Zaydman, Mark A; Kasimova, Marina A; McFarland, Kelli; Beller, Zachary; Hou, Panpan; Kinser, Holly E; Liang, Hongwu; Zhang, Guohui; Shi, Jingyi; Tarek, Mounir; Cui, Jianmin
2014-12-23
Voltage-gated ion channels generate electrical currents that control muscle contraction, encode neuronal information, and trigger hormonal release. Tissue-specific expression of accessory (β) subunits causes these channels to generate currents with distinct properties. In the heart, KCNQ1 voltage-gated potassium channels coassemble with KCNE1 β-subunits to generate the IKs current (Barhanin et al., 1996; Sanguinetti et al., 1996), an important current for maintenance of stable heart rhythms. KCNE1 significantly modulates the gating, permeation, and pharmacology of KCNQ1 (Wrobel et al., 2012; Sun et al., 2012; Abbott, 2014). These changes are essential for the physiological role of IKs (Silva and Rudy, 2005); however, after 18 years of study, no coherent mechanism explaining how KCNE1 affects KCNQ1 has emerged. Here we provide evidence of such a mechanism, whereby, KCNE1 alters the state-dependent interactions that functionally couple the voltage-sensing domains (VSDs) to the pore.
Zaydman, Mark A; Kasimova, Marina A; McFarland, Kelli; Beller, Zachary; Hou, Panpan; Kinser, Holly E; Liang, Hongwu; Zhang, Guohui; Shi, Jingyi; Tarek, Mounir; Cui, Jianmin
2014-01-01
Voltage-gated ion channels generate electrical currents that control muscle contraction, encode neuronal information, and trigger hormonal release. Tissue-specific expression of accessory (β) subunits causes these channels to generate currents with distinct properties. In the heart, KCNQ1 voltage-gated potassium channels coassemble with KCNE1 β-subunits to generate the IKs current (Barhanin et al., 1996; Sanguinetti et al., 1996), an important current for maintenance of stable heart rhythms. KCNE1 significantly modulates the gating, permeation, and pharmacology of KCNQ1 (Wrobel et al., 2012; Sun et al., 2012; Abbott, 2014). These changes are essential for the physiological role of IKs (Silva and Rudy, 2005); however, after 18 years of study, no coherent mechanism explaining how KCNE1 affects KCNQ1 has emerged. Here we provide evidence of such a mechanism, whereby, KCNE1 alters the state-dependent interactions that functionally couple the voltage-sensing domains (VSDs) to the pore. DOI: http://dx.doi.org/10.7554/eLife.03606.001 PMID:25535795
Structural basis for KV7.1/KCNEx interactions in the IKs channel complex
DEFF Research Database (Denmark)
Lundby, Alicia; Tseng, Gea-Ny; Schmitt, Nicole
2010-01-01
The cardiac I(Ks) current is involved in action potential repolarization, where its primary function is to limit action potential prolongation during sympathetic stimulation. The I(Ks) channel is mainly composed of K(V)7.1 ion channels associated with KCNE1 auxiliary subunits. The availability of...
National Recordal System IK holder catalogue process
CSIR Research Space (South Africa)
Pretorius, R
2012-10-01
Full Text Available good, based on IK.? Subsequently, the South African Department of Science and Technology (DST) created a National Indigenous Knowledge Systems Office (NIKSO) that is taking the lead on interfacing IKS with other recognised knowledge holders... is to illustrate the South African National Recordal Systems (NRS) process whereby Indigenous Knowledge (IK) holder?s information is captured in a registry, as specified in South Africa?s Indigenous Knowledge Systems (IKS) Policy, through an IK cataloguing...
IKs Gain- and Loss-of-Function In Early-Onset Lone Atrial Fibrillation
DEFF Research Database (Denmark)
Steffensen, Annette Buur; Refsgaard, Lena; Andersen, Martin Nybo
2015-01-01
INTRODUCTION: Atrial fibrillation (AF) is the most frequent cardiac arrhythmia. The potassium current IKs is essential for cardiac repolarization. Gain-of-function mutation in KCNQ1, the gene encoding the pore-forming α-subunit of the IKs channel (KV 7.1), was the first ion channel dysfunction...... to be associated with familial AF. We hypothesized that early-onset lone AF is associated with a high prevalence of mutations in KCNQ1. METHODS AND RESULTS: We bidirectionally sequenced the entire coding sequence of KCNQ1 in 209 unrelated patients with early-onset lone AF (...-of-function phenotype. CONCLUSIONS: Mutations in the IKs channel leading to gain-of-function have previously been described in familial AF, yet this is the first time a loss-of-function mutation in KCNQ1 is associated with early-onset lone AF. These findings suggest that both gain-of function and loss...
Kotitalouspalvelut ikääntyneen arjen tukena
Hiivala, Kerttu; Linnera, Emilia
2009-01-01
Väestön ikääntyminen tulee olemaan yhteiskunnallemme haaste. Koska julkiset palvelut eivät pysty yksin vastaamaan kasvavaan palvelun tarpeeseen, tarvitaan kotitalouspalveluita tukemaan ikääntyneiden arjessa selviytymistä. Opinnäytetyön tarkoituksena oli kartoittaa ikääntyneiden läntisen Jyväskylän asukkaiden tarvetta kotitalouspalveluille. Lisäksi tavoitteena oli kerätä tietoa siitä, miten ikääntyneet suhtautuvat kotitalouspalveluihin. Tutkimusote oli laadullinen, ja aineisto kerättiin teemah...
Thurber, Amy E; Nelson, Michaela; Frost, Crystal L; Levin, Michael; Brackenbury, William J; Kaplan, David L
2017-06-27
Many potassium channel families are over-expressed in cancer, but their mechanistic role in disease progression is poorly understood. Potassium channels modulate membrane potential (Vmem) and thereby influence calcium ion dynamics and other voltage-sensitive signaling mechanisms, potentially acting as transcriptional regulators. This study investigated the differential response to over-expression and activation of a cancer-associated potassium channel, the intermediate conductance calcium-activated potassium channel (IK), on aggressive behaviors in mammary epithelial and breast cancer cell lines. IK was over-expressed in the highly metastatic breast cancer cell line MDA-MB-231 and the spontaneously immortalized breast epithelial cell line MCF-10A, and the effect on cancer-associated behaviors was assessed. IK over-expression increased primary tumor growth and metastasis of MDA-MB-231 in orthotopic xenografts, demonstrating for the first time in any cancer type that increased IK is sufficient to promote cancer aggression. The primary tumors had similar vascularization as determined by CD31 staining and similar histological characteristics. Interestingly, despite the increased in vivo growth and metastasis, neither IK over-expression nor activation with agonist had a significant effect on MDA-MB-231 proliferation, invasion, or migration in vitro. In contrast, IK decreased MCF-10A proliferation and invasion through Matrigel but had no effect on migration in a scratch-wound assay. We conclude that IK activity is sufficient to promote cell aggression in vivo. Our data provide novel evidence supporting IK and downstream signaling networks as potential targets for cancer therapies.
Existing knowledge related to mainstreaming IKS into Educational ...
African Journals Online (AJOL)
The study aimed at determining existing knowledge related to mainstreaming of IKS into education system. The qualitative research methodology was appropriate for this study to explore and describe the mainstreaming of IKS into the existing education system. The study included 10 school teachers (5male and 5 females) ...
Varttuneet ja ikäsyrjintä työelämässä
Viitasalo, Niina
2015-01-01
Työelämän ikäsyrjintä esteenä pitkille työurille Työelämässä esiintyvä ikäsyrjintä on ristiriidassa työurien pidentämisen kanssa. Ikäsyrjintää kokeneilla on jopa kaksinkertainen pitkien sairauspoissaolojen riski 3 vuoden seuranta-aikana. Eniten ikäsyrjintäkokemuksia on yli 55-vuotiailla naisilla, heistä lähes 8 prosenttia on kokenut ikäsyrjintää työssään. Ikäsyrjintä ilmenee työpaikkojen arjessa varttuneiden torjuntana, painostamisena, vähättelynä tai eristämisenä. Ikäsyrjintä näyttäytyy ...
Oiva, Henna; Mustonen, Saana
2010-01-01
Opinnäytetyömme koostuu kirjallisesta raportista ja opasvihkosesta. Opinnäytetyömme tavoitteena oli laatia opasvihkonen Kemijärvellä olevista leikki-ikäisten lasten perheille suunnatuista terveys- ja sosiaalipalveluista sekä kolmannen sektorin ja vapaa-ajan palveluista. Terveydenhoitajat voivat hyödyntää opasvihkosta työssään ohjatessaan asiakkaitaan. He voivat myös tarpeen mukaan antaa opasvihkosen perheelle mukaan kotiin. Opinnäytetyömme tarkoituksena on tukea leikki-ikäisen lapsen kasvua s...
Challenges and opportunities for IKS in higher education institutions ...
African Journals Online (AJOL)
In 2004 the Department of Science and Technology in the Republic of South Africa adopted a policy on Indigenous Knowledge Systems (IKS). By doing so it moved IKS from just being a political and academic rhetoric into a political policy of government. The policy “affirms African cultural values in the face of globalization ...
DEFF Research Database (Denmark)
Stengl, Milan; Volders, Paul G A; Thomsen, Morten Bækgaard
2003-01-01
In guinea-pig ventricular myocytes, in which the deactivation of slowly activating delayed rectifier potassium current (IKs) is slow, IKs can be increased by rapid pacing as a result of incomplete deactivation and subsequent current accumulation. Whether accumulation of IKs occurs in dogs, in which...
Yup'ik Cosmology to School Mathematics: The Power of Symmetry and Proportional Measuring
Lipka, Jerry; Andrew-Ihrke, Dora; Yanez, Eva Evelyn
2011-01-01
This article shows how Yup'ik cosmology, epistemology, and everyday practice have implications for the teaching of school mathematics. Math in a Cultural Context (MCC) has a long-term collaborative relationship with Yup'ik elders and experienced Yup'ik teachers. Because of this long-term ethnographically-oriented relationship, the authors--both…
Ik Kies Bewust; Effecten van het logo op het koopgedrag
Kornelis, M.; Meeusen, M.J.G.
2010-01-01
Dit rapport beschrijft de effecten van het Ik Kies Bewust-logo in de markt. Daarbij wordt gekeken of en in welke mate de vraag naar de producten met het Ik Kies Bewust-logo groter wordt en welke effecten dit heeft op de vraag naar andere producten in diezelfde of andere productcategorieën.
Ikääntyneiden asuinpaikat nyt ja tulevaisuudessa
Helminen, Ville; Vesala, Satu; Rehunen, Antti; Strandell, Anna; Reimi, Petra; Priha, Aliisa
2017-01-01
Seuraavien vuosikymmenten aikana ikääntyneiden osuus Suomen väestöstä kasvaa merkittävästi. Vuonna 2030 Suomessa on väestöennusteen mukaan noin 1,5 miljoonaa yli 65-vuotiasta, mikä on neljännes koko maan väestöstä. Tässä raportissa tarkastellaan ikääntyneiden eli yli 65-vuotiaiden asuinpaikkoja ja asumista valtakunnallisten paikkatietoaineistojen avulla. Alueellinen tarkastelu on tehty pääosin kuntarajoista riippumattomilla alueluokituksilla, jotka kuvaavat erityyppisiä alueita ja asuinympäri...
Ikääntyneiden suunhoito : Ohjaus- ja koulutustilaisuus Cajanuksentienkodin hoitohenkilökunnalle
Syri, Tyyne; Mustonen, Jemina; Lehto, Anni
2016-01-01
Ikääntyneiden määrä on kasvanut viime aikoina suhteessa muuhun väestöön, ja tämä suuntaus näyttäisi jatkuvan. Tutkimusten mukaan yhä useammalla ikääntyneellä on sekä omia hampaita että erilaisia hammasproteeseja suussaan. Toimintakyvyn heikentyessä suun puhdistuksesta ja kunnosta huolehtiminen siirtyy hoitohenkilökunnan vastuulle. Huolenaiheina ovat, kuinka turvataan hyvä suunhoito ikääntyneille, mitkä ovat itsemääräämisoikeuden rajat suun hoidossa sekä miten varmistetaan hoitohenkilökunnan a...
Update on the slow delayed rectifier potassium current (I(Ks)): role in modulating cardiac function.
Liu, Zhenzhen; Du, Lupei; Li, Minyong
2012-01-01
The slow delayed rectifier current (I(Ks)) is the slow component of cardiac delayed rectifier current and is critical for the late phase repolarization of cardiac action potential. This current is also an important target for Sympathetic Nervous System (SNS) to regulate the cardiac electivity to accommodate to heart rate alterations in response to exercise or emotional stress and can be up-regulated by β- adrenergic or other signal molecules. I(Ks) channel is originated by the co-assembly of pore-forming KCNQ1 α-subunit and accessory KCNE1 β-subunit. Mutations in any subunit can bring about severe long QT syndrome (LQT-1, LQT-5) as characterized by deliquium, seizures and sudden death. This review summarizes the normal physiological functions and molecular basis of I(Ks) channels, as well as illustrates up-to-date development on its blockers and activators. Therefore, the current extensive survey should generate fundamental understanding of the role of I(Ks) channel in modulating cardiac function and donate some instructions to the progression of I(Ks) blockers and activators as potential antiarrhythmic agents or pharmacological tools to determine the physiological and pathological function of I(Ks).
IK Brunel's Crimean war hospital.
Merridew, C G
2014-07-01
"Those wonderful huts…" (Florence Nightingale). This is the story of the British Civil Hospital, erected in 1855 at Renkioi on the south Dardanelles coast of Turkey. The spectacular hospital was a portable one designed by British engineer IK Brunel. It was his only health-related project, and it was known as a Civil Hospital because its staff were all civilians, despite its patients being military.
National Recordal System IK holder catalogue process
CSIR Research Space (South Africa)
Pretorius, R
2011-11-01
Full Text Available The aim of this poster is to illustrate the South African National Recordal Systems (NRS) process whereby Indigenous Knowledge (IK) holder’s information is captured in a registry, as specified in South Africa’s Indigenous Knowledge Systems Policy...
Ikääntyneiden seksuaalisuus ja sen tukeminen hoitotyössä - ohjeita hoitajille
Hoffrén, Jenni; Eskelinen, Noora
2014-01-01
Tämän opinnäytetyön tarkoituksena on kuvata ikääntyneiden seksuaalisuutta ja kuinka hoitajat voivat tukea seksu-aalisuutta hoitotyössä. Opinnäytetyön tavoitteena on luoda opas ikääntyneiden seksuaalisuuden tukemiseksi Leivolan hoitohenkilökunnalle, johon kuuluu perus-, lähi- ja sairaanhoitajia. Toimeksiantajanamme on Leivolan palvelukeskus Leppävirralla, joka on ympärivuorokautinen hoitokoti. Palvelukeskuksen asukkaiden ikäjakauma on 63–99 vuotta. Opinnäytetyö on kehittämistyö. Opinnäyte...
Hoitohenkilökunta muistisairaan ikääntyneen suun hoitajana
Määttä, Johanna; Valtonen, Heidi
2014-01-01
Tulevaisuudessa ikääntyneiden sekä muistisairaiden määrä lisääntyy. Myös hampaallisten ikääntyneiden määrä tulee kasvamaan. Suun terveydestä huolehtiminen osana kokonaisterveyttä on tärkeää, koska huono suun terveys vaikuttaa yleisterveyteen haitallisesti. Muistisairauksiin liittyy muistin huononemisen lisäksi kognitiivisia häiriöitä, kuten käytöshäiriöitä ja motoristen toimintojen heikentymistä. Kaikki tämä aiheuttaa haasteita palvelukodissa työskentelevälle hoitohenkilökunnalle ja vastuu mu...
Directory of Open Access Journals (Sweden)
Tzu Lin
2015-11-01
Full Text Available During development, certain Drosophila sensory neurons undergo dendrite pruning that selectively eliminates their dendrites but leaves the axons intact. How these neurons regulate pruning activity in the dendrites remains unknown. Here, we identify a coiled-coil protein Spindle-F (Spn-F that is required for dendrite pruning in Drosophila sensory neurons. Spn-F acts downstream of IKK-related kinase Ik2 in the same pathway for dendrite pruning. Spn-F exhibits a punctate pattern in larval neurons, whereas these Spn-F puncta become redistributed in pupal neurons, a step that is essential for dendrite pruning. The redistribution of Spn-F from puncta in pupal neurons requires the phosphorylation of Spn-F by Ik2 kinase to decrease Spn-F self-association, and depends on the function of microtubule motor dynein complex. Spn-F is a key component to link Ik2 kinase to dynein motor complex, and the formation of Ik2/Spn-F/dynein complex is critical for Spn-F redistribution and for dendrite pruning. Our findings reveal a novel regulatory mechanism for dendrite pruning achieved by temporal activation of Ik2 kinase and dynein-mediated redistribution of Ik2/Spn-F complex in neurons.
Directory of Open Access Journals (Sweden)
Birgit Goversen
2018-01-01
Full Text Available An important aspect of the Comprehensive In Vitro Proarrhythmia Assay (CiPA proposal is the use of human stem cell-derived cardiomyocytes and the confirmation of their predictive power in drug safety assays. The benefits of this cell source are clear; drugs can be tested in vitro on human cardiomyocytes, with patient-specific genotypes if needed, and differentiation efficiencies are generally excellent, resulting in a virtually limitless supply of cardiomyocytes. There are, however, several challenges that will have to be surmounted before successful establishment of hSC-CMs as an all-round predictive model for drug safety assays. An important factor is the relative electrophysiological immaturity of hSC-CMs, which limits arrhythmic responses to unsafe drugs that are pro-arrhythmic in humans. Potentially, immaturity may be improved functionally by creation of hybrid models, in which the dynamic clamp technique joins simulations of lacking cardiac ion channels (e.g., IK1 with hSC-CMs in real-time during patch clamp experiments. This approach has been used successfully in manual patch clamp experiments, but throughput is low. In this study, we combined dynamic clamp with automated patch clamp of iPSC-CMs in current clamp mode, and demonstrate that IK1 conductance can be added to iPSC-CMs on an automated patch clamp platform, resulting in an improved electrophysiological maturity.
IkPas : Een definitieve breuk met het verleden?
Bovens, R.H.L.M.; Schuitema, A.; P.M., Schmidt
2017-01-01
IkPas (‘No Thanks’) is a Dutch 30 or 40 days temporary alcohol abstinence challenge, aiming at alcohol awareness and changing habitual drinking behavior. Former effect evaluations show a significant decrease in alcohol use measured 6 months after finishing the challenge. In this study the authors
Mäkelä, Hannamari; Porema, Virve
2014-01-01
Suomessa yli 65-vuotiaiden ikäluokan osuus on kasvanut tasaisesti. Tilastokeskuksen ennusteen mukaan vuodesta 2000 vuoteen 2030 yli 65-vuotiaiden määrä tulee kasvamaan 78,7 prosenttia. Lakien ja asetusten pitäisi olla takaamassa ikääntyneille laadukkaita liikuntapalveluita, joilla turvataan toimintakyky ja sitä kautta parempi terveydentila. Tämän toiminnallisen opinnäytetyön tarkoituksena oli tuottaa osastotunti Varsinais-Suomen sairaanhoitopiirin neurotoimialueen osastoille. Osastotunnin ...
Wang, Hegui; Huang, Ting; Wang, Zheng; Ge, Nannan; Ke, Yongsheng
2018-04-28
To observe the changes of rapidly activated delayed rectifier potassium channel (IKr) and slowly activated delayed rectifier potassium channel (IKs) in cardiac hypertrophy and to evaluate the effects of IKr and IKs blocker on the incidence of ventricular arrhythmias in guinea pigs with left ventricular hypertrophy (LVH). Methods: Guinea pigs were divided into a sham operation group and a left ventricular hypertrophy (LVH) group. LVH model was prepared. Whole cell patch-clamp technique was used to record IKr and IKs tail currents in a guinea pig model with LVH. The changes of QTc and the incidence rate of ventricular arrhythmias in LVH guinea pigs were observed by using the IKr and IKs blockers. Results: Compared with cardiac cells in the control group, the interventricular septal thickness at end systole (IVSs), left ventricular posterior wall thickness at end systole (LVPWs), QTc interval and cell capacitance in guinea pigs with LVH were significantly increased (Pguinea pigs with LVH compared with the control guinea pigs. In contrast, IKs blocker produced modest increase in QTc interval in guinea pigs of control group with no increase in LVH animals. IKs blocker did not induce ventricular arrhythmias incidence in either control or LVH animals. Conclusion: The cardiac hypertrophy-induced arrhythmogenesis is due to the down-regulation of IKs.
Nintendo Wii-pelikonsolin käyttö ikääntyneiden tasapainon tukemisessa
Pere, Olli; Suihkonen, Juho; Kärkkäinen, Taneli
2017-01-01
Opinnäytetyömme tavoitteena oli lisätä tietoa Nintendo Wii-pelikonsolin käytöstä ikääntyneiden tasapainoharjoittelussa. Opinnäytetyössämme teimme kirjallisuuskatsauksen kokoamalla aiemmin tutkittua tietoa aiheesta. Selvittääksemme ikääntyneiden käyttökokemuksia tasapainoharjoittelusta Nintendo Wiipelikonsolilla, teimme palvelutalo Karpalokodilla aiheesta tapaustutkimuksen. Tapaustutkimukseen osallistui kolme 80-89-vuotiasta henkilöä. Aineiston tapaustutkimukseen keräsimme haastattelulla. ...
Directory of Open Access Journals (Sweden)
Sheng-Nan Wu
2015-01-01
Full Text Available The inwardly rectifying K+ current [IK(IR] allows large inward K+ currents at potentials negative to K+ equilibrium potential (EK and it becomes small outward K+ currents at those positive to EK. How changes of such currents enriched in glial cells can influence the functions of glial cell, neurons, or both is not clearly defined, although mutations of Kir4.1 channels have been demonstrated to cause serious neurological disorders. In this study, we identified the presence of IK(IR in human glioma cells (U373 and U87 cells. The amplitude of IK(IR in U373 cells was subject to inhibition by amitriptyline, arecoline, or BaCl2. The activity of inwardly rectifying K+ channels was also clearly detected, and single-channel conductance of these channels was calculated to be around 23 pS. Moreover, based on a simulation model derived from neuron–glial interaction mediated by ion flux, we further found out that incorporation of glial IK(IR conductance into the model can significantly contribute to regulation of extracellular K+ concentrations and glial resting potential, particularly during high-frequency stimulation. Glial cells and neurons can mutually modulate their expression of ion channels through K+ ions released into the extracellular space. It is thus anticipated that glial IK(IR may be a potential target utilized to influence the activity of neuronal and glial cells as well as their interaction.
Directory of Open Access Journals (Sweden)
Shaanan Boaz
2008-09-01
Full Text Available Abstract Background IkappaB kinases (IKKs regulate the activity of Rel/NF-kappaB transcription factors by targeting their inhibitory partner proteins, IkappaBs, for degradation. The Drosophila genome encodes two members of the IKK family. Whereas the first is a kinase essential for activation of the NF-kappaB pathway, the latter does not act as IkappaB kinase. Instead, recent findings indicate that Ik2 regulates F-actin assembly by mediating the function of nonapoptotic caspases via degradation of DIAP1. Also, it has been suggested that ik2 regulates interactions between the minus ends of the microtubules and the actin-rich cortex in the oocyte. Since spn-F mutants display oocyte defects similar to those of ik2 mutant, we decided to investigate whether Spn-F could be a direct regulatory target of Ik2. Results We found that Ik2 binds physically to Spn-F, biomolecular interaction analysis of Spn-F and Ik2 demonstrating that both proteins bind directly and form a complex. We showed that Ik2 phosphorylates Spn-F and demonstrated that this phosphorylation does not lead to Spn-F degradation. Ik2 is localized to the anterior ring of the oocyte and to punctate structures in the nurse cells together with Spn-F protein, and both proteins are mutually required for their localization. Conclusion We conclude that Ik2 and Spn-F form a complex, which regulates cytoskeleton organization during Drosophila oogenesis and in which Spn-F is the direct regulatory target for Ik2. Interestingly, Ik2 in this complex does not function as a typical IKK in that it does not direct SpnF for degradation following phosphorylation.
Omaisten ja henkilökunnan välinen yhteistyö ikääntyneiden hoitokodissa
Komulainen, Jenni
2013-01-01
Omaisten ja henkilökunnan välistä yhteistyötä pidetään hyvin merkittävänä osana ikäihmisten hoitotyötä. Omaisten ja henkilökunnan välisen yhteistyön kehittäminen on jatkuvaa. Tein opinnäytetyön ikääntyneiden hoitokotiin. Opinnäytetyön tarkoituksena oli kuvailla omaisten ajatuksia sekä toiveita yhteistyöstä henkilökunnan kanssa. Tavoitteena on kehittää omaisten ja henkilökunnan välistä yhteistyötä ikääntyneiden hoitokodeissa. Toteutin opinnäytetyön aineiston keruun haastattelemalla hoi...
Kosketuksen tarve jatkuu läpi elämän : osastotunti ikääntyneiden muistisairaiden seksuaalisuudesta
Viitanen, Milla; Kontkanen, Katja
2015-01-01
Opinnäytetyö toteutettiin toiminnallisena tutkimusmenetelmänä, jonka tarkoituksena oli tuottaa osastotunti ikääntyneiden muistisairaiden seksuaalisuuden tukemisesta erään pitkäaikaishoitopaikan henkilökunnalle. Opinnäytetyön tehtävinä oli selvittää, miten ikääntyminen ja muistisairaus vaikuttavat seksuaalisuuteen, kuinka seksuaalisuus saattaa näkyä pitkäaikaishoidossa sekä millaisia keinoja hoitohenkilökunnalla on kohdata ikääntyneen muistisairaan seksuaalisuus pitkäaikaishoidossa. Tutkim...
Okada, Muneyoshi; Watanabe, Shinya; Matada, Takashi; Asao, Yoko; Hamatani, Ramu; Yamawaki, Hideyuki; Hara, Yukio
2013-01-01
Influences of psychotropic drugs, six antipsychotics and three antidepressants, on acetylcholine receptor-operated potassium current (IK.ACh) were examined by a whole-cell patch clamp method in freshly isolated guinea-pig atrial myocyte. IK.ACh was induced by a superfusion of carbachol (CCh) or by an intracellular application of guanosine 5'-[thio] triphosphate (GTPγS). To elucidate mechanism for anticholinergic action, IC50 ratio, the ratio of IC50 for GTPγS-activated IK.ACh to CCh-induced IK.ACh, was calculated. Antipsychotics and antidepressants inhibited CCh-induced IK.ACh in a concentration-dependent manner. The IC50 values were as follows; chlorpromazine 0.53 μM, clozapine 0.06 μM, fluphenazine 2.69 μM, haloperidol 2.66 μM, sulpiride 42.3 μM, thioridazine 0.07 μM, amitriptyline 0.03 μM, imipramine 0.22 μM and maprotiline 1.81 μM. The drugs, except for sulpiride, inhibited GTPγS-activated IK.ACh with following IC50 values; chlorpromazine 1.71 μM, clozapine 14.9 μM, fluphenazine 3.55 μM, haloperidol 2.73 μM, thioridazine 1.90 μM, amitriptyline 7.55 μM, imipramine 7.09 μM and maprotiline 5.93 μM. The IC50 ratio for fluphenazine and haloperidol was close to unity. The IC50 ratio for chlorpromazine, clozapine, thioridazine, amitriptyline, imipramine and maprotiline was much higher than unity. The present findings suggest that the psychotropics studied suppress IK.ACh. Chlorpromazine, clozapine, thioridazine, amitriptyline, imipramine, maprotiline and sulpiride are preferentially acting on muscarinic receptor. Fluphenazine and haloperidol may act on G protein and/or potassium channel.
Director murrab pead : Kuidas peatada firma allakäik? / Mari Kooskora
Kooskora, Mari, 1969-
2008-01-01
Küsimusele, kuidas majandusliku languse ajal, mitmete tipptegijate lahkumise ja ajakirjanduse tekitatud negatiivse fooni tõttu peatada ettevõtte allakäik, vastavad MarkIT tegevjuht Andres Agasild ja Personalipunkt Extra tegevdirektor Piret Korol
VizieR Online Data Catalog: First analysis of the binary IK Boo (Kriwattanawong+, 2017)
Kriwattanawong, W.; Sanguansak, N.; Maungkorn, S.
2017-03-01
With new CCD observations of the W UMa type binary IK Boo, we present the first investigation of photometric parameters and orbital period change. The BVRc light curve fit shows that IK Boo is a W-type contact system with a mass ratio of q=1.146 and a shallow contact with a fill-out factor of f=2.22%. The orbital period decrease is found at a rate of -3.28x10-7d/yr, corresponding to a mass transfer from the more massive to the less massive component with a rate of -2.83x10-6M_ȯ/yr. The inner and outer critical Roche lobes will contract and cause the contact degree to increase. Therefore, IK Boo may evolve into a deeper contact system. Furthermore, a possible cyclic variation is found to have a period of 9.74yr, that could be explained by the light-travel time effect, due to the existence of a third companion in the system. (2 data files).
Kistamás, Kornél; Szentandrássy, Norbert; Hegyi, Bence; Ruzsnavszky, Ferenc; Váczi, Krisztina; Bárándi, László; Horváth, Balázs; Szebeni, Andrea; Magyar, János; Bányász, Tamás; Kecskeméti, Valéria; Nánási, Péter P
2013-06-15
Despite its widespread therapeutical use there is little information on the cellular cardiac effects of the antidiabetic drug pioglitazone in larger mammals. In the present study, therefore, the concentration-dependent effects of pioglitazone on ion currents and action potential configuration were studied in isolated canine ventricular myocytes using standard microelectrode, conventional whole cell patch clamp, and action potential voltage clamp techniques. Pioglitazone decreased the maximum velocity of depolarization and the amplitude of phase-1 repolarization at concentrations ≥3 μM. Action potentials were shortened by pioglitazone at concentrations ≥10 μM, which effect was accompanied with significant reduction of beat-to-beat variability of action potential duration. Several transmembrane ion currents, including the transient outward K(+) current (Ito), the L-type Ca(2+) current (ICa), the rapid and slow components of the delayed rectifier K(+) current (IKr and IKs, respectively), and the inward rectifier K(+) current (IK1) were inhibited by pioglitazone under conventional voltage clamp conditions. Ito was blocked significantly at concentrations ≥3 μM, ICa, IKr, IKs at concentrations ≥10 μM, while IK1 at concentrations ≥30 μM. Suppression of Ito, ICa, IKr, and IK1 has been confirmed also under action potential voltage clamp conditions. ATP-sensitive K(+) current, when activated by lemakalim, was effectively blocked by pioglitazone. Accordingly, action potentials were prolonged by 10 μM pioglitazone when the drug was applied in the presence of lemakalim. All these effects developed rapidly and were readily reversible upon washout. In conclusion, pioglitazone seems to be a harmless agent at usual therapeutic concentrations. Copyright © 2013 Elsevier B.V. All rights reserved.
Maurice, Anne-Claire; Philip, Jacques; Bersamin, Andrea
2017-05-25
In remote, Alaska Native communities, traditional foods remain a significant source of essential nutrients and appear to protect against the development of chronic diseases. Relatively low intake of traditional foods among Alaska Native children is therefore of concern. The aim of this study was to identify household and parental predictors of child traditional food (TF) consumption and weight in remote Yup'ik communities of Alaska. Children (10-18 years old) and parents in two communities (populations foods among children and parents was estimated from two-24 h recalls using NDS-R. Weight and height were measured and BMI calculated. Sociodemographic factors, including income and education, were collected from parents. A partial least square path modeling analysis and bootstrapping were performed to identify predictors of child TF consumption and weight. Parental intake of traditional foods, Yup'ik identity and income were positively associated with child intake of traditional foods. Further, parental intake of traditional foods predicted lower child BMI. Parental education was negatively associated with child traditional food intake and positively associated with child BMI. Findings suggest that interventions targeting parents may be an effective strategy to increase intake of traditional foods and improve diet quality among Alaska Native youth.
Using exploratory factor analysis of FFQ data to identify dietary patterns among Yup'ik people.
Ryman, Tove K; Austin, Melissa A; Hopkins, Scarlett; Philip, Jacques; O'Brien, Diane; Thummel, Kenneth; Boyer, Bert B
2014-03-01
An FFQ developed by the Center for Alaska Native Health Research for studies in Yup'ik people includes market foods and subsistence foods such as moose, seal, waterfowl and salmon that may be related to disease risk. Because the FFQ contains >100 food items, we sought to characterize dietary patterns more simply for use in ongoing pharmacogenomics studies. Exploratory factor analysis was used to derive a small number of 'factors' that explain a substantial amount of the variation in the Yup'ik diet. We estimated factor scores and measured associations with demographic characteristics and biomarkers. South-west Alaska, USA. Yup'ik people (n 358) aged ≥18 years. We identified three factors that each accounted for ≥10 % of the common variance: the first characterized by 'processed foods' (e.g. salty snacks, sweetened cereals); the second by 'fruits and vegetables' (e.g. fresh citrus, potato salad); and the third by 'subsistence foods' (seal or walrus soup, non-oily fish). Participants from coastal communities had higher values for the 'subsistence' factor, whereas participants from inland communities had higher values for the 'fruits and vegetables' factor. A biomarker of marine intake, δ 15N, was correlated with the 'subsistence' factor, whereas a biomarker of corn- and sugarcane-based market food intake, δ 13C, was correlated with 'processed foods'. The exploratory factor analysis identified three factors that appeared to reflect dietary patterns among Yup'ik based on associations with participant characteristics and biomarkers. These factors will be useful for chronic disease studies in this population.
Karivirta, Minka; Mikkonen, Tanja
2017-01-01
Väestön vanhetessa terveydenhuollossa pyritään ylläpitämään ja lisäämään ikäihmisen toimintakykyä. Toimintakyvyn kohentuminen parantaa elämänlaatua, lisää toimijuuden tunnetta ja tekee arjessa selviytymisestä turvallisempaa. Ikääntyminen näkyy fyysisen, psyykkisen ja sosiaalisen toimintakyvyn muutoksina. Opinnäytetyön tarkoituksena on kuvailla arkivaikuttavuuden ilmenemistä Turun lääkinnällisen kuntoutuksen Tasapainokoulun ryhmämuotoiseen harjoitteluun osallistuvien kohdalla. Tutkimuksell...
Research reactor core conversion guidebook. V. 4: Fuels (Appendices I-K)
International Nuclear Information System (INIS)
1992-04-01
Volume 4 consists of detailed Appendices I-K, which contain useful information on the properties, irradiation testing, and specifications and inspection procedures for fuels with reduced uranium enrichments. Summaries of these appendices can be found in Chapters 9-11 of Volume 1 of this guidebook. Refs, figs, tabs and samples
Kriwattanawong, Wichean; Sanguansak, Nuanwan; Maungkorn, Sakdawoot
2017-08-01
With new CCD observations of the W UMa type binary IK Boo, we present the first investigation of photometric parameters and orbital period change. The BVRc light curve fit shows that IK Boo is a W-type contact system with a mass ratio of q = 1.146 and a shallow contact with a fill-out factor of f = 2.22%. The orbital period decrease was found to be a rate of -3.28 × 10-7 d yr-1, corresponding to a mass transfer from the more massive to the less massive component with a rate of -2.83 × 10-6 M⊙ yr-1. The inner and outer critical Roche lobes will contract and cause the contact degree to increase. Therefore, IK Boo may evolve into a deeper contact system. Furthermore, a possible cyclic variation was found with a period of 9.74 yr, which could be explained by the light-travel time effect due to the existence of a third companion in the system.
Directory of Open Access Journals (Sweden)
Belén Climent
Full Text Available Endothelial small- and intermediate-conductance KCa channels, SK3 and IK1, are key mediators in the endothelium-derived hyperpolarization and relaxation of vascular smooth muscle and also in the modulation of endothelial Ca2+ signaling and nitric oxide (NO release. Obesity is associated with endothelial dysfunction and impaired relaxation, although how obesity influences endothelial SK3/IK1 function is unclear. Therefore we assessed whether the role of these channels in the coronary circulation is altered in obese animals.In coronary arteries mounted in microvascular myographs, selective blockade of SK3/IK1 channels unmasked an increased contribution of these channels to the ACh- and to the exogenous NO- induced relaxations in arteries of Obese Zucker Rats (OZR compared to Lean Zucker Rats (LZR. Relaxant responses induced by the SK3/IK1 channel activator NS309 were enhanced in OZR and NO- endothelium-dependent in LZR, whereas an additional endothelium-independent relaxant component was found in OZR. Fura2-AM fluorescence revealed a larger ACh-induced intracellular Ca2+ mobilization in the endothelium of coronary arteries from OZR, which was inhibited by blockade of SK3/IK1 channels in both LZR and OZR. Western blot analysis showed an increased expression of SK3/IK1 channels in coronary arteries of OZR and immunohistochemistry suggested that it takes place predominantly in the endothelial layer.Obesity may induce activation of adaptive vascular mechanisms to preserve the dilator function in coronary arteries. Increased function and expression of SK3/IK1 channels by influencing endothelial Ca2+ dynamics might contribute to the unaltered endothelium-dependent coronary relaxation in the early stages of obesity.
Wolsko, Christopher; Lardon, Cécile; Mohatt, Gerald V; Orr, Eliza
2007-02-01
To report on the relationships between cultural identity and stress, coping, and psychological well-being in Yup'ik communities. A quantitative self-administered questionnaire. A health and wellness survey was completed by a total of 488 Yup'ik participants (284 women and 204 men) from 6 rural villages in the Yukon-Kuskokwim Delta region. Respondents were fairly equally distributed across an age range of 14 to 94 (mean +/- SD = 38.50 +/- 17.18). Participants who reported living more of a Kass'aq way of life (greater acculturation) reported experiencing greater psychosocial stress, less happiness, and greater use of drugs and alcohol to cope with stress. Participants who reported identifying more with a traditional Yup'ik way of life reported greater happiness, more frequent use of religion and spirituality to cope with stress, and less frequent use of drugs and alcohol to cope with stress. In conjunction with previous research, the data strongly indicates that in general, Yup'ik people in the Y-K Delta tend to associate stress and negative health outcomes with the process of acculturation, and health and healing with the process of enculturation. Research that focuses on documenting the intrinsic strengths of indigenous worldviews may contribute to positive transformations in community health.
Modulation of KCNQ1 alternative splicing regulates cardiac IKs and action potential repolarization.
Lee, Hsiang-Chun; Rudy, Yoram; Po-Yuan, Phd; Sheu, Sheng-Hsiung; Chang, Jan-Gowth; Cui, Jianmin
2013-08-01
Slow delayed-rectifier potassium current (IKs) channels, made of the pore-forming KCNQ1 and auxiliary KCNE1 subunits, play a key role in determining action potential duration (APD) in cardiac myocytes. The consequences of drug-induced KCNQ1 splice alteration remain unknown. To study the modulation of KCNQ1 alternative splicing by amiloride and the consequent changes in IKs and action potentials (APs) in ventricular myocytes. Canine endocardial, midmyocardial, and epicardial ventricular myocytes were isolated. Levels of KCNQ1a and KCNQ1b as well as a series of splicing factors were quantified by using the reverse transcriptase-polymerase chain reaction and Western blot. The effect of amiloride-induced changes in the KCNQ1b/total KCNQ1 ratio on AP was measured by using whole-cell patch clamp with and without isoproterenol. With 50 μmol/L of amiloride for 6 hours, KCNQ1a at transcriptional and translational levels increased in midmyocardial myocytes but decreased in endo- and epicardial myocytes. Likewise, changes in splicing factors in midmyocardial were opposite to that in endo- and epicardial myocytes. In midmyocardial myocytes amiloride shortened APD and decreased isoproterenol-induced early afterdepolarizations significantly. The same amiloride-induced effects were demonstrated by using human ventricular myocyte model for AP simulations under beta-adrenergic stimulation. Moreover, amiloride reduced the transmural dispersion of repolarization in pseudo-electrocardiogram. Amiloride regulates IKs and APs with transmural differences and reduces arrhythmogenicity through the modulation of KCNQ1 splicing. We suggested that the modulation of KCNQ1 splicing may help prevent arrhythmia. Copyright © 2013 Heart Rhythm Society. Published by Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Wulff, Tune; Hougaard, Charlotte; Klaerke, Dan A
2004-01-01
did not result in any increase in [Ca2+]i. Even though activation of hIK by low concentrations of LTD4 was independent of an increase in [Ca2+]i, a certain "permissive" level of [Ca2+]i was required for its activation, since buffering of intracellular Ca2+ by EGTA completely abolished the response...
Küresel İklim Değişikliğinin Ekoloji Üzerine Etkileri
DURSUN, Sukru; KUNT, Fatma; OZTURK, Zeynep Cansu; VRENOZI, Blerina
2015-01-01
İklim özellikleri insan faaliyetleri ve küresel ekoloji, içinde bulunan ekosistemi sınırlayıcı etkilere sahiptir. İklim değişikliği, kuraklık, sel şiddeti ve sıklığındaki değişiklikler; su kaynağı; hava, toprak ve su kalitesi; Ekosistem sağlığı; insan sağlığı; kaynak kullanımı ve ekonomi üzerinde etkilere sahiptir. İklim değişikliği birden faklı yol aracılığıyla etki edebilir; küresel ekosistem üzerinde etkileşimleri ve farklı yollarla etkileri olabilir. Ekosistem ortamında, arazi kullanımı d...
Hassinen, Minna; Laulaja, Salla; Paajanen, Vesa; Haverinen, Jaakko; Vornanen, Matti
2011-07-01
Ectothermic vertebrates experience acute and chronic temperature changes which affect cardiac excitability and may threaten electrical stability of the heart. Nevertheless, ectothermic hearts function over wide range of temperatures without cardiac arrhythmias, probably due to special molecular adaptations. We examine function and molecular basis of the slow delayed rectifier K(+) current (I(Ks)) in cardiac myocytes of a eurythermic fish (Carassius carassius L.). I(Ks) is an important repolarizing current that prevents excessive prolongation of cardiac action potential, but it is extremely slowly activating when expressed in typical molecular composition of the endothermic animals. Comparison of the I(Ks) of the crucian carp atrial myocytes with the currents produced by homomeric K(v)7.1 and heteromeric K(v)7.1/MinK channels in Chinese hamster ovary cells indicates that activation kinetics and pharmacological properties of the I(Ks) are similar to those of the homomeric K(v)7.1 channels. Consistently with electrophysiological properties and homomeric K(v)7.1 channel composition, atrial transcript expression of the MinK subunit is only 1.6-1.9% of the expression level of the K(v)7.1 subunit. Since activation kinetics of the homomeric K(v)7.1 channels is much faster than activation of the heteromeric K(v)7.1/MinK channels, the homomeric K(v)7.1 composition of the crucian carp cardiac I(Ks) is thermally adaptive: the slow delayed rectifier channels can open despite low body temperatures and curtail the duration of cardiac action potential in ectothermic crucian carp. We suggest that the homomeric K(v)7.1 channel assembly is an evolutionary thermal adaptation of ectothermic hearts and the heteromeric K(v)7.1/MinK channels evolved later to adapt I(Ks) to high body temperature of endotherms.
de Lorenzi, F G; Bridal, T R; Spinelli, W
1994-01-01
1. We investigated the effects of two 5-HT3 antagonists, ondansetron and granisetron, on the action potential duration (APD) and the delayed rectifier current (IK) of feline isolated ventricular myocytes. Whole-cell current and action potential recordings were performed at 37 degrees C with the patch clamp technique. 2. Ondansetron and granisetron blocked IK with a KD of 1.7 +/- 1.0 and 4.3 +/- 1.7 microM, respectively. At a higher concentration (30 microM), both drugs blocked the inward rectifier (IKl). 3. The block of IK was dependent on channel activation. Both drugs slowed the decay of IK tail currents and produced a crossover with the pre-drug current trace. These results are consistent with block and unblock from the open state of the channel. 4. Granisetron showed an intrinsic voltage-dependence as the block increased with depolarization. The equivalent voltage-dependency of block (delta) was 0.10 +/- 0.04, suggesting that granisetron blocks from the intracellular side at a binding site located 10% across the transmembrane electrical field. 5. Ondansetron (1 microM) and granisetron (3 microM) prolonged APD by about 30% at 0.5 Hz. The prolongation of APD by ondansetron was abolished at faster frequencies (3 Hz) showing reverse rate dependence. 6. In conclusion, the 5-HT3 antagonists, ondansetron and granisetron, are open state blockers of the ventricular delayed rectifier and show a clear class III action. PMID:7834204
DEFF Research Database (Denmark)
Nielsen, Jens Steen; Rode, Frederik; Rahbek, Mette
2011-01-01
• To investigate the importance of small (SK)- and intermediate (IK)-conductance Ca2(+) -activated K(+) channels on bladder function, by studying the effects of 4,5-dichloro-1,3-diethyl-1,3-dihydro-benzoimidazol-2-one (NS4591), a new modulator of SK/IK channels, on contractions induced by electri......• To investigate the importance of small (SK)- and intermediate (IK)-conductance Ca2(+) -activated K(+) channels on bladder function, by studying the effects of 4,5-dichloro-1,3-diethyl-1,3-dihydro-benzoimidazol-2-one (NS4591), a new modulator of SK/IK channels, on contractions induced...
