waves and storms, with the deposit of sand brought by the winds and tides, and with the human action, doesn't influence the distribution of the vegetal species found

  5. Review of major sweetpotato pests in Japan, with information on resistance breeding programs.

    Science.gov (United States)

    Okada, Yoshihiro; Kobayashi, Akira; Tabuchi, Hiroaki; Kuranouchi, Toshikazu

    2017-01-01

    Sweetpotato ( Ipomoeae batatas (L.) Lam.) is an important food crop affected by several pests throughout the world, especially in tropical, subtropical, and temperate regions. Although Japan is relatively free from many serious sweetpotato pests, some pests, especially soil-borne pathogens, viruses, and insects such as plant-parasitic nematodes and weevils, cause severe damage in Japan. In this review, we describe the current status and management options for sweetpotato pests and diseases in Japan and review research related to sweetpotato breeding that can promote resistance to these problems. Furthermore, we describe methods to evaluate resistance to pests and disease used in sweetpotato breeding at the National Agriculture and Food Research Organization (NARO).

  6. Embryogenesis in sweet potato, Ipomea batatas (L.) Lam

    Energy Technology Data Exchange (ETDEWEB)

    Sonnino, A; Mini, P [ENEA - Technological Innovation Dept., Sector of Biotechnology and Agriculture, Trisaia Research Center, Policoro (Italy)

    1997-12-01

    Sweet potato (Ipomoea batatas (L.) Lam) ranks sixth among the cultivated crops of the world. In fact, it represents a major staple food in many tropical countries. Recently this crop has been proposed as a source of starch for industrial utilization. Somatic embryogenesis could prove useful as an alternative to traditional propagation by cuttings, which is labour intensive and can transmit diseases. Somatic embryos are reported to originate from single cells, so that, if regenerated from mutagenized tissues, should give rise to solid mutants. 2 refs.

  7. Produção da batata-doce adubada com esterco bovino e biofertilizante

    OpenAIRE

    Oliveira,Ademar Pereira de; Barbosa,Arthur Hennys Diniz; Cavalcante,Lourival Ferreira; Pereira,Walter Esfraim; Oliveira,Arnaldo Nonato Pereira de

    2007-01-01

    Objetivou-se avaliar a produção da batata-doce (Ipomoea batatas (L.) Lam.) adubada com esterco bovino e biofertilizante, conduziu-se um experimento no período de Janeiro a Junho de 2004, em NEOSSOLO REGOLÍTICO, psamítico típico, na Universidade Federal da Paraíba, em Areia-PB. O delineamento experimental empregado foi de blocos casualisados, com quatro repetições com os tratamentos distribuídos em arranjo fatorial 6 x 2, sendo seis doses de esterco bovino (0, 10, 20, 30, 40, 50 t ha-1) e ausê...

  8. AcEST: DK952680 [AcEST

    Lifescience Database Archive (English)

    Full Text Available otein OS=Ipomoea b... 57 3e-07 tr|Q8S3M2|Q8S3M2_AZOFI Metallothionein-like protein 2 OS=Azolla...onein-like protein 2 OS=Azolla filiculoides GN=AzMT2 PE=4 SV=1 Length = 77 Score = 56.6 bits (135), Expect =...C C DPC C Sbjct: 45 KATEGGHACKCGSNCPC-DPCNC 66 >tr|Q8S3M2|Q8S3M2_AZOFI Metallothi

  9. New skeletal sesquiterpenoids, caprariolides A-D, from Capraria biflora and their insecticidal activity.

    Science.gov (United States)

    Collins, D O; Gallimore, W A; Reynolds, W F; Williams, L A; Reese, P B

    2000-11-01

    Four structurally novel isomeric sesquiterpenes have been isolated from the aerial parts of Capraria biflora. Caprariolides A (1), B (2), C (3), and D (4) have been determined by NMR spectroscopy experiments to be the (3S,5S,9R), (3R,5S,9R), (3R,5R,9R), and (3S,5R, 9R) isomers of 7-(furan-3'-yl)-3,9-dimethyl-1-oxaspiro[4. 5]dec-6-en-2-one, respectively. Both 1 and 2 were found to exhibit insecticidal activity against adult Cylas formicarius elegantulus, one of the most destructive insect pests of the sweet potato, Ipomoea sp.

  10. Sensory characterization of a ready-to-eat sweetpotato breakfast cereal by descriptive analysis

    Science.gov (United States)

    Dansby, M. A.; Bovell-Benjamin, A. C.

    2003-01-01

    The sweetpotato [Ipomoea batatas (L.) Lam], an important industry in the United States, has been selected as a candidate crop to be grown on future long-duration space missions by NASA. Raw sweetpotato roots were processed into flour, which was used to formulate ready-to-eat breakfast cereal (RTEBC). Twelve trained panelists evaluated the sensory attributes of the extruded RTEBC using descriptive analysis. The samples were significantly different (Psensory attributes, which could be used to differentiate the appearance, texture, and flavor of sweetpotato RTEBC, were described. The data could be used to optimize the RTEBC and for designing studies to test its consumer acceptance.

  11. Bioregenerative life support system for a lunar base

    Science.gov (United States)

    Liu, H.; Wang, J.; Manukovsky, N. S.; Kovalev, V. S.; Gurevich, Yu. L.

    We have studied a modular approach to construction of bioregenerative life support system BLSS for a lunar base using soil-like substrate SLS for plant cultivation Calculations of massflow rates in BLSS were based mostly on a vegetarian diet and biological conversion of plant residues in SLS Plant candidate list for lunar BLSS includes the following basic species rice Oryza sativa soy Glycine max sweet potato Ipomoea batatas and wheat Triticum aestivum To reduce the time necessary for transition of the system to steady state we suggest that the first seeding and sprouting could be made on Earth

  12. Eficácia do herbicida oxyfluorfen com a cobertura de palha no controle de plantas daninhas Efficacy of oxyfluorfen with straw cover in controlling weeds

    Directory of Open Access Journals (Sweden)

    E. Negrisoli

    2009-03-01

    Full Text Available A palha pode alterar a dinâmica do herbicida oxyfluorfen no sistema de cana-crua; assim, este trabalho teve por objetivo avaliar a eficácia do oxyfluorfen em condições de casa de vegetação, com a cobertura de palha, no controle das plantas daninhas que ocorrem em cana-crua. Foram avaliadas as espécies de Brachiaria decumbens, Ipomoea grandifolia, Ipomoea quamoclit e Merremia cissoides. A dose utilizada do oxyfluorfen foi de 3 L ha-1 (720 g i.a. ha-1. Os tratamentos constaram de diferentes posicionamentos do herbicida e condições antes e após a aplicação. A porcentagem de controle das plantas daninhas foi avaliada aos 12, 20, 26, 33 e 38 DAA. Os maiores índices de controle aos 38 DAA, independentemente da planta daninha estudada, foram alcançados quando se aplicou oxyfluorfen em tratamentos com a presença de palha em cobertura, com ou sem umidade. No entanto, os resultados obtidos nos demais tratamentos mostraram-se eficientes no controle das diferentes espécies de plantas daninhas estudadas.Straw can change the dynamics of the herbicide oxyfluorfen in the raw sugarcane system. Thus, this study aimed to assess the effectiveness of oxyfluorfen with straw cover in controlling weeds in raw sugarcane under greenhouse conditions. The species Brachiaria decumbens, Ipomoea grandifolia, Ipomoea quamoclit and Merremia cissoids were evaluated and the dose used was oxyfluorfen 3 L ha-1 (720 g .i.a. ha-1. Treatments consisted of different herbicide positions and conditions before and after application. Weed control percentage was evaluated at 12, 20, 26, 33 and 38 DAA. The highest control rates at 38 DAA, regardless of the weed studied, were reached when oxyfluorfen was applied in treatments with the cover straw, with or without humidity. However, the results obtained in the other treatments were effective in controlling the different weed species studied.

  13. Development of extruded Ready-To-Eat (RTE) snacks using corn, black gram, roots and tuber flour blends

    OpenAIRE

    Reddy, M. Kavya; Kuna, Aparna; Devi, N. Lakshmi; Krishnaiah, N.; Kaur, Charanjit; Nagamalleswari, Y.

    2014-01-01

    Extruded RTE snacks were prepared from flour blends made with corn flour, Bengal gram flour, roots and tuber flours in a proportion of 60–80: 20: 20 respectively and moisture was adjusted to 17–20 %. The roots and tubers flours were developed from potato (Solanum tuberosum), yam (Dioscorea spp.), sweet potato (Ipomoea batatas L.), taro (Colocassia esculenta) and beet root (Beta vulgaris). Different formulations were extruded at 80 ± 5 °C (heater I) and 95–105 °C (heater II) temperature, 300–3...

  14. Estrutura de duas formações vegetais do cordão externo da restinga de Marambaia, RJ Structure of two plant communities on Marambaia barrier island, Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Luis Fernando Tavares de Menezes

    1999-08-01

    Full Text Available Foram caracterizadas duas formações vegetais, psamófila-reptante e arbustiva de Palmae, no cordão arenoso externo da restinga de Marambaia (RJ com base na posição topográfica, na fisionomia e na estrutura, utilizando-se o método de parcelas. Embora as duas formações sejam visualmente distintas, há uma zona de transição entre elas. Das 23 espécies amostradas na formação psamófila-reptante, Ipomoea pes-caprae, Ipomoea imperati, Allagoptera arenaria, Sporobolus virginicus, Remirea marítima e Panicum racemosum despontaram com maiores valores de importância (VI. A formação halófila dominada por Blutaparon portulacoides, típica de outras restingas no litoral brasileiro, não foi identificada devido ao intenso dinamismo da faixa entre o mar e a primeira linha de cristas praiais estabilizadas. A formação arbustiva de Palmae é dominada por Allagoptera arenaria, com 56% do VI total, dentre as 64 espécies amostradas. As duas formações são dominadas por geófitas rizomatosas.Two plant communities (creeping psamophyte and palm scrub are described from the outer Marambaia beach ridge, Rio de Janeiro State, Brazil, based on topography, vegetation physiognomy, and structure. Although the two communities can be distinguished visually, they are joined by a transition zone. Ipomoea pes-caprae, Ipomoea imperati, Remirea maritima, Allagoptera arenaria, Sporobolus virginicus, and Panicum racemosum were the most important species sampled in the creeping psammophyte community out of a total of 23. The halophyte community reported for other sandy coastal plains in Brazil was not observed at Marambaia due to the intense wave action on this beach. The palm scrub community was dominated by Allagoptera arenaria (56% of total importance value out of a total of 64 species. Rhizome-geophytes dominate both communities.

  15. Petroleum resources assessment of the Okinawa Trough

    Energy Technology Data Exchange (ETDEWEB)

    Oh, Jae Ho; Kwak, Young Hoon; Bong, Pil Yoon; Son, Jin Dam; Cheong, Tae Jin; Lee, Ho Young; Ryu, Byung Jae; Son, Byeong Kook; Hwang, In Gul; Kwon, Young Ihn; Lee, Yong Joo; Kim, Hag Ju; Yi, Sung Soog; Park, Kwan Soon; Park, Keun Pil; Shin, Chang Soo; Sunwoo, Don [Korea Inst. of Geology Mining and Materials, Taejon (Korea, Republic of)

    1995-12-01

    The hydrocarbon potential has been evaluated for the Tertiary strata in the northwestern margin of the Okinawa Trough on the basis of the pale-ontological, petrological, geochemical data from two wells (Nikkan 8-9 and JDZ 7-3), and geophysical data. Abundant marine micro-fossils such as foraminifera, calcareous nannofossils and dinocysts were yielded in the sedimentary section of the above wells. Abundant palynomorphs originated from nearby onshore are also encountered. Based on nannofossils, the bio-stratigraphic zones from NN12 (Amaurolithus tricorniculatus Zone) to NN19 (Pseudoemiliania lacunosa Zone) are established. The sedimentary sequences are divided by local unconformity into Lower and Upper Groups, the ages of which are Late Miocene and Pliocene to Pleistocene, respectively. According to the geochemical analysis results, it is hard to expect a source rock that can generate enough hydrocarbons necessary for migration in the drilled intervals. Even though the thermal maturity reached the oil generation zone in the penetrated intervals, the calculation by the program GENEX of BEICIP shows that the amount of the generated hydrocarbons is not enough for the migration. A good source rock may be expected in the depth deeper than 4300 m horizon. Analysis of over 3300 Line-km of multichannel seismic data integrated with 2 well data serves to detail the structural and stratigraphic evolution of the western margin of the Okinawa Trough, offshore southern part of Korea peninsula. The overall tectonic style is characterized by a series of half-Graben and tilted fault blocks bounded by listric faults. Tectonics of the rift phase have been established on the basis of structural and stratigraphic analyses of depositional sequences and their seismic expressions. The potential hydrocarbon traps associated with titled fault block, fault and roll-over structure exist. (author). 44 refs.

  16. Potensi dan konservasi jenis-jenis Hoya dataran tinggi Pulau Jawa

    Directory of Open Access Journals (Sweden)

    Sri Rahayu

    2013-10-01

    Full Text Available Hoyas (Hoya Sp.: Asclepiadoideae - Apocynaceae has been utilized as ornamental plant especially in Europe and the USA. The original distribute from the South of India to Samoa, and from South of Japan to the North –East of Australia. Altitudinal distribution from the sea level to about 2000m. According to the thermoecological concept by Van Steenish, altitudinal distribution of plant correlated with the latitudinal distribution regarding with the environmental temperature. The lowland plant prefer to higher temperature and distribute in arround the eqator, while high altitude plant able to adapt in temperate zones. The inventory of high altitude Hoya species has been conduct in Java by fl ora exploration during 1996–2011. The species can be utilized as ornamental plant for export trade to Europe and USA. There were eight species of Hoya in high altitude of Java, six of them have wide altitude range distribution, while the two species i.e. H. kuhlii (Blume Koorders and H. purpureofusca Hook. evolve restricted distribution only at the high altitude of Java/Bali above 1000m. H. wrayi King & Gamble only found once at 1200 m in East Java, but this species has been found in lower altitude in Sumatra. Species which have wide range altitudinal distribution i.e. H. campanulata Blume, H. lacunosa, H. latifolia G. Don, H. lasiantha Korth., H. multifl ora Blume and H. wrayi Kimg & Gamble, able to adapt in wider latitude. The potencial development and conservation aspect described in this paper

  17. Importance of Macrophyte Quality in Determining Life-History Traits of the Apple Snails Pomacea canaliculata: Implications for Bottom-Up Management of an Invasive Herbivorous Pest in Constructed Wetlands

    Directory of Open Access Journals (Sweden)

    Rita S. W. Yam

    2016-02-01

    Full Text Available Pomacea canaliculata (Ampullariidae has extensively invaded most Asian constructed wetlands and its massive herbivory of macrophytes has become a major cause of ecosystem dysfunctioning of these restored habitats. We conducted non-choice laboratory feeding experiments of P. canaliculata using five common macrophyte species in constructed wetlands including Ipomoea aquatica, Commelina communis, Nymphoides coreana, Acorus calamus and Phragmites australis. Effects of macrophytes on snail feeding, growth and fecundity responses were evaluated. Results indicated that P. canaliculata reared on Ipomoea had the highest feeding and growth rates with highest reproductive output, but all individuals fed with Phragmites showed lowest feeding rates and little growth with poorest reproductive output. Plant N and P contents were important for enhancing palatability, supporting growth and offspring quantity of P. canaliculata, whilst toughness, cellulose and phenolics had critically deterrent effects on various life-history traits. Although snail offspring quality was generally consistent regardless of maternal feeding conditions, the reduced growth and offspring quantity of the poorly-fed snails in constructed wetlands dominated by the less-palatable macrophytes could limit the invasive success of P. canaliculata. Effective bottom-up control of P. canaliculata in constructed wetlands should involve selective planting strategy using macrophytes with low nutrient and high toughness, cellulose and phenolic contents.

  18. Importance of Macrophyte Quality in Determining Life-History Traits of the Apple Snails Pomacea canaliculata: Implications for Bottom-Up Management of an Invasive Herbivorous Pest in Constructed Wetlands.

    Science.gov (United States)

    Yam, Rita S W; Fan, Yen-Tzu; Wang, Tzu-Ting

    2016-02-24

    Pomacea canaliculata (Ampullariidae) has extensively invaded most Asian constructed wetlands and its massive herbivory of macrophytes has become a major cause of ecosystem dysfunctioning of these restored habitats. We conducted non-choice laboratory feeding experiments of P. canaliculata using five common macrophyte species in constructed wetlands including Ipomoea aquatica, Commelina communis, Nymphoides coreana, Acorus calamus and Phragmites australis. Effects of macrophytes on snail feeding, growth and fecundity responses were evaluated. Results indicated that P. canaliculata reared on Ipomoea had the highest feeding and growth rates with highest reproductive output, but all individuals fed with Phragmites showed lowest feeding rates and little growth with poorest reproductive output. Plant N and P contents were important for enhancing palatability, supporting growth and offspring quantity of P. canaliculata, whilst toughness, cellulose and phenolics had critically deterrent effects on various life-history traits. Although snail offspring quality was generally consistent regardless of maternal feeding conditions, the reduced growth and offspring quantity of the poorly-fed snails in constructed wetlands dominated by the less-palatable macrophytes could limit the invasive success of P. canaliculata. Effective bottom-up control of P. canaliculata in constructed wetlands should involve selective planting strategy using macrophytes with low nutrient and high toughness, cellulose and phenolic contents.