The millimeter IRAM-30 m line survey toward IK Tauri
Velilla Prieto, L.; Sánchez Contreras, C.; Cernicharo, J.; Agúndez, M.; Quintana-Lacaci, G.; Bujarrabal, V.; Alcolea, J.; Balança, C.; Herpin, F.; Menten, K. M.; Wyrowski, F.
2017-01-01
Aims: We aim to investigate the physical and chemical properties of the molecular envelope of the oxygen-rich AGB star IK Tau. Methods: We carried out a millimeter wavelength line survey between 79 and 356 GHz with the IRAM-30 m telescope. We analysed the molecular lines detected in IK Tau using the population diagram technique to derive rotational temperatures and column densities. We conducted a radiative transfer analysis of the SO2 lines, which also helped us to verify the validity of the approximated method of the population diagram for the rest of the molecules. Results: For the first time in this source we detected rotational lines in the ground vibrational state of HCO+, NS, NO, and H2CO, as well as several isotopologues of molecules previously identified, namely, C18O, Si17O, Si18O, 29SiS, 30SiS, Si34S, H13CN, 13CS, C34S, H234S, 34SO, and 34SO2. We also detected several rotational lines in vibrationally excited states of SiS and SiO isotopologues, as well as rotational lines of H2O in the vibrationally excited state ν2 = 2. We have also increased the number of rotational lines detected of molecules that were previously identified toward IK Tau, including vibrationally excited states, enabling a detailed study of the molecular abundances and excitation temperatures. In particular, we highlight the detection of NS and H2CO with fractional abundances of f(NS) 10-8 and f(H2CO) [10-7-10-8]. Most of the molecules display rotational temperatures between 15 and 40 K. NaCl and SiS isotopologues display rotational temperatures higher than the average ( 65 K). In the case of SO2 a warm component with Trot 290 K is also detected. Conclusions: With a total of 350 lines detected of 34 different molecular species (including different isotopologues), IK Tau displays a rich chemistry for an oxygen-rich circumstellar envelope. The detection of carbon bearing molecules like H2CO, as well as the discrepancies found between our derived abundances and the predictions from
Directory of Open Access Journals (Sweden)
Inna Rivkin
2013-08-01
Full Text Available Background. The native people of Alaska have experienced historical trauma and rapid changes in culture and lifestyle patterns. As a consequence, these populations shoulder a disproportionately high burden of psychological stress. The Yup’ik Experiences of Stress and Coping project originated from rural Yup’ik communities’ concerns about stress and its effects on health. It aimed to understand the stressful experiences that affect Yup’ik communities, to identify coping strategies used to deal with these stressors and to inform culturally responsive interventions. Objectives. Here, we examine the process of moving from research (gaining understanding to disseminating project findings to translation into intervention priorities. We highlight the importance of community participation and discuss challenges encountered, strategies to address these challenges and ethical considerations for responsible intervention research with indigenous communities that reflect their unique historical and current socio-cultural realities. Design. Community-wide presentations and discussions of research findings on stress and coping were followed by smaller Community Planning Group meetings. During these meetings, community members contextualized project findings and discussed implications for interventions. This process placed priority on community expertise in interpreting findings and translating results and community priorities into grant applications focused on intervention development and evaluation. Results. Challenges included translation between English and Yup’ik, funding limitations and uncertainties, and the long timelines involved in moving from formative research to intervention in the face of urgent and evolving community needs. The lack of congruence between institutional and community worldviews in the intervention research enterprise highlights the need for “principled cultural sensitivity”. Conclusions. Cultural sensitivity requires
A grammar of Ik (Icé-tód) : Northeast Uganda's last thriving Kuliak language
Schrock, Terrill B.
2014-01-01
The Ik language (Icé-tód), spoken in northeast Uganda, forms the Kuliak (Rub) subgroup along with So/Tepeth and Nyang’í. These latter two lects have already succombed to assimilative pressures from neighboring Nilotic pastoralists like the Karimojong, Turkana, and Pokot. Despite
Jow, Flora; Numann, Randy
1998-01-01
Cultured human capillary endothelial cells (HCEC) contain a large inward rectifier current, IK(IR), that can be abolished by removing external K+ or by adding 50 μm Ba2+.We show that IK(IR) is responsible for maintaining the hyperpolarized potential (−60.6 ± 0.5 mV, n = 83) of HCEC. Blocking IK(IR) with 50 μm Ba2+ shifts the zero current level and depolarizes HCEC by 36.5 ± 1.3 mV (n = 4).Increasing external Ca2+ concentration ([Ca2+]o) from 0.5 to 7 mm reduces the magnitude of IK(IR) by 36.5 ± 2.3 % (n = 5) and depolarizes the cells by 10.33 ± 2.4 mV (n = 3), whereas decreasing [Ca2+]o from 1.8 to 0.5 mm increases the amplitude of IK(IR) by 6.9 ± 1.9 % (n = 4). The relationship between [Ca2+]o and the percentage block of IK(IR) gives a Kd value of 5.4 ± 0.6 mm at −120 mV.IK(IR) is also blocked by other divalent ions, with Ba2+ >> Sr2+ > Mg2+ > Mn2+= Ca2+, and the block of peak current at −120 mV being 85.3 ± 3.2 % (n = 5) for 50 μm Ba2+, 62.9 ± 2.2 % (n = 5) for 5 mm Sr2+, 40.7 ± 2.5 % (n = 9) for 5 mm Mg2+, 33.4 ± 2.1 % (n = 5) for 5 mm Mn2+ and 32.9 ± 2.1 % (n = 5) for 5 mm Ca2+.The voltage dependence of Sr2+ block of peak IK(IR) occurred with a Kd value of 1.0 ± 0.09 mm for −140 mV, 1.9 ± 0.16 mm for −130 mV, 3.1 ± 0.28 mm for −120 mV, 4.6 ± 0.34 mm for −110 mV and 6.4 ± 0.5 mm for −100 mV (n = 5), with a calculated electrical distance (δ) of 0.44 from the outside. PMID:9729622
DEFF Research Database (Denmark)
Strøbaek, Dorte; Teuber, Lene; Jørgensen, Tino D
2004-01-01
We have identified and characterized the compound NS309 (6,7-dichloro-1H-indole-2,3-dione 3-oxime) as a potent activator of human Ca2+ -activated K+ channels of SK and IK types, whereas it is devoid of effect on BK type channels. IK- and SK-channels have previously been reported to be activated...
Rasmus, Stacy M; Charles, Billy; Mohatt, Gerald V
2014-09-01
This paper describes the development of a Yup'ik Alaska Native approach to suicide and alcohol abuse prevention that resulted in the creation of the Qungasvik, a toolbox promoting reasons for life and sobriety among youth. The Qungasvik is made up of thirty-six modules that function as cultural scripts for creating experiences in Yup'ik communities that build strengths and protection against suicide and alcohol abuse. The Qungasvik manual represents the results of a community based participatory research intervention development process grounded in culture and local process, and nurtured through a syncretic blending of Indigenous and Western theories and practices. This paper will provide a description of the collaborative steps taken at the community-level to develop the intervention modules. This process involved university researchers and community members coming together and drawing from multiple sources of data and knowledge to inform the development of prevention activities addressing youth suicide and alcohol abuse. We will present case examples describing the development of three keystone modules; Qasgiq (The Men's House), Yup'ik Kinship Terms, and Surviving Your Feelings. These modules each are representative of the process that the community co-researcher team took to develop and implement protective experiences that: (1) create supportive community, (2) strengthen families, and (3) give individuals tools to be healthy and strong.
Bukowski, Michal; Hyz, Karolina; Janczak, Monika; Hydzik, Marcin; Dubin, Grzegorz; Wladyka, Benedykt
2017-10-18
The versatile roles of toxin-antitoxin (TA) systems in bacterial physiology and pathogenesis have been investigated for more than three decades. Diverse TA loci in Bacteria and Archaea have been identified in genome-wide studies. The advent of massive parallel sequencing has substantially expanded the number of known bacterial genomic sequences over the last 5 years. In staphylococci, this has translated into an impressive increase from a few tens to a several thousands of available genomes, which has allowed us for the re-evalution of prior conclusions. In this study, we analysed the distribution of mazEF/pemIK family TA system operons in available staphylococcal genomes and their prevalence in mobile genetic elements. 10 novel m azEF/pemIK homologues were identified, each with a corresponding toxin that plays a potentially different and undetermined physiological role. A detailed characterisation of these TA systems would be exceptionally useful. Of particular interest are those associated with an SCCmec mobile genetic element (responsible for multidrug resistance transmission) or representing the joint horizontal transfer of TA systems and determinants of vancomycin resistance from enterococci. The involvement of TA systems in maintaining mobile genetic elements and the associations between novel mazEF/pemIK loci and those which carry drug resistance genes highlight their potential medical importance.
Sun, Juan; Yan, Huang; Wugeti, Najina; Guo, Yujun; Zhang, Ling; Ma, Mei; Guo, Xingui; Jiao, Changan; Xu, Wenli; Li, Tianqi
2015-01-01
Atrial fibrillation (AF) arises from abnormalities in atrial structure and electrical activity. Microelectrode arrays (MEA) is a real-time, nondestructive measurement of the resting and action potential signal, from myocardial cells, to the peripheral circuit of electrophysiological activity. This study examined the field action potential duration (fAPD) of the right atrial appendage (RAA) by MEA in rapid atrial pacing (RAP) in the right atrium of rabbits. In addition, this study also investigated the effect of potassium ion channel blockers on fAPD. 40 New Zealand white rabbits of either sex were randomly divided into 3 groups: 1) the control, 2) potassium ion channel blocker (TEA, 4-Ap and BaCl2), and 3) amiodarone groups. The hearts were quickly removed and right atrial appendage sectioned (slice thickness 500 μm). Each slice was perfused with Tyrode's solution and continuously stimulated for 30 minutes. Sections from the control group were superfused with Tyrode's solution for 10 minutes, while the blocker groups and amiodarone were both treated with their respective compounds for 10 minutes each. The fAPD of RAA and action field action potential morphology were measured using MEA. In non-pace (control) groups, fAPD was 188.33 ± 18.29 ms after Tyrode's solution superfusion, and 173.91 ± 6.83 ms after RAP. In pace/potassium ion channel groups, TEA and BaCl2 superfusion prolonged atrial field action potential (fAPD) (control vs blocker: 176.67 ± 8.66 ms vs 196.11 ± 10.76 ms, 182.22 ± 12.87 ms vs 191.11 ± 13.09 ms with TEA and BaCl2 superfusion, respectively, P action potential in animal heart slices. After superfusing potassium ion channel blockers, fAPD was prolonged. These results suggest that Ito, IKur and IK1 remodel and mediate RAP-induced atrial electrical remodeling. Amiodarone alter potassium ion channel activity (Ito, IKur, IK1 and IKs), shortening fAPD.
Rasmus, Stacy M.; Charles, Billy; Mohatt, Gerald V.
2014-01-01
This paper describes the development of a Yup’ik Alaska Native approach to suicide and alcohol abuse prevention that resulted in the creation of the Qungasvik, a toolbox promoting reasons for life and sobriety among youth. The Qungasvik is made up of thirty-six modules that function as cultural scripts for creating experiences in Yup’ik communities that build strengths and protection against suicide and alcohol abuse. The Qungasvik manual represents the results of a community based participatory research intervention development process grounded in culture and local process, and nurtured through a syncretic blending of Indigenous and Western theories and practices. This paper will provide a description of the collaborative steps taken at the community-level to develop the intervention modules. This process involved university researchers and community members coming together and drawing from multiple sources of data and knowledge to inform the development of prevention activities addressing youth suicide and alcohol abuse. We will present case examples describing the development of three keystone modules; Qasgiq (The Men’s House), Yup’ik Kinship Terms, and Surviving Your Feelings. These modules each are representative of the process that the community co-researcher team took to develop and implement protective experiences that: (1) create supportive community, (2) strengthen families, and (3) give individuals tools to be healthy and strong. PMID:24764018
Szabó, László; Szentandrássy, Norbert; Kistamás, Kornél; Hegyi, Bence; Ruzsnavszky, Ferenc; Váczi, Krisztina; Horváth, Balázs; Magyar, János; Bányász, Tamás; Pál, Balázs; Nánási, Péter P
2013-03-01
Tacrolimus is a commonly used immunosuppressive agent which causes cardiovascular complications, e.g., hypertension and hypertrophic cardiomyopathy. In spite of it, there is little information on the cellular cardiac effects of the immunosuppressive agent tacrolimus in larger mammals. In the present study, therefore, the concentration-dependent effects of tacrolimus on action potential morphology and the underlying ion currents were studied in canine ventricular cardiomyocytes. Standard microelectrode, conventional whole cell patch clamp, and action potential voltage clamp techniques were applied in myocytes enzymatically dispersed from canine ventricular myocardium. Tacrolimus (3-30 μM) caused a concentration-dependent reduction of maximum velocity of depolarization and repolarization, action potential amplitude, phase-1 repolarization, action potential duration, and plateau potential, while no significant change in the resting membrane potential was observed. Conventional voltage clamp experiments revealed that tacrolimus concentrations ≥3 μM blocked a variety of ion currents, including I(Ca), I(to), I(K1), I(Kr), and I(Ks). Similar results were obtained under action potential voltage clamp conditions. These effects of tacrolimus developed rapidly and were fully reversible upon washout. The blockade of inward currents with the concomitant shortening of action potential duration in canine myocytes is the opposite of those observed previously with tacrolimus in small rodents. It is concluded that although tacrolimus blocks several ion channels at higher concentrations, there is no risk of direct interaction with cardiac ion channels when applying tacrolimus in therapeutic concentrations.
DEFF Research Database (Denmark)
Liin, Sara I; Larsson, Johan E; Barro-Soria, Rene
2016-01-01
. Finally, we find that the fatty acid analogue N-arachidonoyl taurine restores channel gating of many different mutant channels, even though the mutations are in different domains of the IKs channel and affect the channel by different molecular mechanisms. N-arachidonoyl taurine is therefore an interesting...
Directory of Open Access Journals (Sweden)
Ainur Akilzhanova
2014-12-01
Full Text Available Introduction. Atrial fibrillation (AF is the most common sustained arrhythmia, and it results in significant morbidity and mortality. However, the pathogenesis of AF remains unclear to date. Recently, more pieces of evidence indicated that AF is a multifactorial disease resulting from the interaction between environmental factors and genetics. Recent studies suggest that genetic mutation of the slow delayed rectifier potassium channel (I(Ks may underlie AF.Objective. To investigate sequence alterations of I(Ks potassium channel genes KCNQ1, KCNE1 and KCNE2 in Kazakhstani patients with atrial fibrillation.Methods. Genomic DNA of 69 cases with atrial fibrillation and 27 relatives were analyzed for mutations in all protein-coding exons and their flanking splice site regions of the genes KCNQ1 (NM_000218.2 and NM_181798.1, KCNE1 (NM_000219.2, and KCNE2 (NM_172201.1 using bidirectional sequencing on the ABI 3730xL DNA Analyzer (Applied Biosystems, Foster City, CA, USA.Results. In total, a disease-causing mutation was identified in 39 of the 69 (56.5% index cases. Of these, altered sequence variants in the KCNQ1 gene accounted for 14.5% of the mutations, whereas a KCNE1 mutation accounted for 43.5% of the mutations and KCNE2 mutation accounted for 1.4% of the mutations. The majority of the distinct mutations were found in a single case (80%, whereas 20% of the mutations were observed more than once. We found two sequence variants in KCNQ1 exon 13 (S546S G1638A and exon 16 (Y662Y, C1986T in ten patients (14.5%. In KCNE1 gene in exon 3 mutation, S59G A280G was observed in 30 of 69 patients (43.5% and KCNE2 exon 2 T10K C29A in 1 patient (1.4%. Genetic cascade screening of 27 relatives to the 69 index cases with an identified mutation revealed 26.9% mutation carriers who were at risk of cardiac events such as syncope or sudden unexpected death.Conclusion. In this cohort of Kazakhstani index cases with AF, a disease-causing mutation was identified in
Milam, S. N.; Apponi, A. J.; Woolf, N. J.; Ziurys, L. M.
2007-10-01
The NaCl molecule has been observed in the circumstellar envelopes of VY Canis Majoris (VY CMa) and IK Tauri (IK Tau)-the first identifications of a metal refractory in oxygen-rich shells of evolved stars. Five rotational transitions of NaCl at 1 and 2 mm were detected toward VY CMa and three 1 mm lines were observed toward IK Tau, using the telescopes of the Arizona Radio Observatory. In both objects, the line widths of the NaCl profiles were extremely narrow relative to those of other molecules, indicating that sodium chloride has not reached the terminal outflow velocity in either star, likely a result of early condensation onto grains. Modeling the observed spectra suggests abundances, relative to H2, of f~5×10-9 in VY CMa and f~4×10-9 in IK Tau, with source sizes of 0.5" and 0.3", respectively. The extent of these sources is consistent with the size of the dust acceleration zones in both stars. NaCl therefore appears to be at least as abundant in O-rich shells as compared to C-rich envelopes, where f~(0.2-2)×10-9, although it appears to condense out earlier in the O-rich case. Chemical equilibrium calculations indicate that NaCl is the major carrier of sodium at T~1100 K for oxygen-rich stars, with predicted fractional abundances in good agreement with the observations. These measurements suggest that crystalline salt may be an important condensate for sodium in both C- and O-rich circumstellar shells.
Collins, Siri-Ilona; Ojanperä, Hanne; Rautakorpi, Marianne
2014-01-01
Osteogenesis Imperfecta (OI) on perinnöllinen luustohauraussairaus, jonka oireisiin kuuluu luiden herkkä murtuma-alttius, kasvuhäiriöt ja luiden epämuodostumat. Tyypillisin oire on herkkä murtuma-alttius, joka vaihtelee lievästä vaikeaan. Sairauden seurauksena lapsen motorinen kehitys usein viivästyy. Opinnäytetyömme tarkoituksena on kuvata vaikea-asteista osteogenesis imperfectaa sairastavan leikki-ikäisen lapsen kotiharjoittelun tarve osana kuntoutusta sekä lisätä vanhempien tietoisuut...
DEFF Research Database (Denmark)
Shamgar, Liora; Ma, Lijuan; Schmitt, Nicole
2006-01-01
The slow IKS K+ channel plays a major role in repolarizing the cardiac action potential and consists of the assembly of KCNQ1 and KCNE1 subunits. Mutations in either KCNQ1 or KCNE1 genes produce the long-QT syndrome, a life-threatening ventricular arrhythmia. Here, we show that long-QT mutations ...
Tsai, Ching-Yi; Li, Faith C H; Wu, Carol H Y; Chang, Alice Y W; Chan, Samuel H H
2016-09-22
Small ubiquitin-related modifier (SUMO) is a group of proteins that participates in post-translational modifications. One known SUMO target is the transcription factor nuclear factor-kB (NF-kB) that plays a pivotal role in many disease processes; sumoylation inactivates NF-kB by conjugation with inhibitors of NF-kB (IkB). Our laboratory demonstrated previously that transcriptional upregulation of nitric oxide synthase II (NOS II) by NF-kB, leading to nitrosative stress by the formation of peroxynitrite in the rostral ventrolateral medulla (RVLM), underpins the defunct brain stem cardiovascular regulation that precedes brain death. Based on an experimental endotoxemia model, this study evaluated the hypothesis that sumoylation plays a pro-life role in brain death by interacting with the NF-kB/NOS II/peroxynitrite signaling pathway in the RVLM. In Sprague-Dawley rats, intravenous administration of Escherichia coli lipopolysaccharide (LPS; 10 mg kg -1 ) elicited an augmentation of SUMO-1 and ubiquitin-conjugase 9 (Ubc9) mRNA or protein levels, alongside SUMO-1-conjugated proteins in the RVLM. Immunoneutralization of SUMO-1 or Ubc9 in the RVLM significantly potentiated the already diminished sumoylation of IkBα and intensified NF-kB activation and NOS II/peroxynitrite expression in this brain stem substrate, together with exacerbated fatality, cardiovascular depression and reduction of an experimental index of a life-and-death signal detected from arterial pressure that disappears in comatose patients signifying failure of brain stem cardiovascular regulation before brain death. We conclude that sumoylation of IkB in the RVLM ameliorates the defunct brain stem cardiovascular regulation that underpins brain death in our experimental endotoxemia modal by reducing nitrosative stress via inhibition of IkB degradation that diminishes the induction of the NF-kB/NOS II/peroxynitrite signaling cascade.
Guo, Jun; Wang, Tingzhong; Yang, Tonghua; Xu, Jianmin; Li, Wentao; Fridman, Michael D; Fisher, John T; Zhang, Shetuan
2011-10-07
Cardiac repolarization is controlled by the rapidly (I(Kr)) and slowly (I(Ks)) activating delayed rectifier potassium channels. The human ether-a-go-go-related gene (hERG) encodes I(Kr), whereas KCNQ1 and KCNE1 together encode I(Ks). Decreases in I(Kr) or I(Ks) cause long QT syndrome (LQTS), a cardiac disorder with a high risk of sudden death. A reduction in extracellular K(+) concentration ([K(+)](o)) induces LQTS and selectively causes endocytic degradation of mature hERG channels from the plasma membrane. In the present study, we investigated whether I(Ks) compensates for the reduced I(Kr) under low K(+) conditions. Our data show that when hERG and KCNQ1 were expressed separately in human embryonic kidney (HEK) cells, exposure to 0 mM K(+) for 6 h completely eliminated the mature hERG channel expression but had no effect on KCNQ1. When hERG and KCNQ1 were co-expressed, KCNQ1 significantly delayed 0 mM K(+)-induced hERG reduction. Also, hERG degradation led to a significant reduction in KCNQ1 in 0 mM K(+) conditions. An interaction between hERG and KCNQ1 was identified in hERG+KCNQ1-expressing HEK cells. Furthermore, KCNQ1 preferentially co-immunoprecipitated with mature hERG channels that are localized in the plasma membrane. Biophysical and pharmacological analyses indicate that although hERG and KCNQ1 closely interact with each other, they form distinct hERG and KCNQ1 channels. These data extend our understanding of delayed rectifier potassium channel trafficking and regulation, as well as the pathology of LQTS.
Kui, Péter; Orosz, Szabolcs; Takács, Hedvig; Sarusi, Annamária; Csík, Norbert; Rárosi, Ferenc; Csekő, Csongor; Varró, András; Papp, Julius Gy; Forster, Tamás; Farkas, Attila S; Farkas, András
2016-01-01
Preclinical in vivo QT measurement as a proarrhythmia essay is expensive and not reliable enough. The aim of the present study was to develop a sensitive, cost-effective, Langendorff perfused guinea pig heart model for proarrhythmia safety screening. Low concentrations of dofetilide and cisapride (inhibitors of the rapid delayed rectifier potassium current, IKr) were tested alone and co-perfused with HMR-1556 (inhibitor of the slow delayed rectifier potassium current, IKs) in Langendorff perfused guinea pig hearts. The electrocardiographic rate corrected QT (QTc) interval, the Tpeak-Tend interval and the beat-to-beat variability and instability (BVI) of the QT interval were determined in sinus rhythm. Dofetilide and HMR-1556 alone or co-perfused, prolonged the QTc interval by 20±2%, 10±1% and 55±10%, respectively. Similarly, cisapride and HMR-1556 alone or co-perfused, prolonged the QTc interval by 11±3%, 11±4% and 38±6%, respectively. Catecholamine-induced fast heart rate abolished the QTc prolonging effects of the IKr inhibitors, but augmented the QTc prolongation during IKs inhibition. None of the drug perfusions increased significantly the Tpeak-Tend interval and the sinus BVI of the QT interval. IKs inhibition increased the QTc prolonging effect of IKr inhibitors in a super-additive (synergistic) manner, and the QTc interval was superior to other proarrhythmia biomarkers measured in sinus rhythm in isolated guinea pig hearts. The effect of catecholamines on the QTc facilitated differentiation between IKr and IKs inhibitors. Thus, QTc measurement in Langendorff perfused guinea pig hearts with pharmacologically attenuated repolarization reserve and periodic catecholamine perfusion seems to be suitable for preclinical proarrhythmia screening. Copyright © 2016 Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Nielsen, Jens Steen; Rode, Frederik; Rahbek, Mette
2011-01-01
• To investigate the importance of small (SK)- and intermediate (IK)-conductance Ca2(+) -activated K(+) channels on bladder function, by studying the effects of 4,5-dichloro-1,3-diethyl-1,3-dihydro-benzoimidazol-2-one (NS4591), a new modulator of SK/IK channels, on contractions induced by electri...
Organization of nif gene cluster in Frankia sp. EuIK1 strain, a symbiont of Elaeagnus umbellata.
Oh, Chang Jae; Kim, Ho Bang; Kim, Jitae; Kim, Won Jin; Lee, Hyoungseok; An, Chung Sun
2012-01-01
The nucleotide sequence of a 20.5-kb genomic region harboring nif genes was determined and analyzed. The fragment was obtained from Frankia sp. EuIK1 strain, an indigenous symbiont of Elaeagnus umbellata. A total of 20 ORFs including 12 nif genes were identified and subjected to comparative analysis with the genome sequences of 3 Frankia strains representing diverse host plant specificities. The nucleotide and deduced amino acid sequences showed highest levels of identity with orthologous genes from an Elaeagnus-infecting strain. The gene organization patterns around the nif gene clusters were well conserved among all 4 Frankia strains. However, characteristic features appeared in the location of the nifV gene for each Frankia strain, depending on the type of host plant. Sequence analysis was performed to determine the transcription units and suggested that there could be an independent operon starting from the nifW gene in the EuIK strain. Considering the organization patterns and their total extensions on the genome, we propose that the nif gene clusters remained stable despite genetic variations occurring in the Frankia genomes.
Değişik Randımanlı Unlarda Tiyamin, Riboflavin ve Demir Miktarı
Directory of Open Access Journals (Sweden)
Recai Ercan
2015-02-01
Full Text Available Undaki besin öğesi miktarı, randımana bağlı olarak değişmektedir. Değişik randımanlı unlardaki doğal besin öğesi miktarı, gıda zenginleştirme uygulaması açısından da önem taşımaktadır. Randımana bağlı olarak ticari unlar 6 tipe ayrılmaktadır. Değişik tip unlardaki riboflavin, tiyamin ve demir miktarını belirlemek amacıyla farklı 10 değirmenden sağlanan un örnekleri analiz edilmiştir. Bulgulara göre ekmek hammaddesi olarak kullanılan Tip 4 unlarında (%80 randıman, tiyamin miktarı 1.15-2.08 mg/kg (ortalama 1.72 mg/kg, riboflavin miktarı 0.65-0.90 mg/kg (ortalama 0.81 mg/kg, demir miktarı 12.0-29.6 mg/kg (ortalama 16.77 mg/kg arasında değişmektedir.
Clay, John R
2009-01-01
Potassium ion current in nerve membrane, I(K), has traditionally been described by I(K) = g(K)(V - E(K)), where g(K) is the K ion conductance, V is membrane potential and E(K) is the K(+) Nernst potential. This description has been unchallenged by most investigators in neuroscience since its introduction almost 60 years ago. The problem with the I(K) approximately (V - E(K)) proportionality is that it is inconsistent with the unequal distribution of K ions in the intra- and extracellular bathing media. Under physiological conditions the intracellular K(+) concentration is significantly higher than the extracellular concentration. Consequently, the slope conductance at potentials positive to E(K) cannot be the same as that for potentials negative to E(K), as the linear proportionality between I(K) and (V - E(K)) requires. Instead I(K) has a non-linear dependence on (V - E(K)) which is well described by the Goldman-Hodgkin-Katz equation. The implications of this result for K(+) channel gating and membrane excitability are reviewed in this report.
Directory of Open Access Journals (Sweden)
Emily Lau
Full Text Available Remodeling of cardiac repolarizing currents, such as the downregulation of slowly activating K+ channels (IKs, could underlie ventricular fibrillation (VF in heart failure (HF. We evaluated the role of Iks remodeling in VF susceptibility using a tachypacing HF model of transgenic rabbits with Long QT Type 1 (LQT1 syndrome.LQT1 and littermate control (LMC rabbits underwent three weeks of tachypacing to induce cardiac myopathy (TICM. In vivo telemetry demonstrated steepening of the QT/RR slope in LQT1 with TICM (LQT1-TICM; pre: 0.26±0.04, post: 0.52±0.01, P<0.05. In vivo electrophysiology showed that LQT1-TICM had higher incidence of VF than LMC-TICM (6 of 11 vs. 3 of 11, respectively. Optical mapping revealed larger APD dispersion (16±4 vs. 38±6 ms, p<0.05 and steep APD restitution in LQT1-TICM compared to LQT1-sham (0.53±0.12 vs. 1.17±0.13, p<0.05. LQT1-TICM developed spatially discordant alternans (DA, which caused conduction block and higher-frequency VF (15±1 Hz in LQT1-TICM vs. 13±1 Hz in LMC-TICM, p<0.05. Ca2+ DA was highly dynamic and preceded voltage DA in LQT1-TICM. Ryanodine abolished DA in 5 out of 8 LQT1-TICM rabbits, demonstrating the importance of Ca2+ in complex DA formation. Computer simulations suggested that HF remodeling caused Ca2+-driven alternans, which was further potentiated in LQT1-TICM due to the lack of IKs.Compared with LMC-TICM, LQT1-TICM rabbits exhibit steepened APD restitution and complex DA modulated by Ca2+. Our results strongly support the contention that the downregulation of IKs in HF increases Ca2+ dependent alternans and thereby the risk of VF.
Kämäräinen, Hanne; Farin, Katja; Luukkonen, Päivi
2012-01-01
Opinnäytetyö on palvelutalossa asuvien ikäihmisten parissa toteutettu toimintatutkimus, jonka tavoitteena oli tutkia Vanhustyön keskusliiton Ystäväpiiri-ryhmätoiminnan mahdollisuuksia tukea ikäihmisten psyykkistä hyvinvointia. Opinnäytetyössä tutkittiin ryhmäläisten kokemuksia siitä, voidaanko Ystäväpiiri-ryhmän avulla saada helpotusta koettuun mielialaan ja yksinäisyyteen. Lisäksi tavoitteena oli selvittää ryhmäläisten mielekkäiksi kokemia toimintoja sekä Ystäväpiiri-ryhmätoiminnan mahdollis...
Directory of Open Access Journals (Sweden)
john r Clay
2009-12-01
Full Text Available Potassium ion current in nerve membrane, IK, has traditionally been described by IK = gK(V-EK, where gK is the K ion conductance, V is membrane potential, and EK is the K+ Nernst potential. This description has been unchallenged by most investigators in neuroscience since its introduction almost sixty years ago. The problem with the IK ~ (V-EK proportionality is that it is inconsistent with the unequal distribution of K ions in the intra- and extracellular bathing media. Under physiological conditions the intracellular K+ concentraion is significantly higher than the extracellular concentration. Consequently, the slope conductance at potentials positive to EK cannot be the same as that for potentials negative to EK, as the linear proportionality requires. Instead IK has a non-linear dependence on (V-EK which is well described by the Goldman-Hodgkin-Katz equation. The implications of this result for K+ channel gating and membrane excitability are reviewed in this report.
DEFF Research Database (Denmark)
Johansen, A.; Knudsen, I. M. B.; Binnerup, S. J.
2005-01-01
Non-target effects of a bacterial (Pseudomonas fluorescens DR54) and a fungal (Clonostachys rosea IK726) microbial control agent (MCA), on the indigenous microbiota in bulk soil and rhizosphere of barley, and subsequent a sugar beet crop, were studied in a greenhouse experiment. MCAs were...... introduced by seed and soil inoculation. Bulk and rhizosphere soils were sampled regularly during the growth of barley and sugar beet. The soils were assayed for the fate of MCAs and various features of the indigenous soil microbiota. At the end of the experiment (193 d), DR54 and IK726 had declined...... by a factor of 106 and 20, respectively, and DR54 showed a short-lasting growth increase in the sugar beet rhizosphere. In general, the non-target effects were small and transient. IK726 seemed to have general stimulating effects on soil enzyme activity and the soil microbiota, and resulted in a significant...
Stimmelmayr, R.; Adams, B.; Harcharek, Q.; Pederson, M.; Brower, H., Jr.; Hepa, T.
2017-12-01
Hunter observations and many studies indicate that the Arctic is undergoing major changes in duration of seasonal sea ice extent and thickness, extreme weather patterns, more maritime traffic etc. Coupled to these environmental changes are noted changes in animal distribution, in migration routes and timing, in breeding season start, and arrival of new species to name just a few. The continuation of all these changes could negatively impact the rich marine mammal resources that are essential to Yupik and Iñupiat subsistence communities. The North Slope Borough Department of wildlife management community based marine mammal health research program aims to support the families and communities, as they, as in the past, continue to adapt to changing environmental conditions, changes in wildlife abundance and accessibility. Our program monitors the health of animals so we can detect diseases and contaminants early on that are of concern to people, provide veterinary medicine science based information to hunters regarding "healthy" and "hunter concern" catches, and address individual and "big picture" concerns about native food health and food security. Our collaborative work depends on IK and the sharing of knowledge. IK is an existing source of an integrated object and event-based data knowledge system with culturally rooted quantitative and qualitative aspects. It is characterized by built-in routine and periodic updating and comparison within a given spatial-temporal coverage (traditional use areas). It is the oldest on the ground wildlife health monitoring system of the Arctic. Hunters and communities provide in a meaningful spatial-temporal scale rich wildlife information and data on traditional subsistence resources. The IK based interpretation of ecological, physiological, behavioral, and pathological phenomena advances and expands western science based biological concepts.
Farklı Vinifikasyon Tekniklerinin Kalecik Karası Şaraplarındaki Fenolik Bileşik İçeriklerine Etkisi
Directory of Open Access Journals (Sweden)
Hande Tahmaz
2015-02-01
Full Text Available Fenolik bileşikler şaraba duyusal özelliklerini katmakla beraber, insan sağlığı açısından yararları olduğu bilinen bileşiklerdir ve miktarları vinifikasyon tekniklerine göre değişiklik göstermektedir. Bu araştırmada Kalecik Karası üzüm çeşidinden termovinifikasyon ve soğuk maserasyon uygulamaları ile elde edilen şaraplarda toplam antosiyanin, toplam fenolik bileşik, antioksidan aktivite, kateşin, epikateşin, rutin, trans-resveratrol ve cis-resveratrol miktarlarının belirlenmesi amaçlanmıştır. Araştırmanın bitkisel materyalini oluşturan Kalecik Karası üzüm çeşidi, Ankara Üniversitesi Ziraat Fakültesi Kalecik Bağcılık Araştırma ve Uygulama İstasyonu’nda bulunan bağdan 1,100 dansitede hasat edilmiştir. Soğuk maserasyon ve termovinifikasyon uygulamaları öncesi üzümler şaraba işlenmeden önce 72 saat soğuk hava deposunda tutulmuşlar ve sırası ile 1,116 ve 1,115 dansitede şaraba işlenmişlerdir. Araştırma sonucunda soğuk maserasyon uygulamasının fenolik bileşik içeriklerinde düşüşe sebep olduğu, termovinifikasyon uygulamasının ise şaraplarda antioksidan aktivite, toplam fenolik bileşik, kateşin, rutin ve trans-resveratrol içeriklerini artırdığı tespit edilmiştir.
Directory of Open Access Journals (Sweden)
Adhi Susatyo
2017-11-01
Full Text Available IK-Tech merupakan home industry yang bergerak dalam pembuatan PCB. Proses produksi di IK-Tech masih dengan proses manual, terutama pada proses pelarutan PCB (proses Etching. Proses Etching di IK-Tech tumpah, proses yang lama dan penggunaan yang tidak ergonomis karena operator bekerja dengan menggunakan alat yang seadanya berupa nampan, sehingga dalam proses pelarutan, terdapat banyak kekurangan seperti pelarut mudah posisi jongkok membungkuk. Gerakan kerja yang berulang-ulang dengan frekuensi yang sering, mengakibatkan operator tidak nyaman dalam bekerja dan mudah lelah. Oleh karena itu, perlu dilakukan perbaikan dalam proses Etching yaitu merancang fasilitas kerja. Pada penelitian ini, dirancang fasilitas kerja dengan pendekatan Quality Function Deployment. Metode ini bertujuan mengakomodasi perancangan fasilitas kerja berdasakan kebutuhan pengguna. Selain itu, pendekatan ergonomis pada perancangan fasilitas kerja untuk memperkecil beban kerja operator sehingga menciptakan rasa nyaman dan aman bagi operator dalam bekerja. Berdasarkan hasil analisis dan pengolahan data, enumeration persentase keluhan operator sebelum perancangan sebesar 7% keluhan sakit, setelah perancangan turun menjadi 0% (tidak ada keluhan sakit. Rekapitulasi waktu pelarutan sebelum perancangan sebesar 22,66 menit/unit, waktu pelarutan setelah perancangan (penggunaan manual sebesar 13,66 menit/unit dan waktu pelarutan setelah perancangan (penggunaan otomatis sebesar 11,37 menit/unit. Dari rekap waktu pelarutan, diketahui penurunan waktu pelarutan sebelum dan setelah perancangan (penggunaan manual sebesar 39,72 %, penurunan waktu pelarutan sebelum dan setelah perancangan (penggunaan otomatis sebesar 49,82 %.
DEFF Research Database (Denmark)
Lübeck, M.; Knudsen, I.M.B.; Jensen, B.
2002-01-01
Marker genes were introduced in the biocontrol strain Clonostachys rosea IK726 (IBT 9371) as a tool for monitoring the strain in ecological studies. The beta-glucuronidase (GUS) reporter gene and a gene encoding the green fluorescent protein (GFP) were, in separate experiments, integrated into th...
Lebbad, Marianne; Winiecka-Krusnell, Jadwiga; Insulander, Mona; Beser, Jessica
2018-05-01
Cryptosporidium hominis is considered a strictly human-adapted species, and it is only occasionally diagnosed in animals. However, two variants, C. hominis monkey genotype and C. hominis Ik, were originally described in non-human hosts, monkeys and horses, respectively. During a Swedish national Cryptosporidium study, where all samples were analyzed at the small subunit rRNA and the 60 kDa (gp60) glycoprotein loci, we identified two patients infected with C. hominis monkey genotype (subtype IiA17) and two infected with C. hominis subtype IkA18G1. The isolates were further analyzed at the actin and the 70 kDa heat shock protein loci, and these analyses showed that these two subtype families are closely related to each other and to human-adapted C. hominis as well as to Cryptosporidium cuniculus. The two patients with C. hominis monkey genotype infection (a father and son) had visited a monkey farm in Thailand prior to infection, while the two cases with C. hominis Ik were unrelated, both probably infected in Sweden. This is the first time that a monkey genotype infection in humans has been related to contact with monkeys and where the gp60 subtype was identified. It is also the first time that human infection caused by C. hominis subtype Ik is described. Even though we were not able to detect any parasites in the animal samples, zoonotic transmission cannot be ruled out in any of these cases because both subtype families are regarded as animal adapted. Copyright © 2018 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Fatma SUSAR KIRMIZI
2013-09-01
Full Text Available This study aimed to identify teachers’ views with regard toteaching basal reading and writing with cursive italic writing and basicvertical letters. Action research that is one of the qualitative researchmethods was employed. The population of the study was consisted ofelementary 1st and 2nd graders’ teachers working in Denizli and itsdistricts. Using criterion sampling, 68 elementary teachers were askedfor their opinions. As for the data gathering instrument a survey ofopen-ended six questions developed by the researchers were used in thestudy. Open-coding method was used for data analysis. As a result ofthe analysis, it was seen that the teachers found teaching with basicvertical letters easier both in preparing students for reading and writingand in teaching writing. Furthermore, they argued that with basicvertical letters, students write more beautiful and legible. Most of theteachers participated in the study preferred basic vertical letters justbecause they found cursive italic writing more difficult in teaching basalreading and writing. A comprehensive training related to cursive italicwriting should be provided to teachers. Wider scale studies focusing onwhether teachers prefer cursive italic writing or basic vertical letters inteaching basal reading and writing. Bu araştırma ile öğretmenlerin ilkokuma yazma öğretimi sürecinde bitişik eğik yazı ve dik temel harflerle yapılan eğitim hakkındaki görüşlerinin belirlenmesi amaçlanmıştır. Çalışma sürecinde nitel araştırma yöntemlerinden olan durum çalışması deseni benimsenmiştir. Çalışmanın evreni Denizli il ve ilçelerindeki ilkokullarda görev yapan 1. ve 2. sınıf öğretmenlerinden oluşmaktadır. Araştırmada ölçüt örnekleme yöntemi ile belirlenen 63 kişiden oluşan 1. ve 2. sınıf öğretmeninin görüşüne başvurulmuştur. Veri toplama aracı olarak araştırmacılar tarafından geliştirilen kişisel bilgiler formu ve 6 açık u
DEFF Research Database (Denmark)
Nissen, Jakob Dahl; Diness, Jonas Goldin; Diness, Thomas Goldin
2009-01-01
of this study was to evaluate potential antiarrhythmic effects of compound induced IKs activation using the benzodiazepine L-364,373 (R-L3). Ventricular myocytes from guinea pigs were isolated and whole-cell current clamping was performed at 35 degrees C. It was found that 1 microM R-L3 significantly reduced...
DEFF Research Database (Denmark)
Tang, Chuyi; Skibsbye, Lasse; Yuan, Lei
2015-01-01
Although several physiological, pathophysiological and regulatory properties of classical inward rectifier K+ current I(K1), G-protein coupled inwardly-rectifying K+ current I(K,ACh) and the small-conductance Ca2+ activated K+ current I(K,Ca) have been identified, quantitative biophysical details...
Directory of Open Access Journals (Sweden)
Ranford-Cartwright Lisa
2009-05-01
Full Text Available Abstract Background Post-transcriptional control of gene expression is suspected to play an important role in malaria parasites. In yeast and metazoans, part of the stress response is mediated through phosphorylation of eukaryotic translation initiation factor 2α (eIF2α, which results in the selective translation of mRNAs encoding stress-response proteins. Methods The impact of starvation on the phosphorylation state of PfeIF2α was examined. Bioinformatic methods were used to identify plasmodial eIF2α kinases. The activity of one of these, PfeIK1, was investigated using recombinant protein with non-physiological substrates and recombinant PfeIF2α. Reverse genetic techniques were used to disrupt the pfeik1 gene. Results The data demonstrate that the Plasmodium falciparum eIF2α orthologue is phosphorylated in response to starvation, and provide bioinformatic evidence for the presence of three eIF2α kinases in P. falciparum, only one of which (PfPK4 had been described previously. Evidence is provided that one of the novel eIF2α kinases, PfeIK1, is able to phosphorylate the P. falciparum eIF2α orthologue in vitro. PfeIK1 is not required for asexual or sexual development of the parasite, as shown by the ability of pfeik1- parasites to develop into sporozoites. However, eIF2α phosphorylation in response to starvation is abolished in pfeik1- asexual parasites Conclusion This study strongly suggests that a mechanism for versatile regulation of translation by several kinases with a similar catalytic domain but distinct regulatory domains, is conserved in P. falciparum.
Estimation of Outage Capacity for Free Space Optical Links Over I-K and K Turbulent Channels
Directory of Open Access Journals (Sweden)
D. Marinos
2011-06-01
Full Text Available The free space optical communication systems are attracting great research and commercial interest due to their capability of transferring data, over short distances, with high rate and security, low cost demands and without licensing fees. However, their performance depends strongly on the atmospheric conditions in the link’s area. In this work, we investigate the influence of the turbulence on the outage capacity of such a system for weak to strong turbulence channels modeled by the I-K and the K-distribution and we derive closed-form expressions for its estimation. Finally, using these expressions we present numerical results for various link cases with different turbulence conditions.
Basit Doğrusal Regresyon Analizi İle Hiyerarşik Doğrusal Modeller Analizinin Karşılaştırılması
ATAR, Burcu
2014-01-01
Hiyerarşik veya iç içe geçmiş yapıdaki verilere birçok araştırma alanında rastlanmaktadır. Eğitim alanında öğrenciler, sınıf, okul, şehir, ülke gibi hiyerarşik bir sosyal yapının içinde yer alırlar. Bu yapıdaki bir veride aynı sınıftaki veya okuldaki öğrenciler, evrenden rasgele seçilen öğrencilere göre birbirlerine daha benzer özellikler gösterirler. O halde, aynı sosyal birimde yer alan bireylerden elde edilen gözlemlerin birbirinden tamamen bağımsız olduğu söylenemez. Halbuki doğrusal regr...
DEFF Research Database (Denmark)
Hoeker, Gregory S; Skarsfeldt, Mark A; Jespersen, Thomas
2017-01-01
in Langendorff-perfused guinea pig hearts. PA-6 (200 nm) or vehicle was perfused into ex-vivo guinea pig hearts for 60 min. Hearts were optically mapped with di-4-ANEPPS to quantify CV and APD at 90% repolarization (APD90). Ventricular APD90was significantly prolonged in hearts treated with PA-6 (115 ± 2...... APD90to a lesser degree, but profoundly increased CV Thus, in intact guinea pig hearts, the electrophysiologic effects of the IK1inhibitor, PA-6, are [K+]o-dependent....
A Test Stand for Ion Sources of Ultimate Reliability
International Nuclear Information System (INIS)
Enparantza, R.; Uriarte, L.; Romano, P.; Alonso, J.; Ariz, I.; Egiraun, M.; Bermejo, F. J.; Etxebarria, V.; Lucas, J.; Del Rio, J. M.; Letchford, A.; Faircloth, D.; Stockli, M.
2009-01-01
The rationale behind the ITUR project is to perform a comparison between different kinds of H - ion sources using the same beam diagnostics setup. In particular, a direct comparison will be made in terms of the emittance characteristics of Penning Type sources such as those currently in use in the injector for the ISIS (UK) Pulsed Neutron Source and those of volumetric type such as that driving the injector for the ORNL Spallation Neutron Source (TN, U.S.A.). The endeavour here pursued is thus to build an Ion Source Test Stand where virtually any type of source can be tested and its features measured and, thus compared to the results of other sources under the same gauge. It would be possible then to establish a common ground for effectively comparing different ion sources. The long term objectives are thus to contribute towards building compact sources of minimum emittance, maximum performance, high reliability-availability, high percentage of desired particle production, stability and high brightness. The project consortium is lead by Tekniker-IK4 research centre and partners are companies Elytt Energy and Jema Group. The technical viability is guaranteed by the collaboration between the project consortium and several scientific institutions, such the CSIC (Spain), the University of the Basque Country (Spain), ISIS (STFC-UK), SNS (ORNL-USA) and CEA in Saclay (France).
Lithuania's new Cold War / Egdunas Racius
Racius, Egdunas
2004-01-01
Autori hinnangul varjutavad Leedu poliitikat jätkuvalt külma sõja aegsed arusaamad ja Leedu poliitilises spektris suudetakse eristada vaid kahte rühma - läänemeelseid ja venemeelseid poliitikuid
Role of an inward rectifier K+ current and of hyperpolarization in human myoblast fusion
Liu, J-H; Bijlenga, P; Fischer-Lougheed, J; Occhiodoro, T; Kaelin, A; Bader, C R; Bernheim, L
1998-01-01
The role of K+ channels and membrane potential in myoblast fusion was evaluated by examining resting membrane potential and timing of expression of K+ currents at three stages of differentiation of human myogenic cells: undifferentiated myoblasts, fusion-competent myoblasts (FCMBs), and freshly formed myotubes. Two K+ currents contribute to a hyperpolarization of myoblasts prior to fusion: IK(NI), a non-inactivating delayed rectifier, and IK(IR), an inward rectifier. IK(NI) density is low in undifferentiated myoblasts, increases in FCMBs and declines in myotubes. On the other hand, IK(IR) is expressed in 28 % of the FCMBs and in all myotubes. IK(IR) is reversibly blocked by Ba2+ or Cs+. Cells expressing IK(IR) have resting membrane potentials of −65 mV. A block by Ba2+ or Cs+ induces a depolarization to a voltage determined by IK(NI) (−32 mV). Cs+ and Ba2+ ions reduce myoblast fusion. It is hypothesized that the IK(IR)-mediated hyperpolarization allows FCMBs to recruit Na+, K+ and T-type Ca2+ channels which are present in these cells and would otherwise be inactivated. FCMBs, rendered thereby capable of firing action potentials, could amplify depolarizing signals and may accelerate fusion. PMID:9705997
Chung, Wendy K; Patki, Amit; Matsuoka, Naoki; Boyer, Bert B; Liu, Nianjun; Musani, Solomon K; Goropashnaya, Anna V; Tan, Perciliz L; Katsanis, Nicholas; Johnson, Stephen B; Gregersen, Peter K; Allison, David B; Leibel, Rudolph L; Tiwari, Hemant K
2009-01-01
Human adiposity is highly heritable, but few of the genes that predispose to obesity in most humans are known. We tested candidate genes in pathways related to food intake and energy expenditure for association with measures of adiposity. We studied 355 genetic variants in 30 candidate genes in 7 molecular pathways related to obesity in two groups of adult subjects: 1,982 unrelated European Americans living in the New York metropolitan area drawn from the extremes of their body mass index (BMI) distribution and 593 related Yup'ik Eskimos living in rural Alaska characterized for BMI, body composition, waist circumference, and skin fold thicknesses. Data were analyzed by using a mixed model in conjunction with a false discovery rate (FDR) procedure to correct for multiple testing. After correcting for multiple testing, two single nucleotide polymorphisms (SNPs) in Ghrelin (GHRL) (rs35682 and rs35683) were associated with BMI in the New York European Americans. This association was not replicated in the Yup'ik participants. There was no evidence for gene x gene interactions among genes within the same molecular pathway after adjusting for multiple testing via FDR control procedure. Genetic variation in GHRL may have a modest impact on BMI in European Americans.
Bersamin, Andrea; Wolsko, Christopher; Luick, Bret R; Boyer, Bert B; Lardon, Cecile; Hopkins, Scarlett E; Stern, Judith S; Zidenberg-Cherr, Sheri
2014-06-01
American Indians and Alaska Natives (ANs) report among the lowest levels of physical activity in the USA, but there is very little systematic research examining the determinants of physical activity patterns in these populations. This study investigated the relationships between enculturation (or cultural traditionality), psychosocial stress, and physical activity in a community-based sample of Yup'ik women and men living in rural AN communities. Associations between these variables and several metabolic risk factors were also examined. A sample of 488 Yup'ik participants (284 women and 204 men) from six villages in the Yukon-Kuskokwim Delta region completed a wellness survey and an array of physiological assessments [e.g., body mass index (BMI), blood pressure]. A subset of 179 participants also completed a 3-day pedometer assessment of physical activity. Multivariate linear regression models indicated that participants who were more enculturated (i.e., living more of a traditional lifestyle) and who experienced lower levels of psychosocial stress were significantly more physically active. In turn, both lower levels of psychosocial stress and higher levels of physical activity were associated with lower BMI, lower percent body fat, and lower waist circumference. Findings underscore the importance of gaining a culturally specific understanding of physical activity patterns in indigenous groups in order to inform effective health promotion strategies.
CSIR Research Space (South Africa)
Nhemachena, C
2011-07-01
Full Text Available INDIGENOUS KNOWLEDGE SYSTEMS (IKS) IN IMPROVING RURAL ACCESSIBILITY AND MOBILITY (IN SUPPORT OF THE COMPREHENSIVE RURAL DEVELOPMENT PROGRAMME IN SOUTH AFRICA) CHARLES NHEMACHENA1, JAMES CHAKWIZIRA2, SIPHO DUBE1, GOODHOPE MAPONYA1, REMINA RASHOPOLA3... of Environmental Sciences, Private Bag X5050, Thohoyandou, 0950 3 Department of Rural Development and Land Reform, PO Box X833, Pretoria 0001 ABSTRACT This study discusses opportunities and challenges for integrating local knowledge in improving...
Ishihara, Keiko; Ehara, Tsuguhisa
2004-04-01
The strong inward rectifier K(+) current, I(K1), shows significant outward current amplitude in the voltage range near the reversal potential and thereby causes rapid repolarization at the final phase of cardiac action potentials. However, the mechanism that generates the outward I(K1) is not well understood. We recorded currents from the inside-out patches of HEK 293T cells that express the strong inward rectifier K(+) channel Kir2.1 and studied the blockage of the currents caused by cytoplasmic polyamines, namely, spermine and spermidine. The outward current-voltage (I-V) relationships of Kir2.1, obtained with 5-10 microm spermine or 10-100 microm spermidine, were similar to the steady-state outward I-V relationship of I(K1), showing a peak at a level that is approximately 20 mV more positive than the reversal potential, with a negative slope at more positive voltages. The relationships exhibited a plateau or a double-hump shape with 1 microm spermine/spermidine or 0.1 microm spermine, respectively. In the chord conductance-voltage relationships, there were extra conductances in the positive voltage range, which could not be described by the Boltzmann relations fitting the major part of the relationships. The extra conductances, which generated most of the outward currents in the presence of 5-10 microm spermine or 10-100 microm spermidine, were quantitatively explained by a model that considered two populations of Kir2.1 channels, which were blocked by polyamines in either a high-affinity mode (Mode 1 channel) or a low-affinity mode (Mode 2 channel). Analysis of the inward tail currents following test pulses indicated that the relief from the spermine block of Kir2.1 consisted of an exponential component and a virtually instantaneous component. The fractions of the two components nearly agreed with the fractions of the blockages in Mode 1 and Mode 2 calculated by the model. The estimated proportion of Mode 1 channels to total channels was 0.9 with 0.1-10 microm
Fohner, Alison E; Wang, Zhican; Yracheta, Joseph; O'Brien, Diane M; Hopkins, Scarlett E; Black, Jynene; Philip, Jacques; Wiener, Howard W; Tiwari, Hemant K; Stapleton, Patricia L; Tsai, Jesse M; Thornton, Timothy A; Boyer, Bert B; Thummel, Kenneth E
2016-02-01
Low blood vitamin D concentration is a concern for people living in circumpolar regions, where sunlight is insufficient for vitamin D synthesis in winter months and the consumption of traditional dietary sources of vitamin D is decreasing. The objective was to characterize the effects of diet, genetic variation, and season on serum 25-hydroxycholecalciferol [25(OH)D3] concentrations in Yup'ik Alaska Native people living in rural southwest Alaska. This study was a cross-sectional design that assessed the associations of traditional diet (via a biomarker, the RBC δ(15)N value), age, gender, body mass index (BMI), community location, and genotype of select single nucleotide polymorphisms (SNPs) in cytochrome P450 family 2, subfamily R, peptide 1 (CYP2R1), 7-dehydrocholesterol reductase (DHCR7), and vitamin D binding protein (GC) with serum 25(OH)D3 concentrations in 743 Yup'ik male and female participants, aged 14-93 y, recruited between September 2009 and December 2013. Yup'ik participants, on average, had adequate concentrations of serum 25(OH)D3 (31.1 ± 1.0 ng/mL). Variations in diet, BMI, age, gender, season of sample collection, and inland or coastal community geography were all significantly associated with serum 25(OH)D3 concentration. In models not adjusting for other covariates, age, diet, and seasonal effects explained 33.7%, 20.7%, and 9.8%, respectively, of variability in serum 25(OH)D3 concentrations. Of the 8 SNPs interrogated in CYP2R1 and DHCR7, only rs11023374 in CYP2R1 was significantly associated with serum 25(OH)D3, explaining 1.5% of variability. The GC haplotype explained an additional 2.8% of variability. Together, age, diet, gender, season of sample collection, BMI, geography of the community, and genotype at rs11023374 explained 52.5% of the variability in serum 25(OH)D3 concentrations. Lower consumption of the traditional diet was associated with lower serum concentrations of 25(OH)D3. Younger adults and youth in this community may be at
"Parīzes šiks" mūsdienu restorānu interjera dizainā
Kalnarāja, Agnese
2015-01-01
Diplomdarbā “Parīzes šiks mūsdienu restorānu interjera dizainā” sastāv no piecām nodaļām. Pirmajā nodaļā tiek aprakstīta Parīzes arhitektūras un interjera dizaina vēsture, tā ietekme uz “Parīzes šika” veidošanos, kā arī pētīta restorānu vēsture. Otrajā nodaļā tiek pētīti elementi, kas raksturo “Parīzes šika” interjeru. Trešajā nodaļā tiek analizēti un aprakstīti psiholoģiskie faktori, kas ietekmē restorānu dizainu – apgaismojums, krāsu lietojums un atmosfēras nozīme interjerā. Empīriskajā...
Fohner, Alison E; Wang, Zhican; Yracheta, Joseph; O’Brien, Diane M; Hopkins, Scarlett E; Black, Jynene; Philip, Jacques; Wiener, Howard W; Tiwari, Hemant K; Stapleton, Patricia L; Tsai, Jesse M; Thornton, Timothy A; Boyer, Bert B; Thummel, Kenneth E
2016-01-01
Background: Low blood vitamin D concentration is a concern for people living in circumpolar regions, where sunlight is insufficient for vitamin D synthesis in winter months and the consumption of traditional dietary sources of vitamin D is decreasing. Objective: The objective was to characterize the effects of diet, genetic variation, and season on serum 25-hydroxycholecalciferol [25(OH)D3] concentrations in Yup’ik Alaska Native people living in rural southwest Alaska. Methods: This study was a cross-sectional design that assessed the associations of traditional diet (via a biomarker, the RBC δ15N value), age, gender, body mass index (BMI), community location, and genotype of select single nucleotide polymorphisms (SNPs) in cytochrome P450 family 2, subfamily R, peptide 1 (CYP2R1), 7-dehydrocholesterol reductase (DHCR7), and vitamin D binding protein (GC) with serum 25(OH)D3 concentrations in 743 Yup’ik male and female participants, aged 14–93 y, recruited between September 2009 and December 2013. Results: Yup’ik participants, on average, had adequate concentrations of serum 25(OH)D3 (31.1 ± 1.0 ng/mL). Variations in diet, BMI, age, gender, season of sample collection, and inland or coastal community geography were all significantly associated with serum 25(OH)D3 concentration. In models not adjusting for other covariates, age, diet, and seasonal effects explained 33.7%, 20.7%, and 9.8%, respectively, of variability in serum 25(OH)D3 concentrations. Of the 8 SNPs interrogated in CYP2R1 and DHCR7, only rs11023374 in CYP2R1 was significantly associated with serum 25(OH)D3, explaining 1.5% of variability. The GC haplotype explained an additional 2.8% of variability. Together, age, diet, gender, season of sample collection, BMI, geography of the community, and genotype at rs11023374 explained 52.5% of the variability in serum 25(OH)D3 concentrations. Conclusions: Lower consumption of the traditional diet was associated with lower serum concentrations of 25(OH
Farley, J; Auerbach, S
Phosphorylation of ion channels has been suggested as one molecular mechanism responsible for learning-produced long-term changes in neuronal excitability. Persistent training-produced changes in two distinct K+ currents (IA (ref. 2), IK-Ca (refs 3,4)) and a voltage-dependent calcium current (ICa; refs 3,4) have previously been shown to occur in type B photoreceptors of Hermissenda, as a result of associative learning. But the identity of the phosphorylation pathway(s) responsible for these changes has not as yet been determined. Injections of cyclic AMP-dependent protein kinase reduce a K+ current (IK) in B cells which is different from those changed by training, but fails to reduce IA and IK-Ca. Phosphorylase b kinase (an exogenous calcium/calmodulin-dependent kinase) reduces IA, but whether IK-Ca and ICa are changed in the manner of associative training is not yet known. Another protein kinase present in high concentrations in both mammalian brain and molluscan nervous systems is protein kinase C, which is both calcium- and phospholipid-sensitive. We now present evidence that activation of protein kinase C by the tumour promoter phorbol ester (PDB) and intracellular injection of the enzyme induce conductance changes similar to those caused by associative training in Hermissenda B cells (that is a reduction of IA and IK-Ca, and enhancement of ICa). These results represent the first direct demonstration that protein kinase C affects membrane K+ ion conductance mechanisms.
Cubeddu, Luigi X.
2016-01-01
Risk of severe and fatal ventricular arrhythmias, presenting as Torsade de Pointes (TdP), is increased in congenital and acquired forms of long QT syndromes (LQTS). Drug-induced inhibition of K+ currents, IKs, IKr, IK1, and/or Ito, delay repolarization, prolong QT, and increase the risk of TdP. Drug-induced interference with IKr is the most common cause of acquired LQTS/TdP. Multiple drugs bind to KNCH2-hERG-K+ channels affecting IKr, including antiarrythmics, antibiotics, antivirals, azole-antifungals, antimalarials, anticancer, antiemetics, prokinetics, antipsychotics, and antidepressants. Azithromycin has been recently added to this list. In addition to direct channel inhibition, some drugs interfere with the traffic of channels from the endoplasmic reticulum to the cell membrane, decreasing mature channel membrane density; e.g., pentamidine, geldalamicin, arsenic trioxide, digoxin, and probucol. Other drugs, such as ketoconazole, fluoxetine, norfluoxetine, citalopram, escitalopram, donepezil, tamoxifen, endoxifen, atazanavir, and roxitromycin, induce both direct channel inhibition and impaired channel trafficking. Although many drugs prolong the QT interval, TdP is a rare event. The following conditions increase the risk of drug-induced TdP: a) Disease states/electrolyte levels (heart failure, structural cardiac disease, bradycardia, hypokalemia); b) Pharmacogenomic variables (presence of congenital LQTS, subclinical ion-channel mutations, history of or having a relative with history of drug-induced long QT/TdP); c) Pharmacodynamic and kinetic factors (high doses, women, elderly, metabolism inhibitors, combining two or more QT prolonging drugs, drugs that prolong the QT and increase QT dispersion, and drugs with multiple actions on ion channels). Because most of these conditions are preventable, careful evaluation of risk factors and increased knowledge of drug use associated with repolarization abnormalities are strongly recommended. PMID:26926294
DEFF Research Database (Denmark)
Baatrup, Gunnar; Petersen, Ivan; Svehag, Svend-Erik
1984-01-01
The complement-mediated solubilization (CMS) of immune complexes (IC) and the initial kinetics (IKS) of this reaction in human sera depleted of or deficient in C2, C3, C8, factors B, P and I were investigated. Sera depleted of B or P and those lacking native C3 or factor I showed virtually no CMS......M. Chelation of Ca2+ in serum by Mg2+-ethylene glycol tetraacetic acid reduced the CMS capacity by up to 50% and the IKS was markedly retarded. Varying the Zn2+ or Mn2+ ion concentrations in serum influenced neither the IKS nor the CMS capacity....
DEFF Research Database (Denmark)
Mamarabadi, Mojtaba; Jensen, Birgit; Jensen, Søren Dan Funck
2008-01-01
Clonostachys rosea is a well-known biocontrol agent against Botrytis cinerea, the causal agent of gray mold in strawberry. The activity of cell wall-degrading enzymes might play a significant role for successful biocontrol by C. rosea. The expression pattern of four chitinases, and two endoglucan......Clonostachys rosea is a well-known biocontrol agent against Botrytis cinerea, the causal agent of gray mold in strawberry. The activity of cell wall-degrading enzymes might play a significant role for successful biocontrol by C. rosea. The expression pattern of four chitinases, and two...... endoglucanase genes from C. rosea strain IK726 was analyzed using real-time RT-PCR in vitro and in strawberry leaves during interaction with B. cinerea. Specific primers were designed for ß-tubulin genes from C. rosea and B. cinerea, respectively, and a gene encoding a DNA-binding protein (DBP) from strawberry......, allowing in situ activity assessment of each fungus in vitro and during their interaction on strawberry leaves. Growth of B. cinerea was inhibited in all pathogen-antagonist interactions while the activity of IK726 was slightly increased. In all in vitro interactions, four of the six genes were upregulated...
Development of an instrument for assessing workstyle in checkout cashier work (BAsIK).
Kjellberg, Katarina; Palm, Peter; Josephson, Malin
2012-01-01
Checkout cashier work consists of handling a large number of items during a work shift, which implies repetitive movements of the shoulders, arms and hands/wrists, and a high work rate. The work is associated with a high prevalence of disorders in the neck and upper extremity. The concept of workstyle explains how ergonomic and psychosocial factors interact in the development of work-related upper extremity disorders. The aim of the project was to develop an instrument for the occupational health services to be used in the efforts to prevent upper extremity disorders in checkout cashier work. The instrument is based on the workstyle concept and is intended to be used as a tool to identify high-risk workstyle and needs for interventions, such as training and education. The instrument, BAsIK, consists of four parts; a questionnaire about workstyle, an observation protocol for work technique, a checklist about the design of the checkout and a questionnaire about work organization. The instrument was developed by selecting workstyle items developed for office work and adapting them to checkout cashier work, discussions with researchers and ergonomists, focus-group interviews with cashiers, observations of video recordings of cashiers, and studies of existing guidelines and checklists.
Szentandrássy, N; Farkas, V; Bárándi, L; Hegyi, B; Ruzsnavszky, F; Horváth, B; Bányász, T; Magyar, J; Márton, I; Nánási, P P
2012-10-01
Although isoprenaline (ISO) is known to activate several ion currents in mammalian myocardium, little is known about the role of action potential morphology in the ISO-induced changes in ion currents. Therefore, the effects of ISO on action potential configuration, L-type Ca²⁺ current (I(Ca)), slow delayed rectifier K⁺ current (I(Ks)) and fast delayed rectifier K⁺ current (I(Kr)) were studied and compared in a frequency-dependent manner using canine isolated ventricular myocytes from various transmural locations. Action potentials were recorded with conventional sharp microelectrodes; ion currents were measured using conventional and action potential voltage clamp techniques. In myocytes displaying a spike-and-dome action potential configuration (epicardial and midmyocardial cells), ISO caused reversible shortening of action potentials accompanied by elevation of the plateau. ISO-induced action potential shortening was absent in endocardial cells and in myocytes pretreated with 4-aminopyridine. Application of the I(Kr) blocker E-4031 failed to modify the ISO effect, while action potentials were lengthened by ISO in the presence of the I(Ks) blocker HMR-1556. Both action potential shortening and elevation of the plateau were prevented by pretreatment with the I(Ca) blocker nisoldipine. Action potential voltage clamp experiments revealed a prominent slowly inactivating I(Ca) followed by a rise in I(Ks) , both currents increased with increasing the cycle length. The effect of ISO in canine ventricular cells depends critically on action potential configuration, and the ISO-induced activation of I(Ks) - but not I(Kr) - may be responsible for the observed shortening of action potentials. © 2012 The Authors. British Journal of Pharmacology © 2012 The British Pharmacological Society.
Albrecht, A; Levenson, B; Göhring, S; Haerer, W; Reifart, N; Ringwald, G; Troger, B
2009-10-01
QuIK is the German acronym for QUality Assurance in Invasive Cardiology. It describes the continuous project of an electronic data collection in Cardiac catheterization laboratories all over Germany. Mainly members of the German Society of Cardiologists in Private Practice (BNK) participate in this computer based project. Since 1996 data of diagnostic and interventional procedures are collected and send to a registry-center where a regular benchmarking analysis of the results is performed. Part of the project is a yearly auditing process including an on-site visit to the cath lab to guarantee for the reliability of information collected. Since 1996 about one million procedures have been documented. Georg Thieme Verlag KG Stuttgart , New York.
International Nuclear Information System (INIS)
Bykov, Yu A; Krastelev, E G; Sedin, A A; Feduschak, V F
2017-01-01
A low-inductance module of a high-current capacitive energy storage with an operating voltage of 40 kV is developed. The design of the module is based on the application of capacitive sections of the industrial condenser IK50-3. The module includes two capacitors of 0.35 μF each, one common low-jitter triggered gas switch and 2 groups of output cables of 4 from each capacitor. A bus bars topology developed for the switch and cables connections provides a small total inductance of the discharge circuit, for the module with the output cables KVIM of 0.5 m long, it is lower than 40 nH. The set of 10 modules is now used for driving the 20 stages linear transformer for a fast charging of the pulse forming line of the high-current nanosecond accelerator. A design of the module and the results of tests of a single module and a set of 10 are presented. (paper)
Pharmacological exploration of the resting membrane potential reserve
DEFF Research Database (Denmark)
van der Heyden, Marcel A G; Jespersen, Thomas
2016-01-01
as well as by exchangers and pumps. This review will focus on the relative and regulated contribution of IK1, IK,ACh and IK,Ca, and on pharmacological modification of the channels underlying these currents in respect to the resting membrane potential, Na(+) channel availability and atrial......The cardiac action potential arises and spreads throughout the myocardium as a consequence of highly organized spatial and temporal expression of ion channels conducting Na(+), Ca(2+) or K(+) currents. The cardiac Na(+) current is responsible for the initiation and progression of the action...... potential. Altered Na(+) current has been found implicated in a number of different arrhythmias, including atrial fibrillation. In the atrium, the resting membrane potential is more depolarized than in the ventricles, and as cardiac Na(+) channels undergo voltage-dependent inactivation close...
Chiang, Nai-Jung; Wu, Sheng-Nan; Chen, Li-Tzong
2015-04-01
NVP-AUY922 (AUY) is a potent inhibitor of heat shock protein 90 (HSP90). Whether this compound can exert additional effects on membrane ion channels remains elusive. We investigated the effect of AUY on ion currents in human pancreatic duct epithelial cells (PDECs), including PANC-1 and MIA PaCa-2. AUY increased the amplitude of the K(+) current (IK) in PANC-1 cells shown by whole-cell configuration. Single-channel recordings revealed a large-conductance Ca(2+)-activated K(+) (BKCa) channel in PANC-1, but not in MIA PaCa-2. In cell-attached mode, AUY increased the probability of BKCa channel opening and also potentiated the activity of stretch-induced channels. However, other HSP inhibitors, 17-AAG or BIIB021 only slightly increased the activity of BKCa channels. In inside-out recordings, sodium hydrosulphide or caffeic acid phenethyl ester increased the activity of BKCa channels, but AUY did not. We further evaluated whether conductance of Ca(2+)-activated K(+) channels (IK(Ca)) influenced secretion of HCO3(-) and fluid in PDECs by using a modified Whitcomb-Ermentrout model. Simulation studies showed that an increase in IK(Ca) resulted in additional secretion of HCO3(-) and fluid by mimicking the effect of AUY in PDECs. Collectively, AUY can interact with the BKCa channel to largely increase IK(Ca) in PDECs. Copyright © 2015 The Authors. Production and hosting by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Supriyadi Supriyadi
2016-06-01
Full Text Available Persaingan industri kertas semakin ketat dengan banyaknya industri atau perusahaan yang bergerak dalam industri yang sama dalam bersaing mendapatkan dan mempertahankan pelanggan. Permasalahan yang terjadi saat ini di CaCO3 Section pada Perusahaan Kertas adalah belum tersedianya jadwal induk produksi (Master Production Schedule = MPS sebagai dasar penentuan proses produksi IKS-Filler yang menyebabkan kekurangan persediaan sehingga kualitas kertas cacat dan perusahaan menderita kerugian yang cukup besar. Tujuan penelitian ini adalah menganalisa peramalan yang sesuai untuk diterapkan, merencanakan produksi dengan biaya terendah, penjadwalan produksi sebagai dasar proses produksi dan menghitung persediaan pengaman. Metode yang digunakan adalah peramalan (moving average, perencanaan produksi (level production plan, chase plant, dan intermediate plan, penjadwalan produksi (MPS trial and error dan menganalisis jumlah persediaan pengaman (safety stock menggunakan distribusi normal. Dari hasil pengolahan data menyimpulkan bahwa peramalan yang sesuai adalah Moving Average (n = 3 dengan nilai MAD terkecil dan tracking signal yang tidak menyimpang. Biaya terendah perencanaan produksi menggunakan metode intermediate plan sebesar 56,5 USD. Jadwal Induk Produksi mempunyai persediaan akhir 191 Ton dan rata-rata produksi tiap minggu sebesar 1,852 Ton. Jumlah persediaan pengaman dengan tingkat layanan 95% sebesar 101,75 Ton.
Analitik Hiyerarşi Yöntemi İle İstanbul'da Bütünleşik Bisiklet Ağı Kümelerinin Önceliklendirilmesi
Directory of Open Access Journals (Sweden)
Dilek Çol Yılmaz
2014-06-01
Full Text Available Bu çalışmada motorsuz ulaşım ve toplu taşıma entegrasyonunun yüksek seviyede hareketliliğe etkisi değerlendirilmiştir. Önemli bir ulaşım türü olan bisikletin motorsuz ulaşımdaki rolü, sürdürülebilir yolculuk hedefine katkıları ele alınmıştır. Çalışmada İstanbul metropoliten alanında toplu taşıma sistemi ile bütünleşik bisiklet ulaşım ağının aşamalı olarak gerçekleştirilmesi için bir karar destek modeli kurulmuştur. Model oluşturulurken 2023 yılı için planlanmış olan toplu taşıma hatları, aktarma merkezi noktaları, bu noktalara ait yolcu sayıları, yeniden düzenlenen bisiklet ağı gibi veriler Coğrafi Bilgi Sistemleri (CBS ortamında geliştirilen haritaya altlık olarak kullanılmıştır. Çok Ölçütlü Karar Verme yöntemlerinden nitel ve nicel değerlendirmeye olanak veren Analitik Hiyerarşi Yöntemi (AHY kullanılarak ulaşım planlaması konusunda uzmanların değerlendirmeleri doğrultusunda, İstanbul metropoliten alanında toplu taşıma ile bütünleşik bisiklet ağı kümelerinin öncelikleri belirlenmiştir.
Mode coupling of electron plasma waves
International Nuclear Information System (INIS)
Harte, J.A.
1975-01-01
The driven coupled mode equations are derived for a two fluid, unequal temperature (T/sub e/ much greater than T/sub i/) plasma in the one-dimensional, electrostatic model and applied to the coupling of electron plasma waves. It is assumed that the electron to ion mass ratio identical with m/sub e/M/sub i// much less than 1 and eta 2 /sub ko/k lambda/sub De/ less than 1 where eta 2 /sub ko/ is the pump wave's power normalized to the plasma thermal energy, k the mode wave number and lambda/sub De/ the electron Debye length. Terms up to quadratic in pump power are retained. The equations describe the linear plasma modes oscillating at the wave number k and at ω/sub ek/, the Bohn Gross frequency, and at Ω/sub k/, the ion acoustic frequency, subject to the damping rates ν/sub ek/ and ν/sub ik/ for electrons and ions and their interactions due to intense high frequency waves E/sub k//sup l/. n/sub o/ is the background density, n/sub ik/ the fluctuating ion density, ω/sub pe/ the plasma frequency
Szentandrássy, N; Farkas, V; Bárándi, L; Hegyi, B; Ruzsnavszky, F; Horváth, B; Bányász, T; Magyar, J; Márton, I; Nánási, PP
2012-01-01
BACKGROUND AND PURPOSE Although isoprenaline (ISO) is known to activate several ion currents in mammalian myocardium, little is known about the role of action potential morphology in the ISO-induced changes in ion currents. Therefore, the effects of ISO on action potential configuration, L-type Ca2+ current (ICa), slow delayed rectifier K+ current (IKs) and fast delayed rectifier K+ current (IKr) were studied and compared in a frequency-dependent manner using canine isolated ventricular myocytes from various transmural locations. EXPERIMENTAL APPROACH Action potentials were recorded with conventional sharp microelectrodes; ion currents were measured using conventional and action potential voltage clamp techniques. KEY RESULTS In myocytes displaying a spike-and-dome action potential configuration (epicardial and midmyocardial cells), ISO caused reversible shortening of action potentials accompanied by elevation of the plateau. ISO-induced action potential shortening was absent in endocardial cells and in myocytes pretreated with 4-aminopyridine. Application of the IKr blocker E-4031 failed to modify the ISO effect, while action potentials were lengthened by ISO in the presence of the IKs blocker HMR-1556. Both action potential shortening and elevation of the plateau were prevented by pretreatment with the ICa blocker nisoldipine. Action potential voltage clamp experiments revealed a prominent slowly inactivating ICa followed by a rise in IKs, both currents increased with increasing the cycle length. CONCLUSIONS AND IMPLICATIONS The effect of ISO in canine ventricular cells depends critically on action potential configuration, and the ISO-induced activation of IKs– but not IKr– may be responsible for the observed shortening of action potentials. PMID:22563726
Directory of Open Access Journals (Sweden)
Wei-Hua Tang
Full Text Available Total mortality and sudden cardiac death is highly prevalent in patients with chronic kidney disease (CKD. In CKD patients, the protein-bound uremic retention solute indoxyl sulfate (IS is independently associated with cardiovascular disease. However, the underlying mechanisms of this association have yet to be elucidated. The relationship between IS and cardiac electrocardiographic parameters was investigated in a prospective observational study among early CKD patients. IS arrhythmogenic effect was evaluated by in vitro cardiomyocyte electrophysiological study and mathematical computer simulation. In a cohort of 100 early CKD patients, patients with corrected QT (QTc prolongation had higher IS levels. Furthermore, serum IS level was independently associated with prolonged QTc interval. In vitro, the delay rectifier potassium current (IK was found to be significantly decreased after the treatment of IS in a dose-dependent manner. The modulation of IS to the IK was through the regulation of the major potassium ion channel protein Kv 2.1 phosphorylation. In a computer simulation, the decrease of IK by IS could prolong the action potential duration (APD and induce early afterdepolarization, which is known to be a trigger mechanism of lethal ventricular arrhythmias. In conclusion, serum IS level is independently associated with the prolonged QTc interval in early CKD patients. IS down-regulated IK channel protein phosphorylation and the IK current activity that in turn increased the cardiomyocyte APD and QTc interval in vitro and in the computer ORd model. These findings suggest that IS may play a role in the development of arrhythmogenesis in CKD patients.
Beaulieu-Jones, Brendin R; O'Brien, Diane M; Hopkins, Scarlett E; Moore, Jason H; Boyer, Bert B; Gilbert-Diamond, Diane
2015-05-01
Alaska Native people currently have a higher prevalence of hypertension than do nonnative Alaskans, although in the 1950s hypertension was rare among Alaska Native people. A novel biomarker of marine foods, the nitrogen isotope ratio (δ¹⁵N) in RBCs was shown to be negatively associated with systolic and diastolic blood pressure. Few studies have examined how individual characteristics modify the association of marine food intake with blood pressure. This exploratory analysis examined whether sex, adiposity, and hypertension modify the inverse association between marine food intake and blood pressure. We used covariate-adjusted linear models to describe the association between δ¹⁵N and blood pressure in 873 adult Alaska Native (Yup'ik) people who resided in 8 communities in southwest Alaska. We separately stratified by sex, body mass index (BMI) group, abdominal obesity, and hypertension status and assessed the interaction between δ¹⁵N and participant characteristics on blood pressure via likelihood ratio tests. The association between δ¹⁵N and systolic blood pressure was modified by sex, BMI status, and abdominal obesity, with the inverse association observed only in the male (β = -1.5; 95% CI: -2.4, -0.6 : , nonobese BMI (β = -1.7; 95% CI: -2.5, -1.0), and non-abdominally obese (β = -1.6; 95% CI: -2.4, -0.9) strata (all P-interaction blood pressure associated with δ¹⁵N was observed in the nonobese BMI (β = -1.1; 95% CI: -1.7, -0.5) and non-abdominally obese (β = -1.1; 95% CI: -1.7, -0.5) strata, although only the interaction between BMI group and δ¹⁵N with diastolic blood pressure was significant. The inverse association between δ¹⁵N and both systolic and diastolic blood pressure was observed in nonhypertensive individuals, although the comparison had limited power. The results were consistent with those identified by using combined RBC concentrations of eicosapentaenoic acid and docosahexaenoic acid as the biomarker of marine food
Annual report on nuclear physics activities July 1, 1983 - June 30, 1984
International Nuclear Information System (INIS)
Fries, D.C.; Matussek, P.; Weddigen, C.
1984-10-01
This report surveys the activities in fundamental research from July 1, 1983 to June 30, 1984 at the Institute for Nuclear Physics (IK) of the Kernforschungszentrum Karlsruhe. The research program of this institute comprises laser spectroscopy, nuclear reactions with light ions, neutron physics, neutrino physics and physics at medium and higher energies. (orig.) [de
Annual report on nuclear physics activities. July 1, 1985 - June 30, 1986
International Nuclear Information System (INIS)
Bueche, G.; Doll, P.; Friedrich, L.
1986-12-01
This report surveys the activities in basic research from July 1, 1985 to June 30, 1986 at the Institute for Nuclear Physics (IK) of the Kernforschungszentrum Karlsruhe. The research program of this institute comprises laser spectroscopy, nuclear reactions with light ions, neutron physics, neutrino physics and physics at medium and high energies. (orig.) [de
Annual report on nuclear physics activities
International Nuclear Information System (INIS)
Heeringa, W.; Voss, F.
1988-02-01
This report surveys the activities in basic research from July 1, 1986 to June 30, 1987 at the Institute for Nuclear Physics (IK) of the Nuclear Research Center Karlsruhe. The research program of this institute comprises laser spectroscopy, nuclear reactions with light ions, neutron physics, neutrino physics and high energy physics, as well as detector technology. (orig.) [de
Vector-Potential Flow in Relativistic Beam Diodes.
1980-09-05
is no plasma formation and consequent loss of energy to accelerated ions. Entering a region close to the ax ik in which an anode plasma does exist...Hubbard 1 copy J. Guillory 1 copy JAYCOR, Inc. 1401 Camino Del Mar Del Mar, CA 92014 Attn: E. Wenaas 1 copy JAYCOR, INC. 300 Unicorn Park Drive Woburn
Annual report on nuclear physics activities. July 1, 1987 - June 30, 1988
International Nuclear Information System (INIS)
Doll, P.; Meisel, G.
1989-02-01
This report surveys the activities in basic research from July 1, 1987 to June 30, 1988 at the Institute for Nuclear Physics (IK) of the Kernforschungszentrum Karlsruhe. The research program of this institute comprises nuclear astropysics, laser spectroscopy, nuclear reactions with light ions, neutron physics, neutrino physics and high energy physics, as well as detector technology. (orig.) [de
Levin, Michaela E.
2012-01-01
Inner ear hair cells respond to mechanical stimuli with graded receptor potentials. These graded responses are modulated by a host of voltage-dependent currents that flow across the basolateral membrane. Here, we examine the molecular identity and the function of a class of voltage-dependent ion channels that carries the potassium-selective inward rectifier current known as IK1. IK1 has been identified in vestibular hair cells of various species, but its molecular composition and functional contributions remain obscure. We used quantitative RT-PCR to show that the inward rectifier gene, Kir2.1, is highly expressed in mouse utricle between embryonic day 15 and adulthood. We confirmed Kir2.1 protein expression in hair cells by immunolocalization. To examine the molecular composition of IK1, we recorded voltage-dependent currents from type II hair cells in response to 50-ms steps from −124 to −54 in 10-mV increments. Wild-type cells had rapidly activating inward currents with reversal potentials close to the K+ equilibrium potential and a whole-cell conductance of 4.8 ± 1.5 nS (n = 46). In utricle hair cells from Kir2.1-deficient (Kir2.1−/−) mice, IK1 was absent at all stages examined. To identify the functional contribution of Kir2.1, we recorded membrane responses in current-clamp mode. Hair cells from Kir2.1−/− mice had significantly (P < 0.001) more depolarized resting potentials and larger, slower membrane responses than those of wild-type cells. These data suggest that Kir2.1 is required for IK1 in type II utricle hair cells and contributes to hyperpolarized resting potentials and fast, small amplitude receptor potentials in response to current inputs, such as those evoked by hair bundle deflections. PMID:22496522
Ion transport in a human lens epithelial cell line exposed to hyposmotic and apoptotic stress.
Chimote, Ameet A; Adragna, Norma C; Lauf, Peter K
2010-04-01
Membrane transport changes in human lens epithelial (HLE-B3) cells under hyposmotic and apoptotic stress were compared. Cell potassium content, K(i), uptake of the K congener rubidium, Rb(i), and water content were measured after hyposmotic stress induced by hypotonicity, and apoptotic stress by the protein-kinase inhibitor staurosporine (STP). Cell water increased in hyposmotic (150 mOsm) as compared to isosmotic (300 mOsm) balanced salt solution (BSS) by >2-fold at 5 min and decreased within 15 min to baseline values accompanied by a 40% K(i) loss commensurate with cell swelling and subsequent cell shrinkage likely due to regulatory volume decrease (RVD). Loss of K(i), and accompanying water, and Rb(i) uptake in hyposmotic BSS were prevented by clotrimazole (CTZ) suggesting water shifts associated with K and Rb flux via intermediate conductance K (IK) channels, also detected at the mRNA and protein level. In contrast, 2 h after 2 microM STP exposure, the cells lost approximately 40% water and approximately 60% K(i), respectively, consistent with apoptotic volume decrease (AVD). Indeed, water and K(i) loss was at least fivefold greater after hyposmotic than after apoptotic stress. High extracellular K and 2 mM 4-aminopyridine (4-AP) but not CTZ significantly reduced apoptosis. Annexin labeling phosphatidylserine (PS) at 15 min suggested loss of lipid asymmetry. Quantitative PCR revealed significant IK channel expression during prolonged hyposmotic stress. Results suggest in HLE-B3 cells, IK channels likely partook in and were down regulated after RVD, whereas pro-apoptotic STP-activation of 4-AP-sensitive voltage-gated K channels preceded or accompanied PS externalization before subsequent apoptosis. J. Cell. Physiol. 223: 110-122, 2010. (c) 2009 Wiley-Liss, Inc.
Alvin, Zikiar V; Laurence, Graham G; Coleman, Bernell R; Zhao, Aiqiu; Hajj-Moussa, Majd; Haddad, Georges E
2011-07-01
Early development of cardiac hypertrophy may be beneficial but sustained hypertrophic activation leads to myocardial dysfunction. Regulation of the repolarizing currents can be modulated by the activation of humoral factors, such as angiotensin II (ANG II) through protein kinases. The aim of this work is to assess the regulation of IK and IK1 by ANG II through the PI3-K pathway in hypertrophied ventricular myocytes. Cardiac eccentric hypertrophy was induced through volume-overload in adult male rats by aorto-caval shunt (3 weeks). After one week half of the rats were given captopril (2 weeks; 0.5 g/l/day) and the other half served as control. The voltage-clamp and western blot techniques were used to measure the delayed outward rectifier potassium current (IK) and the instantaneous inward rectifier potassium current (IK1) and Akt activity, respectively. Hypertrophied cardiomyocytes showed reduction in IK and IK1. Treatment with captopril alleviated this difference seen between sham and shunt cardiomyocytes. Acute administration of ANG II (10-6M) to cardiocytes treated with captopril reduced IK and IK1 in shunts, but not in sham. Captopril treatment reversed ANG II effects on IK and IK1 in a PI3-K-independent manner. However in the absence of angiotensin converting enzyme inhibition, ANG II increased both IK and IK1 in a PI3-K-dependent manner in hypertrophied cardiomyocytes. Thus, captopril treatment reveals a negative effect of ANG II on IK and IK1, which is PI3-K independent, whereas in the absence of angiotensin converting enzyme inhibition IK and IK1 regulation is dependent upon PI3-K.
Kolahdooz, Fariba; Simeon, Desiree; Ferguson, Gary; Sharma, Sangita
2014-01-01
Alaska Native populations are experiencing a nutrition transition and a resulting decrease in diet quality. The present study aimed to develop a quantitative food frequency questionnaire to assess the diet of the Yup'ik people of Western Alaska. A cross-sectional survey was conducted using 24-hour recalls and the information collected served as a basis for developing a quantitative food frequency questionnaire. A total of 177 males and females, aged 13-88, in six western Alaska communities, completed up to three 24-hour recalls as part of the Alaska Native Dietary and Subsistence Food Assessment Project. The frequency of the foods reported in the 24-hour recalls was tabulated and used to create a draft quantitative food frequency questionnaire, which was pilot tested and finalized with input from community members. Store-bought foods high in fat and sugar were reported more frequently than traditional foods. Seven of the top 26 foods most frequently reported were traditional foods. A 150-item quantitative food frequency questionnaire was developed that included 14 breads and crackers; 3 cereals; 11 dairy products; 69 meats, poultry and fish; 13 fruit; 22 vegetables; 9 desserts and snacks; and 9 beverages. The quantitative food frequency questionnaire contains 39 traditional food items. This quantitative food frequency questionnaire can be used to assess the unique diet of the Alaska Native people of Western Alaska. This tool will allow for monitoring of dietary changes over time as well as the identification of foods and nutrients that could be promoted in a nutrition intervention program intended to reduce chronic disease.
Directory of Open Access Journals (Sweden)
Fariba Kolahdooz
Full Text Available Alaska Native populations are experiencing a nutrition transition and a resulting decrease in diet quality. The present study aimed to develop a quantitative food frequency questionnaire to assess the diet of the Yup'ik people of Western Alaska. A cross-sectional survey was conducted using 24-hour recalls and the information collected served as a basis for developing a quantitative food frequency questionnaire. A total of 177 males and females, aged 13-88, in six western Alaska communities, completed up to three 24-hour recalls as part of the Alaska Native Dietary and Subsistence Food Assessment Project. The frequency of the foods reported in the 24-hour recalls was tabulated and used to create a draft quantitative food frequency questionnaire, which was pilot tested and finalized with input from community members. Store-bought foods high in fat and sugar were reported more frequently than traditional foods. Seven of the top 26 foods most frequently reported were traditional foods. A 150-item quantitative food frequency questionnaire was developed that included 14 breads and crackers; 3 cereals; 11 dairy products; 69 meats, poultry and fish; 13 fruit; 22 vegetables; 9 desserts and snacks; and 9 beverages. The quantitative food frequency questionnaire contains 39 traditional food items. This quantitative food frequency questionnaire can be used to assess the unique diet of the Alaska Native people of Western Alaska. This tool will allow for monitoring of dietary changes over time as well as the identification of foods and nutrients that could be promoted in a nutrition intervention program intended to reduce chronic disease.
Ion-ion collisions and ion storage rings
International Nuclear Information System (INIS)
Mowat, J.R.