  19. Importance of Macrophyte Quality in Determining Life-History Traits of the Apple Snails Pomacea canaliculata: Implications for Bottom-Up Management of an Invasive Herbivorous Pest in Constructed Wetlands

    Science.gov (United States)

    Yam, Rita S. W.; Fan, Yen-Tzu; Wang, Tzu-Ting

    2016-01-01

    Pomacea canaliculata (Ampullariidae) has extensively invaded most Asian constructed wetlands and its massive herbivory of macrophytes has become a major cause of ecosystem dysfunctioning of these restored habitats. We conducted non-choice laboratory feeding experiments of P. canaliculata using five common macrophyte species in constructed wetlands including Ipomoea aquatica, Commelina communis, Nymphoides coreana, Acorus calamus and Phragmites australis. Effects of macrophytes on snail feeding, growth and fecundity responses were evaluated. Results indicated that P. canaliculata reared on Ipomoea had the highest feeding and growth rates with highest reproductive output, but all individuals fed with Phragmites showed lowest feeding rates and little growth with poorest reproductive output. Plant N and P contents were important for enhancing palatability, supporting growth and offspring quantity of P. canaliculata, whilst toughness, cellulose and phenolics had critically deterrent effects on various life-history traits. Although snail offspring quality was generally consistent regardless of maternal feeding conditions, the reduced growth and offspring quantity of the poorly-fed snails in constructed wetlands dominated by the less-palatable macrophytes could limit the invasive success of P. canaliculata. Effective bottom-up control of P. canaliculata in constructed wetlands should involve selective planting strategy using macrophytes with low nutrient and high toughness, cellulose and phenolic contents. PMID:26927135

  20. Application of ecohydraulic bank protection model to improve river bank stability and biotic community in Surabaya River

    Directory of Open Access Journals (Sweden)

    Daru Setyo Rini

    2017-10-01

    Full Text Available Ecohydraulic river bank protection design was developed as ECO-RIPRAP model and has been applied along 100 meter length to restore accelerated erosion sites in Surabaya River at Wringinanom and Klubuk. The model combined re-profiled and re-vegetated bank with rock toe reinforcement and addition of log groynes at 10 meter length interval. Various native plant species were planted on bank slopes, including water plants Ipomoea aquatica and Pistia stratiotes, grasses and shrubs Ipomoea carnea, Pluchea indica, Saccharum spontaneum, Arundo donax, and native tree species Ficus glomerata, Bambusa arundinacea, Dendrocalamus asper, Bambusa vulgaris, Ficus benjamina, Dillenia indica, Psidium guajava, Arthocarpus camansi, Arthocarpus elasticus, Hibiscus mutabilis, Nauclea sp., Inocarpus edulis, and Syzygium polyanthum. The river bank morphology after ECO-RIPRAP application showed alteration from erosion to sedimentation due to rock toe enforcement, log groynes protection, and increase of plant cover on littoral banks that decreased near bank velocity. The macro-invertebrate community shown increase of taxa richness, EPT richness, %EPT and %Atyidae, but decrease of %Chironomidae at restored sites. The fish community shown increase of taxa richness, increase of abundance by 54.2%, increase of Pangasius micronemus abundance by 25.6%, and increase of Hemibragus nemurus abundance by 6.3 % at restored reach. Rare fish species thrive back at restored area, namely Oxyeleotris marmorata, Mastacembelus unicolor and Hampala macrolepidota.

  1. Uptake of iodine-131 in tropical crops

    International Nuclear Information System (INIS)

    Asprer, G.A.; Lansangan, L.M.

    1986-01-01

    Vegetable crops which include sweet potato tops (Ipomoea batatas), kangkong (Ipomoea repitans) and tomato plants were grown in dark-painted jars containing Hoagland-Arnon modified nutrient solution, utilizing the technique of hydroponics. The experiments for sweet potato tops and kangkong plants were duplicated for replicate studies and steady-state conditions were simulated throughout. Tomato plants were grown in the same manner but growth was observed to be hampered when starting from mature plants. Radioiodine was added to the nutrient medium containing 0.5% non-radioactive NaI solution. The solution in the jar was adjusted daily so as to maintain a constant concentration which would simulate routine releases that are essentially continuous. After incorporating the radioiodine to the solution, 10 ml aliquot was taken and counted for radioactivity by means of a 5'' x 5'' NaI(T1) detector connected to the multichannel gamma analyzer. Both plants and solution were counted for radioactivity at different time intervals using the same geometry. Results indicate that the activity in the plants were relatively higher than that of the solution. The activity tends to level off or decrease after a few days. The concentration factor which is the ratio of the activity in the plant (uCi/gm) over the activity in the medium (uCi/ml) varied for each time interval. 12 references, 2 figures, 3 tables

  2. Mitochondrial genome sequences reveal evolutionary relationships of the Phytophthora 1c clade species.

    Science.gov (United States)

    Lassiter, Erica S; Russ, Carsten; Nusbaum, Chad; Zeng, Qiandong; Saville, Amanda C; Olarte, Rodrigo A; Carbone, Ignazio; Hu, Chia-Hui; Seguin-Orlando, Andaine; Samaniego, Jose A; Thorne, Jeffrey L; Ristaino, Jean B

    2015-11-01

    Phytophthora infestans is one of the most destructive plant pathogens of potato and tomato globally. The pathogen is closely related to four other Phytophthora species in the 1c clade including P. phaseoli, P. ipomoeae, P. mirabilis and P. andina that are important pathogens of other wild and domesticated hosts. P. andina is an interspecific hybrid between P. infestans and an unknown Phytophthora species. We have sequenced mitochondrial genomes of the sister species of P. infestans and examined the evolutionary relationships within the clade. Phylogenetic analysis indicates that the P. phaseoli mitochondrial lineage is basal within the clade. P. mirabilis and P. ipomoeae are sister lineages and share a common ancestor with the Ic mitochondrial lineage of P. andina. These lineages in turn are sister to the P. infestans and P. andina Ia mitochondrial lineages. The P. andina Ic lineage diverged much earlier than the P. andina Ia mitochondrial lineage and P. infestans. The presence of two mitochondrial lineages in P. andina supports the hybrid nature of this species. The ancestral state of the P. andina Ic lineage in the tree and its occurrence only in the Andean regions of Ecuador, Colombia and Peru suggests that the origin of this species hybrid in nature may occur there.

  3. Resin Glycosides from the Morning Glory Family

    Science.gov (United States)

    Pereda-Miranda, Rogelio; Rosas-Ramírez, Daniel; Castañeda-Gómez, Jhon

    Resin glycosides are part of a very extensive family of secondary metabolites known as glycolipids or lipo-oligosaccharides and are constituents of complex resins (glycoresins) (1) unique to the morning glory family, Convolvulaceae (2). These active principles are responsible for the drastic purgative action of all the important Convolvulaceous species used in traditional medicine throughout the world since ancient times. Several commercial purgative crude drugs can be prepared from the roots of different species of Mexican morning glories. Their incorporation as therapeutic agents in Europe is an outstanding example of the assimilation of botanical drugs from the Americas as substitutes for traditional Old World remedies (3). Even though phytochemical investigations on the constituents of these drugs were initiated during the second half of the nineteenth century, the structure of their active ingredients still remains poorly known for some examples of these purgative roots. During the last two decades, the higher resolution capabilities of modern analytical isolation techniques used in conjunction with powerful spectroscopic methods have facilitated the elucidation of the active principles of these relevant herbal products.

  4. Operculina macrocarpa: chemical and intestinal motility effect in mice

    Directory of Open Access Journals (Sweden)

    Daniele Michelin Paganotte

    Full Text Available ABSTRACT Operculina macrocarpa (L. Urb., Convolvulaceae, is used by the population as a laxative. In this work we described the isolation of the three phenolic acids present in the hydroethanolic extract of the O. macrocarpa roots. The quantification of the caffeic, chlorogenic acids and of the new caffeic dimer in the hydroethanolic and infusion extracts was performed by high-performance liquid chromatography coupled photodiode array detector. These analyses showed the higher content of the chlorogenic, caffeic and the new 3,4'-dehydrodicaffeic acid in hydroethanolic and hydroethanolic extracts without resin in which infusion. The acid found in greater quantity is caffeic acid followed by the 3,4'-dehydrodicaffeic acid. The laxative activity was evaluated by different experimental models of intestinal transit with the hydroethanolic and infusion extracts, and the resin fraction, caffeic, chlorogenic and ferulic acids. The results showed all extracts and compounds tested had significant activity in the experimental model tested. These results obtained are essential for the future development of a pharmaceutical product with safety and efficacy.

  5. Cuscuta chinensis Ameliorates Immunosuppression and Urotoxic Effect of Cyclophosphamide by Regulating Cytokines - GM-CSF and TNF-Alpha.

    Science.gov (United States)

    Raju, Nidhi; Sakthivel, Kunnathur Murugesan; Kannan, Narayanan; Vinod Prabhu, Venugopal; Guruvayoorappan, Chandrasekaran

    2015-06-01

    Cancer is the leading cause of death worldwide. Cyclophosphamide (CTX) is commonly used as anticancer drug which causes toxicity by its reactive metabolites such as acroline and phosphoramide mustard. In this study, Cuscuta chinensis (C. chinensis) (family: Convolvulaceae) was assessed for ability to restore mice against CTX-induced toxicity. Coadministration of C. chinensis extract (10 mg/kg BW, IP, daily) for ten consecutive days reduced CTX-induced (25 mg/kg BW, IP, daily) toxicity. Treatment with C. chinensis extract significantly (p < 0.01) increased the relative organ weight and body weight. Moreover, administration of C. chinensis extract significantly increased bone marrow cellulatity and α-esterase activity in CTX-treated mice which suggested its protective role on the hematopoietic system. The GSH content was drastically reduced by CTX administration in urinary bladder which was enhanced by treatment with C. chinensis extract, indicating that preventing acroline-mediated tissue damage or cell toxicity and also the extract decreased the urinary bladder nitric oxide (NO) level which proves recovery over urinary tract injury associated with CTX treatment. The administration of C. chinensis extract decreased serum urea, creatinine, and bilirubin levels when compared to CTX-alone-treated group. Histopathological analysis of the urinary bladder of CTX-alone-treated group showed necrotic damage whereas the C. chinensis-treated group showed normal bladder architecture. The above data clearly demonstrates chemoprotective role of C. chinensis against CTX-induced toxicities by regulating antioxidant and inflammatory mediators.

  6. A holoparasitic plant severely reduces the vegetative and reproductive performance of its host plant in the Caatinga, a Brazilian seasonally dry forest

    Directory of Open Access Journals (Sweden)

    Oswaldo Cruz Neto

    Full Text Available ABSTRACT Host-parasite interactions between plants may reduce the vegetative and reproductive performance of the host plant. Although it is well established that parasitic plants may negatively affect the metabolism and the number of vegetative/reproductive structures of their hosts, the effects of this interaction on the reproductive characteristics of the host plant are poorly understood. Here we document the interaction between Cuscuta partita (Convolvulaceae and its main host, Zornia diphylla (Fabaceae, in the Caatinga of northeastern Brazil. We measured diverse reproductive/vegetative attributes of Z. diphylla in 60 plots randomly distributed in patches that were parasitized and not parasitized by C. partita. Both vegetative and reproductive attributes, such as the number of branches, leaves and flowers, and the individual biomass of Z. diphylla were significantly reduced by the parasitism. The number of pollen grains and ovules per flower were not affected by the parasitism, but since the parasitism reduced flower production, the total number of pollen and ovules per individual and population may also be reduced. Additionally, pollen viability was significantly reduced in the flowers of parasitized individuals. We conclude that C. partita may negatively impact the vegetative and reproductive performance of its main host, Z. diphylla in distinct ways in the Caatinga.

  7. Phytochemical investigation of natural and in vitro raised Vṛddhadāruka plants.

    Science.gov (United States)

    Bharati, Asha Jyoti; Bansal, Yogendra Kumar

    2014-01-01

    Argyreia nervosa commonly known as elephant creeper (English) and Vṛddhadāruka (Sanskrit) is a woody climber that belongs to the family Convolvulaceae. Seeds of this plant contain hallucinogens including ergot alkaloids and a naturally occurring lysergic acid amide. Traditionally the plant is used in the treatment of gonorrhea, strangury, chronic ulcers, diabetes, anemia and cerebral disorders. The plant is also used as appetitiser, brain tonic, cardiotonic, aphrodisiac. It possesses anti-inflammatory, immunomodulatory, antibacterial, antiviral and antifungal activities. To give an account of information on in vitro regeneration and phytochemical analysis of the plant. Nodal explants were selected for in vitro regeneration. Different aerial parts viz., seeds, natural and in vitro leaf, stem and callus were dried and extracted with different solvents and were subjected to various phytochemical analyses. Different concentrations of 6-benzylaminopurine showed shoot and root initiation. The study of phytochemical screening of different extracts showed the presence of bioactive substances like flavonoids, alkaloids, terpenoids, etc. The study will provide an efficient in vitro protocol for micropropagation as an alternative method to conserve the plant and shows the presence of some important secondary metabolites in the nature grown and in vitro raised plants which can be useful for treatment of various diseases.

  8. Diversity of Medicinal Plants in the Flora of Saudi Arabia 3: An inventory of 15 Plant Families and their Conservation Management

    Directory of Open Access Journals (Sweden)

    Mohammed Yusuf

    2014-09-01

    Full Text Available An inventory of medicinal species diversity in the flora of the Kingdom of Saudi Arabia has been made for 15 angiosperm families, viz., Boraginaceae, Convolvulaceae, Cucurbitaceae, Fabaceae, Molluginaceae, Papavaraceae, Portulacaceae, Ranunculaceae, Rhamnaceae, Rutaceae, Tamaricaceae, Tiliaceae, Urticaceae, Verbenaceae and Vitaceae, and 61 species of medicinal plants are recognized. These families are represented in the flora by a total of 393 species of which 15.52% are medicinal. Among the families, the Fabaceae is found to be represented by 23 medicinal species which is highest and 37.70% of the total species. Of these 61 medicinal species, 72.13% exhibits herbaceous life form while remaining 13.11% and 14.75% exhibit shrubs and trees respectively. An enumeration of these medicinal species is presented, each with current nomenclature, Arabic name, English name, medicinal uses, pharmacological properties and status of occurrence in the flora. The communication is aimed at emphasizing the planning and implementation of national conservation strategies for sustainable management of the medicinal plants of the Kingdom of Saudi Arabia. DOI: http://dx.doi.org/10.3126/ije.v3i3.11091 International Journal of Environment Vol.3(3 2014: 312-320

  9. Nootropic, anxiolytic and CNS-depressant studies on different plant sources of shankhpushpi.

    Science.gov (United States)

    Malik, Jai; Karan, Maninder; Vasisht, Karan

    2011-12-01

    Shankhpushpi, a well-known drug in Ayurveda, is extensively used for different central nervous system (CNS) effects especially memory enhancement. Different plants are used under the name shankhpushpi in different regions of India, leading to an uncertainty regarding its true source. Plants commonly used under the name shankhpushpi are: Convolvulus pluricaulis Chois., Evolvulus alsinoides Linn., both from Convolvulaceae, and Clitoria ternatea Linn. (Leguminosae). To find out the true source of shankhpushpi by evaluating and comparing memory-enhancing activity of the three above mentioned plants. Anxiolytic, antidepressant and CNS-depressant activities of these three plants were also compared and evaluated. The nootropic activity of the aqueous methanol extract of each plant was tested using elevated plus-maze (EPM) and step-down models. Anxiolytic, antidepressant and CNS-depressant studies were evaluated using EPM, Porsolt?s swim despair and actophotometer models, respectively. C. pluricaulis extract (CPE) at a dose of 100 mg/kg, p.o. showed maximum nootropic and anxiolytic activity (p nootropic, anxiolytic and CNS-depressant activity. The results of memory-enhancing activity suggest C. pluricaulis to be used as true source of shankhpushpi.

  10. Resistance of Newly Introduced Vegetables to Meloidogyne arenaria and M. incognita in Korea

    Directory of Open Access Journals (Sweden)

    Donggeun Kim

    2013-12-01

    Full Text Available To select resistant vegetables against two species of root-knot nematodes, M. incognita and M. arenaria, 39 vegetables belongs to 7 families, 13 genera, 25 species were screened in greenhouse pot test. Susceptible vegetables to both nematodes were amarath and leaf beet in Amaranthaceae, Malabar spinach in Basellaceae, Moroheiya in Tiliaceae, and Water-convolvulus in Convolvulaceae, Pak-choi in Brassica campestris var. chinensis, Tah tasai in B. campestris var. narinosa, B. campestris var. chinensis x narinosa, Leaf mustard, Mustard green in B. juncea, Kyona in B. juncea var. laciniate, Choy sum in B. rapa subsp. arachinenesis, Kairan in B. oleracea var. alboglabra, Arugula in Eruca sativa, Garland chrysanthemum in Chrysanthemum coronarium, Endive in Cichorium endivia, Artichoke in Cynara cardunculus var. scolymus, Lettuce in Lactuca sativa. Resistant to M. arenaria but susceptible to M. incognita were B. oleracea cv. Matjjang kale, B. oleracea var. gongyloides cv. Jeok kohlrabi, and C. intybus cv. Radicchio. Resistant vegetables to both nematodes were C. intybus cv. Sugar loaf, Grumoro, Radichio treviso, B. oleracea cv. Manchu collard, Super matjjang, B. oleracea italica, B. oleracea var. botrytis italiana, and Perilla in Lamiaceae. Vegetables resistant to both species of root-knot nematodes could be used as high-valued rotation crops in greenhouses where root-knot nematodes are problem.

  11. Microscopic investigations of palynological features of convolvulaceous species from arid zone of Pakistan.

    Science.gov (United States)

    Ashfaq, Shomaila; Zafar, Muhammad; Ahmad, Mushtaq; Sultana, Shazia; Bahadur, Siraj; Khan, Adeel; Shah, Amin

    2018-02-01

    The pollen morphology of some species of glamorous family Convolvulaceae from arid zones of Pakistan has been evaluated. The pollen grains were acetolyzed, measured, described qualitatively, and illustrated using Light microscopy and scanning electron microscopy (SEM). The examined species have differences in shape, size, polarity and exine ornamentation, confirming the eurypalynous character. The pollen types varies from psilate to echinate and colpi to tricolporate, tetracolporate and pantocolporate. Exine ornamentation was exposed as perforate, reticulate and echinate. Spine morphology and exine sculpture are vital for the distinction of species. Pollen fertility shows that selected plants species are well-known in the Arid Zone. A taxonomic key is prepared to use these variations in the identification of species. Statistical analysis by using the Software XLSTAT exhibited that some morphological features is the main characters in identification of the taxa. These studied taxa were separated from each other using cluster Analysis. Our results constructed on MVSP ver. 3.22 software analyses that show morphological explanation; thus, the results highlight the importance of pollen morphology in the identification and characterization of species of the family convolvulacae in arid zone. © 2017 Wiley Periodicals, Inc.

  12. A survey of medicinal plants used in the treatment of dysentery in amathole district municipality, south africa

    International Nuclear Information System (INIS)

    Afolayan, A.J.; Wintola, O.A.