1988-01-01
Improved understanding of fundamental ion-ion interactions is expected to emerge from research carried out with ion storage rings. In this short survey the significant advantages and unique features that make stored ions useful targets for collision experiments are reviewed and discussed. It is pointed out that improvements to existing ion-ion experiments, as well as qualitatively new experiments, should occur over the next few years as ion storage rings become available for atomic physics. Some new experiments are suggested which are difficult if not impossible with present-day technology, but which seem feasible at storage rings facilities. (orig.)
CaCO3-N İlişkileri 4.Değişik Reaksiyonlu Toprakların Karşılaştırılması
BROHI, A.Raşit; Aydeniz, A.
1990-01-01
Kireç - azot bitkilerini açıklayabilmek için, değişik reaksiyonlu 3örnek (Rize-asit, Siverek nötr - hafif alkali, Aligör - alkali) alınarak bunların : % 0-0.5-1-1.5-2-3-4-5-10 oranlarında CaCO3 ve 0-1-5-20:50- 100-200 500 veya 1000 ppm düzeylerinde N katmak sureti ile hazırlanan topraklarda büyütme odasında, mini-biyolojik yöntemle domates yetiştirmek ve 65 gün (alkali topraktakileri 87. gün sonra) sonra hasat etmek suretiyle yapılan araştırma sonuçları şu şekilde özetlenebilir. 1.Asit top...
Singularities in the general theory of relativity
International Nuclear Information System (INIS)
Treder, H.J.
1980-01-01
'Regular solutions of Einstein's equations' mean very different things. In the case of the empty-space equations, Rsub(ik) = o, such solutions must be metrics gsub(ik)(xsup(l)) without additionaly singular 'field sources' (Einstein's 'Particle problem'). However the 'phenomenological matter' is defined by the Einstein equations Rsub(ik) - 1/2gsub(ik)R = -kappaTsub(ik) itselves. Therefore if 10 regular functions gsub(ik)(xsup(l)) are given (which the inequalities of Lorentz-signature fulfil) then these gsub(ik) define 10 functions Tsub(ik)(xsup(l)) without singularities. But, the matter-tensor Tsub(ik) must fulfil the two inequalities T >= o, T 0 0 >= 1/2 T only and therefore the Einstein-equations with 'phenomenological matter' mean the two inequalities R >= o, R 0 0 <= o which are incompatible with a permanently regular metric with Lorentz-signature, generally. (author)
Inhibition of the cardiac inward rectifier potassium currents by KB-R7943.
Abramochkin, Denis V; Alekseeva, Eugenia I; Vornanen, Matti
2013-09-01
KB-R7943 (2-[2-[4-(4-nitrobenzyloxy)phenyl]ethyl]isothiourea) was developed as a specific inhibitor of the sarcolemmal sodium-calcium exchanger (NCX) with potential experimental and therapeutic use. However, KB-R7943 is shown to be a potent blocker of several ion currents including inward and delayed rectifier K(+) currents of cardiomyocytes. To further characterize KB-R7943 as a blocker of the cardiac inward rectifiers we compared KB-R7943 sensitivity of the background inward rectifier (IK1) and the carbacholine-induced inward rectifier (IKACh) currents in mammalian (Rattus norvegicus; rat) and fish (Carassius carassius; crucian carp) cardiac myocytes. The basal IK1 of ventricular myocytes was blocked with apparent IC50-values of 4.6×10(-6) M and 3.5×10(-6) M for rat and fish, respectively. IKACh was almost an order of magnitude more sensitive to KB-R7943 than IK1 with IC50-values of 6.2×10(-7) M for rat and 2.5×10(-7) M for fish. The fish cardiac NCX current was half-maximally blocked at the concentration of 1.9-3×10(-6) M in both forward and reversed mode of operation. Thus, the sensitivity of three cardiac currents to KB-R7943 block increases in the order IK1~INCXrectifier potassium currents, in particular IKACh, should be taken into account when interpreting the data with this inhibitor from in vivo and in vitro experiments in both mammalian and fish models. © 2013.
Kamou, Nathalie N; Dubey, Mukesh; Tzelepis, Georgios; Menexes, Georgios; Papadakis, Emmanouil N; Karlsson, Magnus; Lagopodi, Anastasia L; Jensen, Dan Funck
2016-05-01
This study was carried out to assess the compatibility of the biocontrol fungus Clonostachys rosea IK726 with the phenazine-producing Pseudomonas chlororaphis ToZa7 or with the prodigiosin-producing Serratia rubidaea S55 against Fusarium oxysporum f. sp. radicis-lycopersici. The pathogen was inhibited by both strains in vitro, whereas C. rosea displayed high tolerance to S. rubidaea but not to P. chlororaphis. We hypothesized that this could be attributed to the ATP-binding cassette (ABC) proteins. The results of the reverse transcription quantitative PCR showed an induction of seven genes (abcB1, abcB20, abcB26, abcC12, abcC12, abcG8 and abcG25) from subfamilies B, C and G. In planta experiments showed a significant reduction in foot and root rot on tomato plants inoculated with C. rosea and P. chlororaphis. This study demonstrates the potential for combining different biocontrol agents and suggests an involvement of ABC transporters in secondary metabolite tolerance in C. rosea.
Heating tokamaks via the ion-cyclotron and ion-ion hybrid resonances
International Nuclear Information System (INIS)
Perkins, F.W.
1977-04-01
For the ion-ion hybrid resonance it is shown that: (1) the energy absorption occurs via a sequence of mode conversions; (2) a poloidal field component normal to the ion-ion hybrid mode conversion surface strongly influences the mode conversion process so that roughly equal electron and ion heating occurs in the present proton-deuterium experiments, while solely electron heating is predicted to prevail in deuterium-tritium reactors; (3) the ion-ion hybrid resonance suppresses toroidal eigenmodes; and (4) wave absorption in minority fundamental ion-cyclotron heating experiments will be dominated by ion-ion hybrid mode conversion absorption for minority concentrations exceeding roughly 1 percent. For the ion-cyclotron resonance, it is shown that: (1) ion-cyclotron mode conversion leads to surface electron heating; and (2) ion-cyclotron mode conversion absorption dominates fundamental ion-cyclotron absorption thereby preventing efficient ion heating
1981-05-08
by writing the electric field observer approaches the focal as E = A exp I i(kS - wt) 1, where A is le in the plane ofthc sky the amplitude and kS...lowest-order correction to the electric field E. Writing z- [@ (Yi-Yo) 2 + o (zI -z 0 c 0 (zI - o) 3 4c 2 (z, -Zo) 2 (, -yo) + ... (3.14) it is...si ellair oc cult at ions when t It(- tcondit ions leadlIn-,, to equation (7.2) are satisfied. Thus equtins 17. 1) and( ( 7.2) ielt the( vatriance
Scientific progress report 2 - 1975
International Nuclear Information System (INIS)
1975-01-01
The work in the field of radiation chemistry was carried out in the year 1975 in the following work groups: Pulsed radiolysis (P), reaction kinematics (RK), and insulators and synthetics (IK). Continuing running research work, the groups P and IK together used the electron accelerator (16 MeV linear accelerator and 1.5 MeV Van de Graaff generator) as well as a laser flash irradiation apparatus (Rubin laser). The new electron accelerator for the nanosecond region ELBENA was installed. Test runs were started. Furthermore, two additional pulsable laser devices were acquired (one of these for work in the picosecond region), which are to be put in operation in 1976. The main topic of investigation in the work group P was the solving of complex reaction mechanisms and the determination of physical-chemical properties of short-lived intermediary products in the investigation of biologically relevant and micelle systems. The problems worked on are partly closely related to problems concerning the photochemical use of solar energy. This involves, e.g., the light-induced reduction of metal ions and the photoionization in micelle systems. The work group RK continued work on elastic, inelastic and reactive scattering processes between ions and molecules as well as electron transfer processes between atoms and molecules. The problems investigated are of fundamental importance to the understanding of chemical elementary processes in the gas phase relevant to procedures in space. The work group IK concentrate on studies for the production and transport of charge carriers in hydrocarbons and liquidized noble gases; amongst others, the electron mobility in short chain paraffins and polyethylene was investigated. A further main topic of investigation was the decomposition of polymers which, amongst others, brought considerable knowledge on the motion of macromolecules and a new method of detecting the preferential solvation of macrolecules. (orig.) [de
Ma, Xiaohong; Shor, Oded; Diminshtein, Sofia; Yu, Ling; Im, Yang Ju; Perera, Imara; Lomax, Aaron; Boss, Wendy F; Moran, Nava
2009-02-01
In the animal world, the regulation of ion channels by phosphoinositides (PIs) has been investigated extensively, demonstrating a wide range of channels controlled by phosphatidylinositol (4,5)bisphosphate (PtdInsP2). To understand PI regulation of plant ion channels, we examined the in planta effect of PtdInsP2 on the K+-efflux channel of tobacco (Nicotiana tabacum), NtORK (outward-rectifying K channel). We applied a patch clamp in the whole-cell configuration (with fixed "cytosolic" Ca2+ concentration and pH) to protoplasts isolated from cultured tobacco cells with genetically manipulated plasma membrane levels of PtdInsP2 and cellular inositol (1,4,5)trisphosphate: "Low PIs" had depressed levels of these PIs, and "High PIs" had elevated levels relative to controls. In all of these cells, K channel activity, reflected in the net, steady-state outward K+ currents (IK), was inversely related to the plasma membrane PtdInsP2 level. Consistent with this, short-term manipulations decreasing PtdInsP2 levels in the High PIs, such as pretreatment with the phytohormone abscisic acid (25 microM) or neutralizing the bath solution from pH 5.6 to pH 7, increased IK (i.e. NtORK activity). Moreover, increasing PtdInsP2 levels in controls or in abscisic acid-treated high-PI cells, using the specific PI-phospholipase C inhibitor U73122 (2.5-4 microM), decreased NtORK activity. In all cases, IK decreases stemmed largely from decreased maximum attainable NtORK channel conductance and partly from shifted voltage dependence of channel gating to more positive potentials, making it more difficult to activate the channels. These results are consistent with NtORK inhibition by the negatively charged PtdInsP2 in the internal plasma membrane leaflet. Such effects are likely to underlie PI signaling in intact plant cells.
Dicty_cDB: Contig-U04770-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available m I P700 apoprot... 48 0.44 1 ( AY422592 ) Dictyota koreana IK24 photosystem I P700 apoprote... 48 0.44 1 ( AY422591 ) Dictyota korea...na IK23 photosystem I P700 apoprote... 48 0.44 1 ( AY422590 ) Dictyota korea...na IK22 photosystem I P700 apoprote... 48 0.44 1 ( AY422589 ) Dictyota koreana IK21 phot...osystem I P700 apoprote... 48 0.44 1 ( AY422588 ) Dictyota koreana IK20 photosystem I P700 apoprote... 48 0....44 1 ( AY422587 ) Dictyota koreana IK17 photosystem I P700 apoprote... 48 0.44 1 ( AY422586 ) Dictyota alter
Voigt, Niels; Heijman, Jordi; Trausch, Anne; Mintert-Jancke, Elisa; Pott, Lutz; Ravens, Ursula; Dobrev, Dobromir
2013-08-01
Shortened action-potential duration (APD) and blunted APD rate adaptation are hallmarks of chronic atrial fibrillation (cAF). Basal and muscarinic (M)-receptor-activated inward-rectifier K(+) currents (IK1 and IK,ACh, respectively) contribute to regulation of human atrial APD and are subject to cAF-dependent remodeling. Intracellular Na(+) ([Na(+)]i) enhances IK,ACh in experimental models but the effect of [Na(+)]i-dependent regulation of inward-rectifier K(+) currents on APD in human atrial myocytes is currently unknown. Here, we report a [Na(+)]i-dependent inhibition of outward IK1 in atrial myocytes from sinus rhythm (SR) or cAF patients. In contrast, IK,ACh activated by carbachol, a non-selective M-receptor agonist, increased with elevation of [Na(+)]i in SR. This [Na(+)]i-dependent IK,ACh regulation was absent in cAF. Including [Na(+)]i dependence of IK1 and IK,ACh in a recent computational model of the human atrial myocyte revealed that [Na(+)]i accumulation at fast rates inhibits IK1 and blunts physiological APD rate dependence in both groups. [Na(+)]i-dependent IK,ACh augmentation at fast rates increased APD rate dependence in SR, but not in cAF. These results identify impaired Na(+)-sensitivity of IK,ACh as one potential mechanism contributing to the blunted APD rate dependence in patients with cAF. This article is part of a Special Issue entitled "Na(+) Regulation in Cardiac Myocytes". Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.
Kwon, Soon-Jae; Lee, Ju-Hye; Moon, Kwang-Deog; Jeong, Il-Yun; Yee, Sung-Tae; Lee, Mi-Kyung; Seo, Kwon-Il
2014-11-01
Isoegomaketone (IK) is a major biologically active component of Perilla frutescens. In this study, we investigated the contribution of reactive oxygen species (ROS) to IK-induced apoptosis in human melanoma SK-MEL-2 cells. We found that IK inhibited the proliferation of SK-MEL-2 human melanoma cells in a dose-dependent manner. IK also induced sub-G1 DNA accumulation, formation of apoptotic bodies, nuclear condensation, and a DNA ladder in SK-MEL-2 cells. IK also induced activation of caspase-3 and -9, whereas caspase‑8 was unaffected. Further, N-acetyl-L-cysteine (NAC, ROS scavenger) treatment to SK-MEL-2 cells significantly reduced IK-induced cell death. Pretreatment of NAC to SK-MEL-2 cells followed by 100 µM IK reduced the protein levels of Bax and cytochrome c as well as PARP cleavage, whereas the protein level of Bcl-2 increased. Moreover, IK inhibited the phosphorylation of AKT/mTOR protein and cell proliferation induced by LY294002, a PI3K inhibitor. In conclusion, IK-induced ROS generation regulates cell growth inhibition and it induces apoptosis through caspase‑dependent and -independent pathways via modulation of PI3K/AKT signaling in SK-MEL-2 cells.
International Nuclear Information System (INIS)
Martín-Martín, Leire; Gastelurrutia, Jon; Nieto, Nerea; Ramos, Juan Carlos; Rivas, Alejandro; Gil, Iñigo
2016-01-01
Highlights: • A TMS is designed for a cylindrical Li-ion BP using CFD tools. • The model is experimentally validated with a maximum time-averaged error of 1.5 °C. • Cell temperature and module thermal dispersion are below 39 °C and 3 °C. • The prototype design fulfills all thermal requirements. • Design improvements are proposed to minimize the cost and the TMS consumption. - Abstract: Environmental sustainability, more efficient use of energy, and active safety concepts are becoming important requirements for the actual elevation sector. In this context IK4-IKERLAN and ORONA have designed an auxiliary energy storage system (ESS) for a residential elevation application based on lithium-ion cells. Safety and specially lifetime are two of the main concerns surrounding this new technology, which is closely related to the cells operating behavior and temperature asymmetries in the complete ESS. Therefore, the temperature of the cells in battery packs (BPs) needs to be controlled in an efficient way. This paper describes the development of the thermal management system (TMS) designed for this application based on various Computational Fluid Dynamics (CFD) mathematical models. The accuracy of Transient model is validated by using a single module to compare the simulation temperature results with experimental measurements, with a maximum time-averaged temperature prediction error of 1.5 °C. The proposed design is validated as it fulfills the requirements for a wide operating window, with a maximum cell temperature of 39 °C and a thermal dispersion at system level below 3 °C for the worst tested case. A more realistic current profile is checked numerically in the worst ambient and operative conditions for different virtual design variants to propose improvements.
Calculation of ion storage in electron beams with account of ion-ion interactions
International Nuclear Information System (INIS)
Perel'shtejn, Eh.A.; Shirkov, G.D.
1979-01-01
Ion storage in relativistic electron beams was calculated taking account of ion-ion charge exchange and ionization. The calculations were made for nitrogen ion storage from residual gas during the compression of electron rings in the adhezator of the JINR heavy ion accelerator. The calculations were made for rings of various parameters and for various pressures of the residual gas. The results are compared with analogous calculations made without account of ion-ion processes. It is shown that at heavy loading of a ring by ions ion-ion collisions play a significant part, and they should be taken into account while calculating ion storage
Review of indigenous knowledge in Uganda: implications for its promotion
Directory of Open Access Journals (Sweden)
John R.S. Tabuti
2012-02-01
Full Text Available Indigenous knowledge (IK has a role to play for households and community well-being in Uganda. However, IK is undergoing significant change and is on the decline in Uganda because of factors such as acculturation or the loss of IK through exposure to external cultures. In this paper we review some of the roles of, and threats to, IK with particular reference to the local community of Kaliro District. We make some recommendations on how to conserve IK in Kaliro and elsewhere in Uganda. Key words: traditional knowledge, conservation, traditional medicine, ethnobotany
DEFF Research Database (Denmark)
Qian, Xun; Francis, Michael; Köhler, Ralf
2014-01-01
Intermediate and small conductance KCa channels IK1 (KCa3.1) and SK3 (KCa2.3) are primary targets of endothelial Ca(2+) signals in the arterial vasculature, and their ablation results in increased arterial tone and hypertension. Activation of IK1 channels by local Ca(2+) transients from internal ...... stores or plasma membrane channels promotes arterial hyperpolarization and vasodilation. Here, we assess arteries from genetically altered IK1 knockout mice (IK1(-/-)) to determine whether IK1 channels exert a positive feedback influence on endothelial Ca(2+) dynamics....
Ion-Ion Plasmas Produced by Electron Beams
Fernsler, R. F.; Leonhardt, D.; Walton, S. G.; Meger, R. A.
2001-10-01
The ability of plasmas to etch deep, small-scale features in materials is limited by localized charging of the features. The features charge because of the difference in electron and ion anisotropy, and thus one solution now being explored is to use ion-ion plasmas in place of electron-ion plasmas. Ion-ion plasmas are effectively electron-free and consist mainly of positive and negative ions. Since the two ion species behave similarly, localized charging is largely eliminated. However, the only way to produce ion-ion plasmas at low gas pressure is to convert electrons into negative ions through two-body attachment to neutrals. While the electron attachment rate is large at low electron temperatures (Te < 1 eV) in many of the halogen gases used for processing, these temperatures occur in most reactors only during the afterglow when the heating fields are turned off and the plasma is decaying. By contrast, Te is low nearly all the time in plasmas produced by electron beams, and therefore electron beams can potentially produce ion-ion plasmas continuously. The theory of ion-ion plasmas formed by pulsed electron beams is examined in this talk and compared with experimental results presented elsewhere [1]. Some general limitations of ion-ion plasmas, including relatively low flux levels, are discussed as well. [1] See the presentation by D. Leonhardt et al. at this conference.
Coppi, Elisabetta; Cellai, Lucrezia; Maraula, Giovanna; Pugliese, Anna Maria; Pedata, Felicita
2013-10-01
Oligodendrocyte progenitor cells (OPCs) are a population of cycling cells which persist in the adult central nervous system (CNS) where, under opportune stimuli, they differentiate into mature myelinating oligodendrocytes. Adenosine A(2A) receptors are Gs-coupled P1 purinergic receptors which are widely distributed throughout the CNS. It has been demonstrated that OPCs express A(2A) receptors, but their functional role in these cells remains elusive. Oligodendrocytes express distinct voltage-gated ion channels depending on their maturation. Here, by electrophysiological recordings coupled with immunocytochemical labeling, we studied the effects of adenosine A(2A) receptors on membrane currents and differentiation of purified primary OPCs isolated from the rat cortex. We found that the selective A(2A) agonist, CGS21680, inhibits sustained, delayed rectifier, K(+) currents (I(K)) without modifying transient (I(A)) conductances. The effect was observed in all cells tested, independently from time in culture. CGS21680 inhibition of I(K) current was concentration-dependent (10-200 nM) and blocked in the presence of the selective A(2A) antagonist SCH58261 (100 nM). It is known that I(K) currents play an important role during OPC development since their block decreases cell proliferation and differentiation. In light of these data, our further aim was to investigate whether A(2A) receptors modulate these processes. CGS21680, applied at 100 nM in the culture medium of oligodendrocyte cultures, inhibits OPC differentiation (an effect prevented by SCH58261) without affecting cell proliferation. Data demonstrate that cultured OPCs express functional A(2A) receptors whose activation negatively modulate I(K) currents. We propose that, by this mechanism, A(2A) adenosine receptors inhibit OPC differentiation. Copyright © 2013 Elsevier Ltd. All rights reserved.
Ryman, T K; Boyer, B B; Hopkins, S; Philip, J; Beresford, S A A; Thompson, B; Heagerty, P J; Pomeroy, J J; Thummel, K E; Austin, M A
2015-12-01
In previous analyses, we identified three dietary patterns from food frequency questionnaire data among a sample of Yup'ik Alaska Native people living in Southwest Alaska: a "subsistence foods" dietary pattern and two market-based dietary patterns "processed foods" and "fruits and vegetables". In this analysis, we aimed to characterize the association between the dietary patterns and cardiometabolic (CM) risk factors (lipids, blood pressure, glucose, adiposity). We used multilevel linear regression to estimate the mean of each CM risk factor, comparing participants in the 4th to the 1st quartile of each dietary pattern (n = 637). Models were adjusted for age, sex, past smoking, current smoking, and physical activity. Mean log triglyceride levels were significantly higher among participants in the 4th compared to the 1st quartile of the processed foods dietary pattern (β = 0.11). Mean HbA1c percent was significantly lower (β = -0.08) and mean diastolic blood pressure (DBP) mm Hg was significantly higher (β = 2.87) among participants in the 4th compared to the 1st quartile of the fruits and vegetables dietary pattern. Finally, mean log triglyceride levels and mean DBP mm Hg were significantly lower among participants in the 4th compared to the 1st quartile of the subsistence foods dietary pattern (β = -0.10 and β = -3.99 respectively). We found increased CM risk, as reflected by increased triglycerides, associated with eating a greater frequency of processed foods, and reduced CM risk, as reflected by lower triglycerides and DBP, associated with eating a greater frequency of subsistence foods. Copyright © 2015 The Italian Society of Diabetology, the Italian Society for the Study of Atherosclerosis, the Italian Society of Human Nutrition, and the Department of Clinical Medicine and Surgery, Federico II University. Published by Elsevier B.V. All rights reserved.
Choi, Sun-Hye; Lee, Byung-Hwan; Kim, Hyeon-Joong; Jung, Seok-Won; Kim, Hyun-Sook; Shin, Ho-Chul; Lee, Jun-Hee; Kim, Hyoung-Chun; Rhim, Hyewhon; Hwang, Sung-Hee; Ha, Tal Soo; Kim, Hyun-Ji; Cho, Hana; Nah, Seung-Yeol
2014-09-01
Gintonin, a novel, ginseng-derived G protein-coupled lysophosphatidic acid (LPA) receptor ligand, elicits [Ca(2+)]i transients in neuronal and non-neuronal cells via pertussis toxin-sensitive and pertussis toxin-insensitive G proteins. The slowly activating delayed rectifier K(+) (I(Ks)) channel is a cardiac K(+) channel composed of KCNQ1 and KCNE1 subunits. The C terminus of the KCNQ1 channel protein has two calmodulin-binding sites that are involved in regulating I(Ks) channels. In this study, we investigated the molecular mechanisms of gintonin-mediated activation of human I(Ks) channel activity by expressing human I(Ks) channels in Xenopus oocytes. We found that gintonin enhances IKs channel currents in concentration- and voltage-dependent manners. The EC50 for the I(Ks) channel was 0.05 ± 0.01 μg/ml. Gintonin-mediated activation of the I(Ks) channels was blocked by an LPA1/3 receptor antagonist, an active phospholipase C inhibitor, an IP3 receptor antagonist, and the calcium chelator BAPTA. Gintonin-mediated activation of both the I(Ks) channel was also blocked by the calmodulin (CaM) blocker calmidazolium. Mutations in the KCNQ1 [Ca(2+)]i/CaM-binding IQ motif sites (S373P, W392R, or R539W)blocked the action of gintonin on I(Ks) channel. However, gintonin had no effect on hERG K(+) channel activity. These results show that gintonin-mediated enhancement of I(Ks) channel currents is achieved through binding of the [Ca(2+)]i/CaM complex to the C terminus of KCNQ1 subunit.
Majority ion heating near the ion-ion hybrid layer in tokamaks
International Nuclear Information System (INIS)
Phillips, C.K.; Hosea, J.C.; Ignat, D.; Majeski, R.; Rogers, J.H.; Schilling, G.; Wilson, J.R.
1995-08-01
Efficient direct majority ion heating in a deuterium-tritium (D-T) reactor-grade plasma via absorption of fast magnetosonic waves in the ion cyclotron range of frequencies (ICRF) is discussed. Majority ion heating results from resonance overlap between the cyclotron layers and the D-T ion-ion hybrid layer in hot, dense plasmas for fast waves launched with high parallel wavenumbers. Analytic and numerical models are used to explore the regime in ITER plasmas
An RF ion source based primary ion gun for secondary ion mass spectroscopy
International Nuclear Information System (INIS)
Menon, Ranjini; Nabhiraj, P.Y.; Bhandari, R.K.
2011-01-01
In this article we present the design, development and characterization of an RF plasma based ion gun as a primary ion gun for SIMS application. RF ion sources, in particular Inductively Coupled Plasma (ICP) ion sources are superior compared to LMIS and duoplasmtron ion sources since they are filamentless, can produce ions of gaseous elements. At the same time, ICP ion sources offer high angular current density which is an important factor in producing high current in small spot size on the target. These high current microprobes improve the signal to noise ratio by three orders as compared to low current ion sources such as LMIS. In addition, the high current microprobes have higher surface and depth profiling speeds. In this article we describe a simple ion source in its very basic form, two lens optical column and characteristics of microprobe
Ion mixing and numerical simulation of different ions produced in the ECR ion source
International Nuclear Information System (INIS)
Shirkov, G.D.
1996-01-01
This paper is to continue theoretical investigations and numerical simulations in the physics of ECR ion sources within the CERN program on heavy ion acceleration. The gas (ion) mixing effect in ECR sources is considered here. It is shown that the addition of light ions to the ECR plasma has three different mechanisms to improve highly charged ion production: the increase of confinement time and charge state of highly ions as the result of ion cooling; the concentration of highly charged ions in the central region of the source with high energy and density of electrons; the increase of electron production rate and density of plasma. The numerical simulations of lead ion production in the mixture with different light ions and different heavy and intermediate ions in the mixture with oxygen, are carried out to predict the principal ECR source possibilities for LHC applications. 18 refs., 23 refs
Recoil ion spectroscopy with heavy ions
International Nuclear Information System (INIS)
Beyer, H.F.; Mann, R.
1984-01-01
This chapter examines the production of very high charge state ions in single ion-atom collisions. Topics considered include some aspects of highly ionized atoms, experimental approaches, the production of highly charged target ions (monoatomic targets, recoil energy distribution, molecular fragmentation, outer-shell rearrangement, lifetime measurements, a comparison of projectile-, target-, and plasma-ion stripping), and secondary collision experiments (selective electron capture, potential applications). The heavy-ion beams for the described experiments were provided by accelerators such as tandem Van de Graaff facility and the UNILAC
Surface negative ion production in ion sources
International Nuclear Information System (INIS)
Belchenko, Y.
1993-01-01
Negative ion sources and the mechanisms for negative ion production are reviewed. Several classes of sources with surface origin of negative ions are examined in detail: surface-plasma sources where ion production occurs on the electrode in contact with the plasma, and ''pure surface'' sources where ion production occurs due to conversion or desorption processes. Negative ion production by backscattering, impact desorption, and electron- and photo-stimulated desorption are discussed. The experimental efficiencies of intense surface negative ion production realized on electrodes contacted with hydrogen-cesium or pure hydrogen gas-discharge plasma are compared. Recent modifications of surface-plasma sources developed for accelerator and fusion applications are reviewed in detail
Molecular Basis of Cardiac Delayed Rectifier Potassium Channel Function and Pharmacology.
Wu, Wei; Sanguinetti, Michael C
2016-06-01
Human cardiomyocytes express 3 distinct types of delayed rectifier potassium channels. Human ether-a-go-go-related gene (hERG) channels conduct the rapidly activating current IKr; KCNQ1/KCNE1 channels conduct the slowly activating current IKs; and Kv1.5 channels conduct an ultrarapid activating current IKur. Here the authors provide a general overview of the mechanistic and structural basis of ion selectivity, gating, and pharmacology of the 3 types of cardiac delayed rectifier potassium ion channels. Most blockers bind to S6 residues that line the central cavity of the channel, whereas activators interact with the channel at 4 symmetric binding sites outside the cavity. Copyright © 2016 Elsevier Inc. All rights reserved.
A New Visualization Approach to Re-Contextualize Indigenous Knowledge in Rural Africa
DEFF Research Database (Denmark)
Rodil, Kasper; Winschiers-Theophilus, Heike; Bidwell, Nicola J.
2011-01-01
Current views of sustainable development recognize the importance of accepting the Indigenous Knowledge (IK) of rural people. However, there is an increasing technological gap between Elder IK holders and the younger generation and a persistent incompatibility between IK and the values, logics an...
CSIR Research Space (South Africa)
Khalala, G
2013-05-01
Full Text Available . The South African government adopted a policy in 2004; to develop the Indigenous Knowledge Systems (IKS). The policy provided a platform for the recognition, affirmation, development, promotion and protection of IKS in South Africa. The NRS initiative... that have attempted to implement IKS are highlighted below: 3.1 Biozulua database The Biozulua database initiative from Venezuela was established to record IK in order to encourage innovation using traditional knowledge and to facilitate the sharing...
International Nuclear Information System (INIS)
Salzborn, Erhard; Melchert, Frank
2000-01-01
Collisions between ions belong to the elementary processes occurring in all types of plasmas. In this article we give a short overview about collisions involving one-electron systems. For collisions involving multiply-charged ions we limit the discussion to one specific quasi-one-electron system. (author)
Numerical simulation of ion temperature gradient driven modes in the presence of ion-ion collisions
International Nuclear Information System (INIS)
Xu, X.Q.
1990-08-01
Ion temperature gradient driven modes in the presence of ion-ion collisions in a toroidal geometry with trapped ions have been studied by using a 1 2/2 d linearized gyro-kinetic particle simulation code in the electrostatic limit. The purpose of the investigation is to try to understand the physics of flat density discharges, in order to test the marginal stability hypothesis. Results giving threshold conditions of L Ti /R 0 , an upper bound on k χ , and linear growth rates and mode frequencies over all wavelengths for the collisionless ion temperature gradient driven modes are obtained. The behavior of ion temperature gradient driven instabilities in the transition from slab to toroidal geometry, with trapped ions, is shown. A Monte Carlo scheme for the inclusion of ion-ion collisions, in which ions can undergo Coulomb collisional dynamical friction, velocity space diffusion and random walk of guiding centers, has been constructed. The effects of ion-ion collisions on the long wave length limit of the ion modes is discussed. 44 refs., 12 figs
Scanning ion microscopy with low energy lithium ions
International Nuclear Information System (INIS)
Twedt, Kevin A.; Chen, Lei; McClelland, Jabez J.
2014-01-01
Using an ion source based on photoionization of laser-cooled lithium atoms, we have developed a scanning ion microscope with probe sizes of a few tens of nanometers and beam energies from 500 eV to 5 keV. These beam energies are much lower than the typical operating energies of the helium ion microscope or gallium focused ion beam systems. We demonstrate how low energy can be advantageous in ion microscopy when detecting backscattered ions, due to a decreased interaction volume and the potential for surface sensitive composition analysis. As an example application that demonstrates these advantages, we non-destructively image the removal of a thin residual resist layer during plasma etching in a nano-imprint lithography process. - Highlights: • We use an ion source based on photoionization of laser-cooled lithium atoms. • The ion source makes possible a low energy (500 eV to 5 keV) scanning ion microscope. • Low energy is preferred for ion microscopy with backscattered ions. • We use the microscope to image a thin resist used in nano-imprint lithography
Ma, Xiaohong; Shor, Oded; Diminshtein, Sofia; Yu, Ling; Im, Yang Ju; Perera, Imara; Lomax, Aaron; Boss, Wendy F.; Moran, Nava
2009-01-01
In the animal world, the regulation of ion channels by phosphoinositides (PIs) has been investigated extensively, demonstrating a wide range of channels controlled by phosphatidylinositol (4,5)bisphosphate (PtdInsP2). To understand PI regulation of plant ion channels, we examined the in planta effect of PtdInsP2 on the K+-efflux channel of tobacco (Nicotiana tabacum), NtORK (outward-rectifying K channel). We applied a patch clamp in the whole-cell configuration (with fixed “cytosolic” Ca2+ concentration and pH) to protoplasts isolated from cultured tobacco cells with genetically manipulated plasma membrane levels of PtdInsP2 and cellular inositol (1,4,5)trisphosphate: “Low PIs” had depressed levels of these PIs, and “High PIs” had elevated levels relative to controls. In all of these cells, K channel activity, reflected in the net, steady-state outward K+ currents (IK), was inversely related to the plasma membrane PtdInsP2 level. Consistent with this, short-term manipulations decreasing PtdInsP2 levels in the High PIs, such as pretreatment with the phytohormone abscisic acid (25 μm) or neutralizing the bath solution from pH 5.6 to pH 7, increased IK (i.e. NtORK activity). Moreover, increasing PtdInsP2 levels in controls or in abscisic acid-treated high-PI cells, using the specific PI-phospholipase C inhibitor U73122 (2.5–4 μm), decreased NtORK activity. In all cases, IK decreases stemmed largely from decreased maximum attainable NtORK channel conductance and partly from shifted voltage dependence of channel gating to more positive potentials, making it more difficult to activate the channels. These results are consistent with NtORK inhibition by the negatively charged PtdInsP2 in the internal plasma membrane leaflet. Such effects are likely to underlie PI signaling in intact plant cells. PMID:19052153
Lonkkaproteesipotilaan hoitopolku suunnitelluissa lonkkaleikkauksissa : DVD:n laatiminen
Rantanen, Petteri; Kesti, Jonas
2013-01-01
Hyvällä ja monipuolisella informaatiolla on suuri merkitys ikäihmisten käsityksiin ja ennakkoasenteisiin leikkaukseen mentäessä. Ikä asettaa usein rajoitteita tiedon vastaanottamisessa ja sen käsittelyssä. Vajavaiset tiedot johtavat ikäviin ennakko-asenteisiin ja pelkoihin leikkausta kohtaan. Monipuolisella tiedottamisella voidaan hälventää näitä ennakkoasenteita ja pelkotiloja. Tämän toiminnallisen opinnäytetyön tarkoituksena oli tuottaa informatiivinen video ikäihmisille lonkkaproteesile...
Lemas, Dominick J.; Wiener, Howard W.; O'Brien, Diane M.; Hopkins, Scarlett; Stanhope, Kimber L.; Havel, Peter J.; Allison, David B.; Fernandez, Jose R.; Tiwari, Hemant K.; Boyer, Bert B.
2012-01-01
Variants of carnitine palmitoyltransferase 1A (CPT1A), a key hepatic lipid oxidation enzyme, may influence how fatty acid oxidation contributes to obesity and metabolic outcomes. CPT1A is regulated by diet, suggesting interactions between gene variants and diet may influence outcomes. The objective of this study was to test the association of CPT1A variants with body composition and lipids, mediated by consumption of polyunsaturated fatty acids (PUFA). Obesity phenotypes and fasting lipids were measured in a cross-sectional sample of Yup'ik Eskimo individuals (n = 1141) from the Center of Alaska Native Health Research (CANHR) study. Twenty-eight tagging CPT1A SNPs were evaluated with outcomes of interest in regression models accounting for family structure. Several CPT1A polymorphisms were associated with HDL-cholesterol and obesity phenotypes. The P479L (rs80356779) variant was associated with all obesity-related traits and fasting HDL-cholesterol. Interestingly, the association of P479L with HDL-cholesterol was still significant after correcting for body mass index (BMI), percentage body fat (PBF), or waist circumference (WC). Our findings are consistent with the hypothesis that the L479 allele of the CPT1A P479L variant confers a selective advantage that is both cardioprotective (through increased HDL-cholesterol) and associated with reduced adiposity. PMID:22045927
Ion microtomography using ion time-of-flight
International Nuclear Information System (INIS)
Roberts, M.L.; Heikkinen, D.W.; Proctor, I.D.; Pontau, A.E.; Olona, G.T.; Felter, T.E.; Morse, D.H.; Hess, B.V.
1992-01-01
We have developed and are in the process of testing an ion time-of-flight (TOF) detector system for use in our ion microtomography measurements. Using TOF, ion energy is determined by measurement of the ion's flight time over a certain path length. For ion microtomography, the principle advantage of TOF analysis is that ion count rates of several hundred thousand counts per second can be achieved as compared to a limit of about ten thousand ions per second when using a solid-state silicon surface barrier detector and associated electronics. This greater than 10 fold increase in count rate correspondingly shortens sample analysis time or increases the amount of data that can be collected on a given sample. Details of the system and progress to date are described
International Nuclear Information System (INIS)
Dearnaley, Geoffrey
1975-01-01
First, ion implantation in semiconductors is discussed: ion penetration, annealing of damage, gettering, ion implanted semiconductor devices, equipement requirements for ion implantation. The importance of channeling for ion implantation is studied. Then, some applications of ion implantation in metals are presented: study of the corrosion of metals and alloys; influence or ion implantation on the surface-friction and wear properties of metals; hyperfine interactions in implanted metals
Ion Beam Extraction by Discrete Ion Focusing
DEFF Research Database (Denmark)
2010-01-01
An apparatus (900) and methods are disclosed for ion beam extraction. In an implementation, the apparatus includes a plasma source (or plasma) (802) and an ion extractor (804). The plasma source is adapted to generate ions and the ion extractor is immersed in the plasma source to extract a fracti...
Baird, Zane; Wei, Pu; Cooks, R Graham
2015-02-07
A method is presented in which ions are generated and manipulated in the ambient environment using polymeric electrodes produced with a consumer-grade 3D printer. The ability to focus, separate, react, and detect ions in the ambient environment is demonstrated and the data agree well with simulated ion behaviour.
Nanodispersed Suspensions of Zeolite Catalysts for Converting Dimethyl Ether into Olefins
Kolesnichenko, N. V.; Yashina, O. V.; Ezhova, N. N.; Bondarenko, G. N.; Khadzhiev, S. N.
2018-01-01
Nanodispersed suspensions that are effective in DME conversion and stable in the reaction zone in a three-phase system (slurry reactor) are obtained from MFI zeolite commercial samples (TsVM, IK-17-1, and CBV) in liquid media via ultrasonic treatment (UST). It is found that the dispersion medium, in which ultrasound affects zeolite commercial sample, has a large influence on particle size in the suspension. UST in the aqueous medium produces zeolite nanoparticles smaller than 50 nm, while larger particles of MFI zeolite samples form in silicone or hydrocarbon oils. Spectral and adsorption data show that when zeolites undergo UST in an aqueous medium, the acid sites are redistributed on the zeolite surface and the specific surface area of the mesopores increases. Preliminary UST in aqueous media of zeolite commercial samples (TsVM, IK-17-1, and CBV) affects the catalytic properties of MFI zeolite nanodispersed suspensions. The selectivity of samples when paraffins and olefins form is largely due to superacid sites consisting of OH groups of hydroxonium ion H3O+.
Study of ion exchange equilibrium and determination of heat of ion exchange by ion chromatography
International Nuclear Information System (INIS)
Liu Kailu; Yang Wenying
1996-01-01
Ion chromatography using pellicularia ion exchange resins and dilute solution can be devoted to the study of ion exchange thermodynamics and kinetics. Ion exchange equilibrium equation was obtained, and examined by the experiments. Based on ion exchange equilibrium, the influence of eluent concentration and resin capacity on adjusted retention volumes was examined. The effect of temperature on adjusted retention volumes was investigated and heats of ion exchange of seven anions were determined by ion chromatography. The interaction between anions and skeleton structure of resins were observed
Excitation of VLF quasi-electrostatic oscillations in the ionospheric plasma
Directory of Open Access Journals (Sweden)
B. Lundin
Full Text Available A numerical solution of the dispersion equation for electromagnetic waves in a hot magnetized collisionless plasma has shown that, in a current-free ionospheric plasma, the distortion of the electron distribution function reproducing the downward flow of a thermal electron component and the compensating upward flow of the suprathermal electrons, which are responsible for the resulting heat flux, can destabilize quasi-electrostatic ion sound waves. The numerical analysis, performed with ion densities and electron temperature taken from the data recorded by the Interkosmos-24 (IK-24, Aktivny satellite, is compared with a VLF spectrum registered at the same time on board. This spectrum shows a wide frequency band emission below the local ion plasma frequency. The direction of the electron heat flux inherent to the assumed model of VLF emission generation is discussed
Excitation of VLF quasi-electrostatic oscillations in the ionospheric plasma
Directory of Open Access Journals (Sweden)
B. Lundin
1996-01-01
Full Text Available A numerical solution of the dispersion equation for electromagnetic waves in a hot magnetized collisionless plasma has shown that, in a current-free ionospheric plasma, the distortion of the electron distribution function reproducing the downward flow of a thermal electron component and the compensating upward flow of the suprathermal electrons, which are responsible for the resulting heat flux, can destabilize quasi-electrostatic ion sound waves. The numerical analysis, performed with ion densities and electron temperature taken from the data recorded by the Interkosmos-24 (IK-24, Aktivny satellite, is compared with a VLF spectrum registered at the same time on board. This spectrum shows a wide frequency band emission below the local ion plasma frequency. The direction of the electron heat flux inherent to the assumed model of VLF emission generation is discussed
Polyatomic ions from a high current ion implanter driven by a liquid metal ion source
Pilz, W.; Laufer, P.; Tajmar, M.; Böttger, R.; Bischoff, L.
2017-12-01
High current liquid metal ion sources are well known and found their first application as field emission electric propulsion thrusters in space technology. The aim of this work is the adaption of such kind of sources in broad ion beam technology. Surface patterning based on self-organized nano-structures on, e.g., semiconductor materials formed by heavy mono- or polyatomic ion irradiation from liquid metal (alloy) ion sources (LMAISs) is a very promising technique. LMAISs are nearly the only type of sources delivering polyatomic ions from about half of the periodic table elements. To overcome the lack of only very small treated areas by applying a focused ion beam equipped with such sources, the technology taken from space propulsion systems was transferred into a large single-end ion implanter. The main component is an ion beam injector based on high current LMAISs combined with suited ion optics allocating ion currents in the μA range in a nearly parallel beam of a few mm in diameter. Different types of LMAIS (needle, porous emitter, and capillary) are presented and characterized. The ion beam injector design is specified as well as the implementation of this module into a 200 kV high current ion implanter operating at the HZDR Ion Beam Center. Finally, the obtained results of large area surface modification of Ge using polyatomic Bi2+ ions at room temperature from a GaBi capillary LMAIS will be presented and discussed.
Zhu, Yujie; Ai, Xun; Oster, Robert A; Bers, Donald M; Pogwizd, Steven M
2013-06-01
Slow delayed rectifier potassium current (IKs) is important in action potential (AP) repolarization and repolarization reserve. We tested the hypothesis that there are sex-specific differences in IKs, AP, and their regulation by β-adrenergic receptors (β-AR's) using whole-cell patch-clamp. AP duration (APD90) was significantly longer in control female (F) than in control male (M) myocytes. Isoproterenol (ISO, 500 nM) shortened APD90 comparably in M and F, and was largely reversed by β1-AR blocker CGP 20712A (CGP, 300 nM). Inhibition of IKs with chromanol 293B (10 μM) resulted in less APD prolongation in F at baseline (3.0 vs 8.9 %, p < 0.05 vs M) and even in the presence of ISO (5.4 vs 20.9 %, p < 0.05). This suggests that much of the ISO-induced APD abbreviation in F is independent of IKs. In F, baseline IKs was 42 % less and was more weakly activated by ISO (19 vs 68 % in M, p < 0.01). ISO enhancement of IKs was comparably attenuated by CGP in M and F. After ovariectomy, IKs in F had greater enhancement by ISO (72 %), now comparable to control M. After orchiectomy, IKs in M was only slightly enhanced by ISO (23 %), comparable to control F. Pretreatment with thapsigargin (to block SR Ca release) had bigger impact on ISO-induced APD shortening in F than that in M (p < 0.01). In conclusion, we found that there are sex differences in IKs, AP, and their regulation by β-AR's that are modulated by sex hormones, suggesting the potential for sex-specific antiarrhythmic therapy.
Mohatt, Gerald V; Fok, Carlotta Ching Ting; Henry, David; Allen, James
2014-09-01
The Elluam Tungiinun and Yupiucimta Asvairtuumallerkaa studies evaluated the feasibility of a community intervention to prevent suicide and alcohol abuse among rural Yup'ik Alaska Native youth in two remote communities. The intervention originated in an Indigenous model of protection, and its development used a community based participatory research process. Feasibility assessment aimed to assess the extent to which (1) the intervention could be implemented in rural Alaska Native communities, and (2) the intervention was capable of producing measurable effects. Scales maximally sensitive to change were derived from earlier measurement work, and the study contrasted implementation process and outcomes across the two communities. In one community, medium dose response effects (d = .30-.50), with dose defined as number of intervention activities attended, were observed in the growth of intermediate protective factors and ultimate variables. In the other community, medium dose effects were observed for one intermediate protective factor variable, and small dose effects were observed in ultimate variables. Differences across communities in resources supporting intervention explain these contrasting outcomes. Results suggest implementation in these rural Alaska settings is feasible when sufficient resources are available to sustain high levels of local commitment. In such cases, measureable effects are sufficient to warrant a prevention trial.
Experimental Evaluation of a Negative Ion Source for a Heavy Ion Fusion Negative Ion Driver
International Nuclear Information System (INIS)
Grisham, L.R.; Hahto, S.K.; Hahto, S.T.; Kwan, J.W.; Leung, K.N.
2004-01-01
Negative halogen ions have recently been proposed as a possible alternative to positive ions for heavy ion fusion drivers because electron accumulation would not be a problem in the accelerator, and if desired, the beams could be photo-detached to neutrals. To test the ability to make suitable quality beams, an experiment was conducted at Lawrence Berkeley National Laboratory using chlorine in an RF-driven ion source. Without introducing any cesium (which is required to enhance negative ion production in hydrogen ion sources) a negative chlorine current density of 45 mA/cm 2 was obtained under the same conditions that gave 57 45 mA/cm 2 of positive chlorine, suggesting the presence of nearly as many negative ions as positive ions in the plasma near the extraction plane. The negative ion spectrum was 99.5% atomic chlorine ions, with only 0.5% molecular chlorine, and essentially no impurities. Although this experiment did not incorporate the type of electron suppression technology that i s used in negative hydrogen beam extraction, the ratio of co-extracted electrons to Cl - was as low as 7 to 1, many times lower than the ratio of their mobilities, suggesting that few electrons are present in the near-extractor plasma. This, along with the near-equivalence of the positive and negative ion currents, suggests that the plasma in this region was mostly an ion-ion plasma. The negative chlorine current density was relatively insensitive to pressure, and scaled linearly with RF power. If this linear scaling continues to hold at higher RF powers, it should permit current densities of 100 45 mA/cm 2 , sufficient for present heavy ion fusion injector concepts. The effective ion temperatures of the positive and negative ions appeared to be similar and relatively low for a plasma source
Laser-cooled atomic ions as probes of molecular ions
Energy Technology Data Exchange (ETDEWEB)
Brown, Kenneth R.; Viteri, C. Ricardo; Clark, Craig R.; Goeders, James E.; Khanyile, Ncamiso B.; Vittorini, Grahame D. [Schools of Chemistry and Biochemistry, Computational Science and Engineering and Physics, Georgia Institute of Technology, Atlanta, GA 30332 (United States)
2015-01-22
Trapped laser-cooled atomic ions are a new tool for understanding cold molecular ions. The atomic ions not only sympathetically cool the molecular ions to millikelvin temperatures, but the bright atomic ion fluorescence can also serve as a detector of both molecular reactions and molecular spectra. We are working towards the detection of single molecular ion spectra by sympathetic heating spectroscopy. Sympathetic heating spectroscopy uses the coupled motion of two trapped ions to measure the spectra of one ion by observing changes in the fluorescence of the other ion. Sympathetic heating spectroscopy is a generalization of quantum logic spectroscopy, but does not require ions in the motional ground state or coherent control of the ion internal states. We have recently demonstrated this technique using two isotopes of Ca{sup +} [Phys. Rev. A, 81, 043428 (2010)]. Limits of the method and potential applications for molecular spectroscopy are discussed.
A novel ion imager for secondary ion mass spectrometry
International Nuclear Information System (INIS)
Matsumoto, Kazuya; Miyata, Kenji; Nakamura, Tsutomu
1993-01-01
This paper describes a new area detector for secondary ion mass spectrometry (SIMS) ion microscope, and its performance. The operational principle is based on detecting the change in potential of a floating photodiode caused by the ion-induced secondary-electron emission and the incoming ion itself. The experiments demonstrated that 10 1 -10 5 aluminum ions per pixel can be detected with good linear response. Moreover, relative ion sensitivities from hydrogen to lead were constant within a factor of 2. The performance of this area detector provides the potential for detection of kiloelectronvolt ion images with current ion microscopy
International Nuclear Information System (INIS)
Grisham, L.R.; Kwan, J.W.
2008-01-01
Some years ago it was suggested that halogen negative ions could offer a feasible alternative path to positive ions as a heavy ion fusion driver beam which would not suffer degradation due to electron accumulation in the accelerator and beam transport system, and which could be converted to a neutral beam by photodetachment near the chamber entrance if desired. Since then, experiments have demonstrated that negative halogen beams can be extracted and accelerated away from the gas plume near the source with a surviving current density close to what could be achieved with a positive ion of similar mass, and with comparable optical quality. In demonstrating the feasibility of halogen negative ions as heavy ion driver beams, ion - ion plasmas, an interesting and somewhat novel state of matter, were produced. These plasmas, produced near the extractor plane of the sources, appear, based upon many lines of experimental evidence, to consist of almost equal densities of positive and negative chlorine ions, with only a small component of free electrons. Serendipitously, the need to extract beams from this plasma for driver development provides a unique diagnostic tool to investigate the plasma, since each component - positive ions, negative ions, and electrons - can be extracted and measured separately. We discuss the relevance of these observations to understanding negative ion beam extraction from electronegative plasmas such as halogens, or the more familiar hydrogen of magnetic fusion ion sources. We suggest a concept which might improve negative hydrogen extraction by the addition of a halogen. The possibility and challenges of producing ion - ion plasmas with thin targets of halogens or, perhaps, salt, is briefly addressed.
International Nuclear Information System (INIS)
Grisham, L.R.; Kwan, J.W.
2008-01-01
Some years ago it was suggested that halogen negative ions (1)could offer a feasible alternative path to positive ions as a heavy ion fusion driver beam which would not suffer degradation due to electron accumulation in the accelerator and beam transport system, and which could be converted to a neutral beam by photodetachment near the chamber entrance if desired. Since then, experiments have demonstrated that negative halogen beams can be extracted and accelerated away from the gas plume near the source with a surviving current density close to what could be achieved with a positive ion of similar mass, and with comparable optical quality. In demonstrating the feasibility of halogen negative ions as heavy ion driver beams, ion-ion plasmas, an interesting and somewhat novel state of matter, were produced. These plasmas, produced near the extractor plane of the sources, appear, based upon many lines of experimental evidence, to consist of almost equal densities of positive and negative chlorine ions, with only a small component of free electrons. Serendipitously, the need to extract beams from this plasma for driver development provides a unique diagnostic tool to investigate the plasma, since each component--positive ions, negative ions, and electrons--can be extracted and measured separately. We discuss the relevance of these observations to understanding negative ion beam extraction from electronegative plasmas such as halogens, or the more familiar hydrogen of magnetic fusion ion sources. We suggest a concept which might improve negative hydrogen extraction by the addition of a halogen. The possibility and challenges of producing ion-ion plasmas with thin targets of halogens or, perhaps, salt, is briefly addressed
Software architecture for an indigenous knowledge management system
CSIR Research Space (South Africa)
Fogwill, T
2011-11-01
Full Text Available in technological land- scape. It preserves IK in a digital form that remains acces- sible to the original IK holders. It does so by recording and archiving audio/visual content that captures, to the extent possible, the oral, visual and performed aspects of IK...-end (described in section 6.2). The knowledge repository and the Fedora technology at its core are described in this section. The DKR stores and maintains digital audio/visual record- ings of the captured IK. While these audio/visual record- ings may...
Liu, Xuehan; Xie, Na; Li, Wei; Zhou, Ziyao; Zhong, Zhijun; Shen, Liuhong; Cao, Suizhong; Yu, Xingming; Hu, Yanchuan; Chen, Weigang; Peng, Gangneng
2015-01-01
A single Cryptosporidium isolate from a squirrel monkey with no clinical symptoms was obtained from a zoo in Ya'an city, China, and was genotyped by PCR amplification and DNA sequencing of the small-subunit ribosomal RNA (SSU rRNA), 70-kDa heat shock protein (HSP70), Cryptosporidium oocyst wall protein, and actin genes. This multilocus genetic characterization determined that the isolate was Cryptosporidium hominis, but carried 2, 10, and 6 nucleotide differences in the SSU rRNA, HSP70, and actin loci, respectively, which is comparable to the variations at these loci between C. hominis and the previously reported monkey genotype (2, 3, and 3 nucleotide differences). Phylogenetic studies, based on neighbor-joining and maximum likelihood methods, showed that the isolate identified in the current study had a distinctly discordant taxonomic status, distinct from known C. hominis and also from the monkey genotype, with respect to the three loci. Restriction fragment length polymorphisms of the SSU rRNA gene obtained from this study were similar to those of known C. hominis but clearly differentiated from the monkey genotype. Further subtyping was performed by sequence analysis of the gene encoding the 60-kDa glycoprotein (gp60). Maximum homology of only 88.3% to C. hominis subtype IdA10G4 was observed for the current isolate, and phylogenetic analysis demonstrated that this particular isolate belonged to a novel C. hominis subtype family, IkA7G4. This study is the first to report C. hominis infection in the squirrel monkey and, based on the observed genetic characteristics, confirms a new C. hominis genotype, monkey genotype II. Thus, these results provide novel insights into genotypic variation in C. hominis.
Harnessing indigenous knowledge for sustainable forest management in Ghana
Directory of Open Access Journals (Sweden)
Margaret Sraku-Lartey
2015-01-01
Full Text Available This paper makes a case for harnessing indigenous knowledge (IK for sustainable national development in Ghana. IK according to the World Bank is the basic component of any country’s knowledge system and it is upon this knowledge that scientific research builds. In Ghana the Government has recognized the need to harness IK for sustainable national development and has therefore incorporated it into the National Science, Technology and Innovation Development Programme. But there is no evidence however that scientific research in Ghana actually takes IK into consideration during the research process. This paper discusses the concept of indigenous knowledge, its relevance in scientific discourse and the need for harnessing it for national development in Ghana. A desk study was conducted using journal publications, research and technical reports, online databases and the internet. About sixty articles were analysed using the thematic synthesis method under the following broad headings: Importance of Indigenous knowledge, Indigenous forest foods, Indigenous medicines, IK and food security, the management and processing of IK and the protection of Indigenous Knowledge.The results of the study established the need to document the local knowledge using appropriate procedures and strategies. It also concludes by suggesting that IK in Ghana must be protected by law and integrated into formal science.
It Matters Who You Are: Indigenous Knowledge Research and Researchers
Keane, Moyra; Khupe, Constance; Muza, Blessings
2016-01-01
It is common for researchers in Indigenous Knowledge (IK) in science education research to draw on aspects of the scientific paradigm from their science training. The consequent research seeks to be objective. This paradigm is not necessarily appropriate for IK research. While there have been calls for IK-aligned methodologies (Chilisa 2012; Keane…
DEFF Research Database (Denmark)
Hayashi, Mikio; Wang, Jing; Hede, Susanne Edeling
2012-01-01
2; Slack; Slick; and an intermediate-conductance Ca(2+)-activated K(+) (IK) channel (K(Ca)3.1). The following functional studies were focused on the IK channel. 5,6-Dichloro-1-ethyl-1,3-dihydro-2H-benzimidazole-2-one (DC-EBIO), an activator of IK channel, increased equivalent short-circuit current...
Lifescience Database Archive (English)
Full Text Available QPPAN SAGCWNILTYQPLEGYVVAISPFNFTAIGLNLSSAPALMGNVVLWKPASTAVL--- ---IKDRLGYWC*ik*kmgqsddfssfvsavidknsfnniqsyieha...i*vqpql*wvmlsfgsllqllsy--- ---IKDRLGYWC*ik*kmgqsddfssfvsavidknsfnniqsyiehakaspdaeiivggk cdssvgwfveptiilakdph
Design study of primary ion provider for relativistic heavy ion collider electron beam ion source.
Kondo, K; Kanesue, T; Tamura, J; Okamura, M
2010-02-01
Brookhaven National Laboratory has developed the new preinjector system, electron beam ion source (EBIS) for relativistic heavy ion collider (RHIC) and National Aeronautics and Space Administration Space Radiation Laboratory. Design of primary ion provider is an essential problem since it is required to supply beams with different ion species to multiple users simultaneously. The laser ion source with a defocused laser can provide a low charge state and low emittance ion beam, and is a candidate for the primary ion source for RHIC-EBIS. We show a suitable design with appropriate drift length and solenoid, which helps to keep sufficient total charge number with longer pulse length. The whole design of primary ion source, as well as optics arrangement, solid targets configuration and heating about target, is presented.
Ion-Beam-Excited Electrostatic Ion Cyclotron Waves
DEFF Research Database (Denmark)
Michelsen, Poul; Pécseli, Hans; Juul Rasmussen, Jens
1976-01-01
Self-excited electrostatic ion cyclotron waves were observed in an ion-beam-plasma system produced in a DP-operated Q-machine. The frequency of the waves showed the theoretically predicted variation with the magnetic field.......Self-excited electrostatic ion cyclotron waves were observed in an ion-beam-plasma system produced in a DP-operated Q-machine. The frequency of the waves showed the theoretically predicted variation with the magnetic field....
Ion mobilities and ion-atom interaction potentials
International Nuclear Information System (INIS)
Gatland, I.R.
1982-01-01
The techniques for measuring the mobilities of ions in gases, relating interaction potentials to mobilities, and determining potentials from experimental mobilities are reviewed. Applications are presented for positive alkali ions and negative halogen ions in inert gases. (Auth.)
Low-altitude ion heating with downflowing and upflowing ions
Shen, Y.; Knudsen, D. J.; Burchill, J. K.; Howarth, A. D.; Yau, A. W.; James, G.; Miles, D.; Cogger, L. L.; Perry, G. W.
2017-12-01
Mechanisms that energize ions at the initial stage of ion upflow are still not well understood. We statistically investigate ionospheric ion energization and field-aligned motion at very low altitudes (330-730 km) using simultaneous plasma, magnetic field, wave electric field and optical data from the e-POP satellite. The high-time-resolution (10 ms) dataset enables us to study the micro-structures of ion heating and field-aligned ion motion. The ion temperature and field-aligned bulk flow velocity are derived from 2-D ion distribution functions measured by the SEI instrument. From March 2015 to March 2016, we've found 17 orbits (in total 24 ion heating periods) with clear ion heating signatures passing across the dayside cleft or the nightside auroral regions. Most of these events have consistent ion heating and flow velocity characteristics observed from both the SEI and IRM instruments. The perpendicular ion temperature goes up to 4.5 eV within a 2 km-wide region in some cases, in which the Radio Receiver Instrument (RRI) sees broadband extremely low frequency (BBELF) waves, demonstrating significant wave-ion heating down to as low as 350 km. The e-POP Fast Auroral Imager (FAI) and Magnetic Field (MGF) instruments show that many events are associated with active aurora and are within downward current regions. Contrary to what would be expected from mirror-force acceleration of heated ions, the majority of these heating events (17 out of 24) are associated with the core ion downflow rather than upflow. These statistical results provide us with new sights into ion heating and field-aligned flow processes at very low altitudes.
Design and simulation of ion optics for ion sources for production of singly charged ions
Zelenak, A.; Bogomolov, S. L.
2004-05-01
During the last 2 years different types of the singly charged ion sources were developed for FLNR (JINR) new projects such as Dubna radioactive ion beams, (Phase I and Phase II), the production of the tritium ion beam and the MASHA mass separator. The ion optics simulations for 2.45 GHz electron cyclotron resonance source, rf source, and the plasma ion source were performed. In this article the design and simulation results of the optics of new ion sources are presented. The results of simulation are compared with measurements obtained during the experiments.
Design and simulation of ion optics for ion sources for production of singly charged ions
International Nuclear Information System (INIS)
Zelenak, A.; Bogomolov, S.L.
2004-01-01
During the last 2 years different types of the singly charged ion sources were developed for FLNR (JINR) new projects such as Dubna radioactive ion beams, (Phase I and Phase II), the production of the tritium ion beam and the MASHA mass separator. The ion optics simulations for 2.45 GHz electron cyclotron resonance source, rf source, and the plasma ion source were performed. In this article the design and simulation results of the optics of new ion sources are presented. The results of simulation are compared with measurements obtained during the experiments
Crater formation by single ions, cluster ions and ion "showers"
Djurabekova, Flyura; Timko, Helga; Nordlund, Kai; Calatroni, Sergio; Taborelli, Mauro; Wuensch, Walter
2011-01-01
The various craters formed by giant objects, macroscopic collisions and nanoscale impacts exhibit an intriguing resemblance in shapes. At the same time, the arc plasma built up in the presence of sufficiently high electric fields at close look causes very similar damage on the surfaces. Although the plasma–wall interaction is far from a single heavy ion impact over dense metal surfaces or the one of a cluster ion, the craters seen on metal surfaces after a plasma discharge make it possible to link this event to the known mechanisms of the crater formations. During the plasma discharge in a high electric field the surface is subject to high fluxes (~1025 cm-2s-1) of ions with roughly equal energies typically of the order of a few keV. To simulate such a process it is possible to use a cloud of ions of the same energy. In the present work we follow the effect of such a flux of ions impinging the surface in the ‘‘shower’’ manner, to find the transition between the different mechanisms of crater formati...
Single-ion conducting diblock terpolymers for lithium-ion batteries
Morris, Melody; Epps, Thomas H., III
Block polymer (BP) electrolytes provide an attractive route to overcome the competing constraints of high conductivity and mechanical/thermal stability in lithium-ion batteries through nanoscale self-assembly. For example, macromolecules can be engineered such that one domain conducts lithium ions and the other prevents lithium dendrite formation. Herein, we report on the behavior of a single-ion conducting BP electrolyte that was designed to facilitate the transport of lithium ions. These polymers differ from traditional salt-doped BP electrolytes, which require the addition of a lithium salt to bestow conductivity and typically suffer from substantial counterion motion that reduces efficiency. New single-ion BPs were synthesized, and the nanoscale morphologies were determined using small angle X-ray scattering and transmission electron microscopy. Electrolyte performance was measured using AC impedance spectroscopy and DC polarization, and the results were correlated to nanoscale morphology and ion content. Enhanced physical understanding of single-ion BPs was gained by connecting the ion mobility to the chemistry, chain structure, and ion content of the single-ion BP. These studies can be applied to other charged-neutral block polymers to elucidate the effects of ion content on self-assembly and macroscopic properties.
Directory of Open Access Journals (Sweden)
Mukundi Mutasa
2015-05-01
Full Text Available Indigenous knowledge (IK is a key component of disaster risk management (DRM and development planning, yet it is often overlooked, with practitioners preferring to use scientific knowledge. Critics of IK have termed it archaic, primitive, a constraint to development and inferior to scientific knowledge, which has contributed to its widespread marginalisation. However, smallholder farmers in rural Zimbabwe have utilised IK for generations, especially in predicting rainfall patterns and managing drought conditions, showing that IK can be a useful tool in DRM. This article presents findings from research on drought vulnerability and coping conducted in Zimbabwe’s Buhera and Chikomba districts in 2009, particularly relating to utilisation of IK in smallholder farming communities, and argues that unless IK is documented and preserved, its marginalisation will persist. The research followed a mixed-methods approach whereby both quantitative and qualitative data were collected and analysed. Whilst smallholder respondents were randomly selected for household surveys, snowball sampling was employed for key informant interviews. Respondents indicated that they utilised some indigenous rainfall pattern predictions gained from observing and interpreting plant and animal behaviour. Some cultural practices that were critical to development and utilisation of certain IK were also threatened with extinction. The article argues for ’marrying’ IK and scientific knowledge, in the hope that the two will offset each other’s weaknesses, resulting in some kind of hybrid knowledge that will be critical for promoting sustainable agricultural production in Zimbabwe. However, this is not for disregard the challenges associated with knowledge hybridisation, as these two types of knowledge are grounded on differing foundations.
Enhanced ion acoustic fluctuations and ion outflows
Directory of Open Access Journals (Sweden)
F. R. E. Forme
1999-02-01
Full Text Available A number of observations showing enhanced ion acoustic echoes observed by means of incoherent scatter radars have been reported in the literature. The received power is extremely enhanced by up to 1 or 2 orders of magnitude above usual values, and it is mostly contained in one of the two ion acoustic lines. This spectral asymmetry and the intensity of the received signal cannot be resolved by the standard analysis procedure and often causes its failure. As a result, and in spite of a very clear spectral signature, the analysis is unable to fit the plasma parameters inside the regions of ion acoustic turbulence. We present European Incoherent Scatter radar (EISCAT observations of large ion outflows associated with the simultaneous occurrence of enhanced ion acoustic echoes. The ion fluxes can reach 1014 m-2 s-1 at 800 km altitude. From the very clear spectral signatures of these echoes, a method is presented to extract estimates of the electron temperature and the ion drift within the turbulent regions. It is shown that the electron gas is strongly heated up to 11 000 K. Also electron temperature gradients of about 0.02 K/m exist. Finally, the estimates of the electron temperature and of the ion drift are used to study the possible implications for the plasma transport inside turbulent regions. It is shown that strong electron temperature gradients cause enhancement of the ambipolar electric field and can account for the observed ion outflows.Key words. Ionosphere (auroral ionosphere; ionosphere · magnetosphere interactions; plasma waves and instabilities.
Mareš, Jan
2011-01-01
Arvustus: Libri civitatis I. Pamĕtni kniha mĕsta českế lipy (Gedenkbuch der Stadt Böhmisch Leipa) 1461-1722. (Ǘstí nad Labem, 2005) ; Libri civitatis II. Rejstřik stavby děkanského kostela nanebevzetí panny Marie v mostě (Bauregister der Dekanalkirche Maria Himmelfahrt in Brüx) 1517-1519. (Ǘstí nad Labem, 2006) ; Libri civitatis II. Městká kniha litoměřic (1341)-1562 v kontextu písemností městké kanceláre (Stadtbuch von Leitmeritz (1341)-1562 im Kontext des Schiftgutes der Stadtkanzlei (Ǘstí nad Labem, 2006)
Ion sources for heavy ion fusion
International Nuclear Information System (INIS)
Yu, S.S.; Eylon, S.; Chupp, W.
1995-09-01
The development of ion sources for heavy ion fusion will be reported with particular emphasis on a recently built 2 MV injector. The new injector is based on an electrostatic quadrupole configuration, and has produced pulsed K + ions of 950 mA peak from a 6.7 inch curved alumino silicate source. The ion beam has reached 2.3 MV with an energy flatness of ±0.2% over 1 micros. The measured normalized edge emittance of less than 1 π mm-mr is close to the source temperature limit. The design, construction, performance, and comparisons with three-dimensional particle-in-cell simulations will be described
Ion-ion interaction and energy transfer of 4+ transuranium ions in cerium tetrafluoride
International Nuclear Information System (INIS)
Liu, G.K.; Beitz, J.V.
1990-01-01
Dynamics of excited 5f electron states of the transuranium ions Cm 4+ and Bk 4+ in CeF 4 are compared. Based on time- and wavelength-resolved laser-induced fluorescence, excitation energy transfer processes have been probed. Depending on concentration and electronic energy level structure of the studied 4+ transuranium ion, the dominant energy transfer mechanisms were identified as cross relaxation, exciton-exciton annihilation, and trapping. Energy transfer rates derived from the fitting of the observed fluorescence decays to theoretical models, based on electric multipolar ion-ion interactions, are contrasted with prior studies of 4f states of 3+ lanthanide and 3d states of transition metal ions. 16 refs., 1 tab
Polyunsaturated fatty acid analogs act antiarrhythmically on the cardiac IKs channel
DEFF Research Database (Denmark)
Liin, Sara I.; Silverå Ejneby, Malin; Barro-Soria, Rene
2015-01-01
Polyunsaturated fatty acids (PUFAs) affect cardiac excitability. Kv7.1 and the β-subunit KCNE1 form the cardiac IKs channel that is central for cardiac repolarization. In this study, we explore the prospects of PUFAs as IKs channel modulators. We report that PUFAs open Kv7.1 via an electrostatic...... charge at neutral pH, restore the sensitivity to open IKs channels. PUFA analogs with a positively charged head group inhibit IKs channels. These different PUFA analogs could be developed into drugs to treat cardiac arrhythmias. In support of this possibility, we show that PUFA analogs act...
International Nuclear Information System (INIS)
McKinney, C.R.
1980-01-01
An ion beam analyzer is specified, having an ion source for generating ions of a sample to be analyzed, means for extracting the sample ions, means for focusing the sample ions into a beam, separation means positioned along the ion beam for selectively deflecting species of ions, and means for detecting the selected species of ions. According to the specification, the analyzer further comprises (a) means for disabling at least a portion of the separation means, such that the ion beam from the source remains undeflected; (b) means located along the path of the undeflected ion beam for sensing the sample ions; and (c) enabling means responsive to the sensing means for automatically re-enabling the separation means when the sample ions reach a predetermined intensity level. (author)
Ion acoustic solitons/double layers in two-ion plasma revisited
International Nuclear Information System (INIS)
Lakhina, G. S.; Singh, S. V.; Kakad, A. P.
2014-01-01
Ion acoustic solitons and double layers are studied in a collisionless plasma consisting of cold heavier ion species, a warm lighter ion species, and hot electrons having Boltzmann distributions by Sagdeev pseudo-potential technique. In contrast to the previous results, no double layers and super-solitons are found when both the heavy and lighter ion species are treated as cold. Only the positive potential solitons are found in this case. When the thermal effects of the lighter ion species are included, in addition to the usual ion-acoustic solitons occurring at M > 1 (where the Mach number, M, is defined as the ratio of the speed of the solitary wave and the ion-acoustic speed considering temperature of hot electrons and mass of the heavier ion species), slow ion-acoustic solitons/double layers are found to occur at low Mach number (M < 1). The slow ion-acoustic mode is actually a new ion-ion hybrid acoustic mode which disappears when the normalized number density of lighter ion species tends to 1 (i.e., no heavier species). An interesting property of the new slow ion-acoustic mode is that at low number density of the lighter ion species, only negative potential solitons/double layers are found whereas for increasing densities there is a transition first to positive solitons/double layers, and then only positive solitons. The model can be easily applicable to the dusty plasmas having positively charged dust grains by replacing the heavier ion species by the dust mass and doing a simple normalization to take account of the dust charge
International Nuclear Information System (INIS)
Ishikawa, Junzo; Takagi, Toshinori
1983-01-01
Negative ion sources have been originally developed at the request of tandem electrostatic accelerators, and hundreds of nA to several μA negative ion current has been obtained so far for various elements. Recently, the development of large current hydrogen negative ion sources has been demanded from the standpoint of the heating by neutral particle beam injection in nuclear fusion reactors. On the other hand, the physical properties of negative ions are interesting in the thin film formation using ions. Anyway, it is the present status that the mechanism of negative ion action has not been so fully investigated as positive ions because the history of negative ion sources is short. In this report, the many mechanisms about the generation of negative ions proposed so far are described about negative ion generating mechanism, negative ion source plasma, and negative ion generation on metal surfaces. As a result, negative ion sources are roughly divided into two schemes, plasma extraction and secondary ion extraction, and the former is further classified into the PIG ion source and its variation and Duoplasmatron and its variation; while the latter into reflecting and sputtering types. In the second half of the report, the practical negative ion sources of each scheme are described. If the mechanism of negative ion generation will be investigated more in detail and the development will be continued under the unified know-how as negative ion sources in future, the development of negative ion sources with which large current can be obtained for any element is expected. (Wakatsuki, Y.)
Experiments on Ion-Ion Plasmas From Discharges
Leonhardt, Darrin; Walton, Scott; Blackwell, David; Murphy, Donald; Fernsler, Richard; Meger, Robert
2001-10-01
Use of both positive and negative ions in plasma processing of materials has been shown to be advantageous[1] in terms of better feature evolution and control. In this presentation, experimental results are given to complement recent theoretical work[2] at NRL on the formation and decay of pulsed ion-ion plasmas in electron beam generated discharges. Temporally resolved Langmuir probe and mass spectrometry are used to investigate electron beam generated discharges during the beam on (active) and off (afterglow) phases in a variety of gas mixtures. Because electron-beam generated discharges inherently[3] have low electron temperatures (<0.5eV in molecular gases), negative ion characteristics are seen in the active as well as afterglow phases since electron detachment increases with low electron temperatures. Analysis of temporally resolved plasma characteristics deduced from these measurements will be presented for pure O_2, N2 and Ar and their mixtures with SF_6. Oxygen discharges show no noticeable negative ion contribution during the active or afterglow phase, presumably due to the higher energy electron attachment threshold, which is well above any electron temperature. In contrast, SF6 discharges demonstrate ion-ion plasma characteristics in the active glow and are completely ion-ion in the afterglow. Comparison between these discharges with published cross sections and production mechanisms will also be presented. [1] T.H. Ahn, K. Nakamura & H. Sugai, Plasma Sources Sci. Technol., 5, 139 (1996); T. Shibyama, H. Shindo & Y. Horiike, Plasma Sources Sci. Technol., 5, 254 (1996). [2] See presentation by R. F. Fernsler, at this conference. [3] D. Leonhardt, et al., 53rd Annual GEC, Houston, TX.
Detection of gold cluster ions by ion-to-ion conversion using a CsI-converter
International Nuclear Information System (INIS)
Nguyen, V.-T.; Novilkov, A.C.; Obnorskii, V.V.
1997-01-01
Gold cluster ions in the m/z range of 10 4 -2 x 10 6 u were produced by bombarding a thin film of gold with 252 Cf-fission fragments. The gold covering a C-Al substrate formed islets having a mean diameter of 44 A. Their size- and mass-distribution was determined by means of electron microscopy. The main task was to measure the m/z distribution of the cluster ions ejected from the sample surface. For this purpose we built a time-of-flight (TOF) mass spectrometer, which could be used as a linear TOF instrument or, alternatively, as a tandem-TOF instrument being equipped with an ion-to-ion converter. Combining the results obtained in both modes, it turned out that the linear TOF instrument equipped with micro-channel plates had a mean detection efficiency for 20 keV cluster ions of about 40%. In the tandem mode, the cluster ions hit a CsI converter with energies of 40z keV (z = charge state), from where secondary ions - mainly Cs + and (CsI) n Cs + cluster ions - were ejected. These ions were used to measure the TOF spectrum of the gold cluster ions. The detection efficiency of the cluster ions was found to vary in the available mass range from 99.7% to 96.5%. The complete mass distribution between 4 x 10 4 and 4 x 10 6 u was determined and compared with the corresponding mass distribution of the gold islets covering the substrate. (orig.)
Aflaki, Mona; Qi, Xiao-Yan; Xiao, Ling; Ordog, Balazs; Tadevosyan, Artavazd; Luo, Xiaobin; Maguy, Ange; Shi, Yanfen; Tardif, Jean-Claude; Nattel, Stanley
2014-03-14
β-Adrenoceptor activation contributes to sudden death risk in heart failure. Chronic β-adrenergic stimulation, as occurs in patients with heart failure, causes potentially arrhythmogenic reductions in slow delayed-rectifier K(+) current (IKs). To assess the molecular mechanisms of IKs downregulation caused by chronic β-adrenergic activation, particularly the role of exchange protein directly activated by cAMP (Epac). Isolated guinea pig left ventricular cardiomyocytes were incubated in primary culture and exposed to isoproterenol (1 μmol/L) or vehicle for 30 hours. Sustained isoproterenol exposure decreased IKs density (whole cell patch clamp) by 58% (P<0.0001), with corresponding decreases in potassium voltage-gated channel subfamily E member 1 (KCNE1) mRNA and membrane protein expression (by 45% and 51%, respectively). Potassium voltage-gated channel, KQT-like subfamily, member 1 (KCNQ1) mRNA expression was unchanged. The β1-adrenoceptor antagonist 1-[2-((3-Carbamoyl-4-hydroxy)phenoxy)ethylamino]-3-[4-(1-methyl-4-trifluoromethyl-2-imidazolyl)phenoxy]-2-propanol dihydrochloride (CGP-20712A) prevented isoproterenol-induced IKs downregulation, whereas the β2-antagonist ICI-118551 had no effect. The selective Epac activator 8-pCPT-2'-O-Me-cAMP decreased IKs density to an extent similar to isoproterenol exposure, and adenoviral-mediated knockdown of Epac1 prevented isoproterenol-induced IKs/KCNE1 downregulation. In contrast, protein kinase A inhibition with a cell-permeable highly selective peptide blocker did not affect IKs downregulation. 1,2-Bis(o-aminophenoxy)ethane-N,N,N',N'-tetraacetate-AM acetoxymethyl ester (BAPTA-AM), cyclosporine, and inhibitor of nuclear factor of activated T cell (NFAT)-calcineurin association-6 (INCA6) prevented IKs reduction by isoproterenol and INCA6 suppressed isoproterenol-induced KCNE1 downregulation, consistent with signal-transduction via the Ca(2+)/calcineurin/NFAT pathway. Isoproterenol induced nuclear NFATc3/c4
Highly Stripped Ion Sources for MeV Ion Implantation
Energy Technology Data Exchange (ETDEWEB)
Hershcovitch, Ady
2009-06-30
Original technical objectives of CRADA number PVI C-03-09 between BNL and Poole Ventura, Inc. (PVI) were to develop an intense, high charge state, ion source for MeV ion implanters. Present day high-energy ion implanters utilize low charge state (usually single charge) ion sources in combination with rf accelerators. Usually, a MV LINAC is used for acceleration of a few rnA. It is desirable to have instead an intense, high charge state ion source on a relatively low energy platform (de acceleration) to generate high-energy ion beams for implantation. This de acceleration of ions will be far more efficient (in energy utilization). The resultant implanter will be smaller in size. It will generate higher quality ion beams (with lower emittance) for fabrication of superior semiconductor products. In addition to energy and cost savings, the implanter will operate at a lower level of health risks associated with ion implantation. An additional aim of the project was to producing a product that can lead to long term job creation in Russia and/or in the US. R&D was conducted in two Russian Centers (one in Tomsk and Seversk, the other in Moscow) under the guidance ofPVI personnel and the BNL PI. Multiple approaches were pursued, developed, and tested at various locations with the best candidate for commercialization delivered and tested at on an implanter at the PVI client Axcelis. Technical developments were exciting: record output currents of high charge state phosphorus and antimony were achieved; a Calutron-Bemas ion source with a 70% output of boron ion current (compared to 25% in present state-of-the-art). Record steady state output currents of higher charge state phosphorous and antimony and P ions: P{sup 2+} (8.6 pmA), P{sup 3+} (1.9 pmA), and P{sup 4+} (0.12 pmA) and 16.2, 7.6, 3.3, and 2.2 pmA of Sb{sup 3+} Sb {sup 4 +}, Sb{sup 5+}, and Sb{sup 6+} respectively. Ultimate commercialization goals did not succeed (even though a number of the products like high
Development of focused ion beam systems with various ion species
International Nuclear Information System (INIS)
Ji Qing; Leung, K.-N.; King, Tsu-Jae; Jiang Ximan; Appleton, Bill R.
2005-01-01
Conventional focused ion beam systems employ a liquid-metal ion source (LMIS) to generate high-brightness beams, such as Ga + beams. Recently there has been an increased need for focused ion beams in areas like biological studies, advanced magnetic-film manufacturing and secondary-ion mass spectroscopy (SIMS). In this article, status of development on focused ion beam systems with ion species such as O 2 + , P + , and B + will be reviewed. Compact columns for forming focused ion beams from low energy (∼3keV), to intermediate energy (∼35keV) are discussed. By using focused ion beams, a SOI MOSFET is fabricated entirely without any masks or resist
Energy Technology Data Exchange (ETDEWEB)
Fischer, W.
2011-12-01
Ion colliders are research tools for high-energy nuclear physics, and are used to test the theory of Quantum Chromo Dynamics (QCD). The collisions of fully stripped high-energy ions create matter of a temperature and density that existed only microseconds after the Big Bang. Ion colliders can reach higher densities and temperatures than fixed target experiments although at a much lower luminosity. The first ion collider was the CERN Intersecting Storage Ring (ISR), which collided light ions [77Asb1, 81Bou1]. The BNL Relativistic Heavy Ion Collider (RHIC) is in operation since 2000 and has collided a number of species at numerous energies. The CERN Large Hadron Collider (LHC) started the heavy ion program in 2010. Table 1 shows all previous and the currently planned running modes for ISR, RHIC, and LHC. All three machines also collide protons, which are spin-polarized in RHIC. Ion colliders differ from proton or antiproton colliders in a number of ways: the preparation of the ions in the source and the pre-injector chain is limited by other effects than for protons; frequent changes in the collision energy and particle species, including asymmetric species, are typical; and the interaction of ions with each other and accelerator components is different from protons, which has implications for collision products, collimation, the beam dump, and intercepting instrumentation devices such a profile monitors. In the preparation for the collider use the charge state Z of the ions is successively increased to minimize the effects of space charge, intrabeam scattering (IBS), charge change effects (electron capture and stripping), and ion-impact desorption after beam loss. Low charge states reduce space charge, intrabeam scattering, and electron capture effects. High charge states reduce electron stripping, and make bending and acceleration more effective. Electron stripping at higher energies is generally more efficient. Table 2 shows the charge states and energies in the
International Nuclear Information System (INIS)
Fischer, W.
2010-01-01
Ion colliders are research tools for high-energy nuclear physics, and are used to test the theory of Quantum Chromo Dynamics (QCD). The collisions of fully stripped high-energy ions create matter of a temperature and density that existed only microseconds after the Big Bang. Ion colliders can reach higher densities and temperatures than fixed target experiments although at a much lower luminosity. The first ion collider was the CERN Intersecting Storage Ring (ISR), which collided light ions (77Asb1, 81Bou1). The BNL Relativistic Heavy Ion Collider (RHIC) is in operation since 2000 and has collided a number of species at numerous energies. The CERN Large Hadron Collider (LHC) started the heavy ion program in 2010. Table 1 shows all previous and the currently planned running modes for ISR, RHIC, and LHC. All three machines also collide protons, which are spin-polarized in RHIC. Ion colliders differ from proton or antiproton colliders in a number of ways: the preparation of the ions in the source and the pre-injector chain is limited by other effects than for protons; frequent changes in the collision energy and particle species, including asymmetric species, are typical; and the interaction of ions with each other and accelerator components is different from protons, which has implications for collision products, collimation, the beam dump, and intercepting instrumentation devices such a profile monitors. In the preparation for the collider use the charge state Z of the ions is successively increased to minimize the effects of space charge, intrabeam scattering (IBS), charge change effects (electron capture and stripping), and ion-impact desorption after beam loss. Low charge states reduce space charge, intrabeam scattering, and electron capture effects. High charge states reduce electron stripping, and make bending and acceleration more effective. Electron stripping at higher energies is generally more efficient. Table 2 shows the charge states and energies in the
Fischer, W
2014-01-01
High-energy ion colliders are large research tools in nuclear physics to study the Quark-Gluon-Plasma (QGP). The range of collision energy and high luminosity are important design and operational considerations. The experiments also expect flexibility with frequent changes in the collision energy, detector fields, and ion species. Ion species range from protons, including polarized protons in RHIC, to heavy nuclei like gold, lead and uranium. Asymmetric collision combinations (e.g. protons against heavy ions) are also essential. For the creation, acceleration, and storage of bright intense ion beams, limits are set by space charge, charge change, and intrabeam scattering effects, as well as beam losses due to a variety of other phenomena. Currently, there are two operating ion colliders, the Relativistic Heavy Ion Collider (RHIC) at BNL, and the Large Hadron Collider (LHC) at CERN.
InChI in the wild: an assessment of InChIKey searching in Google
2013-01-01
While chemical databases can be queried using the InChI string and InChIKey (IK) the latter was designed for open-web searching. It is becoming increasingly effective for this since more sources enhance crawling of their websites by the Googlebot and consequent IK indexing. Searchers who use Google as an adjunct to database access may be less familiar with the advantages of using the IK as explored in this review. As an example, the IK for atorvastatin retrieves ~200 low-redundancy links from a Google search in 0.3 of a second. These include most major databases and a very low false-positive rate. Results encompass less familiar but potentially useful sources and can be extended to isomer capture by using just the skeleton layer of the IK. Google Advanced Search can be used to filter large result sets. Image searching with the IK is also effective and complementary to open-web queries. Results can be particularly useful for less-common structures as exemplified by a major metabolite of atorvastatin giving only three hits. Testing also demonstrated document-to-document and document-to-database joins via structure matching. The necessary generation of an IK from chemical names can be accomplished using open tools and resources for patents, papers, abstracts or other text sources. Active global sharing of local IK-linked information can be accomplished via surfacing in open laboratory notebooks, blogs, Twitter, figshare and other routes. While information-rich chemistry (e.g. approved drugs) can exhibit swamping and redundancy effects, the much smaller IK result sets for link-poor structures become a transformative first-pass option. The IK indexing has therefore turned Google into a de-facto open global chemical information hub by merging links to most significant sources, including over 50 million PubChem and ChemSpider records. The simplicity, specificity and speed of matching make it a useful option for biologists or others less familiar with chemical searching
Li, Xinran; Hu, Hesheng; Wang, Ye; Xue, Mei; Li, Xiaolu; Cheng, Wenjuan; Xuan, Yongli; Yin, Jie; Yang, Na; Yan, Suhua
2016-03-01
Myocardial infarction (MI) results in decreased inward-rectifier K⁺ current (IK1), which is mediated primarily by the Kir2.1 protein and is accompanied by upregulated T cells. Interferon γ (IFN-γ), secreted predominantly by Th1 cells, causes a decrease in IK1 in microglia. Whether Th1 cells can induce IK1/Kir2.1 remodeling following MI and whether valsartan can ameliorate this phenomenon remain unclear. Rats experiencing MI received either valsartan or saline for 7 days. Th1-enriched lymphocytes and myocytes were cocultured with or without valsartan treatment. Th1 cells were monitored by flow cytometry. The protein levels of Kir2.1 were detected by Western blot analyses. IK1 was recorded through whole-cell patch clamping. The plasma levels of IFN-γ, interleukin 2, and tumor necrosis factor α were detected by enzyme-linked immunosorbent assay. Th1 cell number and cytokine expression levels were higher following MI, and the Kir2.1 protein level was decreased. In MI rats, valsartan reduced Th1 cell number and cytokine expression levels and increased the Kir2.1 expression and the IK1 current compared with the rats that received saline treatment; these results are consistent with the effect of valsartan in cocultured lymphocytes and myocytes. In vitro, IFN-γ overexpression suppressed the IK1 current, whereas interleukin 2 and tumor necrosis factor α had no significant effect on the current, establishing that Th1 cell regulation of IK1/Kir2.1 expression is mainly dependent on IFN-γ. Valsartan ameliorates IK1/Kir2.1 remodeling by downregulating the Th1 immune response following MI.
Production of highly charged ion beams from ECR ion sources
International Nuclear Information System (INIS)
Xie, Z.Q.
1997-09-01
Electron Cyclotron Resonance (ECR) ion source development has progressed with multiple-frequency plasma heating, higher mirror magnetic fields and better technique to provide extra cold electrons. Such techniques greatly enhance the production of highly charged ions from ECR ion sources. So far at cw mode operation, up to 300 eμA of O 7+ and 1.15 emA of O 6+ , more than 100 eμA of intermediate heavy ions for charge states up to Ar 13+ , Ca 13+ , Fe 13+ , Co 14+ and Kr 18+ , and tens of eμA of heavy ions with charge states to Kr 26+ , Xe 28+ , Au 35+ , Bi 34+ and U 34+ have been produced from ECR ion sources. At an intensity of at least 1 eμA, the maximum charge state available for the heavy ions are Xe 36+ , Au 46+ , Bi 47+ and U 48+ . An order of magnitude enhancement for fully stripped argon ions (I ≥ 60 enA) also has been achieved. This article will review the ECR ion source progress and discuss key requirement for ECR ion sources to produce the highly charged ion beams
International Nuclear Information System (INIS)
Cocke, C.L.; Olson, R.E.
1991-01-01
The collision of a fast moving heavy ion with a neutral atomic target can produce very highly charged but slowly moving target ions. This article reviews experimental and theoretical work on the production and use of recoil ions beyond the second ionization state by beams with specific energies above 0.5 MeV/amu. A brief historical survey is followed by a discussion of theoretical approaches to the problem of the removal of many electrons from a neutral target by a rapid, multiply charged projectile. A discussion of experimental techniques and results for total and differential cross sections for multiple ionization of atomic and molecular targets is given. Measurements of recoil energy are discussed. The uses of recoil ions for in situ spectroscopy of multiply charged ions, for external beams of slow, highly charged ions and in ion traps are reviewed. Some possible future opportunities are discussed. (orig.)
Ion Elevators and Escalators in Multilevel Structures for Lossless Ion Manipulations
Energy Technology Data Exchange (ETDEWEB)
Ibrahim, Yehia M.; Hamid, Ahmed M.; Cox, Jonathan T.; Garimella, Venkata BS; Smith, Richard D.