    2014-01-01

    In view of the prevalence of dysentery in developing countries such as South Africa and the erosion of indigenous knowledge of phytomedicine due to lack of interest by the young generation, a survey of five local municipalities of Amathole district, Eastern Cape Province was carried out in 2012. A questionnaire-guided interview of the indigenous people by random sampling was done with the help of an interpreter during a survey of the district. Fifty-five (55) respondents participated in the study. The respondents comprised of 25% traditional medical practitioners, 15% herb-sellers and 15% rural elders. Fifty-one (51) plants species of 32 families were documented. Fabaceae had the highest representation of seven (14%) plant species used for the treatment of dysentery; some other families were Asphodelaceae, Apiaceae, Geraniaceae, Anacardiaceae, Bignoniaceae, Ebenaceae, Euphorbiaceae, Hyacinthaceae, Asclepiadiaceae, Acanthaceae, Asteraceae, Balanophaceae, Celstraceae, Convolvulaceae, Cornaceae, Iridaceae, and Hydronaceae. The medicinal plants with the highest frequency of prescription were Hydnora africana and Alepidea amatymbica. The plants were used singly or in combination in recipes. Leaves (28%) had the highest use-value of plant parts, followed by the roots (24%), bark (22%) and the whole plant (9%). Methods of preparation of recipes were decoction, infusion and tincture. The use of recipe as an enema was also documented. The study of the pharmacology and mode of action of the plants will contribute immensely to their therapeutic value. (author)

  13. Phytochemical investigation of natural and in vitro raised Vṛddhadāruka plants

    Directory of Open Access Journals (Sweden)

    Asha Jyoti Bharati

    2014-01-01

    Full Text Available Background: Argyreia nervosa commonly known as elephant creeper (English and Vṛddhadāruka (Sanskrit is a woody climber that belongs to the family Convolvulaceae. Seeds of this plant contain hallucinogens including ergot alkaloids and a naturally occurring lysergic acid amide. Traditionally the plant is used in the treatment of gonorrhea, strangury, chronic ulcers, diabetes, anemia and cerebral disorders. The plant is also used as appetitiser, brain tonic, cardiotonic, aphrodisiac. It possesses anti-inflammatory, immunomodulatory, antibacterial, antiviral and antifungal activities. Objective: To give an account of information on in vitro regeneration and phytochemical analysis of the plant. Materials and Methods: Nodal explants were selected for in vitro regeneration. Different aerial parts viz., seeds, natural and in vitro leaf, stem and callus were dried and extracted with different solvents and were subjected to various phytochemical analyses. Results: Different concentrations of 6-benzylaminopurine showed shoot and root initiation. The study of phytochemical screening of different extracts showed the presence of bioactive substances like flavonoids, alkaloids, terpenoids, etc. Conclusion: The study will provide an efficient in vitro protocol for micropropagation as an alternative method to conserve the plant and shows the presence of some important secondary metabolites in the nature grown and in vitro raised plants which can be useful for treatment of various diseases.

  14. FLORA VASCULAR DE UMA ÁREA DE CAATINGA NO ESTADO DA PARAÍBA - NORDESTE DO BRASIL

    Directory of Open Access Journals (Sweden)

    ANTÔNIO CÁSSIO JUSTINO DOS SANTOS

    2010-01-01

    Full Text Available The caatinga biome covers around 70% of the North-Eastern territory and nevertheless the studies carried out about its natural riches are still insufficient especially tackling the floristics diversity of the biome as a whole, particularly in the state of Paraiba. For this reason the current study aimed to carry out the floristics survey of an area of caatinga in the municipality of Boqueirão, Paraiba State. In the area of study, it was registered 47 species distributed in 39 genera and 20 families of flowering plants. The families that stood out in number of species were: Fabaceae, with 12 species; Cactaceae, with five; Euphorbiaceae and Malvaceae, with four species each one and Convolvulaceae with three species, while the other families (15 showed one to two species each one. The woody component dominated over the shrubby, herbaceous, subshrubby and the woody vines components of the area studied. Based on the data obtained in this study, it was possible to correlate the taxa shown with the flora of different areas of caatinga, especially in the Northeast region, showing up the priority of carrying out floristics studies including other areas of the caatinga of Paraiba as well as of different states of the Brazilian Northeastern.

  15. Suppression of Plant Defenses by Herbivorous Mites Is Not Associated with Adaptation to Host Plants

    Directory of Open Access Journals (Sweden)

    Jéssica T. Paulo

    2018-06-01

    Full Text Available Some herbivores suppress plant defenses, which may be viewed as a result of the coevolutionary arms race between plants and herbivores. However, this ability is usually studied in a one-herbivore-one-plant system, which hampers comparative studies that could corroborate this hypothesis. Here, we extend this paradigm and ask whether the herbivorous spider-mite Tetranychus evansi, which suppresses the jasmonic-acid pathway in tomato plants, is also able to suppress defenses in other host plants at different phylogenetic distances from tomatoes. We test this using different plants from the Solanales order, namely tomato, jimsonweed, tobacco, and morning glory (three Solanaceae and one Convolvulaceae, and bean plants (Fabales. First, we compare the performance of T. evansi to that of the other two most-commonly found species of the same genus, T. urticae and T. ludeni, on several plants. We found that the performance of T. evansi is higher than that of the other species only on tomato plants. We then showed, by measuring trypsin inhibitor activity and life history traits of conspecific mites on either clean or pre-infested plants, that T. evansi can suppress plant defenses on all plants except tobacco. This study suggests that the suppression of plant defenses may occur on host plants other than those to which herbivores are adapted.

  16. Validation of a spectrophotometric methodology for the quantification of polysaccharides from roots of Operculina macrocarpa (jalapa

    Directory of Open Access Journals (Sweden)

    Marcos A.M. Galvão

    Full Text Available The roots from Operculina macrocarpa (L. Urb., Convolvulaceae, are widely used in Brazilian traditional medicine as a laxative and purgative. The biological properties of this drug material have been attributed to its polysaccharides content. Thus, the aim of this study was to evaluate the polysaccharide content in drug material from O. macrocarpa by spectrophotometric quantitative analysis. The root was used as plant material and the botanical identification was performed by macro and microscopic analysis. The plant material was used to validate the spectrophotometric procedures at 490 nm for the quantification of the reaction product from drug polysaccharides and phenol-sulfuric acid solution. The analytical procedure was evaluated in order to comply with the necessary legal requirements by the determination of the following parameters: specificity, linearity, selectivity, precision, accuracy and robustness. This study provides with a simple and valid analytical procedure (linear, precise, accurate and reproducible, which can be satisfactorily used for quality control and standardization of herbal drug from O. macrocarpa.

  17. Molecular Phylogenetic Screening of Withania somnifera Relative From Indonesia Based on Internal Transcribed Spacer Region

    Directory of Open Access Journals (Sweden)

    Topik Hidayat

    2016-04-01

    Full Text Available Withania somnifera (family Solanaceae, known commonly as Ashwaganda, is one of the important medicinal plants, and recent studies reported that Withanone, one of the chemical components in this plant, has ability to kill cancer cell. Because of endemic state of this plant to South Asia, exploring plant species under the same family which grow well in Indonesia has been of interest. The purpose of this study was to screen the Indonesian plant which has strong phylogenetic relationship with Ashwaganda. Thus, phylogenetic analysis using DNA sequences of internal transcribed spacer (ITS region was conducted. Thus, 19 species of Solanaceae and two species of Convolvulaceae as outgroup were examined. Five ITS regions of Ashwaganda retrieved from GenBank were included in the phylogenetic analysis. Parsimony analysis showed that Indonesia Solanaceae comprises seven groups which is consistent with the global Solanaceae relationship as previously reported. Furthermore, our study revealed that two species, Physalis angulata and Physalis peruviana, are relative to W. somnifera. Morphologically, they share characters of flower and fruit. This result indicated that these two species are potential to have similar chemical properties as Ashwaganda, thus we can have new variants of Withanone originated from Indonesia with similar effect.

  18. PEMANFAATAN DAUN TANAMAN BERKAYU SEBAGAI PUPUK ORGANIK TANAMAN SAYURAN DAN JAGUNG - (UTILIZATION OF WOODY PLANT LEAVES AS ORGANIC FERTILIZER FOR VEGETABLES AND CORN

    Directory of Open Access Journals (Sweden)

    Dody Priadi

    2017-12-01

    Full Text Available This study aimed to use woody plant leaves as organic fertilizer (compost and their effects on vegetables and corn. The compost was made from leaves of Samanea saman, Swietenia macrophylla, Nephelium lappaceum and cow dung (1:3, 2:2 and 3:1 using OrgaDec (0.5% w/w, Decomic (0.1% v/w and Dectro (0.1 v/w as bioactivator. The result showed that compost from Samanea saman leaves and cow dung (1:3 using Decomic (0.1% v/w met the organic fertilizer standard. The compost was applied to Ipomoea reptans, Capsicum annuum and Zea mays on a media from compost and latosol soil (1:3, 2:2 and 3:1 using Completely Randomized Design (CRD with 3 replications. The analyzed data using ANOVA showed no significant difference in the growth parameter of tested plants. The best media for Ipomoea reptans was the mixture of compost and latosol soil (3:1 meanwhile for Zea mays and Capsicum annuum were 1:3 and 2:2, respectively.Keywords: compost, compost application, organic fertilizer, woody plant leavesABSTRAKPenelitian ini bertujuan untuk memanfaatkan daun tumbuhan berkayu menjadi pupuk organik (kompos serta pengaruhnya terhadap tanaman sayuran dan jagung. Kompos dibuat dari daun kihujan (Samanea saman, daun mahoni (Swietenia macrophylla daun rambutan (Nephelium lappaceum dan kotoran sapi (1:3, 2:2 dan 3:1 dengan penambahan bioaktivator OrgaDec (0,5% w/w, Decomic (0,1% v/w dan Dectro (0,1 v/w. Hasil analisis kimia menunjukkan bahwa kompos yang dibuat dari daun kihujan dan kotoran sapi (1:3 yang menggunakan bioaktivator Decomic (0,1% v/w adalah perlakuan yang paling sesuai dengan baku mutu pupuk organik berdasarkan Permentan No.70/Permentan/SR.140/10/2011. Kompos hasil penelitian diujicobakan kepada tanaman kangkung darat (Ipomoea reptans, cabe keriting (Capsicum annuum dan jagung manis (Zea mays pada media campuran kompos dan tanah latosol (1:3, 2:2 dan 3:1 menggunakan Rancangan Acak Lengkap (RAL dengan 3 ulangan sedangkan data yang diperoleh diolah dengan ANOVA

  19. Pleistocene to Miocene Calcareous Nannofossil Biostratigraphy from IODP Expedition 334 Hole U1381A and Expedition 352 Hole U1439A

    Science.gov (United States)

    Power, M.; Scientists, I. E.; Avery, A. J.

    2015-12-01

    Samples for this study were collected from drill cores taken during the Integrated Ocean Drilling Program (IODP) Expeditions 334 and 352 at Sites U1381 and U1439, respectively. Both of these expeditions were focused around subduction zones and, therefore, had priorities to determine time frames for the initiation of subduction. There are two main objectives for this study, the first being to age-date Pleistocene to Miocene sediments from the western offshore continental margin of Costa Rica (IODP Expedition 334) via calcareous nannofossils. The second objective is to age-date the Miocene sediments from the fore-arc of the Izu-Bonin-Mariana system, east of Japan (IODP Expedition 352), using calcareous nannofossils. Shore-based analysis allows for high-resolution study to determine exact biostratigraphic zonations. These zonations reflect specific time frames based on the occurrence or non-occurrence of certain nannofossil species. Once these zonations are determined, scientists can use the data to identify the initiation of seismic processes that often occur in these regions. Calcareous nannofossil biostratigraphy has now provided zonations for the samples taken from IODP Expedition 334 cores. Samples from core 6R are assigned to the Pleistocene nannofossil Zone NN19 due to the presence ofPseudoemiliania lacunosa and the absence of Emiliania huxleyi. Using the zonal scheme by de Kaenel (1999), this can further be broken down into Event 18 due to the presence of Gephyrocapsa oceanica larger than 4 μm but less than 5 μm, the presence of Calcidiscus macintyrei smaller than 11 μm, and the absence ofGephyrocapsa caribbeanica larger than 4 μm. De Kaenel (1999) has assigned this event datum an age of 1.718 Ma using orbital time scales and oxygen isotope data. Below these samples, an extensive hiatus ranges from the Pleistocene to the early Miocene. Samples from cores 7R through 10R are assigned to nannofossil zone NN5; however, it is impossible to constrain the top of

  20. Influence of substrate and mycorrhizal fungus on the root and shoot architecture of coffee-shading walnut (Cordia alliodora [Ruiz et Pav.] Oken

    Directory of Open Access Journals (Sweden)

    Rodriguez Pérez Loyla

    2012-04-01

    Full Text Available

    Cordia alliodora (coffee-shading walnut is a species of economic importance to Colombia because of its multiple uses for farmers and for reforestation as a timber and industrial resources, mainly in the central coffee region of the country. The aim of this research was to study parameters of C. alliodora shoot and root system architecture over the first year of development. Plants were established in Pacho municipality (Cundinamarca at an 2,150 m a.s.l. A split plot design with a randomized complete block and three replicates was applied. Within the main plot, we evaluated the substrates (soil, husk and compost 2:1:1; soil and husk 3:2; soil and husk 3:1, and withing the subplot, the mycorrhizal fungus (without fungus, Kuklospora colombiana, Glomus manihotis and Acaulospora lacunosa. Substrate type affected C. alliodora root and shoot architectural parameters. Plants transplanted into soil, husk and compost 2:1:1 had the best responses in architectural parameters: diameter of the base of the root (7.82 mm, number of secondary roots (48.4, root dry weight (5.38 g, number of leaves (47.33, dry weight of shoots (7.71 g, shoot length (72.64 g and leaf dry weight (6.28 g at 384 days after transplant. Since no fertilizer was applied to coffee-shading walnut plants, we conclude that the mycorrhizal fungi facilitated a better use and development of mineral elements present in the substrates.

  1. Efeito dos parâmetros de extrusão sobre as propriedades funcionais de extrusados da farinha de batata-doce

    OpenAIRE

    Borba,Alexandra M.; Sarmento,Silene B. S.; Leonel,Magali

    2005-01-01

    Farinha de batata-doce (Ipomoea batatas) foi extrusada em equipamento de rosca simples, mantendo-se fixas as temperaturas na 1ª e 2ª zonas de extrusão (20ºC e 60ºC, respectivamente). O efeito das variáveis umidade da farinha (15, 18 e 21%), temperatura na 3ª zona (100, 120 e 140ºC) e rotação da rosca (180, 210 e 240 rpm) sobre as características dos extrusados foi investigado utilizando-se metodologia de superfície de resposta. O teor de umidade e a temperatura de extrusão influenciaram signi...

  2. http://www.online-rpd.org/journal/view.html?uid=42&sort=&scale=&key=year&keyword=&s_v=20&s_n=2&pn=vol&year=2014&vmd=Full

    Directory of Open Access Journals (Sweden)

    Shin-Chul Kim

    2014-06-01

    Full Text Available This study was carried out to assay the disease incidence degree of Sclerotium rot caused by Sclerotium rolfsii in sixteen most popular commercial cultivars of sweet potato (Ipomoea batatas in Republic of Korea. The degree of disease incidence was evaluated on pot experiments. In pot experiments using artificial inoculation, the Sclerotium rolfsii caused a stem rot on seedling of sweet potato plants and causes a crown rot on lower stems near or at the soil line at favorable environmental conditions. White mycelial mats and sclerotia were formed at the infection sites. Plants severely infected were fell over or died because lower stems near soil surface were rotten. The degree of disease incidence was varied according to cultivars. Two cultivars, Bio-mi and Deayumi, were very resistant, while five cultivars, Shinjami, Shingeonmi, Hongmi, Yeonjami, and Shinhung-3 were highly susceptible.

  3. PENYISIHAN LIMBAH NITROGEN DARI SISTEM AKUAKULTUR MULTITROFIK TERPADU MENGGUNAKAN TANAMAN SAYUR SEBAGAI KONVERTER FOTOAUTOTROF

    Directory of Open Access Journals (Sweden)

    Sumoharjo Sumoharjo

    2016-04-01

    Full Text Available Tiga spesies tanaman sayur, kangkung darat (Ipomoea reptana, sawi (Brassica juncea, dan kemangi (Ocimum basilicum dibandingkan guna mengonversi ammonium dan nitrat nitrogen dari sistem akuakultur. Tanaman tersebut ditanam secara hidroponik menggunakan teknik rakit (rafting technique dengan tata letak rancangan acak kelompok lengkap (RAKL. Hasil percobaan menunjukkan bahwa tingkat konversi nitrogen oleh ketiga jenis tanaman berbeda secara nyata dengan tingkat retensi nitrogen tertinggi pada tanaman kangkung sebesar 0,73±0,28 g; diikuti oleh kemangi (0,30±0,17 g; dan terakhir oleh sawi (0,03±0,07 g. Secara keseluruhan ketiga tanaman mampu menyisihkan limbah nitrogen sebesar 6,70% dari total produksi TAN dari sisa metabolisme ikan yang dibudidayakan.

  4. Leaf vegetables for use in integrated hydroponics and aquaculture systems: Effects of root flooding on growth, mineral composition and nutrient uptake

    DEFF Research Database (Denmark)

    Trang, Ngo Thuy Diem; Schierup, Hans-Henrik; Brix, Hans

    2010-01-01

    In recirculating aquaculture and hydroponics systems, the waste products from fish production are used to produce vegetables or other crops of economic value, and the water is recirculated to the fish tanks. We studied growth, productivity and nutrient uptake of four leaf vegetable species (Lactuca...... sativa, Ipomoea aquatica, Brassica rapa var. chinensis and Brassica rapa var. parachinensis) in a controlled growth experiment with three root flooding treatments (drained, half-flooded and flooded) to assess their preferred hydroponic growth requirements, biomass production and nutrient removal......, respectively. The two Brassica varieties produced much less aerial biomass (50-54 g DW/m2 during a 60-day period). Both I. aquatica and L. sativa are promising species to be included in integrated hydroponic and aquaculture facilities, with I. aquatica showing the most promise because of its higher growth...

  5. Aquaponics Cultivation of Ipome Aquatica and the Peasant Financial Income of Cirata Cistern

    Directory of Open Access Journals (Sweden)

    Abel Gandhy

    2016-08-01

    Full Text Available The research paper analyzes the financial income of a poor community living around the Cirata cistern, in West Java, Indonesia, before and after the community employed the aquaponics strategy of planting ipomoea aquatica. Data are gathered from observation, interviews and statistical analysis of the incomes of community members. In addition, analysis of the data applies Net Present Value (NPV, Internal Rate of Return (IRR, and Payback Period (PP. The findings clearly demonstrate an increased annual income of more than 1.117.296 rupiah among those community members using the aquaponics strategy. Once the community has adjusted to professionally implementing this aquaponics strategy, it would be practically useful to invite investors to invest their capital to develop this area.   Keywords: aquaponics, financial income, West Java, internal rate of return, payback period

  6. The improvement of functional food in yogurt enriched with purple sweet potato (Ipomea batatas var. Ayamurasaki

    Directory of Open Access Journals (Sweden)

    F. Afiati

    2018-05-01

    Full Text Available he research was conducted to examine the use of purple sweet potato (Ipomoea batatas var. Ayamurasaki to improve functional food of yogurt. This experiment has 2 factors of treatments. The first factor (i was concentration of skim milk, i.e. 0%, 3% and 6%; the second factor (ii was concentration of purple sweet potato, i.e. 0%, 2% and 4% of purple sweet potato. The parameters observed were viability of lactic acid bacteria (LAB, pH, moisture content, protein, fat, carbohydrate, ash and crude fiber and organoleptic. The results showed that there was no interaction between the concentration of skim-milk and the purple sweet potato on total LAB, moisture content and crude fiber. However, the interaction occurred on the levels of fat, protein, carbohydrate and ash. The organoleptic test results that yogurt enriched by 2% purple sweet potato without addition of skim was more preferable by panelist with a value of 3.65.

  7. EVALUATION OF CYTOTOXIC, ANTIMICROBIAL AND ANTIINFLAMMATORY PROPERTIES FROM THE LATEX OF IPOMEA STAPHYLINA

    Directory of Open Access Journals (Sweden)

    Prasanthi Narra

    2014-04-01

    Full Text Available The plant Ipomoea staphylina has been used in diverse traditional medication for the treatment of diseases and illness of human beings. The crude latex extract obtained from the stem of Ipomea staphylina was evaluated for cytotoxic, antimicrobial and wound healing properties. Cell viability and cytotoxicity assays such as Colony Formation method and Enzyme based methods that determined cell viability with a colorimetric method were performed to evaluate the medicinal properties of Ipomea staphylina. Similarly Microbiological Antibiotic Assay to determine the antimicrobial properties and wound healing properties were tested by determining the potent anti-inflammatory molecules that inhibited COX and LOX enzymes. Results showed that the latex crude extract of Ipomea staphylina showed potent Antimicrobial and Antiinflamatory properties, but the viability of the cells were unaffected.

  8. Comparison of the efficiency of bacterial and fungal laccases in delignification and detoxification of steam-pretreated lignocellulosic biomass for bioethanol production.

    Science.gov (United States)

    De La Torre, María; Martín-Sampedro, Raquel; Fillat, Úrsula; Eugenio, María E; Blánquez, Alba; Hernández, Manuel; Arias, María E; Ibarra, David

    2017-11-01

    This study evaluates the potential of a bacterial laccase from Streptomyces ipomoeae (SilA) for delignification and detoxification of steam-exploded wheat straw, in comparison with a commercial fungal laccase from Trametes villosa. When alkali extraction followed by SilA laccase treatment was applied to the water insoluble solids fraction, a slight reduction in lignin content was detected, and after a saccharification step, an increase in both glucose and xylose production (16 and 6%, respectively) was observed. These effects were not produced with T. villosa laccase. Concerning to the fermentation process, the treatment of the steam-exploded whole slurry with both laccases produced a decrease in the phenol content by up to 35 and 71% with bacterial and fungal laccases, respectively. The phenols reduction resulted in an improved performance of Saccharomyces cerevisiae during a simultaneous saccharification and fermentation (SSF) process, improving ethanol production rate. This enhancement was more marked with a presaccharification step prior to the SSF process.

  9. Rheology of Potato flour Mixes and Wheat to Make Bread

    Directory of Open Access Journals (Sweden)

    Ely Fernando Sacón-Vera

    2016-07-01

    Full Text Available Evaluate the rheological properties of flour mixes Ipomoea batata and Triticum vulgare for the preparation of bread dough, was the goal of this research for it a completely randomized design, as treatments sweet potato flour was used varieties are used: Toquecita, Guayaco Purple, Purple Ecuador, Brazil and Ina Purple in a 30/70 ratio (sweet potato flour / wheat flour respectively. The rheological variables: water absorption, development time, weakening of the dough stability, water absorption index (C1, mixing rate (C2, gluten strength index (C3, gel viscosity (C4, resistance index amylase (C5 and starch retro gradation index (C6 were evaluated with Mixolab equipment. The results showed that the variety Purple Brazil showed better characteristics of flours recommended premixes for the baking process in response to these indices

  10. Estimation of the adult male population of sweet potato weevil, Cylas formicarius (Fabricius) at its low-density period on Kikai Island in Japan

    International Nuclear Information System (INIS)

    Yamaguchi, T.; Hatono, T.; Izumi, S.; Nishihara, S.; Kimura, K.; Torigoe, H.; Tanaka, T.; Miyaji, K.; Hara, Y.; Ueda, A.; Shigei, F.

    2008-01-01

    The sweet potato weevil, Cylas formicarius (Fabricius) is a major insect pest of the sweet potato, Ipomoea batatas (L.) Lam. throughout the tropical and subtropical regions of the world. We estimated the entire adult male population of C. formicarius at its low-density period on Kikai Island, Kagoshima Pref., Japan. The population of adult males at the high-density period in September was about 5 times larger than that at its low-density period in May, both of which were estimated by Yamamura's method. Using this calculation in combination with an estimate of the maximal population size (4 x 10E6) by Sugimoto et al. in 1994, the total number of male weevils at their low-density period can be assumed to be less than 8 x 10E5

  11. Value-added probiotic development by high-solid fermentation of sweet potato with Saccharomyces boulardii.

    Science.gov (United States)

    Campbell, Carmen; Nanjundaswamy, Ananda K; Njiti, Victor; Xia, Qun; Chukwuma, Franklin

    2017-05-01

    Controlled fermentation of Sweet potato ( Ipomoea batatas ) var. Beauregard by yeast, Saccharomyces boulardii (MAY 796) to enhance the nutritional value of sweet potato was investigated. An average 8.00 × 10 10 Colony Forming Units (CFU)/g of viable cells were obtained over 5-day high-solid fermentation. Yeast cell viability did not change significantly over time at 4°C whereas the number of viable yeast cells reduced significantly at room temperature (25°C), which was approximately 40% in 12 months. Overall, the controlled fermentation of sweet potato by MAY 796 enhanced protein, crude fiber, neutral detergent fiber, acid detergent fiber, amino acid, and fatty acid levels. Development of value-added sweet potato has a great potential in animal feed and human nutrition. S. boulardii - fermented sweet potato has great potential as probiotic-enriched animal feed and/or functional food for human nutrition.

  12. Immobilisation of Cu, Pb and Zn in Scrap Metal Yard Soil Using Selected Waste Materials.

    Science.gov (United States)

    Kamari, A; Putra, W P; Yusoff, S N M; Ishak, C F; Hashim, N; Mohamed, A; Isa, I M; Bakar, S A

    2015-12-01

    Immobilisation of heavy metals in a 30-year old active scrap metal yard soil using three waste materials, namely coconut tree sawdust (CTS), sugarcane bagasse (SB) and eggshell (ES) was investigated. The contaminated soil was amended with amendments at application rates of 0 %, 1 % and 3 % (w/w). The effects of amendments on metal accumulation in water spinach (Ipomoea aquatica) and soil metal bioavailability were studied in a pot experiment. All amendments increased biomass yield and reduced metal accumulation in the plant shoots. The bioconcentration factor and translocation factor values of the metals were in the order of Zn > Cu > Pb. The addition of ES, an alternative source of calcium carbonate (CaCO3), has significantly increased soil pH and resulted in marked reduction in soil metal bioavailability. Therefore, CTS, SB and ES are promising low-cost immobilising agents to restore metal contaminated land.

  13. Curvas dose-resposta em espécies de plantas daninhas com o uso do herbicida glyphosate(1 Dose-response curves in weed species with the use of herbicide glyphosate

    Directory of Open Access Journals (Sweden)

    André Luiz de Souza Lacerda

    2004-01-01

    Full Text Available Com o objetivo de verificar a resposta de diferentes espécies de plantas daninhas ao herbicida glyphosate, foi desenvolvido em câmara de crescimento um experimento inteiramente casualizado, com cinco repetições no Departamento de Produção Vegetal da ESALQ/USP. Para isso, foram estudadas seis espécies de plantas daninhas: Bidens pilosa L., Tridax procumbens L., Digitaria insularis (L. Fedde, Spermacoce latifolia Aubl., Ipomoea grandifolia L. e Commelina benghalensis L. Utilizou-se o herbicida glyphosate, inibidor da enzima EPSPs, com doses em escalas de 0,0; 11,3; 22,5; 45; 90; 180; 360; 720 e 1.440 g.ha-1 i.a. A elaboração das curvas dose-resposta foi feita pelo ajuste da equação dos dados coletados de biomassa verde utilizando o modelo log-logístico: Y = C+D-C / 1 + Exp{b[log(x-log(RC50]}, calculado por modelo estatístico não linear dos dados pelo programa estatístico SAS. Após a determinação das curvas dose-resposta nas espécies acima citadas concluiu-se que Bidens pilosa foi considerada a planta daninha mais suscetível ao herbicida glyphosate, pois apresentou menor RC50 (31,86 g.ha-1 i.a.. As espécies Tridax procumbens, Digitaria insularis, Spermacoce latifolia, Ipomoea grandifolia, Commelina benghalensis obtiveram RC50 de 58,40; 128,50; 250,44; 615,49 e >1.440 g.ha-1 i.a. respectivamente. Portanto, a quantidade necessária de herbicida para reduzir em 50% a biomassa verde foi de 1,83; 4,03; 7,86; 32 e >359,56 vezes maior em relação à Bidens pilosa respectivamente.With the objective of veryfing the response of different doses in species of weeds by herbicide glyphosate, an experiment was conducted in growth chamber in a completetly randomized design with three repetitions, in the Department of Vegetable Production at ESALQ/USP. For that, were chosen six species of weeds: Bidens pilosa L., Tridax procumbens L., Digitaria insularis (L. Feed, Spermacoce latifolia Aubl., Ipomoea grandifolia L. and Commelina benghalensis L

  14. Dicty_cDB: Contig-U02054-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.080 1 ( DT656898 ) pgr1n.UA001.227 Normalized chicken reproductive t... 50 0.080 1 ( AJ454996 ) Gallus gallus EST, clone library...90810 XtSt10-30 Xenopus (Silurana) t... 36 0.17 2 ( DV037739 ) BRS3230 storage root cDNA library Ipomoea bat..... 44 4.9 1 ( BM959958 ) cihA1L9S Ascidian hemocytes cDNA library Ciona in... 44 4.9 1 ( BM230365 ) K0294C12-3 NIA Mouse Unferti...... 36 0.010 3 ( EY189411 ) LLAE1039S Spider Loxosceles laeta cDNA library Lo... ... riken1, clone 4e... 50 0.080 1 ( AJ453299 ) Gallus gallus EST, clone library riken1,

  15. An analytical pipeline to compare and characterise the anthocyanin antioxidant activities of purple sweet potato cultivars.

    Science.gov (United States)

    Hu, Yijie; Deng, Liqing; Chen, Jinwu; Zhou, Siyu; Liu, Shuang; Fu, Yufan; Yang, Chunxian; Liao, Zhihua; Chen, Min

    2016-03-01

    Purple sweet potato (Ipomoea batatas L.) is rich in anthocyanin pigments, which are valuable constituents of the human diet. Techniques to identify and quantify anthocyanins and their antioxidant potential are desirable for cultivar selection and breeding. In this study, we performed a quantitative and qualitative chemical analysis of 30 purple sweet potato (PSP) cultivars, using various assays to measure reducing power radical-scavenging activities, and linoleic acid autoxidation inhibition activity. Grey relational analysis (GRA) was applied to establish relationships between the antioxidant activities and the chemical fingerprints, in order to identify key bioactive compounds. The results indicated that four peonidin-based anthocyanins and three cyanidin-based anthocyanins make significant contributions to antioxidant activity. We conclude that the analytical pipeline described here represents an effective method to evaluate the antioxidant potential of, and the contributing compounds present in, PSP cultivars. This approach may be used to guide future breeding strategies. Copyright © 2015. Published by Elsevier Ltd.

  16. Levantamento de plantas infestantes em lavouras de milho 'safrinha'no estado de São Paulo Weed survey in autumn corn crops in the state of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Aildson P. Duarte

    1999-08-01

    Full Text Available Fez-se o levantamento da flora infestante na lavoura do milho "safrinha" nas duas principais regiões de plantio no Estado de São Paulo, em 1995. Foram visitadas 85 lavouras na Região do Médio Vale do Paranapanema e 29 na Região Norte. Nesta, em quatro lavouras fez-se a semeadura na palha e em 25, em solo com preparo de gradagem simples, todos sem herbicida. Naquela, a semeadura na palha foi em 68 lavouras, em 11 fez-se gradagem simples e, em seis, gradagem dupla, havendo aplicação de herbicidas de POS em algumas áreas. As espécies que ocorreram, segundo a sua freqüência, foram, na Região Norte: Glycine max> Amaranthus retroflexus> Acanthospermum hispidum = Bidens pilosa = Alternanthera tenella > Cenchrus echinatus > Euphorbia heterophylla > Ipomoea spp. > Commelina benghalensis > Sida spp. = Eleusine indica; e, na Região do Médio Vale do Paranapanema: Euphorbia heterophylla = Glycine max = Commelina benghalensis > Bidens pilosa = Raphanus sativus > Cenchrus echinatus = Acanthospermum hispidum > Brachiaria plantaginea > Sida spp. = Coronopus didymus > Eleusine indica > Digitaria horizontalis > Amaranthus retroflexus. O preparo do solo com gradagem dupla, resultou em menor índice de ocorrência de alta infestação, seguida da gradagem simples. O uso de herbicidas, de modo geral, também reduziu esse índice. As espécies Commelina benghalensis, Digitaria horizontalis, Sida spp., Eleusine indica e Amaranthus hibridus ocorreram apenas com a semeadura direta na Região do Paranapanema. Na Região Norte, Ipomoea spp. e Euphorbia heterophylla só ocorreram nas áreas com gradagem simples.A weed infestation survey was carried out in the two main cultivation regions of autumn corn crops in the State of São Paulo. In the Médio Vale do Paranapanema 85 plantations were visited and in the Região Norte 29 plantations. In this region four crops were sowed directly and 25 after soil preparation with a single harrowing, all without herbicides

  17. Weed Hosts of Meloidogyne arenaria and M. incognita Common in Tobacco Fields in South Carolina.

    Science.gov (United States)

    Tedford, E C; Fortnum, B A

    1988-10-01

    Thirty-two weed species common in South Carolina and one cultivar of tobacco were evaluated as hosts of Meloidogyne arenaria race 2 and M. incognita race 3 in the greenhouse. Egg mass production and galling differed (P Eleusine indica, Sorghum halepense, Setaria viridis, Digitaria sanguinalis, and Datura stramonium were poor hosts for M. arenaria. Amaranthus palmeri, Amaranthus hybridus, Chenopodium album, Euphorbia maculata, Setaria lutescens, Vicia villosa, Sida spinosa, Rumex crispus, and Portulaca oleracea were moderate hosts and Ipomoea hederacea var. integriuscula, Xanthium strumarium, Cyperus esculentus, Cynodon dactylon, Paspalum notatum, Eleusine indica, Setaria viridis, and Rumex acetosella were poor hosts for M. incognita. None of the above were good hosts for M. incognita. Tobacco 'PD4' supported large numbers of both nematode species.

  18. Efektivitas Bioremediasi Lima Jenis Tanaman Terhadap Kandungan Logam Berat (Cr2+dan Pb2+ dalam Air

    Directory of Open Access Journals (Sweden)

    I.G. Seregeg

    2012-09-01

    Full Text Available Telah dilakukan penelitian di Laboratorium, tentang efektivitas bioremediasi lima jenis tanaman ; mendong {Scirpus articularis welingi (Cyperus sp, purun (Typha sp., tales-talesan (Typhonium sp, kangkung (Ipomoea aquatica terhadap kandungan Cr2+ dan Pb2+ dalam air tercemar di Jakarta, Desember 1994. Kelima jenis tanaman tersebut ditempatkan dalam akuarium berkapasitas 10 liter, yang diisi air tercemar Cr2+ dan Pb2+ sebanyak lima liter. Penelitian ini dilengkapi dengan akuarium kontrol, seluruh perlakuan diulang dua kali. Hasilnya menunjukkan, bahwa semua jenis tanaman mempunyai kemampuan yang berbeda-beda. Kemampuan yang paling kuat ditunjukkan oleh purun disusul berturut-turut oleh welingi, mendong, kangkung dan tales-talesan. Pengaruh tanam terhadap Pb2+ menunjukkan, daya serap yang cukup kuat dan pola urutannya sama seperti yang ditunjukkan terhadap Cr2+. Tanaman yang tumbuh tegak dengan batang yang kuat (rumput-rumputan mempunyai daya serap yang lebih tinggi dibandingkan dengan tanaman menjalar.

  19. The study of distribution characteristics of vascular and naturalized plants in Dokdo, South Korea

    Directory of Open Access Journals (Sweden)

    Su-Young Jung

    2014-06-01

    Full Text Available This study was performed to investigate the distribution of vascular plants and the characteristics of naturalized plants in Dokdo Island, South Korea. The survey was conducted a total of 5 times from June 2012 to September 2013. The number of plants confirmed in this study was 60 taxa in total: 29 families, 49 genera, 55 species, 2 subspecies and 3 varieties. To classify them by regional groups, 53 taxa were confirmed in the Dongdo and 38 taxa were confirmed in the Seodo. Among them, the distribution of Stellaria neglecta Weihe and Puccinellia nipponica Ohwi was first discovered in this study. The naturalized plants distributed in Dokdo was 7 taxa: Chenopodium album L., Sonchus asper (L. Hill, Sonchus oleraceus L., Ipomoea purpurea Roth, Brassica juncea (L. Czern., etc. Overall, concerns over the naturalized plants in Dokdo are high regardless of the scale of their distribution and the appearance frequency.

  20. Weed management: a case study from north-west Pakistan

    International Nuclear Information System (INIS)

    Marwat, K.B.; Hashim, S.; Ali, H.