2017-01-19
We describe two approaches based upon ion ‘elevator’ and ‘escalator’ components that allow moving ions to different levels in structures for lossless ion manipulations (SLIM). Guided by ion motion simulations we designed elevator and escalator components providing essentially lossless transmission in multi-level designs based upon ion current measurements. The ion elevator design allowed ions to efficiently bridge a 4 mm gap between levels. The component was integrated in a SLIM and coupled to a QTOF mass spectrometer using an ion funnel interface to evaluate the m/z range transmitted as compared to transmission within a level (e.g. in a linear section). Mass spectra for singly-charged ions of m/z 600-2700 produced similar mass spectra for both elevator and straight (linear motion) components. In the ion escalator design, traveling waves (TW) were utilized to transport ions efficiently between two SLIM levels. Ion current measurements and ion mobility (IM) spectrometry analysis illustrated that ions can be transported between TW-SLIM levels with no significant loss of either ions or IM resolution. These developments provide a path for the development of multilevel designs providing e.g. much longer IM path lengths, more compact designs, and the implementation of much more complex SLIM devices in which e.g. different levels may operate at different temperatures or with different gases.
Ion Elevators and Escalators in Multilevel Structures for Lossless Ion Manipulations.
Ibrahim, Yehia M; Hamid, Ahmed M; Cox, Jonathan T; Garimella, Sandilya V B; Smith, Richard D
2017-02-07
We describe two approaches based upon ion "elevator" and "escalator" components that allow moving ions to different levels in structures for lossless ion manipulations (SLIM). Guided by ion motion simulations, we designed elevator and escalator components based upon ion current measurements providing essentially lossless transmission in multilevel designs. The ion elevator design allowed ions to efficiently bridge a 4 mm gap between levels. The component was integrated in a SLIM and coupled to a QTOF mass spectrometer using an ion funnel interface to evaluate the m/z range transmitted as compared to transmission within a level (e.g., in a linear section). The analysis of singly charged ions of m/z 600-2700 produced similar mass spectra for both elevator and straight (linear motion) components. In the ion escalator design, traveling waves (TW) were utilized to transport ions efficiently between two SLIM levels. Ion current measurements and ion mobility (IM) spectrometry analysis illustrated that ions can be transported between TW-SLIM levels with no significant loss of either ions or IM resolution. These developments provide a path for the development of multilevel designs providing, e.g., much longer IM path lengths, more compact designs, and the implementation of much more complex SLIM devices in which, e.g., different levels may operate at different temperatures or with different gases.
Two-dimensional boundary-value problem for ion-ion diffusion
International Nuclear Information System (INIS)
Tuszewski, M.; Lichtenberg, A.J.
1977-01-01
Like-particle diffusion is usually negligible compared with unlike-particle diffusion because it is two orders higher in spatial derivatives. When the ratio of the ion gyroradius to the plasma transverse dimension is of the order of the fourth root of the mass ratio, previous one-dimensional analysis indicated that like-particle diffusion is significant. A two-dimensional boundary-value problem for ion-ion diffusion is investigated. Numerical solutions are found with models for which the nonlinear partial differential equation reduces to an ordinary fourth-order differential equation. These solutions indicate that the ion-ion losses are higher by a factor of six for a slab geometry, and by a factor of four for circular geometry, than estimated from dimensional analysis. The solutions are applied to a multiple mirror experiment stabilized with a quadrupole magnetic field which generates highly elliptical flux surfaces. It is found that the ion-ion losses dominate the electron-ion losses and that these classical radial losses contribute to a significant decrease of plasma lifetime, in qualitiative agreement with the experimental results
Ion Acceleration by Double Layers with Multi-Component Ion Species
Good, Timothy; Aguirre, Evan; Scime, Earl; West Virginia University Team
2017-10-01
Current-free double layers (CFDL) models have been proposed to explain observations of magnetic field-aligned ion acceleration in plasmas expanding into divergent magnetic field regions. More recently, experimental studies of the Bohm sheath criterion in multiple ion species plasma reveal an equilibration of Bohm speeds at the sheath-presheath boundary for a grounded plate in a multipole-confined filament discharge. We aim to test this ion velocity effect for CFDL acceleration. We report high resolution ion velocity distribution function (IVDF) measurements using laser induced fluorescence downstream of a CFDL in a helicon plasma. Combinations of argon-helium, argon-krypton, and argon-xenon gases are ionized and measurements of argon or xenon IVDFs are investigated to determine whether ion acceleration is enhanced (or diminished) by the presence of lighter (or heavier) ions in the mix. We find that the predominant effect is a reduction of ion acceleration consistent with increased drag arising from increased gas pressure under all conditions, including constant total gas pressure, equal plasma densities of different ions, and very different plasma densities of different ions. These results suggest that the physics responsible for acceleration of multiple ion species in simple sheaths is not responsible for the ion acceleration observed in these expanding plasmas. Department of Physics, Gettysburg College.
A singly charged ion source for radioactive 11C ion acceleration
Katagiri, K.; Noda, A.; Nagatsu, K.; Nakao, M.; Hojo, S.; Muramatsu, M.; Suzuki, K.; Wakui, T.; Noda, K.
2016-02-01
A new singly charged ion source using electron impact ionization has been developed to realize an isotope separation on-line system for simultaneous positron emission tomography imaging and heavy-ion cancer therapy using radioactive 11C ion beams. Low-energy electron beams are used in the electron impact ion source to produce singly charged ions. Ionization efficiency was calculated in order to decide the geometric parameters of the ion source and to determine the required electron emission current for obtaining high ionization efficiency. Based on these considerations, the singly charged ion source was designed and fabricated. In testing, the fabricated ion source was found to have favorable performance as a singly charged ion source.
International Nuclear Information System (INIS)
Coles, J.N.; Long, J.V.P.
1977-01-01
An ion microprobe is described that has an ion extraction arrangement comprising two separate paths for ions and electrons diverging from a common point. A cone shaped or pyramidal guard electrode surrounds each path the apex angles being equal and coinciding with the said point. The guard electrodes are positioned to lie tangentially to each other and to a planar surface including the said point. An aperture is provided for the two paths at the apexes of both guard electrodes, and electrical connections between the guard electrodes enable the same potential to be applied to both guard electrodes. Means are provided for generating oppositely polarised electric fields within the guard electrodes, together with means for causing a focused ion beam to strike the common point without suffering astigmatism. The means for causing a focused ion beam to strike the said point includes an ion gun for directing an ion beam along one of the paths and means to provide an axial accelerating field there along. Optical viewing means are also provided. Existing designs enable only ions or electrons, but not both, to be extracted at any one time. (U.K.)
Ion acoustic waves in one- and two-negative ion species plasmas
International Nuclear Information System (INIS)
Ichiki, Ryuta; Shindo, Masako; Yoshimura, Shinji; Watanabe, Tsuguhiro; Kawai, Yoshinobu
2001-01-01
Ion acoustic waves in multi-ion plasmas including two negative ion species are investigated both numerically and experimentally. Numerically, the kinetic dispersion relation in two-negative ion plasmas is investigated. There are three modes of the ion acoustic waves in two-negative ion plasmas. In an Ar + -F - -SF 6 - plasma, only one of the three modes is dominant, regardless of the values of the electron and the ion temperatures. In a Xe + -F - -SF 6 - plasma, on the other hand, two modes can be important for a certain range of the electron-ion temperature ratio. The results also imply the possibility of the coexistence of the fast mode and the slow mode in one-negative ion plasmas. Experimentally, ion acoustic waves are observed in an Ar + -F - -SF 6 - plasma and are found to show a mode transition that agrees with the theoretical prediction for one of the three ion acoustic modes
Ikaros is degraded by proteasome-dependent mechanism in the early phase of apoptosis induction
International Nuclear Information System (INIS)
He, Li-Cai; Xu, Han-Zhang; Gu, Zhi-Min; Liu, Chuan-Xu; Chen, Guo-Qiang; Wang, Yue-Fei; Wen, Dong-Hua; Wu, Ying-Li
2011-01-01
Research highlights: → Chemotherapeutic drugs or UV treatment reduces Ikaros prior to caspase-3 activation. → Etoposide treatment does not alter the mRNA but shortens the half-life of Ikaros. → MG132 or epoxomicin but not calpeptin inhibits etoposide-induced Ikaros degradation. → Overexpression of Ikaros accelerates etoposide-induced apoptosis in NB4 cells. -- Abstract: Ikaros is an important transcription factor involved in the development and differentiation of hematopoietic cells. In this work, we found that chemotherapeutic drugs or ultraviolet radiation (UV) treatment could reduce the expression of full-length Ikaros (IK1) protein in less than 3 h in leukemic NB4, Kasumi-1 and Jurkat cells, prior to the activation of caspase-3. Etoposide treatment could not alter the mRNA level of IK1 but it could shorten the half-life of IK1. Co-treatment with the proteasome inhibitor MG132 or epoxomicin but not calpain inhibitor calpeptin inhibited etoposide-induced Ikaros downregulation. Overexpression of IK1 could accelerate etoposide-induced apoptosis in NB4 cells, as evidenced by the increase of Annexin V positive cells and the more early activation of caspase 3. To our knowledge, this is the first report to show that upon chemotherapy drugs or UV treatment, IK1 could be degraded via the proteasome system in the early phase of apoptosis induction. These data might shed new insight on the role of IK1 in apoptosis and the post-translational regulation of IK1.
Directory of Open Access Journals (Sweden)
Pengfei Huang
2014-08-01
Full Text Available Intermediate-conductance Ca2+-activated K+ (IK channels are calcium/calmodulin-regulated voltage-independent K+ channels. Activation of IK currents is important in vessel and respiratory tissues, rendering the channels potential drug targets. A variety of small organic molecules have been synthesized and found to be potent activators of IK channels. However, the poor selectivity of these molecules limits their therapeutic value. Venom-derived peptides usually block their targets with high specificity. Therefore, we searched for novel peptide activators of IK channels by testing a series of toxins from spiders. Using electrophysiological experiments, we identified hainantoxin-I (HNTX-I as an IK-channel activator. HNTX-I has little effect on voltage-gated Na+ and Ca2+ channels from rat dorsal root ganglion neurons and on the heterologous expression of voltage-gated rapidly activating delayed rectifier K+ channels (human ether-à-go-go-related gene; human ERG in HEK293T cells. Only 35.2% ± 0.4% of the currents were activated in SK channels, and there was no effect on BK channels. We demonstrated that HNTX-I was not a phrenic nerve conduction blocker or acutely toxic. This is believed to be the first report of a peptide activator effect on IK channels. Our study suggests that the activity and selectivity of HNTX-I on IK channels make HNTX-I a promising template for designing new drugs for cardiovascular diseases.
Fusion at counterstreaming ion beams - ion optic fusion (IOF)
International Nuclear Information System (INIS)
Gryzinski, M.
1981-01-01
The results of investigation are briefly reviewed in the field of ion optic fusion performed at the Institute of Nuclear Research in Swierk. The ion optic fusion concept is based on the possibility of obtaining fusion energy at highly ordered motion of ions in counterstreaming ion beams. For this purpose TW ion beams must be produced and focused. To produce dense and charge-neutralized ion beams the selective conductivity and ballistic focusing ideas were formulated and used in a series of RPI devices with low-pressure cylindrical discharge between grid-type electrodes. 100 kA, 30 keV deuteron beams were successfully produced and focused into the volume of 1 cm 3 , yielding 10 9 neutrons per 200 ns shot on a heavy ice target. Cylindrically convergent ion beams with magnetic anti-defocusing were proposed in order to reach a positive energy gain at reasonable energy level. (J.U.)
Ions kinematics in an electrostatic ion beam trap
Energy Technology Data Exchange (ETDEWEB)
Attia, D
2004-06-01
In this study, I have tried to provide a better understanding of the dynamics of ions inside an electrostatic ion beam trap. The electrostatic ion trap allows to store ions moving between two electrostatic mirrors. Although the trap has been developed already seven years ago, no direct measurement of the transversal velocity distribution of the ions has been performed. Such quantity is central for understanding the conditions under which a beam should be produced (mainly emittance) in order to be trapped by such a device. The data I have obtained during the course of this work are based on an experimental technique which relies on the direct imaging of the particles exiting the trap, as well as on numerical simulations of the ion trajectories inside the trap. I have personally been involved in the hardware development of the imaging system, the data acquisition and analysis of the data as well as il all numerical calculations presented here. These results allow us to obtain, for the first time, experimental information on the transverse phase space of the trap, and contribute to the overall understanding of the ion motion in this system. (author)
Ion temperature via laser scattering on ion Bernstein waves
International Nuclear Information System (INIS)
Wurden, G.A.; Ono, M.; Wong, K.L.
1981-10-01
Hydrogen ion temperature has been measured in a warm toroidal plasma with externally launched ion Bernstein waves detected by heterodyne CO 2 laser scattering. Radial scanning of the laser beam allows precise determination of k/sub perpendicular to/ for the finite ion Larmor radius wave (ω approx. less than or equal to 2Ω/sub i/). Knowledge of the magnetic field strength and ion concentration then give a radially resolved ion temperature from the dispersion relation. Probe measurements and Doppler broadening of ArII 4806A give excellent agreement
Diffuse ions produced by electromagnetic ion beam instabilities
International Nuclear Information System (INIS)
Winske, D.; Leroy, M.M.
1984-01-01
The evolution of the electromagnetic ions beam instability driven by the reflected ion component backstreaming away from the earth's how shock into the foreshock region is studied by means computer simulation. The linear the quasi-linear states of the instability are found to be in good agreement with known results for the resonant model propagating parallel to the beam along the magnetic field and with theory developed in this paper for the nonresonant mode, which propagates antiparallel to the beam direction. The quasi-linear stage, which produces large amplitude 8Bapprox.B, sinusoidal transverse waves and ''intermediate'' ion distribution, is terminated by a nonlinear phase in which strongly nonlinear, compressive waves and ''diffuse'' ion distributions are produced. Additional processes by which the diffuse ions are accelerated to observed high energies are not addressed. The results are discussed in terms of the ion distributions and hydromagnetic waves observed in the foreshock of the earth's bow shock and of interplanetary shocks
Production of highly ionized recoil ions in heavy ion impact
International Nuclear Information System (INIS)
Tawara, H.; Tonuma, T.; Be, S.H.; Shibata, H.; Kase, M.; Kambara, T.; Kumagai, H.; Kohno, I.
1985-01-01
The production mechanisms of highly ionized recoil ions in energetic, highly charged heavy ion impact are compared with those in photon and electron impact. In addition to the innershell ionization processes which are important in photon and electron impact, the electron transfer processes are found to play a key role in heavy ion impact. In molecular targets are also observed highly ionized monoatomic ions which are believed to be produced through production of highly ionized molecular ions followed by prompt dissociation. The observed N 6+ ions produced in 1.05MeV/amu Ar 12+ ions on N 2 molecules are produced through, for example, N 2 12+ *→N 6+ +N 6+ process. (author)
Ion optics in an ion source system
Energy Technology Data Exchange (ETDEWEB)
Abdel-Salam, F W; Moustafa, O A; El-Khabeary, H [Accelerators Dept, Nuclear Research Center, Atomic Energy Authority, Cairo (Egypt)
1997-12-31
An analysis of ion beams from an ion source which consisted of a hemispherical anode, a plane earthed cathode, and a focusing electrode has been carried out. The focal properties of such electrode arrangement were studied using axially symmetric fields. Axial and radial electric fields were obtained as functions of the axial distance. It was found that the radial component of the gradient of potential pushes the ions towards the axis, which indicates the convergent action of the system. The effect of voltage variation between the boundary and the focusing electrode on the position of the plasma boundary are given using the experimental data of the ion source characteristics and its geometrical parameters. The advantages of plasma diffusing outside the source through a small aperture were used by applying a potential to the focusing electrode. It was possible to extract a large ion current from the expanded plasma. The system constituted a lens with a focal length of 29.4 mm. 7 figs.
Heavy ion beams from the new Hungarian ECR ion source
International Nuclear Information System (INIS)
Biri, S.; Valek, A.; Ditroi, F.; Koivisto, H.; Arje, J.; Stiebing, K.; Schmidt, L.
1998-01-01
The first beams of highly charged ions in Hungary were obtained in fall of 1996. The new 14.5 GHz ECR ion source of ATOMKI produced beams of multiply charged ions with remarkable intensities at first experiments. Since then, numerous further developments were carried out. An external electrondonor electrode drastically increased the plasma density and, consequently, the intensity of highly charged ions. These upgrades concentrated mainly on beams from gaseous elements and were carried out by the ECRIS team of ATOMKI. Another series of experiments - ionising from solids - however, was done in the framework of an international collaboration. The first metal ion beam has been extracted from the ECRIS in November 1997 using the known method of Metal Ions from Volatile Compounds (MIVOC). The possibility to put the MIVOC chamber inside the ion source was also tested and the dosing regulation problem of metal vapours inside the ion source was solved. As a result, beams of more than 10 μA of highly charged Fe and Ni ions were produced. (author)
A Study of Ion-Ion Hybrid Instability in the Mixed Plasma
Directory of Open Access Journals (Sweden)
Soo-Yong Kim
1987-12-01
Full Text Available There are more oxygen ions than hydrogen ions in the auroral field zone. We consider both analytic and numerical simulation study of the heating of hydrogen and oxygen ions by auroral electrons. With the low drift speed of electron beams, the ion-ion hybrid wave becomes unstable instead of the lower hybrid wave so that a preferential heating of oxygen ions occurs.
Human oxidation-specific antibodies reduce foam cell formation and atherosclerosis progression
DEFF Research Database (Denmark)
Tsimikas, Sotirios; Miyanohara, Atsushi; Hartvigsen, Karsten
2011-01-01
We sought to assess the in vivo importance of scavenger receptor (SR)-mediated uptake of oxidized low-density lipoprotein (OxLDL) in atherogenesis and to test the efficacy of human antibody IK17-Fab or IK17 single-chain Fv fragment (IK17-scFv), which lacks immunologic properties of intact antibod...... antibodies other than the ability to inhibit uptake of OxLDL by macrophages, to inhibit atherosclerosis....
Simulating (log(c) n)-wise Independence in NC
1989-05-01
independent) distribution. However, Xk (A) = (1x(I))k = Z Z y (i,)...X(ik). iEA ijEAi 2 EA IkEA So Lemma 2.4 applies to show that any k-wise independent...AEA AEAi1EA ikEA So henceforth we want an X such that F(X) >_ E[F(X)]. 2.5 Generating k-Wise Independent Variables It still remains to demonstrate a k
Directory of Open Access Journals (Sweden)
Radnai Balazs
2012-05-01
Full Text Available Abstract Background 2,4-Dimethoxyphenyl-E-4-arylidene-3-isochromanone (IK11 was previously described to induce apoptotic death of A431 tumor cells. In this report, we investigated the molecular action of IK11 in the HepG2 human hepatocellular carcinoma cell line to increase our knowledge of the role of poly (ADP-ribose-polymerase (PARP, protein kinase B/Akt and mitogen activated protein kinase (MAPK activation in the survival and death of tumor cells and to highlight the possible role of PARP-inhibitors in co-treatments with different cytotoxic agents in cancer therapy. Results We found that sublethal concentrations of IK11 prevented proliferation, migration and entry of the cells into their G2 phase. At higher concentrations, IK11 induced reactive oxygen species (ROS production, mitochondrial membrane depolarization, activation of c-Jun N-terminal kinase 2 (JNK2, and substantial loss of HepG2 cells. ROS production appeared marginal in mediating the cytotoxicity of IK11 since N-acetyl cysteine was unable to prevent it. However, the PARP inhibitor PJ34, although not a ROS scavenger, strongly inhibited both IK11-induced ROS production and cell death. JNK2 activation seemed to be a major mediator of the effect of IK11 since inhibition of JNK resulted in a substantial cytoprotection while inhibitors of the other kinases failed to do so. Inhibition of Akt slightly diminished the effect of IK11, while the JNK and Akt inhibitor and ROS scavenger trans-resveratrol completely protected against it. Conclusions These results indicate significant involvement of PARP, a marginal role of ROS and a pro-apoptotic role of Akt in this system, and raise attention to a novel mechanism that should be considered when cancer therapy is augmented with PARP-inhibition, namely the cytoprotection by inhibition of JNK2.
International Nuclear Information System (INIS)
Fabrikant, J.I.; Tobias, C.A.; Holley, W.R.; Benton, E.V.; Woodruff, K.H.; MacFarland, E.W.
1983-01-01
High energy, heavy-ion beams offer superior discrimination of tissue electron densities at very low radiation doses. This characteristic has potential for diagnostic medical imaging of neoplasms arising in the soft tissues and organs because it can detect smaller inhomogeneities than x rays. Heavy-ion imaging may also increase the accuracy of cancer radiotherapy planning involving use of accelerated charged particles. In the current physics research program of passive heavy-ion imaging, critical modulation transfer function tests are being carried out in heavy-ion projection radiography and heavy-ion computerized tomography. The research goal is to improve the heavy-ion imaging method until it reaches the limits of its theoretical resolution defined by range straggling, multiple scattering, and other factors involved in the beam quality characteristics. Clinical uses of the imaging method include the application of heavy-ion computerized tomography to heavy-ion radiotherapy planning, to the study of brain tumors and other structures of the head, and to low-dose heavy-ion projection mammography, particularly for women with dense breasts where other methods of diagnosis fail. The ions used are primarily 300 to 570 MeV/amu carbon and neon ions accelerated at the Lawrence Berkeley Laboratory Bevalac
Ion channels versus ion pumps: the principal difference, in principle.
Gadsby, David C
2009-05-01
The incessant traffic of ions across cell membranes is controlled by two kinds of border guards: ion channels and ion pumps. Open channels let selected ions diffuse rapidly down electrical and concentration gradients, whereas ion pumps labour tirelessly to maintain the gradients by consuming energy to slowly move ions thermodynamically uphill. Because of the diametrically opposed tasks and the divergent speeds of channels and pumps, they have traditionally been viewed as completely different entities, as alike as chalk and cheese. But new structural and mechanistic information about both of these classes of molecular machines challenges this comfortable separation and forces its re-evaluation.
Note: Ion source design for ion trap systems
Noriega, J. R.; Quevedo, M.; Gnade, B.; Vasselli, J.
2013-06-01
A small plasma (glow discharge) based ion source and circuit are described in this work. The ion source works by producing a high voltage pulsed discharge between two electrodes in a pressure range of 50-100 mTorr. A third mesh electrode is used for ion extraction. The electrodes are small stainless steel screws mounted in a MACOR ionization chamber in a linear arrangement. The electrode arrangement is driven by a circuit, design for low power operation. This design is a proof of concept intended for applications on small cylindrical ion traps.
High-ion temperature experiments with negative-ion-based NBI in LHD
International Nuclear Information System (INIS)
Takeiri, Y.; Morita, S.; Tsumori, K.; Ikeda, K.; Oka, Y.; Osakabe, M.; Nagaoka, K.; Goto, M.; Miyazawa, J.; Masuzaki, S.; Ashikawa, N.; Yokoyama, M.; Narihara, K.; Yamada, I.; Kubo, S.; Shimozuma, T.; Inagaki, S.; Tanaka, K.; Peterson, B.J.; Ida, K.; Kaneko, O.; Komori, A.; Murakami, S.
2005-01-01
High-Z plasmas have been produced with Ar- and/or Ne-gas fuelling to increase the ion temperature in the LHD plasmas heated with the high-energy negative-ion-based NBI. Although the electron heating is dominant in the high-energy NBI heating, the direct ion heating power is much enhanced effectively in low-density plasmas due to both an increase in the beam absorption (ionisation) power and a reduction of the ion density in the high-Z plasmas. Intensive Ne- and/or Ar-glow discharge cleaning works well to suppress dilution of the high-Z plasmas with the wall-absorbed hydrogen. As a result, the ion temperature increases with an increase in the ion heating power normalized by the ion density, and reaches 10 keV. An increase in the ion temperature is also observed with an addition of the centrally focused ECRH to the low-density and high-Z NBI plasma, suggesting improvement of the ion transport. The results obtained in the high-Z plasma experiments with the high-energy NBI heating indicate that an increase in the direct ion heating power and improvement of the ion transport are essential to the ion temperature rise, and that a high-ion temperature would be obtained as well in hydrogen plasmas with low-energy positive-NBI heating which is planed in near future in LHD. (author)
Single ion hit detection set-up for the Zagreb ion microprobe
Smith, R. W.; Karlušić, M.; Jakšić, M.
2012-04-01
Irradiation of materials by heavy ions accelerated in MV tandem accelerators may lead to the production of latent ion tracks in many insulators and semiconductors. If irradiation is performed in a high resolution microprobe facility, ion tracks can be ordered by submicrometer positioning precision. However, full control of the ion track positioning can only be achieved by a reliable ion hit detection system that should provide a trigger signal irrespectively of the type and thickness of the material being irradiated. The most useful process that can be utilised for this purpose is emission of secondary electrons from the sample surface that follows the ion impact. The status report of the set-up presented here is based on the use of a channel electron multiplier (CEM) detector mounted on an interchangable sample holder that is inserted into the chamber in a close geometry along with the sample to be irradiated. The set-up has been tested at the Zagreb ion microprobe for different ions and energies, as well as different geometrical arrangements. For energies of heavy ions below 1 MeV/amu, results show that efficient (100%) control of ion impact can be achieved only for ions heavier than silicon. The successful use of the set-up is demonstrated by production of ordered single ion tracks in a polycarbonate film and by monitoring fluence during ion microbeam patterning of Foturan glass.
Heavy-ion radiography and heavy-ion computed tomography
International Nuclear Information System (INIS)
Fabrikant, J.I.; Holley, W.R.; McFarland, E.W.; Tobias, C.a.
1982-02-01
Heavy-ion projection and CT radiography is being developed into a safe, low-dose, noninvasive radiological procedure that can quantitate and image small density differences in human tissues. The applications to heavy-ion mammography and heavy-ion CT imaging of the brain in clinical patients suggest their potential value in cancer diagnosis
International Nuclear Information System (INIS)
Golovin, A.V.
1991-01-01
A method of ion-ion coincidences was suggested to study the process of ion pairs formation during molecule photoionization. The principle of action of ion-ion coincidence method is based on recording of only the negative and positive ions that formed as a result of a molecule decomposition. The flowsheet of the facility of ion-ion coincidences was presented. The processes of ion pairs formation in iodine, chloroform, propyl-, n-propenyl-, tert.butyl- and benzyl-chlorides were studied. A simple model permitting to evaluate the dependence of quantum yield of ion pair formation on excitation energy was suggested
High current vacuum arc ion source for heavy ion fusion
International Nuclear Information System (INIS)
Qi, N.; Schein, J.; Gensler, S.; Prasad, R.R.; Krishnan, M.; Brown, I.
1999-01-01
Heavy Ion fusion (HIF) is one of the approaches for the controlled thermonuclear power production. A source of heavy ions with charge states 1+ to 2+, in ∼0.5 A current beams with ∼20 micros pulse widths and ∼10 Hz repetition rates are required. Thermionic sources have been the workhorse for the HIF program to date, but suffer from sloe turn-on, heating problems for large areas, are limited to low (contact) ionization potential elements and offer relatively low ion fluxes with a charge state limited to 1+. Gas injection sources suffer from partial ionization and deleterious neutral gas effects. The above shortcomings of the thermionic ion sources can be overcome by a vacuum arc ion source. The vacuum arc ion source is a good candidate for HIF applications. It is capable of providing ions of various elements and different charge states, in short and long pulse bursts, with low emittance and high beam currents. Under a Phase-I STTR from DOE, the feasibility of the vacuum arc ion source for the HIF applications is investigated. An existing ion source at LBNL was modified to produce ∼0.5 A, ∼60 keV Gd (A∼158) ion beams. The experimental effort concentrated on beam noise reduction, pulse-to-pulse reproducibility and achieving low beam emittance at 0.5 A ion current level. Details of the source development will be reported
Cs+ ion source for secondary ion mass spectrometry
International Nuclear Information System (INIS)
Bentz, B.L.; Weiss, H.; Liebl, H.
1981-12-01
Various types of cesium ionization sources currently used in secondary ion mass spectrometry are briefly reviewed, followed by a description of the design and performance of a novel, thermal surface ionization Cs + source developed in this laboratory. The source was evaluated for secondary ion mass spectrometry applications using the COALA ion microprobe mass analyzer. (orig.)
Practical aspects of trapped ion mass spectrometry, 5 applications of ion trapping devices
March, Raymond E
2009-01-01
Examines ion/neutral and ion/ion reactions, ion spectroscopy, and the structural characterization of proteins and peptides using quadropole ion trap mass spectrometry, Fourier transform - ion cyclotron resonance (FT-ICR) mass spectrometry, and traveling wave ion mobility mass spectrometry.
Energy Technology Data Exchange (ETDEWEB)
Bykovskij, Yu
1979-02-01
The characteristics a laser source of multiply-ionized ions are described with regard to the interaction of laser radiation and matter, ion energy spectrum, angular ion distribution. The amount of multiple-ionization ions is evaluated. Out of laser source applications a laser injector of multiple-ionization ions and nuclei, laser mass spectrometry, laser X-ray microradiography, and a laser neutron generators are described.
Compact RF ion source for industrial electrostatic ion accelerator
Energy Technology Data Exchange (ETDEWEB)
Kwon, Hyeok-Jung, E-mail: hjkwon@kaeri.re.kr; Park, Sae-Hoon; Kim, Dae-Il; Cho, Yong-Sub [Korea Multi-purpose Accelerator Complex, Korea Atomic Energy Research Institute, Gyeongsangbukdo 38180 (Korea, Republic of)
2016-02-15
Korea Multi-purpose Accelerator Complex is developing a single-ended electrostatic ion accelerator to irradiate gaseous ions, such as hydrogen and nitrogen, on materials for industrial applications. ELV type high voltage power supply has been selected. Because of the limited space, electrical power, and robust operation, a 200 MHz RF ion source has been developed. In this paper, the accelerator system, test stand of the ion source, and its test results are described.
Compact RF ion source for industrial electrostatic ion accelerator
Kwon, Hyeok-Jung; Park, Sae-Hoon; Kim, Dae-Il; Cho, Yong-Sub
2016-02-01
Korea Multi-purpose Accelerator Complex is developing a single-ended electrostatic ion accelerator to irradiate gaseous ions, such as hydrogen and nitrogen, on materials for industrial applications. ELV type high voltage power supply has been selected. Because of the limited space, electrical power, and robust operation, a 200 MHz RF ion source has been developed. In this paper, the accelerator system, test stand of the ion source, and its test results are described.
Programmable ion mobility spectrometer: Time resolution improvement and ion counter comparison
International Nuclear Information System (INIS)
Harrison, R.G.; Wilding, R.J.
2005-01-01
Atmospheric ion mobility spectrometers operating on the aspirated electrode principle require switching of a bias voltage to select ions of different mobility. The ion spectrum can be obtained by sweeping across a set of bias voltages. If rapid temporal changes in atmospheric ion spectra are to be measured, however, such as for a balloon-carried instrument, the sweep time across the ion spectrum must be kept short. As bias voltage steps can generate saturation in the mobility spectrometer's electrometer amplifier, the electrometer recovery time limits the ion mobility spectrum sweep rate. Here, active compensation of the charge injected at a bias voltage step is used to reduce the saturation time. Further, the optimal setting of the charge compensation circuitry provides a determination of the system capacitance, a necessary calibration parameter for absolute measurements. Using laboratory air, hourly variations in ion concentrations and air conductivity found using the voltage switching system were similar to those obtained with a traditional ion counter operating at a single mobility: ion growth, however, could only be detected using the ion spectrometer
Lifescience Database Archive (English)
Full Text Available lkth*haqlllvitkri*pk*fhlml hqvntlvtllspiktmlkspvlmliltckrik*nkik*khtix* Frame C: ik*neiiisp...ydrndsi*csir* ihw*rcyhrskqc*nrly*c*y*lvne*nkik*nkntpsinyl*ikkk--- ---ik*neiiisplfrscfsfpifhpslvklwyccr*ipnyq
Development of ion-acoustic double layers through ion-acoustic fluctuations
International Nuclear Information System (INIS)
Sekar, A.N.; Saxena, Y.C.
1985-01-01
Experimental results on the formation of ion acoustic double layers resembling asymmetric ion-holes are presented. In a double plasma device, modified suitably to inject electron beam into the target plasma, modulation of the beam through step potential leads to excitation of ion-acoustic fluctuation. The ion-acoustic fluctuation, growing away from the grids separating source and target plasmas, developed into weak asymmetric ion-acoustic double layer. The observations are in qualitative agreement with theoretical models and computer simulations. (author)
A laser ablation ion source for the FRS ion catcher
Energy Technology Data Exchange (ETDEWEB)
Rink, Ann-Kathrin; Ebert, Jens; Petrick, Martin; Reiter, Pascal [Justus Liebig Universitaet Giessen (Germany); Dickel, Timo; Geissel, Hans; Plass, Wolfgang; Scheidenberger, Christoph [Justus Liebig Universitaet Giessen (Germany); GSI, Darmstadt (Germany); Purushothamen, Sivaji [GSI, Darmstadt (Germany)
2013-07-01
The FRS Ion Catcher was developed to serve as test bench for the low energy branch of the Super FRS to slow down exotic nuclei and prepare them for further measurements/ experiments. It consists of a cryogenic stopping cell to thermalise the ions, a diagnostic unit for stopping cell characterisation and various radiofrequency quadrupole structures to guide the ions to the Multiple-Reflection Time-of-Flight Mass Spectrometer for mass measurements, α spectroscopy and isobar separation. To characterise the extraction times of the stopping cell, which is one of the main performance parameters of such a cell, a laser ablation ion source has been develped and tested. This ion source provides a sharply defined starting point of the ions for the extraction time measurement. In the future this source will provide reference ions to calibrate the mass spectrometer for accurate mass measurements.
Bowers, Michael T
2013-01-01
Gas Phase Ion Chemistry, Volume 3: Ions and Light discusses how ions are formed by electron impact, ion-molecule reactions, or electrical discharge. This book discusses the use of light emitted by excited molecules to characterize either the chemistry that formed the excited ion, the structure of the excited ion, or both.Organized into 10 chapters, this volume begins with an overview of the extension of the classical flowing afterglow technique to include infrared and chemiluminescence and laser-induced fluorescence detection. This text then examines the experiments involving molecules that ar
Heavy Ion Injection Into Synchrotrons, Based On Electron String Ion Sources
Donets, E E; Syresin, E M
2004-01-01
A possibility of heavy ions injection into synchrotrons is discussed on the base of two novel ion sources, which are under development JINR during last decade: 1) the electron string ion source (ESIS), which is a modified version of a conventional electron beam ion source (EBIS), working in a reflex mode of operation, and 2) the tubular electron string ion source (TESIS). The Electron String Ion Source "Krion-2" (VBLHE, JINR, Dubna) with an applied confining magnetic field of 3 T was used for injection into the superconducting JINR synchrotron - Nuclotron and during this runs the source provided a high pulse intensity of the highly charged ion beams: Ar16+
Lv, Yankun; Bai, Song; Zhang, Hua; Zhang, Hongxue; Meng, Jing; Li, Li; Xu, Yanfang
2015-12-01
There is emerging evidence that the mineralocorticoid hormone aldosterone is associated with arrhythmias in cardiovascular disease. However, the effect of aldosterone on the slowly activated delayed rectifier potassium current (IK s ) remains poorly understood. The present study was designed to investigate the modulation of IK s by aldosterone. Adult guinea pigs were treated with aldosterone for 28 days via osmotic pumps. Standard glass microelectrode recordings and whole-cell patch-clamp techniques were used to record action potentials in papillary muscles and IK s in ventricular cardiomyocytes. The aldosterone-treated animals exhibited a prolongation of the QT interval and action potential duration with a higher incidence of early afterdepolarizations. Patch-clamp recordings showed a significant down-regulation of IK s density in the ventricular myocytes of these treated animals. These aldosterone-induced electrophysiological changes were fully prevented by a combined treatment with spironolactone, a mineralocorticoid receptor (MR) antagonist. In addition, in in vitro cultured ventricular cardiomyocytes, treatment with aldosterone (sustained exposure for 24 h) decreased the IK s density in a concentration-dependent manner. Furthermore, a significant corresponding reduction in the mRNA/protein expression of IKs channel pore and auxiliary subunits, KCNQ1 and KCNE1 was detected in ventricular tissue from the aldosterone-treated animals. Aldosterone down-regulates IK s by inhibiting the expression of KCNQ1 and KCNE1, thus delaying the ventricular repolarization. These results provide new insights into the mechanism underlying K(+) channel remodelling in heart disease and may explain the highly beneficial effects of MR antagonists in HF. © 2015 The British Pharmacological Society.
Influence of nonelectrostatic ion-ion interactions on double-layer capacitance
Zhao, Hui
2012-11-01
Recently a Poisson-Helmholtz-Boltzmann (PHB) model [Bohinc , Phys. Rev. EPLEEE81539-375510.1103/PhysRevE.85.031130 85, 031130 (2012)] was developed by accounting for solvent-mediated nonelectrostatic ion-ion interactions. Nonelectrostatic interactions are described by a Yukawa-like pair potential. In the present work, we modify the PHB model by adding steric effects (finite ion size) into the free energy to derive governing equations. The modified PHB model is capable of capturing both ion specificity and ion crowding. This modified model is then employed to study the capacitance of the double layer. More specifically, we focus on the influence of nonelectrostatic ion-ion interactions on charging a double layer near a flat surface in the presence of steric effects. We numerically compute the differential capacitance as a function of the voltage under various conditions. At small voltages and low salt concentrations (dilute solution), we find out that the predictions from the modified PHB model are the same as those from the classical Poisson-Boltzmann theory, indicating that nonelectrostatic ion-ion interactions and steric effects are negligible. At moderate voltages, nonelectrostatic ion-ion interactions play an important role in determining the differential capacitance. Generally speaking, nonelectrostatic interactions decrease the capacitance because of additional nonelectrostatic repulsion among excess counterions inside the double layer. However, increasing the voltage gradually favors steric effects, which induce a condensed layer with crowding of counterions near the electrode. Accordingly, the predictions from the modified PHB model collapse onto those computed by the modified Poisson-Boltzmann theory considering steric effects alone. Finally, theoretical predictions are compared and favorably agree with experimental data, in particular, in concentrated solutions, leading one to conclude that the modified PHB model adequately predicts the diffuse
Ion beam modification of solids ion-solid interaction and radiation damage
Wesch, Werner
2016-01-01
This book presents the method of ion beam modification of solids in realization, theory and applications in a comprehensive way. It provides a review of the physical basics of ion-solid interaction and on ion-beam induced structural modifications of solids. Ion beams are widely used to modify the physical properties of materials. A complete theory of ion stopping in matter and the calculation of the energy loss due to nuclear and electronic interactions are presented including the effect of ion channeling. To explain structural modifications due to high electronic excitations, different concepts are presented with special emphasis on the thermal spike model. Furthermore, general concepts of damage evolution as a function of ion mass, ion fluence, ion flux and temperature are described in detail and their limits and applicability are discussed. The effect of nuclear and electronic energy loss on structural modifications of solids such as damage formation, phase transitions and amorphization is reviewed for ins...
A Study on the Ion Beam Extraction using Duo-PiGatron Ion source for Vertical Type Ion Beam Facility
Energy Technology Data Exchange (ETDEWEB)
Kim, Bom Sok; Lee, Chan young; Lee, Jae Sang [KAERI, Daejeon (Korea, Republic of)
2015-05-15
In Korea Multipurpose Accelerator Complex (KOMAC), we have started ion beam service in the new beam utilization building since March this year. For various ion beam irradiation services, we are developed implanters such as metal (150keV/1mA), gaseous (200keV/5mA) and high current ion beam facility (20keV/150mA). One of the new one is a vertical type ion beam facility without acceleration tube (60keV/20mA) which is easy to install the sample. After the installation is complete, it is where you are studying the optimal ion beam extraction process. Detailed experimental results will be presented. Vertical Type Ion Beam Facility without acceleration tube of 60keV 20mA class was installed. We successfully extracted 60keV 20mA using Duo- PiGatron Ion source for Vertical Type Ion Beam Facility. Use the BPM and Faraday-cup, is being studied the optimum conditions of ion beam extraction.
Reactions of atomic oxygen with the chlorate ion and the perchlorate ion
Anan'ev, Vladimir; Miklin, Mikhail; Kriger, Ludmila
2014-06-01
The reactions of the chlorate ion with atomic oxygen formed under photolysis of the nitrate ion introduced to potassium chlorate crystal by co-crystallization were studied by optical and infrared absorption spectroscopy. The perchlorate ion was found to form in solids as product of addition reaction of singlet atomic oxygen, formed under dissociation of the peroxynitrite ion - the product of isomerization of the excited nitrate ion. Triplet atomic oxygen does not react with the chlorate ion. The atomic oxygen formed under photolysis of the nitrate ion introduced to potassium perchlorate crystal by co-crystallization does not react with the perchlorate ion.
Ion species stratification within strong shocks in two-ion plasmas
Keenan, Brett D.; Simakov, Andrei N.; Taitano, William T.; Chacón, Luis
2018-03-01
Strong collisional shocks in multi-ion plasmas are featured in many environments, with Inertial Confinement Fusion (ICF) experiments being one prominent example. Recent work [Keenan et al., Phys. Rev. E 96, 053203 (2017)] answered in detail a number of outstanding questions concerning the kinetic structure of steady-state, planar plasma shocks, e.g., the shock width scaling by the Mach number, M. However, it did not discuss shock-driven ion-species stratification (e.g., relative concentration modification and temperature separation). These are important effects since many recent ICF experiments have evaded explanation by standard, single-fluid, radiation-hydrodynamic (rad-hydro) numerical simulations, and shock-driven fuel stratification likely contributes to this discrepancy. Employing the state-of-the-art Vlasov-Fokker-Planck code, iFP, along with multi-ion hydro simulations and semi-analytics, we quantify the ion stratification by planar shocks with the arbitrary Mach number and the relative species concentration for two-ion plasmas in terms of ion mass and charge ratios. In particular, for strong shocks, we find that the structure of the ion temperature separation has a nearly universal character across ion mass and charge ratios. Additionally, we find that the shock fronts are enriched with the lighter ion species and the enrichment scales as M4 for M ≫ 1.
Electron string ion sources for carbon ion cancer therapy accelerators
Boytsov, A. Yu.; Donets, D. E.; Donets, E. D.; Donets, E. E.; Katagiri, K.; Noda, K.; Ponkin, D. O.; Ramzdorf, A. Yu.; Salnikov, V. V.; Shutov, V. B.
2015-08-01
The type of the Electron String Ion Sources (ESIS) is considered to be the appropriate one to produce pulsed C4+ and C6+ ion beams for cancer therapy accelerators. In fact, the new test ESIS Krion-6T already now provides more than 1010 C4+ ions per pulse and about 5 × 109 C6+ ions per pulse. Such ion sources could be suitable to apply at synchrotrons. It has also been found that Krion-6T can provide more than 1011 C6+ ions per second at the 100 Hz repetition rate, and the repetition rate can be increased at the same or larger ion output per second. This makes ESIS applicable at cyclotrons as well. ESIS can be also a suitable type of ion source to produce the 11C radioactive ion beams. A specialized cryogenic cell was experimentally tested at the Krion-2M ESIS for pulse injection of gaseous species into the electron string. It has been shown in experiments with stable methane that the total conversion efficiency of methane molecules to C4+ ions reached 5%÷10%. For cancer therapy with simultaneous irradiation and precise dose control (positron emission tomography) by means of 11C, transporting to the tumor with the primary accelerated 11C4+ beam, this efficiency is preliminarily considered to be large enough to produce the 11C4+ beam from radioactive methane and to inject this beam into synchrotrons.
Preliminary Tests of a Paul ion Trap as an Ion Source
Sadat Kiai, S. M.; Zirak, A. R.; Elahi, M.; Adlparvar, S.; Mortazavi, B. N.; Safarien, A.; Farhangi, S.; Sheibani, S.; Alhooie, S.; Khalaj, M. M. A.; Dabirzadeh, A. A.; Ruzbehani, M.; Zahedi, F.
2010-10-01
The paper reports on the design and construction of a Paul ion trap as an ion source by using an impact electron ionization technique. Ions are produced in the trap and confined for the specific time which is then extracted and detected by a Faraday cup. Especial electronic configurations are employed between the end caps, ring electrodes, electron gun and a negative voltage for the detector. This configuration allows a constant low level of pure ion source between the pulsed confined ion sources. The present experimental results are based on the production and confinement of Argon ions with good stability and repeatability, but in principle, the technique can be used for various Argon like ions.
GANIL Workshop on Ion Sources; Journees Sources d'Ions
Energy Technology Data Exchange (ETDEWEB)
Leroy, Renan [Grand Accelerateur National d' Ions Lourds (GANIL), 14 - Caen (France)
1999-07-01
The proceedings of the GANIL Workshop on Ion Sources held at GANIL - Caen on 18-19 March 1999 contains 13 papers aiming at improving the old source operation and developing new types of sources for nuclear research and studies of ion physics. A number of reports are devoted to applications like surface treatment, ion implantation or fusion injection. The 1+{yields}n+ transformation, charged particle transport in ECR sources, addition of cesium and xenon in negative ion sources and other basic issues in ion sources are also addressed.
Review on heavy ion radiotherapy facilities and related ion sources (invited)
International Nuclear Information System (INIS)
Kitagawa, A.; Fujita, T.; Muramatsu, M.; Biri, S.; Drentje, A. G.
2010-01-01
Heavy ion radiotherapy awakens worldwide interest recently. The clinical results obtained by the Heavy Ion Medical Accelerator in Chiba at the National Institute of Radiological Sciences in Japan have clearly demonstrated the advantages of carbon ion radiotherapy. Presently, there are four facilities for heavy ion radiotherapy in operation, and several new facilities are under construction or being planned. The most common requests for ion sources are a long lifetime and good stability and reproducibility. Sufficient intensity has been achieved by electron cyclotron resonance ion sources at the present facilities.
International Nuclear Information System (INIS)
Gries, W.H.
1976-06-01
This is a report of the study of the implantation of heavy ions at medium keV-energies into electrically conducting mono-elemental solids, at ion doses too small to cause significant loss of the implanted ions by resputtering. The study has been undertaken to investigate the possibility of accurate portioning of matter in submicrogram quantities, with some specific applications in mind. The problem is extensively investigated both on a theoretical level and in practice. A mathematical model is developed for calculating the loss of implanted ions by resputtering as a function of the implanted ion dose and the sputtering yield. Numerical data are produced therefrom which permit a good order-of-magnitude estimate of the loss for any ion/solid combination in which the ions are heavier than the solid atoms, and for any ion energy from 10 to 300 keV. The implanted ion dose is measured by integration of the ion beam current, and equipment and techniques are described which make possible the accurate integration of an ion current in an electromagnetic isotope separator. The methods are applied to two sample cases, one being a stable isotope, the other a radioisotope. In both cases independent methods are used to show that the implantation is indeed quantitative, as predicted. At the same time the sample cases are used to demonstrate two possible applications for quantitative ion implantation, viz. firstly for the manufacture of calibration standards for instrumental micromethods of elemental trace analysis in metals, and secondly for the determination of the half-lives of long-lived radioisotopes by a specific activity method. It is concluded that the present study has advanced quantitative ion implantation to the state where it can be successfully applied to the solution of problems in other fields
International Nuclear Information System (INIS)
Takeuchi, Mitsuo; Wada, Shigeru; Takahashi, Hiroyuki; Hayashi, Kazuhiko; Murayama, Yoji
2000-09-01
At the research reactor such as JRR-3M, the operation management is carried out in order to ensure safe operation, for example, the excess reactivity is measured regularly and confirmed that it satisfies a safety condition. The excess reactivity is calculated using control rod position in criticality and control rod worth measured by a positive period method (P.P method), the conventional inverse kinetic method (IK method) and so on. The neutron source, however, influences measurement results and brings in a measurement error. A new IK method considering the influence of the steady neutron sources is proposed and applied to the JRR-3M. This report shows that the proposed IK method measures control rod worth more precisely than a conventional IK method. (author)
Ion-acoustic nonlinear periodic waves in electron-positron-ion plasma
International Nuclear Information System (INIS)
Chawla, J. K.; Mishra, M. K.
2010-01-01
Ion-acoustic nonlinear periodic waves, namely, ion-acoustic cnoidal waves have been studied in electron-positron-ion plasma. Using reductive perturbation method and appropriate boundary condition for nonlinear periodic waves, the Korteweg-de Vries (KdV) equation is derived for the system. The cnoidal wave solution of the KdV equation is discussed in detail. It is found that the frequency of the cnoidal wave is a function of its amplitude. It is also found that the positron concentration modifies the properties of the ion-acoustic cnoidal waves. The existence regions for ion-acoustic cnoidal wave in the parameters space (p,σ), where p and σ are the positron concentration and temperature ratio of electron to positron, are discussed in detail. In the limiting case these ion-acoustic cnoidal waves reduce to the ion-acoustic soliton solutions. The effect of other parameters on the characteristics of the nonlinear periodic waves is also discussed.
Schmidt, B.
Ion beam techniques, including conventional broad beam ion implantation, ion beam synthesis and ion irradiation of thin layers, as well as local ion implantation with fine-focused ion beams have been applied in different fields of micro- and nanotechnology. The ion beam synthesis of nanoparticles in high-dose ion-implanted solids is explained as phase separation of nanostructures from a super-saturated solid state through precipitation and Ostwald ripening during subsequent thermal treatment of the ion-implanted samples. A special topic will be addressed to self-organization processes of nanoparticles during ion irradiation of flat and curved solid-state interfaces. As an example of silicon nanocrystal application, the fabrication of silicon nanocrystal non-volatile memories will be described. Finally, the fabrication possibilities of nanostructures, such as nanowires and chains of nanoparticles (e.g. CoSi2), by ion beam synthesis using a focused Co+ ion beam will be demonstrated and possible applications will be mentioned.
Sympathetic cooling of ions in a hybrid atom ion trap
Energy Technology Data Exchange (ETDEWEB)
Hoeltkemeier, Bastian
2016-10-27
In this thesis the dynamics of a trapped ion immersed in a spatially localized buffer gas is investigated. For a homogeneous buffer gas, the ion's energy distribution reaches a stable equilibrium only if the mass of the buffer gas atoms is below a critical value. This limitation can be overcome by using multipole traps in combination and/or a spatially confined buffer gas. Using a generalized model for elastic collisions of the ion with the buffer gas atoms, the ion's energy distribution is numerically determined for arbitrary buffer gas distributions and trap parameters. Three regimes characterized by the respective analytic form of the ion's equilibrium energy distribution are found. One of these is a novel regime at large atom-to-ion mass ratios where the final ion temperature can tuned by adiabatically decreasing the spatial extension of the buffer gas and the effective ion trap depth (forced sympathetic cooling). The second part of the thesis presents a hybrid atom ion trap designed for sympathetic cooling of hydroxide anions. In this hybrid trap the anions are immersed in a cloud of laser cooled rubidium atoms. The translational and rovibrational temperatures of the anions is probed by photodetachment tomography and spectroscopy which shows the first ever indication of sympathetic cooling of anions by laser cooled atoms.
Electron string ion sources for carbon ion cancer therapy accelerators
Energy Technology Data Exchange (ETDEWEB)
Boytsov, A. Yu.; Donets, D. E.; Donets, E. D.; Donets, E. E.; Ponkin, D. O.; Ramzdorf, A. Yu.; Salnikov, V. V.; Shutov, V. B. [Joint Institute for Nuclear Research, Dubna 141980 (Russian Federation); Katagiri, K.; Noda, K. [National Institute of Radiological Science, 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan)
2015-08-15
The type of the Electron String Ion Sources (ESIS) is considered to be the appropriate one to produce pulsed C{sup 4+} and C{sup 6+} ion beams for cancer therapy accelerators. In fact, the new test ESIS Krion-6T already now provides more than 10{sup 10} C{sup 4+} ions per pulse and about 5 × 10{sup 9} C{sup 6+} ions per pulse. Such ion sources could be suitable to apply at synchrotrons. It has also been found that Krion-6T can provide more than 10{sup 11} C{sup 6+} ions per second at the 100 Hz repetition rate, and the repetition rate can be increased at the same or larger ion output per second. This makes ESIS applicable at cyclotrons as well. ESIS can be also a suitable type of ion source to produce the {sup 11}C radioactive ion beams. A specialized cryogenic cell was experimentally tested at the Krion-2M ESIS for pulse injection of gaseous species into the electron string. It has been shown in experiments with stable methane that the total conversion efficiency of methane molecules to C{sup 4+} ions reached 5%÷10%. For cancer therapy with simultaneous irradiation and precise dose control (positron emission tomography) by means of {sup 11}C, transporting to the tumor with the primary accelerated {sup 11}C{sup 4+} beam, this efficiency is preliminarily considered to be large enough to produce the {sup 11}C{sup 4+} beam from radioactive methane and to inject this beam into synchrotrons.
Emission of positive oxygen ions from ion bombardment of adsorbate-covered metal surfaces
International Nuclear Information System (INIS)
Kaurin, M.G.
1989-01-01
During ion bombardment of metal surfaces, collision cascades can result in the emission of sputtered secondary ions. Recent experiments, however, have suggested that the emission of positive ions of electronegative adsorbates can result from electronic processes rather than from processes involving elastic collisions. This dissertation presents the results of experiments studying the emission of positive oxygen ions from oxygen- and carbon-monoxide-covered transition metal surfaces during bombardment by 25-250 keV ions of neon, argon, and krypton. The systems studied may be grouped into four categories. For a nickel substrate with adsorbed oxygen, the emission of positive oxygen ions proceeds through collision cascades. For titanium and niobium with adsorbed oxygen, the emission of positive oxygen ions is proportional to the primary ion velocity, consistent with emission from electronic processes; for a given primary ion velocity, the oxygen ion yield is independent of primary ion species. For substrates of molybdenum and tungsten, the oxygen yield is proportional to primary ion velocity, but the yield also depends on the primary ion species for a given primary ion velocity in a manner that is consistent with emission resulting from electronic processes. For these two groups, except for titanium, the yields during neon ion bombardment do not extrapolate (assuming linearity with primary ion velocity) to a nonzero value at zero beam velocity. The magnitude of the oxygen ion yields from these targets is not consistent with that expected if the emission were induced by secondary electrons emitted during the ion bombardment
Systems and Methods for Ejection of Ions from an Ion Trap
Cooks, Robert Graham (Inventor); Snyder, Dalton (Inventor)
2018-01-01
The invention generally relates to systems and methods for ejection of ions from an ion trap. In certain embodiments, systems and methods of the invention sum two different frequency signals into a single summed signal that is applied to an ion trap. In other embodiments, an amplitude of a single frequency signal is modulated as the single frequency signal is being applied to the ion trap. In other embodiments, a first alternating current (AC) signal is applied to an ion trap that varies as a function of time, while a constant radio frequency (RF) signal is applied to the ion trap.
2008-01-01
The Ion Beam Propulsion Study was a joint high-level study between the Applied Physics Laboratory operated by NASA and ASRC Aerospace at Kennedy Space Center, Florida, and Berkeley Scientific, Berkeley, California. The results were promising and suggested that work should continue if future funding becomes available. The application of ion thrusters for spacecraft propulsion is limited to quite modest ion sources with similarly modest ion beam parameters because of the mass penalty associated with the ion source and its power supply system. Also, the ion source technology has not been able to provide very high-power ion beams. Small ion beam propulsion systems were used with considerable success. Ion propulsion systems brought into practice use an onboard ion source to form an energetic ion beam, typically Xe+ ions, as the propellant. Such systems were used for steering and correction of telecommunication satellites and as the main thruster for the Deep Space 1 demonstration mission. In recent years, "giant" ion sources were developed for the controlled-fusion research effort worldwide, with beam parameters many orders of magnitude greater than the tiny ones of conventional space thruster application. The advent of such huge ion beam sources and the need for advanced propulsion systems for exploration of the solar system suggest a fresh look at ion beam propulsion, now with the giant fusion sources in mind.
Some Methods for Calculating Competition Coefficients from Resource-Utilization Spectra.
Schoener, Thomas W
When relative frequencies of resource kinds in the diet are known, the competition coefficient giving the effect of competitor j on i may be computed as \\documentclass{aastex} \\usepackage{amsbsy} \\usepackage{amsfonts} \\usepackage{amssymb} \\usepackage{bm} \\usepackage{mathrsfs} \\usepackage{pifont} \\usepackage{stmaryrd} \\usepackage{textcomp} \\usepackage{portland,xspace} \\usepackage{amsmath,amsxtra} \\usepackage{wasysym} \\pagestyle{empty} \\DeclareMathSizes{10}{9}{7}{6} \\begin{document}$$\\alpha_{ij}=\\left(\\frac{T_{j}}{T_{i}}\\right)\\left[\\frac{{\\sum\\limits_{k=1}^{m}}(d_{ik}/f_{k})\\:(d_{jk}/f_{k})\\:b_{ik}}{\\sum\\limits_{k=1}^{m}(d_{ik}/f_{k})^{2}\\:b_{ik}}\\right],$$\\end{document} where T j /T i = the ratio of the number of items consumed by an individual of competitor j to that consumed by an individual of competitor i, measured over an interval of time that includes all regular fluctuations in consumption for both species; d ik = the frequency of resource k in the diet of competitor i (and similarly for d jk ); f k = the standing frequency of resource k in the environment; b ik = the net calories gained by an individual of competitor i from an item of resource k, or more approximately the calories contained in an item of resource k, or still more approximately the weight or volume of an item of resource k; and the summations are taken over all resources eaten by at least one of the competing species. The coefficient follows from MacArthur's (1968) consumer-resource system when the ratio of the carrying capacity to intrinsic rate of increase is constant for all resources. When relative frequencies of time spent foraging in habitat kinds are known, the competition coefficient may be computed as \\documentclass{aastex} \\usepackage{amsbsy} \\usepackage{amsfonts} \\usepackage{amssymb} \\usepackage{bm} \\usepackage{mathrsfs} \\usepackage{pifont} \\usepackage{stmaryrd} \\usepackage{textcomp} \\usepackage{portland,xspace} \\usepackage
Directory of Open Access Journals (Sweden)
Edda T. Lwoga
2010-12-01
Full Text Available This article addresses the management of agricultural indigenous knowledge (IK in developing countries, with a specific focus on Tanzania. It provides background details on IK and its importance for agricultural development. It introduces various knowledge management (KM concepts and discusses their application in managing IK in the developing world by placing Nonaka’s knowledge creation theory (Nonaka 1991; Nonaka & Takeuchi 1995; Nonaka, Toyama & Konno 2000 in the context of the local communities. Data from focus groups were used to triangulate with data from interviews in order to validate, confirm and corroborate quantitative results with qualitative findings. The study findings showed that knowledge creation theory can be used to manage IK in the local communities, however, adequate and appropriate resources need to be allocated for capturing and preserving IK before it disappears altogether. For sustainable agricultural development, the communities have to be placed within a knowledge-creating setting that continuously creates, distributes and shares knowledge within and beyond the communities’ boundaries and integrates it with new agricultural technologies, innovations and knowledge.
Electron-ion correlation effects in ion-atom single ionization
Energy Technology Data Exchange (ETDEWEB)
Colavecchia, F.D.; Garibotti, C.R. [Centro Atomico Bariloche and Consejo Nacional de Investigaciones Cientificas y Tecnicas, 8400 San Carlos de Bariloche (Argentina); Gasaneo, G. [Departamento de Fisica, Universidad Nacional del Sur, Av. Alem 1253, 8000 Bahia Blanca (Argentina)
2000-06-28
We study the effect of electron-ion correlation in single ionization processes of atoms by ion impact. We present a distorted wave model where the final state is represented by a correlated function solution of a non-separable three-body continuum Hamiltonian, that includes electron-ion correlation as coupling terms of the wave equation. A comparison of the electronic differential cross sections computed with this model with other theories and experimental data reveals that the influence of the electron-ion correlation is more significant for low energy emitted electrons. (author). Letter-to-the-editor.
A quadrupole ion trap as low-energy cluster ion beam source
Uchida, N; Kanayama, T
2003-01-01
Kinetic energy distribution of ion beams was measured by a retarding field energy analyzer for a mass-selective cluster ion beam deposition system that uses a quadrupole ion trap as a cluster ion beam source. The results indicated that the system delivers a cluster-ion beam with energy distribution of approx 2 eV, which corresponded well to the calculation results of the trapping potentials in the ion trap. Using this deposition system, mass-selected hydrogenated Si cluster ions Si sub n H sub x sup + were actually deposited on Si(111)-(7x7) surfaces at impact kinetic energy E sub d of 3-30 eV. Observation by using a scanning tunneling microscope (STM) demonstrated that Si sub 6 H sub x sup + cluster ions landed on the surface without decomposition at E sub d =3 eV, while the deposition was destructive at E sub d>=18 eV. (author)
Energy Technology Data Exchange (ETDEWEB)
Zhu, X. P. [Key Laboratory of Materials Modification by Laser, Ion, and Electron Beams, Ministry of Education, Dalian University of Technology, Dalian 116024 (China); Surface Engineering Laboratory, School of Materials Science and Engineering, Dalian University of Technology, Dalian 116024 (China); Zhang, Z. C.; Lei, M. K., E-mail: surfeng@dlut.edu.cn [Surface Engineering Laboratory, School of Materials Science and Engineering, Dalian University of Technology, Dalian 116024 (China); Pushkarev, A. I. [Surface Engineering Laboratory, School of Materials Science and Engineering, Dalian University of Technology, Dalian 116024 (China); Laboratory of Beam and Plasma Technology, High Technologies Physics Institute, Tomsk Polytechnic University, 30, Lenin Ave, 634050 Tomsk (Russian Federation)
2016-01-15
High-intensity pulsed ion beam (HIPIB) with ion current density above Child-Langmuir limit is achieved by extracting ion beam from anode plasma of ion diodes with suppressing electron flow under magnetic field insulation. It was theoretically estimated that with increasing the magnetic field, a maximal value of ion current density may reach nearly 3 times that of Child-Langmuir limit in a non-relativistic mode and close to 6 times in a highly relativistic mode. In this study, the behavior of ion beam enhancement by magnetic insulation is systematically investigated in three types of magnetically insulated ion diodes (MIDs) with passive anode, taking into account the anode plasma generation process on the anode surface. A maximal enhancement factor higher than 6 over the Child-Langmuir limit can be obtained in the non-relativistic mode with accelerating voltage of 200–300 kV. The MIDs differ in two anode plasma formation mechanisms, i.e., surface flashover of a dielectric coating on the anode and explosive emission of electrons from the anode, as well as in two insulation modes of external-magnetic field and self-magnetic field with either non-closed or closed drift of electrons in the anode-cathode (A-K) gap, respectively. Combined with ion current density measurement, energy density characterization is employed to resolve the spatial distribution of energy density before focusing for exploring the ion beam generation process. Consistent results are obtained on three types of MIDs concerning control of neutralizing electron flows for the space charge of ions where the high ion beam enhancement is determined by effective electron neutralization in the A-K gap, while the HIPIB composition of different ion species downstream from the diode may be considerably affected by the ion beam neutralization during propagation.
Recharging of a screened ion on the molecular ion
International Nuclear Information System (INIS)
Karbovanets, M.I.; Lazur, V.Yu.; Yudin, G.L.; Gosudarstvennyj Komitet po Ispol'zovaniyu Atomnoj Ehnergii SSSR, Obninsk. Fiziko-Ehnergeticheskij Inst.)
1987-01-01
Charge exchange of a screened ion on a molecular ion is studied in the Oppenheimer-Brinkman-Cramers approximation. To calculate ion exchange probabilities and cross sections summed over the final degenerated electron states method of Green functions analogous to that applied earlier in the direct Coulomb excitation theory and atomic ionization is developed
International Nuclear Information System (INIS)
Igor Kaganovich
2000-01-01
Negative ions tend to stratify in electronegative plasmas with hot electrons (electron temperature Te much larger than ion temperature Ti, Te > Ti ). The boundary separating a plasma containing negative ions, and a plasma, without negative ions, is usually thin, so that the negative ion density falls rapidly to zero-forming a negative ion density front. We review theoretical, experimental and numerical results giving the spatio-temporal evolution of negative ion density fronts during plasma ignition, the steady state, and extinction (afterglow). During plasma ignition, negative ion fronts are the result of the break of smooth plasma density profiles during nonlinear convection. In a steady-state plasma, the fronts are boundary layers with steepening of ion density profiles due to nonlinear convection also. But during plasma extinction, the ion fronts are of a completely different nature. Negative ions diffuse freely in the plasma core (no convection), whereas the negative ion front propagates towards the chamber walls with a nearly constant velocity. The concept of fronts turns out to be very effective in analysis of plasma density profile evolution in strongly non-isothermal plasmas
Multiply charged ions from solid substances with the mVINIS Ion Source
International Nuclear Information System (INIS)
Dragani, I; Nedeljkovi, T; Jovovi, J; Siljegovic, M; Dobrosavljevic, A
2007-01-01
We have used the well known metal-ions-from-volatile-compounds (MIVOC) method at the mVINIS Ion Source to produce the multiply charged ion beams form solid substances. Based on this method the very intense and stable multiply charged ion beams of several solid substances having the high melting points were extracted. The ion yields and the spectra of multiply charged ion beams obtained from solid materials like Fe and Hf will be presented. We have utilized the multiply charged ion beams from solid substances to irradiate the polymers, fullerenes and glassy carbon at the low energy channel for modification of materials
Ion Selectivity Mechanism in a Bacterial Pentameric Ligand-Gated Ion Channel
International Nuclear Information System (INIS)
Wang, Hailong; Cheng, Xiaolin
2011-01-01
The proton-gated ion channel from Gloeobacter violaceus (GLIC) is a prokaryotic homolog of the eukaryotic nicotinic acetylcholine receptor (nAChR) that responds to the binding of neurotransmitter acetylcholine and mediates fast signal transmission. Recent emergence of a high resolution crystal structure of GLIC captured in a potentially open state allowed detailed, atomic-level insight into ion conduction and selectivity mechanisms in these channels. Herein, we have examined the barriers to ion conduction and origins of ion selectivity in the GLIC channel by the construction of potential of mean force (PMF) profiles for sodium and chloride ions inside the transmembrane region. Our calculations reveal that the GLIC channel is open for a sodium ion to transport, but presents a ∼10 kcal/mol free energy barrier for a chloride ion, which arises primarily from the unfavorable interactions with a ring of negatively charged glutamate residues (E-2) at the intracellular end and a ring of hydrophobic residues (I9) in the middle of the transmembrane domain. Our collective findings further suggest that the charge selection mechanism can, to a large extent, be attributed to the narrow intracellular end and a ring of glutamate residues in this position their strong negative electrostatics and ability to bind cations. By contrast, E19 at the extracellular entrance only plays a minor role in ion selectivity of GLIC. In addition to electrostatics, both ion hydration and protein dynamics are found to be crucial for ion conduction as well, which explains why a chloride ion experiences a much greater barrier than a sodium ion in the hydrophobic region of the pore.
Akter, Fouzia; Saito, Shingo; Tasaki-Handa, Yuiko; Shibukawa, Masami
2018-01-01
A new analytical methodology for a simple and efficient on-line preconcentration of trace inorganic anions in water and salt samples prior to ion chromatographic determination is proposed. The preconcentration method is based on partition/ion-exclusion chromatographic ion stacking (PIEC ion stacking) with a hydrophilic polymer gel column containing a small amount of fixed anionic charges. The developed on-line PIEC ion stacking-ion chromatography method was validated by recovery experiments for the determination of nitrate in tap water in terms of both accuracy and precision, and the results showed the reliability of the method. The method proposed was also successfully applied to the determination of trace impurity nitrite and nitrate in reagent-grade salts of sodium sulfate. A low background level can be achieved since pure water is used as the eluant for the PIEC ion stacking. It is possible to reach sensitive detection at sub-μg L -1 levels by on-line PIEC ion stacking-ion chromatography.
Development of a compact ECR ion source for various ion production
Energy Technology Data Exchange (ETDEWEB)
Muramatsu, M., E-mail: m-mura@nirs.go.jp; Hojo, S.; Iwata, Y.; Katagiri, K.; Sakamoto, Y.; Kitagawa, A. [National Institute of Radiological Sciences (NIRS), 4-9-1 Anagawa, Inage, Chiba 263-8555 (Japan); Takahashi, N. [Sumitomo Heavy Industries, Ltd., 19 Natsushima, Yokosuka, Kanagawa 237-8555 (Japan); Sasaki, N.; Fukushima, K.; Takahashi, K.; Suzuki, T.; Sasano, T. [Accelerator Engineering Corporation, 3-8-5 Konakadai, Inage, Chiba 263-0043 (Japan); Uchida, T.; Yoshida, Y. [Bio-Nano Electronics Research Centre, Toyo University, 2100 Kujirai, Kawagoe-shi, Saitama 350-8585 (Japan); Hagino, S.; Nishiokada, T.; Kato, Y. [Graduate School of Engineering, Osaka University, 2-1 Yamada-oka, Suita-shi, Osaka 565-0871 (Japan)
2016-02-15
There is a desire that a carbon-ion radiotherapy facility will produce various ion species for fundamental research. Although the present Kei2-type ion sources are dedicated for the carbon-ion production, a future ion source is expected that could provide: (1) carbon-ion production for medical use, (2) various ions with a charge-to-mass ratio of 1/3 for the existing Linac injector, and (3) low cost for modification. A prototype compact electron cyclotron resonance (ECR) ion source, named Kei3, based on the Kei series has been developed to correspond to the Kei2 type and to produce these various ions at the National Institute of Radiological Sciences (NIRS). The Kei3 has an outer diameter of 280 mm and a length of 1120 mm. The magnetic field is formed by the same permanent magnet as Kei2. The movable extraction electrode has been installed in order to optimize the beam extraction with various current densities. The gas-injection side of the vacuum chamber has enough space for an oven system. We measured dependence of microwave frequency, extraction voltage, and puller position. Charge state distributions of helium, carbon, nitrogen, oxygen, and neon were also measured.
Molecular dynamics simulations of ion range profiles for heavy ions in light targets
Energy Technology Data Exchange (ETDEWEB)
Lan, C. [Department of Materials Science and Engineering, University of Tennessee, Knoxville, TN 37996 (United States); State Key Laboratory of Nuclear Physics and Technology, Peking University, 100871 (China); Xue, J.M. [State Key Laboratory of Nuclear Physics and Technology, Peking University, 100871 (China); Zhang, Y., E-mail: Zhangy1@ornl.gov [Department of Materials Science and Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Materials Science and Technology Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Morris, J.R. [Department of Materials Science and Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Materials Science and Technology Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Zhu, Z. [Pacific Northwest National Laboratory, Richland, WA 99352 (United States); Gao, Y.; Wang, Y.G.; Yan, S. [State Key Laboratory of Nuclear Physics and Technology, Peking University, 100871 (China); Weber, W.J. [Department of Materials Science and Engineering, University of Tennessee, Knoxville, TN 37996 (United States); Materials Science and Technology Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States)
2012-09-01
The determination of stopping powers for slow heavy ions in targets containing light elements is important to accurately describe ion-solid interactions, evaluate ion irradiation effects and predict ion ranges for device fabrication and nuclear applications. Recently, discrepancies of up to 40% between the experimental results and SRIM (Stopping and Range of Ions in Matter) predictions of ion ranges for heavy ions with medium and low energies (<{approx}25 keV/nucleon) in light elemental targets have been reported. The longer experimental ion ranges indicate that the stopping powers used in the SRIM code are overestimated. Here, a molecular dynamics simulation scheme is developed to calculate the ion ranges of heavy ions in light elemental targets. Electronic stopping powers generated from both a reciprocity approach and the SRIM code are used to investigate the influence of electronic stopping on ion range profiles. The ion range profiles for Au and Pb ions in SiC and Er ions in Si, with energies between 20 and 5250 keV, are simulated. The simulation results show that the depth profiles of implanted ions are deeper and in better agreement with the experiments when using the electronic stopping power values derived from the reciprocity approach. These results indicate that the origin of the discrepancy in ion ranges between experimental results and SRIM predictions in the low energy region may be an overestimation of the electronic stopping powers used in SRIM.
International Nuclear Information System (INIS)
Johnson, E.
1986-01-01
It is the purpose of the present paper to give a review of surface alloy processing by ion implantation. However, rather than covering this vast subject as a whole, the survey is confined to a presentation of the microstructures that can be found in metal surfaces after ion implantation. The presentation is limited to alloys processed by ion implantation proper, that is to processes in which the alloy compositions are altered significantly by direct injection of the implanted ions. The review is introduced by a presentation of the processes taking place during development of the fundamental event in ion implantation - the collision cascade, followed by a summary of the various microstructures which can be formed after ion implantation into metals. This is compared with the variability of microstructures that can be achieved by rapid solidification processing. The microstructures are subsequently discussed in the light of the processes which, as the implantations proceed, take place during and immediately after formation of the individual collision cascades. These collision cascades define the volumes inside which individual ions are slowed down in the implanted targets. They are not only centres for vigorous agitation but also the sources for formation of excess concentrations of point defects, which will influence development of particular microstructures. A final section presents a selection of specific structures which have been observed in different alloy systems. (orig./GSCH)
Transport of negative hydrogen and deuterium ions in RF-driven ion sources
International Nuclear Information System (INIS)
Gutser, R; Wuenderlich, D; Fantz, U
2010-01-01
Negative hydrogen ion sources are major components of neutral beam injection systems for plasma heating in future large-scale fusion experiments such as ITER. In order to fulfill the requirements of the ITER neutral beam injection, a high-performance, large-area RF-driven ion source for negative ions is being developed at the MPI fuer Plasmaphysik. Negative hydrogen ions are mainly generated on a converter surface by impinging neutral particles and positive ions under the influence of magnetic fields and the plasma sheath potential. The 3D transport code TrajAn has been applied in order to obtain the total and spatially resolved extraction probabilities for H - and D - ions under identical plasma parameters and the realistic magnetic field topology of the ion source. A comparison of the isotopes shows a lower total extraction probability in the case of deuterium ions, caused by a different transport effect. The transport calculation shows that distortions of the spatial distributions of ion birth and extraction by the magnetic electron suppression field are present for both negative hydrogen and deuterium ions.
Laatamna, Abd Elkarim; Wagnerová, Pavla; Sak, Bohumil; Květoňová, Dana; Xiao, Lihua; Rost, Michael; McEvoy, John; Saadi, Ahmed Rachid; Aissi, Meriem; Kváč, Martin
2015-03-15
A total of 219 and 124 individual fecal samples of horses and donkeys, respectively, were screened for the presence of Cryptosporidium spp., Encephalitozoon spp., and Enterocytozoon bieneusi DNA by genus-specific nested PCR. Isolates were genotyped by sequence analysis of SSU rRNA, GP60, TRAP-C1, COWP, and HSP70 loci in Cryptosporidium, and the ITS region in microsporidia. Cryptosporidium spp. was detected on 3/18 horse farms and 1/15 farms where donkeys were kept. Overall, five (2.3%) horse and two (1.6%) donkey specimens were PCR positive for Cryptosporidium. Genotyping at SSU and GP60 loci revealed that three isolates from horses and donkeys were C. parvum subtype family IIaA16G1R1, one isolate from a horse was, C. muris RN66, and one isolate from a donkey was C. muris TS03. An isolate from a horse shared 99.4% and 99.3% similarity with Cryptosporidium hominis and C. cuniculus, respectively, at the SSU locus. This isolate shared 100% identity with C. hominis at the TRAP-C1, COWP, and HSP70 loci, and it was from the novel gp60 subtype family IkA15G1. Microsporidia were found on 6/18 horse and 2/15 donkey farms. E. bieneusi was identified in 6.8% (15/219) and 1.6% (2/124), and Encephalitozoon cuniculi was identified in 1.8% (4/219) and 1.6% (2/124), of horses and donkeys, respectively. Three genotypes of E. cuniculi (I, II and III) were detected in horses, and E. cuniculi genotype II was detected in donkeys. Four genotypes of E. bieneusi (horse1, horse 2, CZ3, D) were described in horses. An additional five horses and two donkeys were positive for E. bieneusi, but the isolated were not genotyped. Neither Cryptosporidium nor microsporidia prevalence were affected by sex, age, type of breeding, or whether the host was a horse or a donkey. Copyright © 2015 Elsevier B.V. All rights reserved.
Di Giovanni, James P; Barkley, Robert M; Jones, David N M; Hankin, Joseph A; Murphy, Robert C
2018-04-23
Ion mobility measurements of product ions were used to characterize the collisional cross section (CCS) of various complex lipid [M-H] - ions using traveling wave ion mobility mass spectrometry (TWIMS). TWIMS analysis of various product ions derived after collisional activation of mono- and dihydroxy arachidonate metabolites was found to be more complex than the analysis of intact molecular ions and provided some insight into molecular mechanisms involved in product ion formation. The CCS observed for the molecular ion [M-H] - and certain product ions were consistent with a folded ion structure, the latter predicted by the proposed mechanisms of product ion formation. Unexpectedly, product ions from [M-H-H 2 O-CO 2 ] - and [M-H-H 2 O] - displayed complex ion mobility profiles suggesting multiple mechanisms of ion formation. The [M-H-H 2 O] - ion from LTB 4 was studied in more detail using both nitrogen and helium as the drift gas in the ion mobility cell. One population of [M-H-H 2 O] - product ions from LTB 4 was consistent with formation of covalent ring structures, while the ions displaying a higher CCS were consistent with a more open-chain structure. Using molecular dynamics and theoretical CCS calculations, energy minimized structures of those product ions with the open-chain structures were found to have a higher CCS than a folded molecular ion structure. The measurement of product ion mobility can be an additional and unique signature of eicosanoids measured by LC-MS/MS techniques. Graphical Abstract ᅟ.
Di Giovanni, James P.; Barkley, Robert M.; Jones, David N. M.; Hankin, Joseph A.; Murphy, Robert C.
2018-04-01
Ion mobility measurements of product ions were used to characterize the collisional cross section (CCS) of various complex lipid [M-H]- ions using traveling wave ion mobility mass spectrometry (TWIMS). TWIMS analysis of various product ions derived after collisional activation of mono- and dihydroxy arachidonate metabolites was found to be more complex than the analysis of intact molecular ions and provided some insight into molecular mechanisms involved in product ion formation. The CCS observed for the molecular ion [M-H]- and certain product ions were consistent with a folded ion structure, the latter predicted by the proposed mechanisms of product ion formation. Unexpectedly, product ions from [M-H-H2O-CO2]- and [M-H-H2O]- displayed complex ion mobility profiles suggesting multiple mechanisms of ion formation. The [M-H-H2O]- ion from LTB4 was studied in more detail using both nitrogen and helium as the drift gas in the ion mobility cell. One population of [M-H-H2O]- product ions from LTB4 was consistent with formation of covalent ring structures, while the ions displaying a higher CCS were consistent with a more open-chain structure. Using molecular dynamics and theoretical CCS calculations, energy minimized structures of those product ions with the open-chain structures were found to have a higher CCS than a folded molecular ion structure. The measurement of product ion mobility can be an additional and unique signature of eicosanoids measured by LC-MS/MS techniques. [Figure not available: see fulltext.
An electron cyclotron resonance ion source based low energy ion beam platform
International Nuclear Information System (INIS)
Sun, L. T.; Shang, Y.; Ma, B. H.; Zhang, X. Z.; Feng, Y. C.; Li, X. X.; Wang, H.; Guo, X. H.; Song, M. T.; Zhao, H. Y.; Zhang, Z. M.; Zhao, H. W.; Xie, D. Z.
2008-01-01
To satisfy the requirements of surface and atomic physics study in the field of low energy multiple charge state ion incident experiments, a low energy (10 eV/q-20 keV/q) ion beam platform is under design at IMP. A simple test bench has been set up to test the ion beam deceleration systems. Considering virtues such as structure simplicity, easy handling, compactness, cost saving, etc., an all-permanent magnet ECRIS LAPECR1 [Lanzhou all-permanent magnet electron cyclotron resonance (ECR) ion source No. 1] working at 14.5 GHz has been adopted to produce intense medium and low charge state ion beams. LAPECR1 source has already been ignited. Some intense low charge state ion beams have been produced on it, but the first test also reveals that many problems are existing on the ion beam transmission line. The ion beam transmission mismatches result in the depressed performance of LAPECR1, which will be discussed in this paper. To obtain ultralow energy ion beam, after being analyzed by a double-focusing analyzer magnet, the selected ion beam will be further decelerated by two afocal deceleration lens systems, which is still under design. This design has taken into consideration both ions slowing down and also ion beam focusing. In this paper, the conceptual design of deceleration system will be discussed
An electron cyclotron resonance ion source based low energy ion beam platform.
Sun, L T; Shang, Y; Ma, B H; Zhang, X Z; Feng, Y C; Li, X X; Wang, H; Guo, X H; Song, M T; Zhao, H Y; Zhang, Z M; Zhao, H W; Xie, D Z
2008-02-01
To satisfy the requirements of surface and atomic physics study in the field of low energy multiple charge state ion incident experiments, a low energy (10 eV/q-20 keV/q) ion beam platform is under design at IMP. A simple test bench has been set up to test the ion beam deceleration systems. Considering virtues such as structure simplicity, easy handling, compactness, cost saving, etc., an all-permanent magnet ECRIS LAPECR1 [Lanzhou all-permanent magnet electron cyclotron resonance (ECR) ion source No. 1] working at 14.5 GHz has been adopted to produce intense medium and low charge state ion beams. LAPECR1 source has already been ignited. Some intense low charge state ion beams have been produced on it, but the first test also reveals that many problems are existing on the ion beam transmission line. The ion beam transmission mismatches result in the depressed performance of LAPECR1, which will be discussed in this paper. To obtain ultralow energy ion beam, after being analyzed by a double-focusing analyzer magnet, the selected ion beam will be further decelerated by two afocal deceleration lens systems, which is still under design. This design has taken into consideration both ions slowing down and also ion beam focusing. In this paper, the conceptual design of deceleration system will be discussed.
Ion-beam plasma and propagation of intense compensated ion beams
Energy Technology Data Exchange (ETDEWEB)
Gabovich, M D [AN Ukrainskoj SSR, Kiev. Inst. Fiziki
1977-02-01
Discussed are the results of investigation of plasma properties received by neutralization of intense ion beam space charge. Considered is the process of ion beam compensation by charges, formed as a result of gas ionization by this beam or by externally introduced ones. Emphasis is placed on collective phenomena in ion-beam plasma, in particular on non-linear effects limiting amplitude of oscillations. It is shown that not only dynamic decompensation but the Coulomb collisions of ions with electrons as well as other collective oscillations significantly affects the propagation of compensated ion beams. All the processes are to be taken into account in solving the problem of obtaining ''superdense'' compensated beams.
Ion-beam plasma and propagation of intense compensated ion beams
International Nuclear Information System (INIS)
Gabovich, M.D.
1977-01-01
Discussed are the results of investigation of plasma properties recieved by neutralization of intensive ion beam space charge. Considered is the process of ion beam compensation by charges, formed as a result of gas ionization by this beam or by externally introduced ones. Emphasis is placed on collective phenomena in ion-beam plasma, in particular on non-linear effects limiting amplitude of oscillations. It is shown, that not only dinamic decompensation but the Coulomb collisions of ions with electrons as well as other collective oscillations significantly affects the propagation of compensated ion beams. All the processes are to be taken into account at solving the problem of obtaining ''superdense'' compensated beams
Ion source techniques for high-speed processing of material surface by ion beams
International Nuclear Information System (INIS)
Ishikawa, Junzo
1990-01-01
The present paper discusses some key or candidate techniques for future ion source development and such ion sources developed by the author. Several types of microwave ion sources for producing low charge state ions have been developed in Japan. When a microwave plasma cathode developed by the author is adapted to a Kaufman type ion source, the electron emission currents are found to be 2.5 A for argon gas and 0.5-0.9 A for oxygen gas. An alternative ionization method for metal atoms is strongly required for high-speed processing of material surface by metal-ion beams. Detailed discussion is made of collisional ionization of vaporized atoms, and negative-ion production (secondary negative-ion emission by sputtering). An impregnated electrode type liquid-metal ion source developed by the author, which has a porous tip structure, is described. The negative-ion production efficiency is quite high. The report also presents a neutral and ionized alkaline-metal bombardment type heavy negative-ion source, which consists of a cesium plasma ion source, suppressor, target electrode, negative-ion extraction electrode, and einzel lens. (N.K.)
Fundamental processes determining the highly charged ion production in ECR ion sources
International Nuclear Information System (INIS)
Shirkov, G.D.
1992-01-01
The ion confinement and loss conditions in the open magnetic traps have been analyzed in this article. In EGRIS the the ions are confined in the negative potential well. The simultaneous application of ion cooling and pulse regime is proposed for pulse injection of highly charged ions in heavy ion accelerators and storage rings. 14 refs.; 3 figs
Ion-selective electrode reviews
Thomas, J D R
1983-01-01
Ion-Selective Electrode Reviews, Volume 5 is a collection of articles that covers ion-speciation. The book aims to present the advancements of the range and capabilities of selective ion-sensors. The topics covered in the selection are neutral carrier based ion-selective electrodes; reference electrodes and liquid junction effects in ion-selective electrode potentiometry; ion transfer across water/organic phase boundaries and analytical; and carbon substrate ion-selective electrodes. The text will be of great use to chemists and chemical engineers.
Zschornacka, G.; Thorn, A.
2013-12-16
Electron beam ion sources (EBISs) are ion sources that work based on the principle of electron impact ionization, allowing the production of very highly charged ions. The ions produced can be extracted as a DC ion beam as well as ion pulses of different time structures. In comparison to most of the other known ion sources, EBISs feature ion beams with very good beam emittances and a low energy spread. Furthermore, EBISs are excellent sources of photons (X-rays, ultraviolet, extreme ultraviolet, visible light) from highly charged ions. This chapter gives an overview of EBIS physics, the principle of operation, and the known technical solutions. Using examples, the performance of EBISs as well as their applications in various fields of basic research, technology and medicine are discussed.
ECR ion source based low energy ion beam facility
Indian Academy of Sciences (India)
Mass analyzed highly charged ion beams of energy ranging from a few keV to a few MeV plays an important role in various aspects of research in modern physics. In this paper a unique low energy ion beam facility (LEIBF) set up at Nuclear Science Centre (NSC) for providing low and medium energy multiply charged ion ...
Caliko: An Inverse Kinematics Software Library Implementation of the FABRIK Algorithm
Lansley, Alastair; Vamplew, Peter; Smith, Philip; Foale, Cameron
2016-01-01
The Caliko library is an implementation of the FABRIK (Forward And Backward Reaching Inverse Kinematics) algorithm written in Java. The inverse kinematics (IK) algorithm is implemented in both 2D and 3D, and incorporates a variety of joint constraints as well as the ability to connect multiple IK chains together in a hierarchy. The library allows for the simple creation and solving of multiple IK chains as well as visualisation of these solutions. It is licensed under the MIT software license...
Ong, Zhan Yuin; Cheng, Junchi; Huang, Yuan; Xu, Kaijin; Ji, Zhongkang; Fan, Weimin; Yang, Yi Yan
2014-01-01
In the face of mounting global antibiotics resistance, the identification and development of membrane-active antimicrobial peptides (AMPs) as an alternative class of antimicrobial agent have gained significant attention. The physical perturbation and disruption of microbial membranes by the AMPs have been proposed to be an effective means to overcome conventional mechanisms of drug resistance. Recently, we have reported the design of a series of short synthetic β-sheet folding peptide amphiphiles comprised of recurring (X1Y1X2Y2)n-NH2 sequences where X: hydrophobic amino acids, Y: cationic amino acids and n: number of repeat units. In efforts to investigate the effects of key parameters including stereochemistry, chain length and sequence pattern on antimicrobial effects, systematic d-amino acid substitutions of the lead peptides (IRIK)2-NH2 (IK8-all L) and (IRVK)3-NH2 (IK12-all L) were performed. It was found that the corresponding D-enantiomers exhibited stronger antimicrobial activities with minimal or no change in hemolytic activities, hence translating very high selectivity indices of 407.0 and >9.8 for IK8-all D and IK12-all D respectively. IK8-all D was also demonstrated to be stable to degradation by broad spectrum proteases trypsin and proteinase K. The membrane disrupting bactericidal properties of IK8-all D effectively prevented drug resistance development and inhibited the growth of various clinically isolated MRSA, VRE, Acinetobacter baumanni, Pseudomonas aeruginosa, Cryptococcus. neoformans and Mycobacterium tuberculosis. Significant reduction in intracellular bacteria counts was also observed following treatment with IK8-all D in the Staphylococcus. aureus infected mouse macrophage cell line RAW264.7 (P < 0.01). These results suggest that the d-amino acids substituted β-sheet forming peptide IK8-all D with its enhanced antimicrobial activities and improved protease stability, is a promising therapeutic candidate with potential to combat
Ion-acoustic double layers in multi-species plasmas maintained by negative ions
International Nuclear Information System (INIS)
Verheest, F.