    2010-01-01

    Alien and exotic plant invasions are threatening the floral diversity around the globe and affect ecological processes. Weed invasion has been documented in North-West Pakistan. A total of 16 weeds were reported as invasive. These were Xanthium strumarium, Ipomoea eriocarpa, Alternanthera pungens, Trianthema portulacastrum, Tagetes minuta, Imperata cylindrica, Amaranthus hybridus subsp. hybridus, Robinia pseudo-acacia, Broussonetia papyrifera, Ailanthus altissima, Pistia stratiotes, Phragmites australis, Parthenium hysterophorus, Cannabis sativa, Galium aparine and Emex spinosus. Among these Robinia pseudo-acacia, Broussonetia papyrifera and Ailanthus altissima are trees and were purposely introduced as they later became invasive. They were aggressive in nature and replaced or suppressed the local vegetation. Their distribution, history of invasion and management has been discussed here. The behaviour and association of the 36 problem weeds with different crops has also been outlined as they perspired from the farmers. (author)

  1. Weed management: a case study from north-west Pakistan

    Energy Technology Data Exchange (ETDEWEB)

    Marwat, K B; Hashim, S; Ali, H [KPK Agriculture University, Peshawar (Pakistan). Dept. of Weed Science

    2010-12-15

    Alien and exotic plant invasions are threatening the floral diversity around the globe and affect ecological processes. Weed invasion has been documented in North-West Pakistan. A total of 16 weeds were reported as invasive. These were Xanthium strumarium, Ipomoea eriocarpa, Alternanthera pungens, Trianthema portulacastrum, Tagetes minuta, Imperata cylindrica, Amaranthus hybridus subsp. hybridus, Robinia pseudo-acacia, Broussonetia papyrifera, Ailanthus altissima, Pistia stratiotes, Phragmites australis, Parthenium hysterophorus, Cannabis sativa, Galium aparine and Emex spinosus. Among these Robinia pseudo-acacia, Broussonetia papyrifera and Ailanthus altissima are trees and were purposely introduced as they later became invasive. They were aggressive in nature and replaced or suppressed the local vegetation. Their distribution, history of invasion and management has been discussed here. The behaviour and association of the 36 problem weeds with different crops has also been outlined as they perspired from the farmers. (author)

  2. Allelopathic Activity of Extracts from Different Brazilian Peanut (Arachis hypogaea L.) Cultivars on Lettuce (Lactuca sativa) and Weed Plants.

    Science.gov (United States)

    Casimiro, G S; Mansur, E; Pacheco, G; Garcia, R; Leal, I C R; Simas, N K

    2017-01-01

    Peanut ( Arachis hypogaea L.) is the fourth most consumed oleaginous plant in the world, producing seeds with high contents of lipids, proteins, vitamins, and carbohydrates. Biological activities of different extracts of this species have already been evaluated by many researchers, including antioxidant, antitumoral, and antibacterial. In this work, the allelopathic activity of extracts from different Brazilian peanut cultivars against lettuce (Lactuca sativa) and two weed plants ( Commelina benghalensis and Ipomoea nil ) was studied. Aerial parts, roots, seeds, and seed coats were used for the preparation of crude extracts. Seed extract partitioning was performed with n -hexane, dichloromethane, ethyl acetate, n -butanol, and aqueous residue. Germination and growth of hypocotyls and rootlets were evaluated after one and five days of incubation with plant extracts, respectively. Crude seed extract and its dichloromethanic partition displayed highest allelopathic activity. These results contribute for the study of new potential natural herbicides.

  3. Allelopathic Activity of Extracts from Different Brazilian Peanut (Arachis hypogaea L.) Cultivars on Lettuce (Lactuca sativa) and Weed Plants

    Science.gov (United States)

    Garcia, R.; Simas, N. K.

    2017-01-01

    Peanut (Arachis hypogaea L.) is the fourth most consumed oleaginous plant in the world, producing seeds with high contents of lipids, proteins, vitamins, and carbohydrates. Biological activities of different extracts of this species have already been evaluated by many researchers, including antioxidant, antitumoral, and antibacterial. In this work, the allelopathic activity of extracts from different Brazilian peanut cultivars against lettuce (Lactuca sativa) and two weed plants (Commelina benghalensis and Ipomoea nil) was studied. Aerial parts, roots, seeds, and seed coats were used for the preparation of crude extracts. Seed extract partitioning was performed with n-hexane, dichloromethane, ethyl acetate, n-butanol, and aqueous residue. Germination and growth of hypocotyls and rootlets were evaluated after one and five days of incubation with plant extracts, respectively. Crude seed extract and its dichloromethanic partition displayed highest allelopathic activity. These results contribute for the study of new potential natural herbicides. PMID:28396881

  4. Image diagnosis of plant function under environmental pollution. Shokubutsu de kankyo osen wo shindansuru

    Energy Technology Data Exchange (ETDEWEB)

    Omasa, K. (National Inst. for Environmental studies, Tsukuba (Japan))

    1993-12-20

    Various physiological reaction of plants would be obstructed and troubles of their growth would be met under environmental pollution. There are also cases that the polluted materials as nutritious components are absorbed by plants. Consequently, if plant's reaction on this environmental pollution would be used, indexes of environmental pollution and environment can be improved. For examples, Ipomoea Nil and Petunia having high reaction on photochemical oxidate are widely used as index plant of air pollution. Zelkova trees and poplars planted as street trees can also greatly absorbed the polluted gas and have a function to clear air. In this paper, a diagnosis method by visualizing plant's reaction on environmental pollution by using technique of image measurement was explained. As devices of usable image measurement, a thermal camera, a solid measuring cameras, an ultrasonic camera, a multi-spectral camera and an X-ray TV camera were given. 6 refs., 4 figs., 1 tab.

  5. Efeitos de períodos de permanência de clomazone + hexazinona no solo e na palha de cana-de-açúcar antes da ocorrência de chuvas na eficácia de controle de plantas daninhas Effects of different periods of clomazone + hexazinona permanence in soil and sugarcane mulch before the occurrence of rain on weed control efficacy

    Directory of Open Access Journals (Sweden)

    C.A. Carbonari

    2010-01-01

    Full Text Available O presente trabalho teve por objetivo avaliar a eficácia da mistura formulada de clomazone e hexazinona aplicada sobre o solo e em associação com a palha de cana-de-açúcar, após diferentes períodos de permanência sem a ocorrência de chuvas. O experimento foi conduzido em vasos em casa de vegetação, no município de Botucatu-SP. Os vasos foram preenchidos com solo, e as sementes de plantas daninhas (Brachiaria decumbens, Ipomoea grandifolia, Ipomoea hederifolia e Euphorbia heterophylla foram semeadas superficialmente e, em seguida, cobertas ou não com palha de cana-de-açúcar, dependendo do tratamento utilizado. O delineamento experimental utilizado foi o inteiramente casualizado, com quatro repetições. Os tratamentos foram dispostos em um esquema fatorial 3 x 6, sendo os fatores seis períodos sem ocorrência de chuvas (0, 3, 7, 15, 30 e 60 dias e três posicionamentos do produto (sobre o solo sem palha, sobre e sob a palha de cana. Foram realizadas avaliações de controle aos 10, 21, 35 e 42 dias após a ocorrência da chuva. A mistura de clomazone + hexazinona promoveu excelentes resultados de controle para todas as espécies estudadas quando aplicada sobre, sob ou na ausência de palha de cana-de-açúcar. No entanto, observou-se tendência de redução nos níveis de controle para períodos superiores a 60 dias sem ocorrência de chuva.The objective of this work was to evaluate the efficacy of the formulated mixture clomazone and hexazinone applied in soil or combined with sugarcane mulch, after different periods of permanence without the occurrence of rain. The experiment was carried out in vases under greenhouse conditions in Botucatu, São Paulo, Brazil. The weeds Brachiaria decumbens, Ipomoea grandifolia, Ipomoea hederifolia and Euphorbia heterophylla were sown and covered or not with sugarcane mulch. The experiment was arranged in a complete randomized design with four repetitions. The treatments were displaced in a 3x6

  6. The evolution of tolerance to deer herbivory: modifications caused by the abundance of insect herbivores.

    Science.gov (United States)

    Stinchcombe, John R; Rausher, Mark D

    2002-01-01

    Although recent evidence indicates that coevolutionary interactions between species often vary on a biogeographical scale, little consideration has been given to the processes responsible for producing this pattern. One potential explanation is that changes in the community composition alter the coevolutionary interactions between species, but little evidence exists regarding the occurrence of such changes. Here we present evidence that the pattern of natural selection on plant defence traits, and the probable response to that selection, are critically dependent on the composition of the biotic community. The evolutionary trajectory of defence traits against mammalian herbivory in the Ivyleaf morning glory (Ipomoea hederacea), and which defence traits are likely to respond to selection, are both dependent on the presence or absence of insect herbivores. These results indicate that variation in community composition may be a driving force in generating geographical mosaics. PMID:12065040

  7. Crop Management Practices in the Humid Hills from Northeastern Brazil between 670-530 Yrs BP: Palynological Evidences from Archaeological Site Evaristo I

    Directory of Open Access Journals (Sweden)

    Aline Gonçalves Freitas

    2015-12-01

    Full Text Available The first cultural traces of ancient pottery towns in the Serra de Baturité are presented. The pollen spectrum of sediments reveals a mosaic of moist mountainous vegetation, xerophytes, annual nitrophilous, hygrophilous and bog plants. Useful pollen recovered from ceramic, such as cassava (Manihot type, sweet potatoes (Ipomoea type, cotton (Gossypium type, palm trees and fruitful (Arecaceae, cf. Astronium and Anacardium type, together with pathogenic microfungi corn, cotton and some tubers (Curvularia type, Alternaria, Puccinia type and cf. Ustilago maydis indicate agricultural and livelihood activities. The coprophilous fungi of humans and other animals (Cercophora type Gelasinospora type and Sordariaceae reflect the time spent by these groups in the archaeological area. The Gelasinospora fungus also shows the use of fire as fuel for agricultural practices and hunting. These data demonstrate the use of ceramics in funerary and domestic contexts.

  8. High-throughput microarray mapping of cell wall polymers in roots and tubers during the viscosity-reducing process

    DEFF Research Database (Denmark)

    Huang, Yuhong; Willats, William George Tycho; Lange, Lene

    2016-01-01

    the viscosity-reducing process are poorly characterized. Comprehensive microarray polymer profiling, which is a high-throughput microarray, was used for the first time to map changes in the cell wall polymers of sweet potato (Ipomoea batatas), cassava (Manihot esculenta), and Canna edulis Ker. over the entire...... viscosity-reducing process. The results indicated that the composition of cell wall polymers among these three roots and tubers was markedly different. The gel-like matrix and glycoprotein network in the C. edulis Ker. cell wall caused difficulty in viscosity reduction. The obvious viscosity reduction......Viscosity reduction has a great impact on the efficiency of ethanol production when using roots and tubers as feedstock. Plant cell wall-degrading enzymes have been successfully applied to overcome the challenges posed by high viscosity. However, the changes in cell wall polymers during...

  9. Penggunaan Enzim α-Amilase dari Saccharomycopsis fibuligera R64 untuk Peningkatan Kualitas Roti Komposit Terigu-Ubi Jalar Ungu

    Directory of Open Access Journals (Sweden)

    Agus Safari

    2017-12-01

    Full Text Available Purple sweet potato (Ipomoea batatas var. Ayamurasaki is one of typical sweet tubers which is also commonly well known as Ipomoea blackie due to blackish purple (solid purple tuber skin and flesh. The sweet potato can be transformed into flour or pasta and used to substitute wheat flour in the production of composite bread. Instead of synthetic chemical compounds, α-amylase isolated from the yeast Saccharomycopsis fibuligera can be added to the flour or dough of the composite bread to improve its quality. The purpose of the present study was to investigate the effect of α–amylase addition on the quality of the purple sweet potato flour and pasta composite bread. The observed properties of the bread were crumbs morphology of the bread, volume increment, bread height, texture, and organoleptic test. The results showed that addition of the α-amylase to the dough of the composite bread increased the volume increment value from 155.0% to 177.1% and from 335.7% to 342.1% for the sweet potato flour and pasta bread composite, respectively. While height of the bread increased from 4.7 to 5.1 cm and from 6.9 to 7.8 cm after addition of the enzyme for the sweet potato flour and pasta bread composite, respectively. Composite bread with α-amylase addition has softer texture and higher preference. Morphology examination result showed that starch granules in the bread crums with α-amylase treatment were disrupted. Most plausibly, the enzymes degrade the starch granules and produced dextrin which inhibited the cross linking formation between starch and protein, and therefore, the speed of hardening process of the bread can be reduced.

  10. KETAHANAN HIDUP BEBERAPA JENIS TUMBUHAN DI KAWASAN VOID BEKAS TAMBANG BATUBARA

    Directory of Open Access Journals (Sweden)

    Kissinger Kissinger

    2018-04-01

    Full Text Available The selection of plant species for phytoremediation activities is very important in the conservation of soil, water, plant, and animal life to create a conducive environment within a community or ecosystem. Plant survival is one indication for the selection of phytoremediation plants. This study aims to determine the survival of some plants in void areas of coal mining. Types of plants used are surface water plants species and the edge of void plant species. The plants of surface water area consisting of Kiambang (Salvinia sp., Enceng gondok (Eichornia crassipes, Genjer (Limnocharis flava, and Kangkung (Ipomoea aquatica. The plants which planted on edge of void were purun tikus (Eleocharis dulcis and Bamban (Donax canniformis. Time of observation time was 6 months. Data were analyzed using a tabular matrix that contained the percentage of plant life/period time. The growth of the plant is specifically defined according to the color visibility and the development of plant form. The results of the study found that the highest surface survival species were Kiambang (Salvinia sp. and Kangkung (Ipomoea aquatica. Both of them still survive for 6 months of observation. The growth percentage of these two plants at the end of the observations are 36% and 20% respectively. Enceng gondok (Eichhornia crassipes has a survival for 4 months. Whole water plant growth was depressed by indications of death, tendencies to yellowish-brownish or blackish, and smaller body parts. Purun tikus (Eleocharis dulcis and Bamban (Donax canniformis grown on the edge of voids have a high survival. Both of them showed ≥95% survival at the end of observation time.

  11. Reconciling Conflicting Phylogenies in the Origin of Sweet Potato and Dispersal to Polynesia.

    Science.gov (United States)

    Muñoz-Rodríguez, Pablo; Carruthers, Tom; Wood, John R I; Williams, Bethany R M; Weitemier, Kevin; Kronmiller, Brent; Ellis, David; Anglin, Noelle L; Longway, Lucas; Harris, Stephen A; Rausher, Mark D; Kelly, Steven; Liston, Aaron; Scotland, Robert W

    2018-04-23

    The sweet potato is one of the world's most widely consumed crops, yet its evolutionary history is poorly understood. In this paper, we present a comprehensive phylogenetic study of all species closely related to the sweet potato and address several questions pertaining to the sweet potato that remained unanswered. Our research combined genome skimming and target DNA capture to sequence whole chloroplasts and 605 single-copy nuclear regions from 199 specimens representing the sweet potato and all of its crop wild relatives (CWRs). We present strongly supported nuclear and chloroplast phylogenies demonstrating that the sweet potato had an autopolyploid origin and that Ipomoea trifida is its closest relative, confirming that no other extant species were involved in its origin. Phylogenetic analysis of nuclear and chloroplast genomes shows conflicting topologies regarding the monophyly of the sweet potato. The process of chloroplast capture explains these conflicting patterns, showing that I. trifida had a dual role in the origin of the sweet potato, first as its progenitor and second as the species with which the sweet potato introgressed so one of its lineages could capture an I. trifida chloroplast. In addition, we provide evidence that the sweet potato was present in Polynesia in pre-human times. This, together with several other examples of long-distance dispersal in Ipomoea, negates the need to invoke ancient human-mediated transport as an explanation for its presence in Polynesia. These results have important implications for understanding the origin and evolution of a major global food crop and question the existence of pre-Columbian contacts between Polynesia and the American continent. Copyright © 2018 Elsevier Ltd. All rights reserved.

  12. Species tree estimation for the late blight pathogen, Phytophthora infestans, and close relatives.

    Directory of Open Access Journals (Sweden)

    Jaime E Blair

    Full Text Available To better understand the evolutionary history of a group of organisms, an accurate estimate of the species phylogeny must be known. Traditionally, gene trees have served as a proxy for the species tree, although it was acknowledged early on that these trees represented different evolutionary processes. Discordances among gene trees and between the gene trees and the species tree are also expected in closely related species that have rapidly diverged, due to processes such as the incomplete sorting of ancestral polymorphisms. Recently, methods have been developed for the explicit estimation of species trees, using information from multilocus gene trees while accommodating heterogeneity among them. Here we have used three distinct approaches to estimate the species tree for five Phytophthora pathogens, including P. infestans, the causal agent of late blight disease in potato and tomato. Our concatenation-based "supergene" approach was unable to resolve relationships even with data from both the nuclear and mitochondrial genomes, and from multiple isolates per species. Our multispecies coalescent approach using both Bayesian and maximum likelihood methods was able to estimate a moderately supported species tree showing a close relationship among P. infestans, P. andina, and P. ipomoeae. The topology of the species tree was also identical to the dominant phylogenetic history estimated in our third approach, Bayesian concordance analysis. Our results support previous suggestions that P. andina is a hybrid species, with P. infestans representing one parental lineage. The other parental lineage is not known, but represents an independent evolutionary lineage more closely related to P. ipomoeae. While all five species likely originated in the New World, further study is needed to determine when and under what conditions this hybridization event may have occurred.

  13. Species tree estimation for the late blight pathogen, Phytophthora infestans, and close relatives.

    Science.gov (United States)

    Blair, Jaime E; Coffey, Michael D; Martin, Frank N

    2012-01-01

    To better understand the evolutionary history of a group of organisms, an accurate estimate of the species phylogeny must be known. Traditionally, gene trees have served as a proxy for the species tree, although it was acknowledged early on that these trees represented different evolutionary processes. Discordances among gene trees and between the gene trees and the species tree are also expected in closely related species that have rapidly diverged, due to processes such as the incomplete sorting of ancestral polymorphisms. Recently, methods have been developed for the explicit estimation of species trees, using information from multilocus gene trees while accommodating heterogeneity among them. Here we have used three distinct approaches to estimate the species tree for five Phytophthora pathogens, including P. infestans, the causal agent of late blight disease in potato and tomato. Our concatenation-based "supergene" approach was unable to resolve relationships even with data from both the nuclear and mitochondrial genomes, and from multiple isolates per species. Our multispecies coalescent approach using both Bayesian and maximum likelihood methods was able to estimate a moderately supported species tree showing a close relationship among P. infestans, P. andina, and P. ipomoeae. The topology of the species tree was also identical to the dominant phylogenetic history estimated in our third approach, Bayesian concordance analysis. Our results support previous suggestions that P. andina is a hybrid species, with P. infestans representing one parental lineage. The other parental lineage is not known, but represents an independent evolutionary lineage more closely related to P. ipomoeae. While all five species likely originated in the New World, further study is needed to determine when and under what conditions this hybridization event may have occurred.

  14. Efficiency of removing nitrogen and phosphorous and effects on extracellular enzyme activity in water body by five hydrophytes%5种水生植物的脱氮除磷效果及其对水体胞外酶活的影响

    Institute of Scientific and Technical Information of China (English)

    汪文强; 王子芳; 高明

    2016-01-01

    To investigate the role of hydrophytes in the purification of eutrophic water bodies,Trapa quadrispinosa Roxb.,Eichhornia crassipes,Hydrocharis dubia (Bl.) Backer,Ipomoea aquatica Forsk,and Lemna minor L.were planted in treated water to compare their effects on purification and their influence on extracellular enzyme activity.The results showed that all hydrophytes performed well during the purification process.For total nitrogen (TN),the order of removal efficiency was Eichhornia crassipes (81.6%) > Ipomoea aquatica Forsk (72.2%) > Hydrocharis dubia (Bl.) Backer (68.4%) > Trapa quadrispinosa Roxb.(65.8%) > Lemna minor L.(60.2%),and for total phosphorous (TP) removal,the order was Eichhornia crassipes (95.0%) > Ipomoea aquatica Forsk (89.7%) > Hydrocharis dubia (Bl.) Backer (78.4%) > Trapa quadrispinosa Roxb.(77.3%) > Lemna minor L.(70.5%).All five hydrophytes could enhance the activity of extracellular enzymes,and the treatment involving E.crassipes showed the maximum range and peak urease activity (UA) and alkaline phosphatase activity (APA).The range and peak UA were 19.70 μg · mL-1 and 10.33 μg · mL-1,respectively,and for APA,they were 8.12 μg · mL-1 and 5.95 μg · mL-1.The range and peak UA and APA for Ipomoea aquatica Forsk were the next highest.UA and APA were significantly negatively correlated with the concentrations of both NH4-N and dissolved active phosphorus (SRP),and the correlations were between-0.853 and-0.992 and -0.813 and-0.994,respectively.Eichhornia crassipes and Ipomoea aquatica Forsk may work better than Trapa quadrispinosa Roxb,Hydrocharis dubia (Bl.) Backer and Lemna minor L.,and have potential for application in the purification of eutrophic water bodies.%利用静态小区实验研究了菱角(Trapa quadrispinosa Roxb.)、凤眼莲(Eichhornia crassipes.)、水鳖(Hydrocharis dubia (Bl.) Backer)、空心菜(Ipomoea aquatica Forsk)和青萍(Lemna minor L.)5种不同植物对富营养水体的净

  15. Levantamento fitossociológico de plantas daninhas na cultura da cenoura em monocultivo e consorciada com rabanete

    Directory of Open Access Journals (Sweden)

    A. P. M. S. Rodrigues

    2016-01-01

    Full Text Available O experimento foi conduzido na horta da Universidade Federal Rural do Semi-Árido (UFERSA, no período de setembro a dezembro de 2009, com o objetivo de realizar o levantamento fitossociológico nos seguintes tratamentos: sistema de monocultivo da cenoura (Daucus carota e sistema de cultivo da cenoura consorciada com rabanete (Raphanus sativus. Para cada sistema de plantio foram realizadas 24 amostragens em quadrados vazados de 0,50 m de lado, onde as plantas daninhas foram coletadas e separadas por espécie, para determinação das seguintes características: número total de indivíduos por espécie, número total de parcelas que contém a espécie, freqüência, freqüência relativa, densidade, densidade relativa, abundância, abundância relativa, massa seca, massa seca relativa, índice de valor de importância (IVI, e o índice de valor de importância incluindo a massa seca (IVI-MS. Foram identificadas 19 espécies, distribuídas em 12 famílias botânicas. A família mais representativa foi a Poaceae, seguida por Portulacaceae, Cyperaceae, Tumeraceae, Euphorbiaceae, Malvaceae, Amaranthaceae, Rubiaceae, Fabaceae, Molluginaceae, Convolvulaceae e Asteraceae. As áreas conduzidas no sistema de consórcio apresentaram redução de 13,2% na massa seca pelas plantas daninhas, embora a densidade não tenha sido alterada. A espécie de planta daninha Portulaca oleracea se destacou em relação às demais por ter acumulado 40,21 e 47,31% da massa seca produzidas infestantes em monocultivo e consórcio, respectivamente.Phyto-sociological survey of weed in carrot’s cultivation in monocrop and intercropped with radishAbstract: Was conducted the experiment in didact garden at the Rural Federal University of Semi-Arid, from September to December 2009, in order to carry out the phytosociological survey in the treatments: monocrop system of carrot (Daucus carota and intercropping system of carrot with radish (Raphanus sativus. For each planting system

  16. Antidiabetic effects of Cuscuta reflexa Roxb. in streptozotocin induced diabetic rats.

    Science.gov (United States)

    Rath, Diptirani; Kar, Durga Madhab; Panigrahi, Sandeep Kumar; Maharana, Laxmidhar

    2016-11-04

    Cuscuta reflexa Roxb. (Convolvulaceae) is traditionally used to treat diabetes mellitus by tribal people of north-east India and Bangladesh. To evaluate the anti-diabetic effects of methanol and aqueous extracts of the aerial parts of Cuscuta reflexa Roxb. in normal, glucose loaded and Streptozotocin (STZ) induced diabetic rats. The methanol (MECR) and aqueous (AECR) extracts (200 and 400mg/kg body weight) were administered orally to normal and diabetic rats with Metformin and solvent control as comparison groups. Long term effects like FBG, OGTT, lipid profile, HbA1c, body weight, histopathology of major organs, etc. were investigated. MECR and AECR did not have hypoglycemic effects in normal rats. Both AECR and MECR (400mg/kg) treatments showed significant reduction in blood glucose during OGTT in diabetic rats at 3h. Single oral administration of methanol and aqueous extracts (400mg/kg) to diabetic rats significantly reduced (p<0.05) blood glucose level to 61.90% and 55.39% respectively as compared to the Metformin group i.e. 68.32% at the end of 8h. MECR (400mg/kg body weight for 30 days to diabetic rats) showed a significant decrease (p<0.01) of blood glucose level to 60.00% as compared to other groups. The treatment also resulted an improvement in body weights, decreased HbA1c and restored lipid profile. Histopathological injury was not observed, rather repair of beta cells was seen in extract treated diabetic rats. Methanolic extract of C. reflexa has significant antidiabetic effects and improves metabolic alterations thereby justifying its traditional folkloric claims. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  17. Glucosinolates from Host Plants Influence Growth of the Parasitic Plant Cuscuta gronovii and Its Susceptibility to Aphid Feeding.

    Science.gov (United States)

    Smith, Jason D; Woldemariam, Melkamu G; Mescher, Mark C; Jander, Georg; De Moraes, Consuelo M

    2016-09-01

    Parasitic plants acquire diverse secondary metabolites from their hosts, including defense compounds that target insect herbivores. However, the ecological implications of this phenomenon, including the potential enhancement of parasite defenses, remain largely unexplored. We studied the translocation of glucosinolates from the brassicaceous host plant Arabidopsis (Arabidopsis thaliana) into parasitic dodder vines (Convolvulaceae; Cuscuta gronovii) and its effects on the parasite itself and on dodder-aphid interactions. Aliphatic and indole glucosinolates reached concentrations in parasite tissues higher than those observed in corresponding host tissues. Dodder growth was enhanced on cyp79B2 cyp79B3 hosts (without indole glucosinolates) but inhibited on atr1D hosts (with elevated indole glucosinolates) relative to wild-type hosts, which responded to parasitism with localized elevation of indole and aliphatic glucosinolates. These findings implicate indole glucosinolates in defense against parasitic plants. Rates of settling and survival on dodder vines by pea aphids (Acyrthosiphon pisum) were reduced significantly when dodder parasitized glucosinolate-producing hosts (wild type and atr1D) compared with glucosinolate-free hosts (cyp79B2 cyp79B3 myb28 myb29). However, settling and survival of green peach aphids (Myzus persicae) were not affected. M. persicae population growth was actually reduced on dodder parasitizing glucosinolate-free hosts compared with wild-type or atr1D hosts, even though stems of the former contain less glucosinolates and more amino acids. Strikingly, this effect was reversed when the aphids fed directly upon Arabidopsis, which indicates an interactive effect of parasite and host genotype on M. persicae that stems from host effects on dodder. Thus, our findings indicate that glucosinolates may have both direct and indirect effects on dodder-feeding herbivores. © 2016 American Society of Plant Biologists. All rights reserved.

  18. Anti-fibrotic effects of Cuscuta chinensis with in vitro hepatic stellate cells and a thioacetamide-induced experimental rat model.

    Science.gov (United States)

    Kim, Jin Seoub; Koppula, Sushruta; Yum, Mun Jeong; Shin, Gwang Mo; Chae, Yun Jin; Hong, Seok Min; Lee, Jae Dong; Song, MinDong

    2017-12-01

    Cuscuta chinensis Lam. (Convolvulaceae) has been used as a traditional herbal remedy for treating liver and kidney disorders. Anti-fibrotic effects of C. chinensis extract (CCE) in cellular and experimental animal models were investigated. HSC-T6 cell viability, cell cycle and apoptosis were analysed using MTT assay, flow cytometry and Annexin V-FITC/PI staining techniques. Thioacetamide (TAA)-induced fibrosis model was established using Sprague Dawley rats (n = 10). Control, TAA, CCE 10 (TAA with CCE 10 mg/kg), CCE 100 (TAA with CCE 100 mg/kg) and silymarin (TAA with silymarin 50 mg/kg). Fibrosis was induced by TAA (200 mg/kg, i.p.) twice per week for 13 weeks. CCE and silymarin were administered orally two times per week from the 7th to 13th week. Fibrotic related gene expression (α-SMA, Col1α1 and TGF-β1) was measured by RT-PCR. Serum biomarkers, glutathione (GSH) and hydroxyproline were estimated by spectrophotometer using commercial kits. CCE (0.05 and 0.1 mg/mL) and silymarin (0.05 mg/mL) treatment significantly (p < 0.01 and p < 0.001) induced apoptosis (11.56%, 17.52% for CCE; 16.50% for silymarin, respectively) in activated HSC-T6 cells, compared with control group (7.26%). Further, rat primary HSCs showed changes in morphology with CCE 0.1 mg/mL treatment. In in vivo studies, CCE (10 and 100 mg/kg) treatment ameliorated the TAA-induced altered levels of serum biomarkers, fibrotic related gene expression, GSH, hydroxyproline significantly (p < 0.05-0.001) and rescued the histopathological changes. CCE can be developed as a potential agent in the treatment of hepatofibrosis.

  19. Glucosinolates from Host Plants Influence Growth of the Parasitic Plant Cuscuta gronovii and Its Susceptibility to Aphid Feeding1[OPEN

    Science.gov (United States)

    2016-01-01

    Parasitic plants acquire diverse secondary metabolites from their hosts, including defense compounds that target insect herbivores. However, the ecological implications of this phenomenon, including the potential enhancement of parasite defenses, remain largely unexplored. We studied the translocation of glucosinolates from the brassicaceous host plant Arabidopsis (Arabidopsis thaliana) into parasitic dodder vines (Convolvulaceae; Cuscuta gronovii) and its effects on the parasite itself and on dodder-aphid interactions. Aliphatic and indole glucosinolates reached concentrations in parasite tissues higher than those observed in corresponding host tissues. Dodder growth was enhanced on cyp79B2 cyp79B3 hosts (without indole glucosinolates) but inhibited on atr1D hosts (with elevated indole glucosinolates) relative to wild-type hosts, which responded to parasitism with localized elevation of indole and aliphatic glucosinolates. These findings implicate indole glucosinolates in defense against parasitic plants. Rates of settling and survival on dodder vines by pea aphids (Acyrthosiphon pisum) were reduced significantly when dodder parasitized glucosinolate-producing hosts (wild type and atr1D) compared with glucosinolate-free hosts (cyp79B2 cyp79B3 myb28 myb29). However, settling and survival of green peach aphids (Myzus persicae) were not affected. M. persicae population growth was actually reduced on dodder parasitizing glucosinolate-free hosts compared with wild-type or atr1D hosts, even though stems of the former contain less glucosinolates and more amino acids. Strikingly, this effect was reversed when the aphids fed directly upon Arabidopsis, which indicates an interactive effect of parasite and host genotype on M. persicae that stems from host effects on dodder. Thus, our findings indicate that glucosinolates may have both direct and indirect effects on dodder-feeding herbivores. PMID:27482077

  20. Produção de fitomassa e acúmulo de macronutrientes em jitirana utilizada como adubo verde

    Directory of Open Access Journals (Sweden)

    Paulo César Ferreira Linhares

    2013-01-01

    Full Text Available A jitirana (Merremia aegyptia é uma convolvulácea de fácil adaptação aos diferentes tipos de solo, sendo utilizada para a adubação verde na produção orgânica de hortaliças. O objetivo deste trabalho foi quantificar a produção de fitomassa seca e os acúmulos de N, P, K e Ca da jitirana em diferentes estádios fenológicos. O experimento foi conduzido na localidade do Sumaré, Mossoró-RN, no período de fevereiro a junho de 2007. Os tratamentos foram constituídos de idades fenológicas, sendo: 15, 30, 45, 60, 75, 90, 105 e 120 dias após a emergência (DAE. O delineamento experimental utilizado foi o inteiramente casualizado com oito tratamentos e cinco repetições. A convolvulaceae estudada apresenta potencial na utilização como adubo verde e considerável produção de fitomassa e acúmulo de macronutrientes na matéria seca da parte aérea para as condições de Mossoró-RN. Normal 0 21 false false false /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:10.0pt; font-family:"Times New Roman"; mso-ansi-language:#0400; mso-fareast-language:#0400; mso-bidi-language:#0400;}

  1. Pharmacognostic Study of Argyreia pilosa Wight & Arn. Root

    Directory of Open Access Journals (Sweden)

    prasanth DSNBK

    2017-12-01

    Full Text Available Background: Ethnomedicinally, the plant Argyreia pilosa Wight & Arn. (Convolvulaceae has long been utilized in various disorders in the conventional system; most significantly it is utilized against sexually transmitted diseases, skin troubles, diabetes, rheumatism, cough, and quinsy. The key challenge experienced in the standardization of herbal drugs is the lack of proper identification of plant source. Therefore there is certainly have to establish quality control parameters by utilizing pharmacognostic and phytochemical evaluation, that ensure the purity, safety, and efficacy of medicinal plant A. pilosa. Aim: To assess pharmacognostic characteristics which include macroscopic, microscopic and physicochemical parameters of the root of A. pilosa. Methods: Micro and Macroscopic characters of fresh and dried root samples were investigated. Physicochemical parameters had been done by using WHO recommended parameters, preliminary phytochemical and fluorescent analysis of root sample were carried out for proper identification and standardization of root of A. pilosa. Results: The color, shape, size, odor, and surface characteristics were noted from the root and powdered root material of A. pilosa. Light electron microscope i.e., Olympus CX-21i trinocular Microscope images of cross section of root and powdered root revealed that the presence of cork cells, Xylem fibers with tapered ends, lignified xylem vessels, phloem fibers, medullary rays, sclerides and parenchymatous cells. Phytochemical screening showed the presence of flavonoids, alkaloids, tannins, phenols, steroids, acid compounds, glycosides, amino acids, and proteins. Physicochemical parameters such as moisture content, ash value, extractive value and fluorescent behavior of root powder were determined. These parameters are helpful to differentiate the powdered drug material. Conclusion: The current research is useful in order to supplement the information with regard to its

  2. Ethnobotanical survey of medicinal plants used to manage High Blood Pressure and Type 2 Diabetes Mellitus in Bitterfontein, Western Cape Province, South Africa.

    Science.gov (United States)

    Davids, Denver; Gibson, Diana; Johnson, Quinton

    2016-12-24

    The aim of this study was to identify and document medicinal plants used to manage High Blood Pressure and Type 2 Diabetes Mellitus in Bitterfontein, Western Cape Province, South Africa. One hundred and twelve (112) respondents were interviewed between August 2014 and September 2015 through semi-structured surveys to gather data on the percentage of people who had been diagnosed with High Blood Pressure and/or Type 2 Diabetes Mellitus and to determine the frequency of medicinal plant and allopathic medicine use. Twelve (12) key respondents were subsequently selected, using a non-probability snowball sampling method. They were interviewed in-depth concerning their plant practices and assisted with plant collection. Twenty-four plant (24) species belonging to 15 families were identified for the management of High Blood Pressure and Type 2 Diabetes Mellitus. The most frequently reported families were Asteraceae (20.8%), Lamiaceae (16.67%), Crassulaceae (8.33%) and Aizoaceae (8.33%). The remaining (45.54%) were evenly split over eleven families- Fabaceae, Amaryllidaceae, Anacardiaceae, Capparaceae, Geraniaceae, Apiaceae, Convolvulaceae, Apocynaceae, Rutaceae, Asphodelaceae and Thymelaeaceae. The most commonly used plant species overall was Lessertia frutescens (96.55%). The most frequently used plant parts included leaves (57.63%) roots/bulbs (15.25%) and stems (11.86%), mostly prepared as infusions or decoctions for oral administration. Medicinal plants are widely used by High Blood Pressure and Type 2 Diabetes Mellitus sufferers. They employ diverse plant species to manage both conditions. In addition, some sufferers often use prescribed allopathic medication, as well as medicinal plants, but at different intervals. Despite high usage the plants identified are not currently threatened (Red Data list status: least concern). Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  3. The ethnobotany of psychoactive plant use: a phylogenetic perspective

    Directory of Open Access Journals (Sweden)

    Nashmiah Aid Alrashedy

    2016-10-01

    Full Text Available Psychoactive plants contain chemicals that presumably evolved as allelochemicals but target certain neuronal receptors when consumed by humans, altering perception, emotion and cognition. These plants have been used since ancient times as medicines and in the context of religious rituals for their various psychoactive effects (e.g., as hallucinogens, stimulants, sedatives. The ubiquity of psychoactive plants in various cultures motivates investigation of the commonalities among these plants, in which a phylogenetic framework may be insightful. A phylogeny of culturally diverse psychoactive plant taxa was constructed with their psychotropic effects and affected neurotransmitter systems mapped on the phylogeny. The phylogenetic distribution shows multiple evolutionary origins of psychoactive families. The plant families Myristicaceae (e.g., nutmeg, Papaveraceae (opium poppy, Cactaceae (peyote, Convolvulaceae (morning glory, Solanaceae (tobacco, Lamiaceae (mints, Apocynaceae (dogbane have a disproportionate number of psychoactive genera with various indigenous groups using geographically disparate members of these plant families for the same psychoactive effect, an example of cultural convergence. Pharmacological traits related to hallucinogenic and sedative potential are phylogenetically conserved within families. Unrelated families that exert similar psychoactive effects also modulate similar neurotransmitter systems (i.e., mechanistic convergence. However, pharmacological mechanisms for stimulant effects were varied even within families suggesting that stimulant chemicals may be more evolutionarily labile than those associated with hallucinogenic and sedative effects. Chemically similar psychoactive chemicals may also exist in phylogenetically unrelated lineages, suggesting convergent evolution or differential gene regulation of a common metabolic pathway. Our study has shown that phylogenetic analysis of traditionally used psychoactive plants

  4. Floristic similarity and dispersal syndromes in a rocky outcrop in semi-arid Northeastern Brazil.

    Science.gov (United States)

    Costa, Elainne Cristina Silva; Lopes, Sérgio de Faria; Melo, José Iranildo Miranda de

    2015-09-01

    Floristic studies provide valuable information on species richness in a region, and are particularly important if these areas belong to less studied environments, such as rocky outcrops, that may increase our knowledge. An important aspect for species colonization includes the mechanisms of diaspores dispersal in each community; these are essential to understand its structure, dynamics, and the regeneration process, and constitute an important tool for conservation. We developed a floristic survey on a granite-gneiss outcrop with the objective to increase the knowledge on plant diversity, through a floristic similarity analysis and detection of dispersal syndromes of sampled species, in a semi-arid region of Brazil. The fieldwork included collection and observation of the botanical material in loco during a period of 12 months. A total of 161 species belonging to 127 genera and 50 families of angiosperms were recorded. Fabaceae, Asteraceae and Convolvulaceae were the most representative families in number of species. Allophylus quercifolius (Mart.) Radlk. (Capparaceae) and Lafoensia pacari A. St.-Hil. (Lythraceae) represented new records for the State of Paraiba. The autochoric syndrome was the most representative, with 51.5 % of the recorded species; the anemochory was the second most representative syndrome with 26.7 % of the species; and finally the zoochory, representing 22.3 % of the species. The floristic similarity dendrogram showed the formation of three well-defined groups, whose area with the highest value (J = 33.2) is located in a Caatinga region called Cariri Paraibano, while the lowest value observed (J = 5.2), occurred in a settled area in two geomorphological units, a crystalline complex and a plateau region. These results may be due to the varying topographic conditions and edaphic heterogeneity arising from the specific geological formation of the region. These results yet demonstrate that, in rocky outcrops, abiotic syndromes represent an

  5. Ethnobotanical magnitude towards sustainable utilization of wild foliage in Arabian Desert

    Directory of Open Access Journals (Sweden)

    Prakash C. Phondani

    2016-07-01

    Full Text Available The present investigation was deals with identifying traditional uses of medicinal plants for curing a variety of ailments and degree of religious conservation for retention of ethnobotanical knowledge. The study was carried out in the State of Qatar to document the ethnobotanical uses of 58 medicinally important plant species including identification, botanical name, Arabic name, family, habit, habitat, distribution pattern, and the plant parts used for curing variety of ailments. The documented species belong to 54 plant genera and 30 botanical families. They have been used to cure more than 38 different kinds of human ailments. A majority of ethnobotanical plant species belonging to shrubs (41.38% followed by perennial herbs (31.04%, annual herbs (18.96% and trees (8.62% respectively. The frequency of ethnobotanical plant species were recorded maximum in fabaceae (13.79%, followed by lamiaceae, chenopodiaceae (6.89% each, asteraceae, capparaceae, polygonaceae, boraginaceae, aizooaceae (5.17% each, brassicaceae, asclepiadaceae, convolvulaceae, zygophyllaceae, solanaceae (3.44% each while, remaining 17 families had one (1.72% species each. Perception of stakeholders concerning prioritization and categorization of potential native plants and 25 ethnobotanical species were prioritized and ranked on the basis of their multipurpose use value, feasibility climatic conditions and Global Sustainability Assessment System (GSAS criteria measures i.e. drought resistant, low water requirement, growth performance, survival rate, canopy size, adaptation potential, low maintenance and use value for sustainability and landscaping. The analysis emphasized the potentials of ethnomedicinal research, sustainable utilization, conservation initiatives, and urgent need to document ethnobotanical knowledge for sustainability and scientific validation to prevent their losses.

  6. Metal contamination of soils and crops affected by the Chenzhou lead/zinc mine spill (Hunan, China).

    Science.gov (United States)

    Liu, Hongyu; Probst, Anne; Liao, Bohan

    2005-03-01

    In 1985, the collapse of the tailing dam in Chenzhou lead/zinc mine (Hunan, southern China) led to the spread of mining waste spills on the farmland along the Dong River. After the accident, an urgent soil cleaning up was carried out in some places. Seventeen years later, cereal (rice, maize, and sorghum), pulses (soybean, Adzuki bean, mung bean and peanut), vegetables (ipomoea, capsicum, taro and string bean) and the rooted soils were sampled at four sites: (1) the mining area (SZY), (2) the area still covered with the mining tailing spills (GYB), (3) the cleaned area from mining tailing spills (JTC), and (4) a background site (REF). Metal concentrations in the crops and soils were analyzed to evaluate the long-term effects of the spilled waste on the soil and the potential human exposure through food chains. The results showed that the physical-chemical properties of the soils obviously changed due to the different farming styles used by each individual farmer. Leaching effects and plant extraction of metals from some soils were quite weak. Certain soils were still heavily polluted with As, Cd, Zn, Pb and Cu. The contamination levels were in the order of GYB>SZY>JTC showing that the clean-up treatment was effective. The maximum allowable concentration (MAC) levels for Chinese agricultural soils were still highly exceeded, particularly for As and Cd (followed by Zn, Pb and Cu), with mean concentrations of 709 and 7.6 mg kg(-1), respectively. These concentrations exceed the MAC levels by 24 times for As and 13 times for Cd at GYB. Generally, the edible leaves or stems of crops were more heavily contaminated than seeds or fruits. Ipomoea was the most severely contaminated crop. The concentrations of Cd and Pb were 3.30 and 76.9 mg kg(-1) in ipomoea leaves at GYB, which exceeded the maximum permit levels (0.5 mg kg(-1) for Cd and 9 mg kg(-1) for Pb) by 6.6 and 8.5 times, respectively. Taro (+skin) could accumulate high concentrations of Zn and Cd in the edible stem

  7. Mistura em tanque de boro e herbicidas em semeadura convencional de girassol Tank-mix of boron and herbicides on conventional sunflower sowing

    Directory of Open Access Journals (Sweden)

    C. Castro

    2002-04-01

    Full Text Available Os objetivos deste experimento foi avaliar a resposta do girassol às aplicações de boro (B, isoladas ou em mistura com herbicidas, e o controle de plantas daninhas por meio de experimento conduzido na Embrapa Soja, Londrina-PR. Os tratamentos foram acetochlor (1,92 kg i.a. ha-1, oxyfluorfen (0,36 kg i.a. ha-1, sulfentrazone (0,35 kg i.a.ha-1, trifluralin (1,80 kg i.a. ha-1 e as testemunhas capinada e sem capina. Todos os tratamentos foram aplicados, isoladamente ou em mistura, com 2 kg ha-1 de B (Na2B4O7.10H2 0 - bórax e H3BO3 - ácido bórico. O tratamento mais eficiente foi acetochlor mais ácido bórico; essa combinação resultou em solução mais homogênea da calda de pulverização, quando comparada com os herbicidas mais bórax. O herbicida acetochlor aplicado isoladamente ou em mistura com as duas fontes de B foi eficiente no controle da trapoeraba (Commelina benghalensis, do picão-preto (Bidens pilosa e da corda-de-viola (Ipomoea grandifolia. Os herbicidas oxyfluorfen e sulfentrazone, aplicados isoladamente ou em misturas com as duas fontes de B, foram eficientes no controle do amendoim-bravo (Euphorbia heterophylla e da corda-de-viola, respectivamente. É viável a aplicação de boro juntamente com os herbicidas testados nesta pesquisa em mistura em tanque, evitando a deficiência desse micronutriente e controlando as plantas daninhas na cultura do girassol.The objectives of this study were to determine the response of sunflower to application of boron (B fertilizer and herbicides, alone or in combination, and to determine its weed control. A field experiment was carried out at Embrapa Soja, Londrina, Parana, Brazil. The treatments were acetochlor (1.92 kg a.i. ha-1, oxyfluorfen (0.36 kg a.i. ha-1, sulfentrazone (0.35 kg a.i. ha-1, trifluralin (1.80 kg a.i. ha-1 and two controls (with and without hoeing. All treatments were applied alone or in combination with 2 kg ha-1 of B (Na2B4O7.10H2 0 - borax and H3BO3 - boric acid

  8. Las violencias sexuales y el acoso sexual en el ámbito universitario español / Les violences sexuelles et le harcèlement sexuel dans certaines universités espagnoles / Sexual violences and harassment in some Spanish universities

    Directory of Open Access Journals (Sweden)

    Igareda Noelia

    2013-07-01

    Full Text Available L’articolo riporta i risultati principali di una ricerca qualitativa e quantitativa sulla violenza sessuale contro le studentesse universitarie in Spagna. I dati confermano che la diffusione della violenza sessuale fra le studentesse universitarie è simile a quella che si verifica nella società in generale. Nonostante ciò, la conoscenza del fenomeno è assai lacunosa così come sono carenti le misure preventive e repressive per affrontarlo. Ciò è dovuto in parte all’invisibilità della violenza sessuale nella società in generale e fra le studentesse universitarie in particolare. Un innalzamento del livello culturale è in genere considerato come uno strumento di prevenzione e di difesa abbastanza efficace nei confronti di un eventuale episodio di violenza sessuale all’università. RésuméL’article présente les principaux résultats d’une recherche qualitative et quantitative sur la violence sexuelle contre les étudiantes universitaires en Espagne.Les données confirment que la diffusion de la violence sexuelle parmi les étudiantes universitaires est similaire à celle de la société en général. Malgré cela, la connaissance du phénomène, tant comme les mesures de prévention et de répression présentent des lacunes. Peut-être cela est-il dû à l’invisibilité de la violence sexuelle dans la société en général et parmi les étudiantes universitaires, en particulier. L’élévation du niveau culturel est considéré, en général, comme un instrument de prévention et de défense assez efficace par rapport à l’éventuel passage à l’acte violent sexuel à l’université. AbstractThe article shows the main outcomes from a qualitative and quantitative research on sexual violence against female university students in Spain. Data confirm that the prevalence of sexual violence among the female university students is similar to the society in general, however, it is still a very present and common issue in the

  9. Intoxicações por plantas em ruminantes e equídeos no Sertão Paraibano Plant poisonings in ruminants and equidae in the Sertão of Paraiba, Brazil

    Directory of Open Access Journals (Sweden)

    Tales S. Assis

    2009-11-01

    Full Text Available Foi realizado um levantamento das intoxicações por plantas em 20 municípios do Sertão Paraibano, onde foram entrevistados 50 produtores e 11 médicos veterinários. De acordo com o levantamento realizado, Ipomoea asarifolia e Mascagnia rigida são as intoxicações mais importantes. Indigofera suffruticosa, as plantas cianogênicas (Sorghum vulgare, Piptadenia macrocarpa e Manihot spp., Mimosa tenuiflora, Aspidosperma pyrifolium e Crotalaria retusa são plantas importantes como causa de intoxicações na região. Os entrevistados relataram casos esporádicos de intoxicação por Ricinus communis, Enterolobium contortisiliquum, Prosopis juliflorae Brachiaria decumbens. Ziziphus joazeiro, Passiflora sp., Caesalpina ferrea e Crescentia cujete foram mencionadas como causa de abortos em ruminantes. Frutos de Crescentia cujete foram administrados a duas cabras prenhes causando mortalidade perinatal e abortos. As cascas de feijão (Phaseolus vulgaris e Vigna unguiculata e as folhas de Licania rigida (oiticica são associadas à sobrecarga ruminal em bovinos. As frutas de Mangifera indica (mangae Anacardium occidentale (cajú são responsabilizadas por causarem intoxicação etílica. Dalechampia sp. e Croton sp. foram citadas pelos entrevistados como possíveis plantas tóxicas, que ainda não tiveram sua toxicidade comprovada.A survey of plant poisoning in ruminants and equidae was conducted in 20 municipalities of the semiarid region of the Sertão Paraibano. Fifty farmers and 11 veterinary practitioners were interviewed. Ipomoea asarifolia and Mascagnia rigida are the most important poisonous plants in the region. Indigofera suffruticosa, the cianogenic plants (Sorghum vulgare, Piptadenia macrocarpa, and Manihot spp., Mimosa tenuiflora, Aspidosperma pyrifolium and Crotalaria retusa cause also important intoxications in the area. Sporadic outbreaks of poisonings by Ricinus communis, Enterolobium contortisiliquum, Prosopis juliflora and Brachiaria

  10. Importância econômica, epidemiologia e controle das intoxicações por plantas no Brasil

    Directory of Open Access Journals (Sweden)

    Clarice R.M. Pessoa

    2013-06-01

    Full Text Available A importância econômica, epidemiologia e controle das intoxicações por plantas em animais domésticos no Brasil são revisadas. Com os dados dos laboratórios de diagnóstico de diferentes regiões do país, as perdas anuais por mortes de animais foram estimadas em 820.761 a 1.755.763 bovinos, 399.800 a 445.309 ovinos, 52.675 a 63.292 caprinos e 38.559 equinos. No Brasil, atualmente, o número de plantas tóxicas é de 131 espécies e 79 gêneros e aumenta permanentemente. No entanto, a maioria das perdas são causadas por poucas plantas, incluindo Palicourea marcgravii, Amorimia spp., Senecio spp., Pteridium aquilinum, Ateleia glazioviana e Cestrum laevigatum em bovinos, Brachiaria spp em bovinos e ovinos, Nierembergia veitchii, Mimosa tenuiflora e Ipomoea asarifolia em ovinos, plantas que contêm swainsonina (Ipomoea carnea, Turbina cordata e Sida carpinifolia em caprinos e Brachiaria humidicola e Crotalaria retusa em equinos. Os principais fatores epidemiológicos relacionados às intoxicações por plantas incluem palatabilidade, fome, sede, facilitação social, desconhecimento da planta, acesso a plantas tóxicas, dose tóxica, período de ingestão, variações de toxicidade e resistência/susceptibilidade dos animais às intoxicações. Quanto aos métodos de controle e profilaxia descrevem-se os resultados obtidos no Brasil com métodos recentemente desenvolvidos, incluindo controle biológico, aversão alimentar condicionada, utilização de variedades não tóxicas de forrageiras, utilização de animais resistentes às intoxicações e técnicas de indução de resistência.

  11. Allelopathic potential of Sapindus saponaria L. leaves in the control of weeds=Potencial alelopático de folhas de Sapindus saponaria L. no controle de plantas daninhas

    Directory of Open Access Journals (Sweden)

    Denise Garcia Santana

    2012-01-01

    Full Text Available The objective of this work was to evaluate the allelopathic potential of aqueous extracts of young and mature leaves from Sapindus saponaria on diaspore germination and seedling growth of barnyardgrass (Echinochloa crus-galli and morningglory (Ipomoea grandifolia. The aqueous extract was prepared in a proportion of 100 g of dried, ground leaves dissolved in 1000 mL of distilled water, resulting in a 10% extract concentrate. Dilutions of this concentrate were made with distilled water to 7.5, 5.0 and 2.5%. In seedling growth tests, we compared the effect of these extracts with the herbicide nicosulfuron. Both extracts of mature and young leaves caused delays and reductions in diaspore germination and seedling length of barnyardgrass and morningglory, with the most intense effects observed at a concentration of 10%. The effects of the young leaf extract were more similar to those observed with the herbicide, demonstrating that leaf maturation stage of S. saponaria affects its inhibitory effects on the growth of other plants and that this species is effective in controlling weeds.O objetivo deste trabalho foi avaliar o potencial alelopático do extrato aquoso de folhas jovens e maduras de Sapindus saponaria (sabão-de-soldado na germinação de diásporos e no crescimento de plântulas de capim-arroz (Echinochloa crus-galli e corda-de-viola (Ipomoea grandifolia. O extrato aquoso foi preparado na proporção de 100 g de folhas secas e trituradas dissolvidas em 1000 mL de água destilada, produzindo-se o extrato considerado concentrado (10%. A partir deste, foram feitas diluições em água destilada para 7,5; 5,0 e 2,5%. No teste de crescimento de plântulas comparou-se o efeito desses extratos com o herbicida nicosulfuron. Os extratos de folhas maduras e jovens causaram atraso e redução na germinação dos diásporos e no comprimento das plântulas de capim-arroz e corda-de-viola, com efeitos mais intensos na concentração de 10%. No entanto, os

  12. Envelhecimento de resíduos vegetais sobre o solo e os reflexos na eficácia de herbicidas aplicados em pré-emergência Crop residues aging on soil and their effects on pre-emergence herbicides

    Directory of Open Access Journals (Sweden)

    Núbia Maria Correia

    2007-01-01

    Full Text Available Com o objetivo de avaliar os efeitos do envelhecimento dos resíduos vegetais de diferentes espécies [sorgo de cobertura (Sorghum bicolor x S. sudanensis 'Cober Exp', milheto forrageiro (Pennisetum americanum 'BN2', capim-pé-de-galinha (Eleusine coracana e capim-braquiária (Brachiaria brizantha], no controle de Ipomoea grandifolia, pelos herbicidas diclosulam e imazaquin, aplicados em pré-emergência, foi desenvolvido experimento em casa de vegetação, no período de agosto a dezembro de 2004. Foram realizadas determinações químicas nos materiais vegetais em decomposição. A eficácia do herbicida diclosulam não foi afetada pelo envelhecimento da palha de nenhuma das coberturas estudadas. Pelo contrário, a associação desse herbicida a qualquer dos resíduos vegetais estudados, principalmente o de capim-braquiária, favoreceu o controle da planta daninha. O imazaquin teve o potencial de controle influenciado pelas coberturas de milheto forrageiro e capim-braquiária, aos 90 dias após a deposição dos resíduos vegetais sobre o solo. Tal comportamento pode ser atribuído ao enriquecimento de celulose e lignina nos materiais vegetais de milheto forrageiro e capim braquiária.An experiment was conducted from August to December 2004 under greenhouse conditions to evaluate the effects of aging residues of different plant species [coverage sorghum (Sorghum bicolor x S. sudanensis 'Cober Exp', forage millet (Pennisetum americanum 'BN2', finger millet (Eleusine coracana and St. Lucia Grass (Brachiaria brizantha], on the control of Ipomoea grandifolia using the pre-emergence herbicides diclosulam and imazaquin. Crop residues were subjected to chemical analyses. The efficiency of diclosulam was not affected by any of the residues. On the other hand, in association with residues of any of the species, but especially with St. Lucia Grass, this herbicide showed increased weed control efficiency. The control potential of imazaquin was influenced

  13. Fungal Planet description sheets: 154-213.

    Science.gov (United States)

    Crous, P W; Wingfield, M J; Guarro, J; Cheewangkoon, R; van der Bank, M; Swart, W J; Stchigel, A M; Cano-Lira, J F; Roux, J; Madrid, H; Damm, U; Wood, A R; Shuttleworth, L A; Hodges, C S; Munster, M; de Jesús Yáñez-Morales, M; Zúñiga-Estrada, L; Cruywagen, E M; de Hoog, G S; Silvera, C; Najafzadeh, J; Davison, E M; Davison, P J N; Barrett, M D; Barrett, R L; Manamgoda, D S; Minnis, A M; Kleczewski, N M; Flory, S L; Castlebury, L A; Clay, K; Hyde, K D; Maússe-Sitoe, S N D; Chen, Shuaifei; Lechat, C; Hairaud, M; Lesage-Meessen, L; Pawłowska, J; Wilk, M; Sliwińska-Wyrzychowska, A; Mętrak, M; Wrzosek, M; Pavlic-Zupanc, D; Maleme, H M; Slippers, B; Mac Cormack, W P; Archuby, D I; Grünwald, N J; Tellería, M T; Dueñas, M; Martín, M P; Marincowitz, S; de Beer, Z W; Perez, C A; Gené, J; Marin-Felix, Y; Groenewald, J Z

    2013-12-01

    Novel species of microfungi described in the present study include the following from South Africa: Camarosporium aloes, Phaeococcomyces aloes and Phoma aloes from Aloe, C. psoraleae, Diaporthe psoraleae and D. psoraleae-pinnatae from Psoralea, Colletotrichum euphorbiae from Euphorbia, Coniothyrium prosopidis and Peyronellaea prosopidis from Prosopis, Diaporthe cassines from Cassine, D. diospyricola from Diospyros, Diaporthe maytenicola from Maytenus, Harknessia proteae from Protea, Neofusicoccum ursorum and N. cryptoaustrale from Eucalyptus, Ochrocladosporium adansoniae from Adansonia, Pilidium pseudoconcavum from Greyia radlkoferi, Stagonospora pseudopaludosa from Phragmites and Toxicocladosporium ficiniae from Ficinia. Several species were also described from Thailand, namely: Chaetopsina pini and C. pinicola from Pinus spp., Myrmecridium thailandicum from reed litter, Passalora pseudotithoniae from Tithonia, Pallidocercospora ventilago from Ventilago, Pyricularia bothriochloae from Bothriochloa and Sphaerulina rhododendricola from Rhododendron. Novelties from Spain include Cladophialophora multiseptata, Knufia tsunedae and Pleuroascus rectipilus from soil and Cyphellophora catalaunica from river sediments. Species from the USA include Bipolaris drechsleri from Microstegium, Calonectria blephiliae from Blephilia, Kellermania macrospora (epitype) and K. pseudoyuccigena from Yucca. Three new species are described from Mexico, namely Neophaeosphaeria agaves and K. agaves from Agave and Phytophthora ipomoeae from Ipomoea. Other African species include Calonectria mossambicensis from Eucalyptus (Mozambique), Harzia cameroonensis from an unknown creeper (Cameroon), Mastigosporella anisophylleae from Anisophyllea (Zambia) and Teratosphaeria terminaliae from Terminalia (Zimbabwe). Species from Europe include Auxarthron longisporum from forest soil (Portugal), Discosia pseudoartocreas from Tilia (Austria), Paraconiothyrium polonense and P. lycopodinum from Lycopodium

  14. Investigation on by-products of bioenergy systems (anaerobic digestion and gasification) as potential crop nutrient using FTIR, XRD, SEM analysis and phyto-toxicity test.

    Science.gov (United States)

    Kataki, Sampriti; Hazarika, Samarendra; Baruah, D C

    2017-07-01

    Success and acceptability of the bio energy conversion technology to a large extent depend upon management of the inevitable by-products generated during the conversion process. By-products can be considered favourable as organic fertilizer as they retain nutrients with varying composition depending upon input biomass. However, characteristics of these heterogeneous resources with respect to feedstock and processing conditions have to be assessed to state on their agricultural and environmental benefits. Therefore, 3 types of anaerobic digestion by-products (digestate) from surplus biomass viz. cow dung, Ipomoea carnea:cow dung (60:40 dry weight basis) and rice straw:green gram stover:cow dung (30:30:40 dry weight basis) and one gasification by-product (biochar) from rice husk are considered to understand the fertilizer prospects. Considering 3 potential application options, digestate from each feedstock option was further processed as separated solid, separated liquid and ash from solid digestates. Thus, a total of 10 by-products were investigated for understanding their prospects as fertilizer using Fourier Transform Infrared Spectroscopy (FTIR), X-ray diffraction (XRD), Scanning Electron Microscopy (SEM) and Energy Dispersive X ray Spectroscopy (EDX) and phyto-toxicity test to have a broad insight in terms of their organic, mineral, elemental composition, morphological feature and potential phyto-toxicity. In general, irrespective of origin of feedstock, solid digestate, ash digestate and char showed similarity in terms of composition of functional groups with some degree of variation in relative content as reflected by FTIR analysis. Dominance of organic functional groups in separated solid digestates compared to liquid fraction indicated the former as favourable organic amendments. Quartz was the prevalent mineral phase in all separated solid, ash digestate and rice husk char. Digestates in ash phase represent more concentrated plant nutrient source with

  15. Effect of extrusion-cooking in total carotenoids content in cream and orange flesh sweet potato cultivars

    Directory of Open Access Journals (Sweden)

    Marcos José de O Fonseca

    2008-03-01

    Full Text Available Sweet potato (Ipomoea batatas is a food crop that supplies energy, minerals and vitamins C and B. Some cultivars are very rich in carotenoids (pro-vitamin A. In this study were evaluated and compared the total carotenoids content of two cultivars and the losses on the dehydrated extruded sweet potato flour. Samples from organic and conventional crops were analyzed, in the form of fresh and dehydrated extruded samples. Total carotenoids content of the fresh product, expressed on wet basis, was of 437 µg 100 g-1 for the cream cultivar and 10,12 µg 100 g-1 for the orange cultivar. After dehydration, losses of total carotenoids were of 41% and 38%, respectively. The fresh orange cultivar presented high total carotenoids content in comparison to the cream cultivar. The extruded orange sweet potato flour showed the lowest losses in total carotenoids. Therefore, the processed flour of orange sweet potato could be used to obtain pre-gelatinized extruded flour with high total carotenoids content.A batata-doce (Ipomoea batatas é um alimento fonte rico em energia, minerais, vitaminas C e B. Algumas cultivares são ricas em pró-vitamina A. O objetivo do presente trabalho foi avaliar e comparar o conteúdo de carotenóides totais em duas cultivares de batata-doce e determinar suas perdas na obtenção da farinha desidratada e processada por extrusão. Foram analisadas amostras de sistema de cultivo orgânico e convencional, tanto as frescas como as extrusadas desidratadas. O conteúdo de carotenóides totais do produto fresco, expressos em base úmida, foi de 437 µg 100 g-1 para a cultivar creme e de 10,120 µg 100g-1 para a cultivar alaranjada. Após o processo de desidratação das amostras, as perdas de carotenóides totais foram de 41% para a batata-doce creme e 38% para a alaranjada, respectivamente. Os resultados indicaram alto conteúdo de carotenóides totais para a cultivar alaranjada fresca, quando comparado com a cultivar creme. A amostra de

  16. Avaliação de extratos vegetais no controle de mosca-branca, Bemisia tabaci biótipo B em abóbora Evaluation of plant extracts in the control of whitefly Bemisia tabaci biotype B in squash

    Directory of Open Access Journals (Sweden)

    Bruno Marcus Freire Vieira Lima

    2013-09-01

    Full Text Available A abóbora (Cucurbita moschata Duch. é uma cultura de importância para a agricultura familiar da região Nordeste do Brasil. No entanto, a ocorrência do prateamento das folhas da aboboreira ocasionado pela mosca-branca, Bemisia tabaci biótipo B limita sua produção, causando prejuízos aos agricultores. O objetivo deste trabalho foi avaliar a eficiência de extratos vegetais sobre o nível populacional de ninfas de mosca-branca em abóbora cv. Jacarezinho. O experimento foi instalado em campo experimental, em blocos casualizados, constituído de seis tratamentos e três repetições. As aplicações dos extratos vegetais foram feitas com intervalo de sete dias, fazendo-se uso de substâncias extraídas das seguintes plantas: canudo (Ipomoea carnea subsp. fistulosa, mamona (Ricinus communis L., tinguí (Mascagnia rigida Griseb, cardo-santo (Argemone mexicana L., e o óleo comercial Natuneem®. Todos os extratos vegetais obtiveram eficiência no controle de ninfas B. tabaci, sendo o R. communis (75,49%, M. rigida (73,99%, I. carnea (72,24%, óleo de nim (70,4% e A. mexicana (69,16%.The squash (Cucurbita moschata Duch. is an important crop for family farmers in the northeast of Brazil. However, the occurrence of leaf silvering caused by the whitefly, Bemisia tabaci biotype B, limits production, causing losses to farmers. The aim of this study was to evaluate the efficiency of plant extracts on the population levels of whitefly nymphs on the squash cv. Jacarezinho. The experiment was conducted at an experimental field, in a randomized block design consisting of six treatments and three replications. Applications of plant extracts were made at an interval of seven days, making use of substances extracted from the following plants: Ipomoea carnea subsp. Fistulosa, castor bean (Ricinus communis L., Tingui (Mascagnia rigida Griseb, cardo-santo (Argemone mexicana L., and the commercial oil product Natuneem ®. All of the plant extracts were

  17. Assessment of by-products of bioenergy systems (anaerobic digestion and gasification) as potential crop nutrient.

    Science.gov (United States)

    Kataki, Sampriti; Hazarika, Samarendra; Baruah, D C

    2017-01-01

    Alternative fertilizer resources have drawn attention in recent times in order to cope up with ever increasing demand for fertilizer. By-products of bioenergy system are considered favourable as organic fertilizer due to their ability to recycle plant nutrients. Present study evaluates fertilizer suitability of by-products of two bioenergy systems viz. 3 types of anaerobic digestion by-products (digestate) from local surplus biomass such as cowdung, Ipomoea carnea:cowdung (60:40) and ricestraw:green gram stover:cowdung (30:30:40) and one gasification by-product (biochar) from rice husk. Digestates were assessed considering 4 different application options of each viz. whole, solid, liquid and ash from solid digestates. Digestate characteristics (organic matter, macronutrients, micronutrients and heavy metal content) were found to be a function of feedstock and processing (solid liquid separation and ashing). Ipomoea carnea based digestates in all application options showed comparatively higher N, P, K, NH 4 + -N, Ca, Mg, S and micro nutrient content than other digestates. Separation concentrated plant nutrients and organic matter in solid digestates, making these suitable both as organic amendments and fertilizer. Separated liquid digestate shared larger fraction of ammonium nitrogen (61-91% of total content), indicating their suitability as readily available N source. However, fertilizer application of liquid digestate may not match crop requirements due to lower total nutrient concentration. Higher electrical conductivity of the liquid digestates (3.4-9.3mScm -1 ) than solid digestates (1.5-2mScm -1 ) may impart phyto-toxic effect upon fertilization due to salinity. In case of by-products with unstable organic fraction i.e. whole and solid digestates of rice straw:green gram stover:cowdung digestates (Humification index 0.7), further processing (stabilization, composting) may be required to maximize their fertilizer benefit. Heavy metal contents of the by

  18. KANDUNGAN KLOROFIL, KAROTENOID, DAN VITAMIN C BEBERAPA JENIS SAYURAN DAUN PADA PERTANIAN PERIURBAN DI KOTA SURABAYA

    Directory of Open Access Journals (Sweden)

    Dwi Iriyani

    2015-04-01

    Full Text Available Periurban agriculture actually means agriculture that is found surrounding urban boundary. Due to heavy load for various non-agricultural activity and transportation, it necessary to pay attention on the agro-ecological conditions where each crop could grows well. The quality of environment for growing plants in periurban influences on composition of biochemistry in plants’ tissue. The purpose of this study is to determine the chlorophyll, carotenoid, and ascorbic acid contents in three species of vegetables, those are bayam (Amaranthus tricolor, L., kangkung (Ipomoea reptans and sawi (Brassica juncea L. which were cultivated in three periurban agriculture areas of Surabaya. Total contents of chlorophyll and carotenoid was measured by spectrophotometer. Vitamin C contents was analyzed by DCPIP dye method. The results showed that bayam which was cultivated in Bangkingan-Lakarsantri has the highest content of chlorophyll (3.046 mg/g and carotenoid (375.33 μmol/L. The highest content (4.55 μg/g of vitamin C was found on sawi which was cultivated in Wonorejo. There was no significant difference on chlorophyll content, carotenoid content and vitamin C content between organic vegetables labeled and those are cultivated on Bangkingan-Lakarsantri periurban area. Kawasan pertanian periurban merupakan daerah pertanian yang dijumpai di sekitar pinggiran perkotaan. Berkaitan dengan tekanan lingkungan yang berat di kawasan periurban, akibat berbagai kegiatan non pertanian dan transportasi, perlu adanya perhatian terhadap kondisi agro klimat yang mempengaruhi pertumbuhan tanaman. Kualitas lingkungan tempat tumbuh tanaman pada kawasan pertanian periurban berpengaruh terhadap komposisi kandungan biokimia jaringan tanaman. Tujuan penelitian ini adalah untuk menetapkan kadar klorofil, karotenoid, dan vitamin C pada sayuran bayam (Amaranthus tricolor, L., kangkung (Ipomoea reptans dan sawi (Brassica juncea L. yang dibudidayakan di tiga kawasan periurban Kota

  19. Response of plants to high concentrations of uranium stress and the screening of remediation plants

    International Nuclear Information System (INIS)

    Tang Yongjin; Luo Xuegang; Zeng Feng; Jiang Shijie

    2013-01-01

    Studies of the resistance and accumulation ability of different plant species to uranium (U) has important influence on the bioremediation of U contaminated soil. The resistance and enrichment ability of high concentrations of U (500 mg · kg"-"1 soil) in fourteen plant species were investigated and evaluated in this study in order to screen remediation plants for governance soil U contamination. The results showed that: (1) high concentrations of U stress had different effects on the emergence and survival of the different plants. The seed emergence of Hibiscus esculentus was reduced by 2/3, but the seed emergence of Gynura cusimbua (D. Don) S. Moore, Chenopodium album L. and Phaseolus vulgaris var. humilis Alef were not reduced. Under the contaminated soil, all the sesamum indicum died within a month after the emergence and the survival number of Amaranth and Iresine herbstii 'Aureo-reticulata' reduced by about 80%. But the survival number of Alternanthera philoxeroides (Mart.) Griseb., Chenopodium album L. and Phaseolus vulgaris var. humilis Alef were not influenced. (2) The biomass of the plants would be reduced by 8-99% in the uranium-contaminated soil. The anti-stress ability of Phaseolus vulgaris var. humilis Alef was the strongest in the fourteen plants, and Cucurbita pepo L., Sorghumbicolor (L.) Moench, Ipomoea aquatica Forsk, Helianthus annuus, Chenopodium album L. and Alternanthera philoxeroides (Mart.) Griseb. showed some the anti-stress ability. (3) Significant differences were found in the capacity of plants to absorb uranium between under high-uranium contaminated soil and under the non-uranium contaminated soil were. The plants with higher uranium content in thenon-contaminated soil were Gomphrena globosa, and Cucurbita pepo L., which were 2.249 mg · kg"-"1 DW and 1.620 mg · kg"-"1 DW, respectively. But the plants with higher uranium content in the high uranium contaminated soil were Cichorium intybus L., Amaranth and Ipomoea aquatica Forsk, which

  20. Kinetics of element profile pattern during life cycle stage of morning-glory

    International Nuclear Information System (INIS)

    Nakanishi, T.M.; Tamada, M.

    1999-01-01

    The kinetics of seven element profiles, macroscopic elements, Na, Mg, Cl, K and Ca, as well as Al and Br, in every tissue of morning-glory (Ipomoea nil L. c.v. Murasaki), from seedling to flowering stage are presented. Barriers for the elements were formed even in the same tissue during different growing phases. Most of Na and Al remained in root tissue, showing the first barrier to the upper part of the plant. During the juvenile phase, the tissues lower than cotyledon stored the elements, especially Ca and Mg. The barrier at cotyledon did not disappear completely until seed ripening stage, except for K. Generally, late developing stem showed lower accumulation of the elements, which seemed to regulate the inflow of Mg, Ca, Cl and Br into flowering tissue. The concentrations of K, Ca, Cl and Br in leaf were kept constant in spite of twice or three times higher concentration of these elements in leaf petiole. After flowering, selective element accumulation was observed during seed development, where most of the elements were accumulated into seed wall, not in seed. Higher concentration of the elements in elder leaf, which falls into ground and will be reused as plant nutrient, might reflect the recycling system of the elements in plants. (author)