1989-01-01
A study is made of ion-acoustic double layers in a plasma consisting of any number of cold positive and negative ion (and cold electron) species in addition to one isothermal electron population. The Sagdeev potential is obtained in general, together with limits on both compressive and rarefactive solutions for ion-acoustic double layers and/or solitons. Weak ion-acoustic double layers are described by a modified Korteweg-de Vries equation. Such double layers are not possible in plasmas with only positive ion species and one electron population. When one or more negative ion and/or cold electron species are included above a certain threshold density, rarefactive ion-acoustic double layers occur, but no compressive ones. The double-layer form of the potential is given, together with an application to a plasma with one positive and one negative ion component. It is shown that there is indeed such a threshold density for the negative ion density, depending on the charge-to-mass ratios of both types of ions. The threshold density is determined numerically for a range of such ratios and discussed in view of possible relevance to auroral and experimental plasmas. In the discussion, cold electrons can play the role of the negative ion species. (author)
An alkali ion source based on graphite intercalation compounds for ion mobility spectrometry
International Nuclear Information System (INIS)
Tabrizchi, Mahmoud; Hosseini, Zahra S
2008-01-01
A variety of alkali cation emitters were developed as the ion source for ion mobility spectrometry. The cation emitters were constructed based on alkali ion graphite intercalation compounds (GICs). The compounds were prepared by fusing alkali salts with ground graphite. In order to produce alkali ions, the compounds were loaded on a filament and heated to red. Reactant ions of the form alk + ions were observed for the alkali salts NaCl, KCl.LiCl, CsCl and SrCl. In addition to Na + ions, K + ions were observed at the beginning of thermionic emission from Na-GIC. This is due to the low ionization potential of potassium that exists in trace amounts in sodium salts. In addition to the potassium ion, Na + was observed in the case of LiCl salt. The Na + and K + peaks originating from impurities totally disappeared after about 40 min. However, the thermionic emission of the main ion of the corresponding salt lasted for several days. No negative ions were observed upon reversing the drift field. Selected organic compounds (methyl isobutyl ketone, dimethyl sulfoxide, acetone and tetrahydrofuran) were also ionized via alkali cation attachment reaction. Distinct ion mobility patterns were observed for different substances using one type of alkali reactant ion. However, the ion mobility pattern for a given substance changed when a different alkali reactant ion was used. Ammonia and amines were not ionized when this source was used
Plasma ion sources and ion beam technology in microfabrications
International Nuclear Information System (INIS)
Ji, Lili
2007-01-01
For over decades, focused ion beam (FIB) has been playing a very important role in microscale technology and research, among which, semiconductor microfabrication is one of its biggest application area. As the dimensions of IC devices are scaled down, it has shown the need for new ion beam tools and new approaches to the fabrication of small-scale devices. In the meanwhile, nanotechnology has also deeply involved in material science research and bioresearch in recent years. The conventional FIB systems which utilize liquid gallium ion sources to achieve nanometer scale resolution can no longer meet the various requirements raised from such a wide application area such as low contamination, high throughput and so on. The drive towards controlling materials properties at nanometer length scales relies on the availability of efficient tools. In this thesis, three novel ion beam tools have been developed and investigated as the alternatives for the conventional FIB systems in some particular applications. An integrated focused ion beam (FIB) and scanning electron microscope (SEM) system has been developed for direct doping or surface modification. This new instrument employs a mini-RF driven plasma source to generate focused ion beam with various ion species, a FEI two-lens electron (2LE) column for SEM imaging, and a five-axis manipulator system for sample positioning. An all-electrostatic two-lens column has been designed to focus the ion beam extracted from the source. Based on the Munro ion optics simulation, beam spot sizes as small as 100 nm can be achieved at beam energies between 5 to 35 keV if a 5 (micro)m-diameter extraction aperture is used. Smaller beam spot sizes can be obtained with smaller apertures at sacrifice of some beam current. The FEI 2LE column, which utilizes Schottky emission, electrostatic focusing optics, and stacked-disk column construction, can provide high-resolution (as small as 20 nm) imaging capability, with fairly long working distance
Bowers, Michael T
1979-01-01
Gas Phase Ion Chemistry, Volume 1 covers papers on the advances of gas phase ion chemistry. The book discusses the advances in flow tubes and the measurement of ion-molecule rate coefficients and product distributions; the ion chemistry of the earth's atmosphere; and the classical ion-molecule collision theory. The text also describes statistical methods in reaction dynamics; the state selection by photoion-photoelectron coincidence; and the effects of temperature and pressure in the kinetics of ion-molecule reactions. The energy distribution in the unimolecular decomposition of ions, as well
Design of the compact ECR ion source for heavy-ion therapy
International Nuclear Information System (INIS)
Muramatsu, M.; Kitagawa, A.; Sato, S.; Sato, Y.; Yamada, S.; Hattori, T.; Shibuya, S.
1999-01-01
Heavy ion cancer treatment is successfully being done at the Heavy Ion Medical Accelerator in Chiba (HIMAC). Design philosophy for the ion sources for medical facilities are as follows: sufficient beam intensity, a few hundred eμA; long lifetime with good stability; easy operation and easy maintenance; and compactness. In order to develop such source for future heavy-ion facilities, we have tested compact electron cyclotron resonance (ECR) ion sources using permanent magnets both for axial and radial confinement of hot electrons. Since the yield of C 2+ ion in the firstly-developed source (2.45 GHz ECR) was 15 eμA and far below the medical requirement (-150 eμA for the HIMAC), a new source has been proposed, having the frequency of 10 GHz. The extracted intensity of C 4+ (and C 2+ ) ions is expected to be higher than 200 eμA. (author)
Energy Technology Data Exchange (ETDEWEB)
Deng, Liulin; Garimella, Venkata BS; Hamid, Ahmed M.; Webb, Ian K.; Attah, Isaac K.; Norheim, Randolph V.; Prost, Spencer A.; Zheng, Xueyun; Sandoval, Jeremy A.; Baker, Erin M.; Ibrahim, Yehia M.; Smith, Richard D.
2017-05-25
We report on the implementation of a traveling wave (TW) based compression ratio ion mobility programming (CRIMP) approach within Structures for Lossless Ion Manipulations (SLIM) that enables both greatly enlarged trapped ion charge capacities and also their subsequent efficient compression for use in ion mobility (IM) separations. Ion accumulation is conducted in a long serpentine path TW SLIM region after which CRIMP allows the large ion populations to be ‘squeezed’. The compression process occurs at an interface between two SLIM regions, one operating conventionally and the second having an intermittently pausing or ‘stuttering’ TW, allowing the contents of multiple bins of ions from the first region to be merged into a single bin in the second region. In this initial work stationary voltages in the second region were used to block ions from exiting the first (trapping) region, and the resumption of TWs in the second region allows ions to exit, and the population to also be compressed if CRIMP is applied. In our initial evaluation we show that the number of charges trapped for a 40 s accumulation period was ~5×109, more than two orders of magnitude greater than the previously reported charge capacity using an ion funnel trap. We also show that over 1×109 ions can be accumulated with high efficiency in the present device, and that the extent of subsequent compression is only limited by the space charge capacity of the trapping region. Lower compression ratios allow increased IM peak heights without significant loss of signal, while excessively large compression ratios can lead to ion losses and other artifacts. Importantly, we show that extended ion accumulation in conjunction with CRIMP and multiple passes provides the basis for a highly desirable combination of ultra-high sensitivity and ultra-high resolution IM separations using SLIM.
Fast ion-atom and ion-molecule collisions
2013-01-01
The principal goal of this book is to provide state-of-the art coverage of the non-relativistic three- and four-body theories at intermediate and high energy ion-atom and ion-molecule collisions. The focus is on the most frequently studied processes: electron capture, ionization, transfer excitation and transfer ionization. The content is suitable both for graduate students and experienced researchers. For these collisions, the literature has seen enormous renewal of activity in the development and applications of quantum-mechanical theories. This subject is of relevance in several branches of science and technology, like accelerator-based physics, the search for new sources of energy and high temperature fusion of light ions. Other important applications are in life sciences via medicine, where high-energy ion beams are used in radiotherapy for which a number of storage ring accelerators are in full operation, under construction or planned to be built worldwide. Therefore, it is necessary to review this fiel...
Directory of Open Access Journals (Sweden)
Kota Kasahara
Full Text Available The mechanism of ion conduction by potassium channels is one of the central issues in physiology. In particular, it is still unclear how the ion concentration and the membrane voltage drive ion conduction. We have investigated the dynamics of the ion conduction processes in the Kv1.2 pore domain, by molecular dynamics (MD simulations with several different voltages and ion concentrations. By focusing on the detailed ion movements through the pore including selectivity filter (SF and cavity, we found two major conduction mechanisms, called the III-IV-III and III-II-III mechanisms, and the balance between the ion concentration and the voltage determines the mechanism preference. In the III-IV-III mechanism, the outermost ion in the pore is pushed out by a new ion coming from the intracellular fluid, and four-ion states were transiently observed. In the III-II-III mechanism, the outermost ion is pulled out first, without pushing by incoming ions. Increases in the ion concentration and voltage accelerated ion conductions, but their mechanisms were different. The increase in the ion concentrations facilitated the III-IV-III conductions, while the higher voltages increased the III-II-III conductions, indicating that the pore domain of potassium channels permeates ions by using two different driving forces: a push by intracellular ions and a pull by voltage.
Fast-ion Dα measurements of the fast-ion distribution (invited)
International Nuclear Information System (INIS)
Heidbrink, W. W.
2010-01-01
The fast-ion Dα (FIDA) diagnostic is an application of charge-exchange recombination spectroscopy. Fast ions that neutralize in an injected neutral beam emit Balmer-α light with a large Doppler shift. The spectral shift is exploited to distinguish the FIDA emission from other bright sources of Dα light. Background subtraction is the main technical challenge. A spectroscopic diagnostic typically achieves temporal, energy, and transverse spatial resolution of ∼1 ms, ∼10 keV, and ∼2 cm, respectively. Installations that use narrow-band filters achieve high spatial and temporal resolution at the expense of spectral information. For high temporal resolution, the bandpass-filtered light goes directly to a photomultiplier, allowing detection of ∼50 kHz oscillations in FIDA signal. For two-dimensional spatial profiles, the bandpass-filtered light goes to a charge-coupled device camera; detailed images of fast-ion redistribution at instabilities are obtained. Qualitative and quantitative models relate the measured FIDA signals to the fast-ion distribution function. The first quantitative comparisons between theory and experiment found excellent agreement in beam-heated magnetohydrodynamics (MHD)-quiescent plasmas. FIDA diagnostics are now in operation at magnetic-fusion facilities worldwide. They are used to study fast-ion acceleration by ion cyclotron heating, to detect fast-ion transport by MHD modes and microturbulence, and to study fast-ion driven instabilities.
Rearrangement reactions in ion-ion and ion-atom collisions: results and problems
Energy Technology Data Exchange (ETDEWEB)
Presnyakov, L.P. [Lebedev Physical Institute, Moscow (Russian Federation); Tawara, H.
1997-01-01
Recent experimental and theoretical results are discussed for ionic collisions with large cross sections at intermediate and small energies of the relative motion. Single- and double-electron removal from H{sup -} ions in slow collisions with other ions is considered in more details. The theoretical methods are discussed from the viewpoint of general requirements of scattering theory. (author)
Ion-ion Recombination and Chemiion Concentrations In Aircraft Exhaust
Turco, R. P.; Yu, F.
Jet aircraft emit large quantities of ultrafine volatile aerosols, as well as soot parti- cles, into the environment. To determine the long-term effects of these emissions, a better understanding of the mechanisms that control particle formation and evolution is needed, including the number and size dispersion. A recent explanation for aerosol nucleation in a jet wake involves the condensation of sulfuric acid vapor, and cer- tain organic compounds, onto charged molecular clusters (chemiions) generated in the engine combustors (Yu and Turco, 1997). Massive charged aggregates, along with sulfuric acid and organic precursor vapors, have been detected in jet plumes under cruise conditions. In developing the chemiion nucleation theory, Yu and Turco noted that ion-ion recombination in the engine train and jet core should limit the chemiion emission index to 1017/kg-fuel. This value is consistent with ion-ion recombination coefficients of 1×10-7 cm3/s over time scales of 10-2 s. However, the evolution of the ions through the engine has not been adequately studied. The conditions at the combustor exit are extreme-temperatures approach 1500 K, and pressures can reach 30 atmospheres. In this presentation, we show that as the combustion gases expand and cool, two- and three-body ion-ion recombination processes control the chemiion concentration. The concepts of mutual neutralization and Thomson recombination are first summarized, and appropriate temperature and pressure dependent recombination rate coefficients are derived for the aircraft problem. A model for ion losses in jet exhaust is then formulated using an "invariance" principle discussed by Turco and Yu (1997) in the context of a coagulating aerosol in an expanding plume. This recombina- tion model is applied to estimate chemiion emission indices for a range of operational engine conditions. The predicted ion emission rates are found to be consistent with observations. We discuss the sources of variance in chemiion
A heavy ion pre-injector for the ICT-ion implanter
International Nuclear Information System (INIS)
Bhattacharya, P.K.; Gaonkar, S.; Wagh, A.G.; Hattangadi, V.A.; Sarma, N.
1976-01-01
A cheap and versatile hollow cathode electron bombardment ion source system including its ion extraction-cum-focussing assembly for obtaining intense heavy ion beams of solids and gases is described. The extractor region is designed to include more than 15deg total beam angle of extracted beam for producing focused ion current densities upto 60mA/cm 2 to serve as a pre-injector for the ICT(insulated core transformer) type ion implanter. The extraction-cum-focussing lens is a low aberration strong Einzel lens system of all araldite and metal construction with optical elements of proper quality and location to suit low voltage injection and subsequent ion analysis. The injection can be selected anywhere between 2 to 10 keV for singly charged ions with typical extraction currents of 500/μ, using a ring anode and a source aperture of 20 mil. Einzel lens focussing assembly allows continuous adjustment of the beam convergence to about 5deg and the beam size to approximately 5mm in diameter with about 10 KV central electrode potential. Test results of source characteristics for both the accelerating and decelerating model of beam formation have been made. (author)
Upgraded vacuum arc ion source for metal ion implantation
International Nuclear Information System (INIS)
Nikolaev, A. G.; Oks, E. M.; Savkin, K. P.; Yushkov, G. Yu.; Brown, I. G.
2012-01-01
Vacuum arc ion sources have been made and used by a large number of research groups around the world over the past twenty years. The first generation of vacuum arc ion sources (dubbed ''Mevva,'' for metal vapor vacuum arc) was developed at Lawrence Berkeley National Laboratory in the 1980s. This paper considers the design, performance parameters, and some applications of a new modified version of this kind of source which we have called Mevva-V.Ru. The source produces broad beams of metal ions at an extraction voltage of up to 60 kV and a time-averaged ion beam current in the milliampere range. Here, we describe the Mevva-V.Ru vacuum arc ion source that we have developed at Tomsk and summarize its beam characteristics along with some of the applications to which we have put it. We also describe the source performance using compound cathodes.
Energy Technology Data Exchange (ETDEWEB)
Garimella, Venkata BS; Hamid, Ahmed M.; Deng, Liulin; Ibrahim, Yehia M.; Webb, Ian K.; Baker, Erin M.; Prost, Spencer A.; Norheim, Randolph V.; Anderson, Gordon A.; Smith, Richard D.
2016-11-02
In this work, we report an approach for spatial and temporal gas phase ion population manipulation, and demonstrate its application for the collapse of the ion distributions in ion mobility (IM) separations into tighter packets providing higher sensitivity measurements in conjunction with mass spectrometry (MS). We do this for ions moving from a conventionally traveling wave (TW)-driven region to a region where the TW is intermittently halted or ‘stuttered’. This approach causes the ion packets spanning a number of TW-created traveling traps (TT) to be redistributed into fewer TT, resulting in spatial compression. The degree of spatial compression is controllable and determined by the ratio of stationary time of the TW in the second region to its moving time. This compression ratio ion mobility programming (CRIMP) approach has been implemented using Structures for Lossless Ion Manipulations (SLIM) in conjunction with MS. CRIMP with the SLIM-MS platform is shown to provide increased peak intensities, reduced peak widths, and improved S/N ratios with MS detection. CRIMP also provides a foundation for extremely long path length and multi-pass IM separations in SLIM providing greatly enhanced IM resolution by reducing the detrimental effects of diffusional peak broadening due to increasing peak widths.
Using Ion Exchange Chromatography to Separate and Quantify Complex Ions
Johnson, Brian J.
2014-01-01
Ion exchange chromatography is an important technique in the separation of charged species, particularly in biological, inorganic, and environmental samples. In this experiment, students are supplied with a mixture of two substitution-inert complex ions. They separate the complexes by ion exchange chromatography using a "flash"…
Simulation study on ion extraction from ECR ion sources
International Nuclear Information System (INIS)
Fu, S.; Kitagawa, A.; Yamada, S.
1993-07-01
In order to study beam optics of NIRS-ECR ion source used in HIMAC, EGUN code has been modified to make it capable of modeling ion extraction from a plasma. Two versions of the modified code are worked out with two different methods in which 1-D and 2-D sheath theories are used respectively. Convergence problem of the strong nonlinear self-consistent equations is investigated. Simulations on NIRS-ECR ion source and HYPER-ECR ion source (in INS, Univ. of Tokyo) are presented in this paper, exhibiting an agreement with the experimental results. Some preliminary suggestions on the upgrading the extraction systems of these sources are also proposed. (author)
Simulation study on ion extraction from ECR ion sources
Energy Technology Data Exchange (ETDEWEB)
Fu, S.; Kitagawa, A.; Yamada, S.
1993-07-01
In order to study beam optics of NIRS-ECR ion source used in HIMAC, EGUN code has been modified to make it capable of modeling ion extraction from a plasma. Two versions of the modified code are worked out with two different methods in which 1-D and 2-D sheath theories are used respectively. Convergence problem of the strong nonlinear self-consistent equations is investigated. Simulations on NIRS-ECR ion source and HYPER-ECR ion source (in INS, Univ. of Tokyo) are presented in this paper, exhibiting an agreement with the experimental results. Some preliminary suggestions on the upgrading the extraction systems of these sources are also proposed. (author).
Heavy ion program at BNL: AGS, RHIC [Relativistic Heavy Ion Collider
International Nuclear Information System (INIS)
Barton, D.S.
1987-01-01
With the recent commissioning of fixed target, heavy ion physics at the AGS, Brookhaven National Laboratory (BNL) has embarked on a long range program in support of relativistic heavy ion research. Acceleration of low mass heavy ions (up to sulfur) to an energy of about 14.5 GeV/nucleon is possible with the direct connection of the BNL Tandem Van de Graaff and AGS accelerators. When completed, the new booster accelerator will provide heavy ions over the full mass range for injection and subsequent acceleration in the AGS. BNL is now engaged in an active R and D program directed toward the proposed Relativistic Heavy Ion Collider (RHIC). The results of the first operation of the low mass heavy ion program will be reviewed, and future expectations discussed. The expected performance for the heavy ion operation of the booster will be described and finally, the current status and outlook for the RHIC facility will be presented
The heavy ion injection scheme for RHIC [Relativistic Heavy Ion Collider
International Nuclear Information System (INIS)
Rhoades-Brown, M.J.
1989-01-01
The Relativistic Heavy Ion Collider (RHIC) at Brookhaven has a multi-component injection system. The Collider requires very heavy ions such as 79 197 Au to be injected fully stripped of atomic electrons, at a kinetic energy of approximately 10 GeV/nucleon. However, the heavy ions are produced initially at a negative ion source and accelerated first in a 15 MV Tandem. These partially stripped ions have a kinetic energy of approximately 1 MeV/nucleon on leaving the Tandem. In order to achieve the injection requirements for RHIC, the partially stripped ions are accelerated in the Booster (currently under construction) and pass through a stripping foil on their way to the Alternating Gradient Synchrotron (AGS), where they are further accelerated before injection into RHIC. Recent theoretical calculations have shown quite convincingly that very heavy ions with 2 electrons in the filled K-shell may be accelerated with negligible loss in the AGS. 13 refs., 3 figs., 3 tabs
Auroral ion beams and ion acoustic wave generation by fan instability
Energy Technology Data Exchange (ETDEWEB)
Vaivads, A
1996-04-01
Satellite observations indicate that efficient energy transport among various plasma particles and between plasma waves and plasma particles is taking place in auroral ion beam regions. These observations show that two characteristic wave types are associated with the auroral ion beam regions: electrostatic hydrogen cyclotron waves with frequencies above hydrogen gyrofrequency, and low frequency waves with frequencies below hydrogen gyrofrequency. We speculate that the low frequency waves can be ion acoustic waves generated through the fan instability. The presence of a cold background ion component is necessary for the onset of this instability. A cold ion component has been directly observed and has been indirectly suggested from observations of solitary wave structures. The wave-particle interaction during the development of the fan instability results in an efficient ion beam heating in the direction perpendicular to the ambient magnetic field. The fan instability development and the ion beam heating is demonstrated in a numerical particle simulation. 23 refs, 16 figs.
Ion Trapping, Storage, and Ejection in Structures for Lossless Ion Manipulations.
Zhang, Xinyu; Garimella, Sandilya V B; Prost, Spencer A; Webb, Ian K; Chen, Tsung-Chi; Tang, Keqi; Tolmachev, Aleksey V; Norheim, Randolph V; Baker, Erin S; Anderson, Gordon A; Ibrahim, Yehia M; Smith, Richard D
2015-06-16
A new Structures for Lossless Ion Manipulations (SLIM) module, having electrode arrays patterned on a pair of parallel printed circuit boards (PCB), was constructed and utilized to investigate capabilities for ion trapping at a pressure of 4 Torr. Positive ions were confined by application of RF voltages to a series of inner rung electrodes with alternating phase on adjacent electrodes, in conjunction with positive DC potentials on surrounding guard electrodes on each PCB. An axial DC field was also introduced by stepwise varying the DC potentials applied to the inner rung electrodes to control the ion transport and accumulation inside the ion trapping region. We show that ions can be trapped and accumulated with up to 100% efficiency, stored for at least 5 h with no significant losses, and then could be rapidly ejected from the SLIM trap. The present results provide a foundation for the development of much more complex SLIM devices that facilitate extended ion manipulations.
Numerical Simulation of Ion Transport in a Nano-Electrospray Ion Source at Atmospheric Pressure
Wang, Wei; Bajic, Steve; John, Benzi; Emerson, David R.
2018-03-01
Understanding ion transport properties from the ion source to the mass spectrometer (MS) is essential for optimizing device performance. Numerical simulation helps in understanding of ion transport properties and, furthermore, facilitates instrument design. In contrast to previously reported numerical studies, ion transport simulations in a continuous injection mode whilst considering realistic space-charge effects have been carried out. The flow field was solved using Reynolds-averaged Navier-Stokes (RANS) equations, and a particle-in-cell (PIC) method was applied to solve a time-dependent electric field with local charge density. A series of ion transport simulations were carried out at different cone gas flow rates, ion source currents, and capillary voltages. A force evaluation analysis reveals that the electric force, the drag force, and the Brownian force are the three dominant forces acting on the ions. Both the experimental and simulation results indicate that cone gas flow rates of ≤250 slph (standard liter per hour) are important for high ion transmission efficiency, as higher cone gas flow rates reduce the ion signal significantly. The simulation results also show that the ion transmission efficiency reduces exponentially with an increased ion source current. Additionally, the ion loss due to space-charge effects has been found to be predominant at a higher ion source current, a lower capillary voltage, and a stronger cone gas counterflow. The interaction of the ion driving force, ion opposing force, and ion dispersion is discussed to illustrate ion transport mechanism in the ion source at atmospheric pressure. [Figure not available: see fulltext.
Development of industrial ion implantation and ion assisted coating processes: A perspective
International Nuclear Information System (INIS)
Legg, K.O.; Solnick-Legg, H.
1989-01-01
Ion beam processes have gone through a series of developmental stages, from being the mainstay of the semiconductor industry for production of integrated circuits, to new commercial processes for biomedical, aerospace and other industries. Although research is still continuing on surface modification using ion beam methods, ion implantation and ion assisted coatings for treatment of metals, ceramics, polymers and composites must now be considered viable industrial processes of benefit in a wide variety of applications. However, ion implantation methods face various barriers to acceptability, in terms not only of other surface treatment processes, but for implantation itself. This paper will discuss some of the challenges faced by a small company whose primary business is development and marketing of ion implantation and ion-assisted coating processes. (orig.)
Fully kinetic simulation of ion acoustic and dust-ion acoustic waves
International Nuclear Information System (INIS)
Hosseini Jenab, S. M.; Kourakis, I.; Abbasi, H.
2011-01-01
A series of numerical simulations is presented, based on a recurrence-free Vlasov kinetic model using kinetic phase point trajectories. All plasma components are modeled kinetically via a Vlasov evolution equation, then coupled through Poisson's equation. The dynamics of ion acoustic waves in an electron-ion and in a dusty (electron-ion-dust) plasma configuration are investigated, focusing on wave decay due to Landau damping and, in particular, on the parametric dependence of the damping rate on the dust concentration and on the electron-to-ion temperature ratio. In the absence of dust, the occurrence of damping was observed, as expected, and its dependence to the relative magnitude of the electron vs ion temperature(s) was investigated. When present, the dust component influences the charge balance, enabling dust-ion acoustic waves to survive Landau damping even in the extreme regime where T e ≅ T i . The Landau damping rate is shown to be minimized for a strong dust concentration or/and for a high value of the electron-to-ion temperature ratio. Our results confirm earlier theoretical considerations and contribute to the interpretation of experimental observations of dust-ion acoustic wave characteristics.
Prakrajang, K.; Sangwijit, K.; Anuntalabhochai, S.; Wanichapichart, P.; Yu, L. D.
2012-02-01
Low-energy ion beam biotechnology (IBBT) has recently been rapidly developed worldwide. Ion-beam-induced DNA transfer is one of the important applications of IBBT. However, mechanisms involved in this application are not yet well understood. In this study plasma-neutralized ion beam was applied to investigate ion charge effect on induction of DNA transfer. Argon ion beam at 7.5 keV was neutralized by RF-driven plasma in the beam path and then bombarded cellulose membranes which were used as the mimetic plant cell envelope. Electrical properties such as impedance and capacitance of the membranes were measured after the bombardment. An in vitro experiment on plasmid DNA transfer through the cellulose membrane was followed up. The results showed that the ion charge input played an important role in the impedance and capacitance changes which would affect DNA transfer. Generally speaking, neutral particle beam bombardment of biologic cells was more effective in inducing DNA transfer than charged ion beam bombardment.
Response of thermal ions to electromagnetic ion cyclotron waves
Anderson, B. J.; Fuselier, S. A.
1994-01-01
Electromagnetic ion cyclotron waves generated by 10 - 50 keV protons in the Earth's equatorial magnetosphere will interact with the ambient low-energy ions also found in this region. We examine H(+) and He(+) distribution functions from approx. equals 1 to 160 eV using the Hot Plasma Composition Experiment instrument on AMPTE/CCE to investigate the thermal ion response to the waves. A total of 48 intervals were chosen on the basis of electromagnetic ion cyclotron (EMIC) wave activity: 24 with prevalent EMIC waves and 24 with no EMIC waves observed on the orbit. There is a close correlation between EMIC waves and perpendicular heated ion distributions. For protons the perpendicular temperature increase is modest, about 5 eV, and is always observed at 90 deg pitch angles. This is consistent with a nonresonant interaction near the equator. By contrast, He(+) temperatures during EMIC wave events averaged 35 eV and sometimes exceeded 100 eV, indicating stronger interaction with the waves. Furthermore, heated He(+) ions have X-type distributions with maximum fluxes occurring at pitch angles intermediate between field-aligned and perpendicular directions. The X-type He(+) distributions are consistent with a gyroresonant interaction off the equator. The concentration of He(+) relative to H(+) is found to correlate with EMIC wave activity, but it is suggested that the preferential heating of He(+) accounts for the apparent increase in relative He(+) concentration by increasing the proportion of He(+) detected by the ion instrument.
International Nuclear Information System (INIS)
Nakajima, Hisao; Kohara, Shigeo; Kageyama, Tadashi; Kohno, Isao
1977-01-01
The heavy ion source, of electron bombarded hot cathode type, is usually operated by applying direct current for arc discharge. In order to accelerate Ne 6+ ion in the cyclotron, a pulsed operation of this source was attempted. Ne 6+ and O 6+ ions were accelerated successfully up to 160 MeV and more than 0.1 μA of these ion were extracted from the cyclotron. C 5+ , Ne 7+ and 22 Ne 6+ ions were also extracted with a modest intensity of beam. The intensity of C 4+ , N 4+ , N 5+ , and O 5+ ions was increased about ten times. (auth.)
Hybrid Lithium-ion Capacitor / Lithium-ion Battery System for Extended Performance
National Aeronautics and Space Administration — The proposed task will involve the design of a hybrid power system with lithium-ion (li-ion) capacitors (LICs), li-ion batteries and solar cells. The challenge in...
Metal negative ion beam extraction from a radio frequency ion source
Energy Technology Data Exchange (ETDEWEB)
Kanda, S.; Yamada, N.; Kasuya, T.; Romero, C. F. P.; Wada, M.
2015-04-08
A metal ion source of magnetron magnetic field geometry has been designed and operated with a Cu hollow target. Radio frequency power at 13.56 MHz is directly supplied to the hollow target to maintain plasma discharge and induce self-bias to the target for sputtering. The extraction of positive and negative Cu ion beams have been tested. The ion beam current ratio of Cu{sup +} to Ar{sup +} has reached up to 140% when Ar was used as the discharge support gas. Cu{sup −} ion beam was observed at 50 W RF discharge power and at a higher Ar gas pressure in the ion source. Improvement of poor RF power matching and suppression of electron current is indispensable for a stable Cu{sup −} ion beam production from the source.
Ion-temperature-gradient-driven modes in bi-ion magnetoplasma
Energy Technology Data Exchange (ETDEWEB)
Batool, Nazia; Mirza, Arshad M [Theoretical Plasma Physics Group, Department of Physics, Quaid-i-Azam University, Islamabad 45320 (Pakistan); Qamar, Anisa [Department of Physics, Peshawar University, NWFP 25120 (Pakistan)], E-mail: nazia.batool@ncp.edu.pk
2008-12-15
The toroidal ion-temperature-gradient (ITG)-driven electrostatic drift waves are investigated for bi-ion plasmas with equilibrium density, temperature and magnetic field gradients. Using Braginskii's transport equations for the ions and Boltzmann distributed electrons, the mode coupling equations are derived. New ITG-driven modes are shown to exist. The results of the present study should be helpful to understand several wave phenomena in space and tokamak plasmas.
Proceedings of the 'INS workshop on ECR ion sources for multiply-charged heavy ions'
International Nuclear Information System (INIS)
1995-02-01
This workshop was held on December 1 and 2, 1994 at the Institute for Nuclear Study, University of Tokyo. The performance of ion sources is crucial for all researches and applications that use ion beam. The performance of ECR ion sources is strongly dependent on heuristic knowledge and innovation. From these viewpoints, it is useful to exchange information on the status of the existing sources, the performance of the new sources, and the design of the future sources between the source builders and the users. There were unexpected more than 70 participants and 20 contributions. The lectures were given on the present status of NIRS-ECR, SF-ECR, INS ISOL-ECR, RCNP ECR and EBIS ion sources, the production of multiply charged metallic ions with Hyper ECR or by plasma cathode method, the processing of ceramic rods and the ion production with OCTOPUS, the modeling of multi-charged ion production, the design of an advanced minimum B for ECR multi-charged ion source, the design, construction and operation of 18 GHz HiECR ion source, the construction and test operation of JAERI 18 GHz ion source, the design of an ECR ion source for the HIMAC, a 14.5 GHz ECR ion source at RIKEN, TMU 14 GHz ECR ion source, ''NANOGAN'' ECR ion source and its irradiation system, the optimization of the ECR ion source for optically pumped polarized ion source and so on. (K.I.)
Proceedings of the `INS workshop on ECR ion sources for multiply-charged heavy ions`
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-02-01
This workshop was held on December 1 and 2, 1994 at the Institute for Nuclear Study, University of Tokyo. The performance of ion sources is crucial for all researches and applications that use ion beam. The performance of ECR ion sources is strongly dependent on heuristic knowledge and innovation. From these viewpoints, it is useful to exchange information on the status of the existing sources, the performance of the new sources, and the design of the future sources between the source builders and the users. There were unexpected more than 70 participants and 20 contributions. The lectures were given on the present status of NIRS-ECR, SF-ECR, INS ISOL-ECR, RCNP ECR and EBIS ion sources, the production of multiply charged metallic ions with Hyper ECR or by plasma cathode method, the processing of ceramic rods and the ion production with OCTOPUS, the modeling of multi-charged ion production, the design of an advanced minimum B for ECR multi-charged ion source, the design, construction and operation of 18 GHz HiECR ion source, the construction and test operation of JAERI 18 GHz ion source, the design of an ECR ion source for the HIMAC, a 14.5 GHz ECR ion source at RIKEN, TMU 14 GHz ECR ion source, ``NANOGAN`` ECR ion source and its irradiation system, the optimization of the ECR ion source for optically pumped polarized ion source and so on. (K.I.).
Shemsanga, C.; Muzuka, A. N. N.; Martz, L.; Komakech, H.; Mcharo, E.
2018-05-01
Dodoma city, central Tanzania, seats in a semi-arid region of East Africa with limited rains and surface water resources. Consequently, the area largely depends on shallow and deep aquifers for its freshwater needs. Owing to harsh climatic conditions, chronic lack of year-round surface water bodies and, limited development of water distribution infrastructures, over year's local people have nurtured, developed and, passed on important indigenous knowledge (IK) on exploiting and managing shallow aquifers (SAs). However, there is no clear documented administrative plans for the SAs and the roles of IK, which is widely practised in developing SDWs and managing SAs, are not properly documented. This study intended to assess the extent of shallow dug wells (SDWs) utilization and contribution of IK on management of SAs of indigenous people of Dodoma Municipality. The methods followed include critical field observations, measurements and, focus group discussions done during both the dry season (Sep.-Oct. 2013) and wet season (Dec. 2013-Feb. 2014). The results show that SDWs occur widely in the city, particularly in the suburbs, where they often serve as the only sources of freshwater and heavily dependent by the populace. It is clear that there is rich IK on management of SAs including on groundwater exploration, digging, water allocation, pricing, and even on water quality and, water treatment skills. The aforementioned IK clearly contribute to water sufficiency to the populace and general management of groundwater such as enhancing recharge mechanisms where about 1% of local rainfall is recharged through a network of SDWs compared to 5-10% that is naturally being recharged by rainfall through the vadose zone. Thus, as much as the current policy framework and groundwater managers do not recognize the roles of IK and contributions of SDWs as key water sources, it is clear that IK contributes to the groundwater management and SDWs already support large part of the society
Specific ion effects on membrane potential and the permselectivity of ion exchange membranes.
Geise, Geoffrey M; Cassady, Harrison J; Paul, Donald R; Logan, Bruce E; Hickner, Michael A
2014-10-21
Membrane potential and permselectivity are critical parameters for a variety of electrochemically-driven separation and energy technologies. An electric potential is developed when a membrane separates electrolyte solutions of different concentrations, and a permselective membrane allows specific species to be transported while restricting the passage of other species. Ion exchange membranes are commonly used in applications that require advanced ionic electrolytes and span technologies such as alkaline batteries to ammonium bicarbonate reverse electrodialysis, but membranes are often only characterized in sodium chloride solutions. Our goal in this work was to better understand membrane behaviour in aqueous ammonium bicarbonate, which is of interest for closed-loop energy generation processes. Here we characterized the permselectivity of four commercial ion exchange membranes in aqueous solutions of sodium chloride, ammonium chloride, sodium bicarbonate, and ammonium bicarbonate. This stepwise approach, using four different ions in aqueous solution, was used to better understand how these specific ions affect ion transport in ion exchange membranes. Characterization of cation and anion exchange membrane permselectivity, using these ions, is discussed from the perspective of the difference in the physical chemistry of the hydrated ions, along with an accompanying re-derivation and examination of the basic equations that describe membrane potential. In general, permselectivity was highest in sodium chloride and lowest in ammonium bicarbonate solutions, and the nature of both the counter- and co-ions appeared to influence measured permselectivity. The counter-ion type influences the binding affinity between counter-ions and polymer fixed charge groups, and higher binding affinity between fixed charge sites and counter-ions within the membrane decreases the effective membrane charge density. As a result permselectivity decreases. The charge density and polarizability
Space-charge compensation of highly charged ion beam from laser ion source
International Nuclear Information System (INIS)
Kondrashev, S.A.; Collier, J.; Sherwood, T.R.
1996-01-01
The problem of matching an ion beam delivered by a high-intensity ion source with an accelerator is considered. The experimental results of highly charged ion beam transport with space-charge compensation by electrons are presented. A tungsten thermionic cathode is used as a source of electrons for beam compensation. An increase of ion beam current density by a factor of 25 is obtained as a result of space-charge compensation at a distance of 3 m from the extraction system. The process of ion beam space-charge compensation, requirements for a source of electrons, and the influence of recombination losses in a space-charge-compensated ion beam are discussed. (author)
So, Edmund Cheung; Wu, Sheng-Nan; Wu, Ping-Ching; Chen, Hui-Zhen; Yang, Chia-Jung
2017-01-01
Artemisinin (ART) is an anti-malarial agent reported to influence endocrine function. Effects of ART on ionic currents and action potentials (APs) in pituitary tumor (GH3) cells were evaluated by patch clamp techniques. ART inhibited the amplitude of delayed-rectifier K+ current (IK(DR)) in response to membrane depolarization and accelerated the process of current inactivation. It exerted an inhibitory effect on IK(DR) with an IC50 value of 11.2 µM and enhanced IK(DR) inactivation with a KD value of 14.7 µM. The steady-state inactivation curve of IK(DR) was shifted to hyperpolarization by 10 mV. Pretreatment of chlorotoxin (1 µM) or iloprost (100 nM) did not alter the magnitude of ART-induced inhibition of IK(DR) in GH3 cells. ART also decreased the peak amplitude of voltage-gated Na+ current (INa) with a concentration-dependent slowing in inactivation rate. Application of KMUP-1, an inhibitor of late INa, was effective at reversing ART-induced prolongation in inactivation time constant of INa. Under current-clamp recordings, ART alone reduced the amplitude of APs and prolonged the duration of APs. Under ART exposure, the inhibitory actions on both IK(DR) and INa could be a potential mechanisms through which this drug influences membrane excitability of endocrine or neuroendocrine cells appearing in vivo. © 2017 The Author(s). Published by S. Karger AG, Basel.
Euroopa päeval õhtumaa allakäigust / Jaak Valge
Valge, Jaak, 1955-
2012-01-01
Arvustus: Spengler, Oswald. Õhtumaa allakäik : maailma-ajaloo morfoloogia piirjooned. I köide, Kuju ja tegelikkus ; Õhtumaa allakäik : maailma-ajaloo morfoloogia piirjooned. II köide, Maailma-ajaloolised pespektiivid. Tartu : Ilmamaa, 2012
Ion sources for initial use at the Holifield radioactive ion beam facility
International Nuclear Information System (INIS)
Alton, G.D.
1994-01-01
The Holifield Radioactive Ion Beam Facility (HRIBF) now under construction at the Oak Ridge National Laboratory will use the 25-MV tandem accelerator for the acceleration of radioactive ion beams to energies appropriate for research in nuclear physics; negative ion beams are, therefore, required for injection into the tandem accelerator. Because charge exchange is an efficient means for converting initially positive ion beams to negative ion beams, both positive and negative ion sources are viable options for use at the facility; the choice of the type of ion source will depend on the overall efficiency for generating the radioactive species of interest. A high-temperature version of the CERN-ISOLDE positive ion source has been selected and a modified version of the source designed and fabricated for initial use at the HRIBF because of its low emittance, relatively high ionization efficiencies and species versatility, and because it has been engineered for remote installation, removal and servicing as required for safe handling in a high-radiation-level ISOL facility. Prototype plasma-sputter negative ion sources and negative surfaceionization sources are also under design consideration for generating negative radioactive ion beams from high electron-affinity elements. A brief review of the HRIBF will be presented, followed by a detailed description of the design features, operational characteristics, ionization efficiencies, and beam qualities (emittances) of these sources
Evaluation of Negative-Ion-Beam Driver Concepts for Heavy Ion Fusion
International Nuclear Information System (INIS)
Grisham, Larry R.
2002-01-01
We evaluate the feasibility of producing and using atomically neutral heavy ion beams produced from negative ions as drivers for an inertial confinement fusion reactor. Bromine and iodine appear to be the most attractive elements for the driver beams. Fluorine and chlorine appear to be the most appropriate feedstocks for initial tests of extractable negative ion current densities. With regards to ion sources, photodetachment neutralizers, and vacuum requirements for accelerators and beam transport, this approach appears feasible within existing technology, and the vacuum requirements are essentially identical to those for positive ion drivers except in the target chamber. The principal constraint is that this approach requires harder vacuums in the target chamber than do space-charge-neutralized positive ion drivers. With realistic (but perhaps pessimistic) estimates of the total ionization cross section, limiting the ionization of a neutral beam to less than 5% while traversing a four -meter path would require a chamber pressure of no more than 5 x 10 -5 torr. Alternatively, even at chamber pressures that are too high to allow propagation of atomically neutral beams, the negative ion approach may still have appeal, since it precludes the possibly serious problem of electron contamination of a positive ion beam during acceleration, drift compression, and focusing
The ion polytropic coefficient in a collisionless sheath containing hot ions
Energy Technology Data Exchange (ETDEWEB)
Lin, Binbin; Xiang, Nong, E-mail: xiangn@ipp.ac.cn; Ou, Jing [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Center for Magnetic Fusion Theory, Chinese Academy of Sciences, Hefei 230031 (China)
2016-08-15
The fluid approach has been widely used to study plasma sheath dynamics. For a sheath containing hot ions whose temperature is greater than the electron's, how to truncate the fluid hierarchy chain equations while retaining to the fullest extent of the kinetic effects is always a difficult problem. In this paper, a one-dimensional, collisionless sheath containing hot ions is studied via particle-in-cell simulations. By analyzing the ion energy equation and taking the kinetic effects into account, we have shown that the ion polytropic coefficient in the vicinity of the sheath edge is approximately constant so that the state equation with the modified polytropic coefficient can be used to close the hierarchy chain of the ion fluid equations. The value of the polytropic coefficient strongly depends on the hot ion temperature and its concentration in the plasma. The semi-analytical model is given to interpret the simulation results. As an application, the kinetic effects on the ion saturation current density in the probe theory are discussed.
Eiceman, GA
2005-01-01
Key Developments for Faster, More Precise Detection Capabilities Driven by the demand for the rapid and advanced detection of explosives, chemical and biological warfare agents, and narcotics, ion mobility spectrometry (IMS) undergone significant refinements in technology, computational capabilities, and understanding of the principles of gas phase ion chemistry and mobility. Beginning with a thorough discussion of the fundamental theories and physics of ion mobility, Ion Mobility Spectrometry, Second Edition describes the recent advances in instrumentation and newly
Duopigatron ion source studies
International Nuclear Information System (INIS)
Bacon, F.M.; Bickes, R.W. Jr.; O'Hagan, J.B.
1978-07-01
Ion source performance characteristics consisting of total ion current, ion energy distribution, mass distribution, and ion current density distribution were measured for several models of a duopigatron. Variations on the duopigatron design involved plasma expansion cup material and dimensions, secondary cathode material, and interelectrode spacings. Of the designs tested, the one with a copper and molybdenum secondary cathode and a mild steel plasma expansion cup proved to give the best results. The ion current density distribution was peaked at the center of the plasma expansion cup and fell off to 80 percent of the peak value at the cup wall for a cup 15.2 mm deep. A total ion current of 180 mA consisting of 60 to 70 percent atomic ions was produced with an arc current of 20 A and source pressure of 9.3 Pa. More shallow cups produced a larger beam current and a more sharply peaked ion current density distribution. Typical ion energy distributions were bell-shaped curves with a peak 10 to 20 V below anode potential and with ion energies extending 30 to 40 V on either side of the peak
C-terminal peptide extension via gas-phase ion/ion reactions
Peng, Zhou; McLuckey, Scott A.
2015-01-01
The formation of peptide bonds is of great importance from both a biological standpoint and in routine organic synthesis. Recent work from our group demonstrated the synthesis of peptides in the gas-phase via ion/ion reactions with sulfo-NHS reagents, which resulted in conjugation of individual amino acids or small peptides to the N-terminus of an existing ‘anchor’ peptide. Here, we demonstrate a complementary approach resulting in the C-terminal extension of peptides. Individual amino acids or short peptides can be prepared as reagents by incorporating gas phase-labile protecting groups to the reactive C-terminus and then converting the N-terminal amino groups to the active ketenimine reagent. Gas-phase ion/ion reactions between the anionic reagents and doubly protonated “anchor” peptide cations results in extension of the “anchor” peptide with new amide bond formation at the C-terminus. We have demonstrated that ion/ion reactions can be used as a fast, controlled, and efficient means for C-terminal peptide extension in the gas phase. PMID:26640400
Cobalt alloy ion sources for focused ion beam implantation
Energy Technology Data Exchange (ETDEWEB)
Muehle, R.; Doebeli, M. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Zimmermann, P. [Eidgenoessische Technische Hochschule, Zurich (Switzerland)
1997-09-01
Cobalt alloy ion sources have been developed for silicide formation by focused ion beam implantation. Four eutectic alloys AuCo, CoGe, CoY and AuCoGe were produced by electron beam welding. The AuCo liquid alloy ion source was investigated in detail. We have measured the emission current stability, the current-voltage characteristics, and the mass spectrum as a function of the mission current. (author) 1 fig., 2 refs.
Studies on indigenous ion exchange resins: alkali metal ions-hydrogen ion exchange equilibria
International Nuclear Information System (INIS)
Shankar, S.; Kumar, Surender; Venkataramani, B.
2001-01-01
With a view to select a suitable ion exchange resin for the removal of radionuclides (such as cesium, strontium etc.) from low level radioactive effluents, alkali metal ion -H' exchanges on nine indigenous gel- and macroporous-type and nuclear grade resins have been studied at a total ionic strength of 0.1 mol dm .3 (in the case ofCs' -H' exchange it was 0.05 mol dm .3 ). The expected theoretical capacities were not attained by all the resins for the alkali metal ions. The water content (moles/equiv.) of the fully swollen resins for different alkali metal ionic forms do not follow the usual sequence of greater the tendency of the cation to hydrate the higher the water uptake, but a reverse trend. The ion exchange isotherms (plots of equivalent fractions of the ion in resin phase, N M1 to that in solution, N M ) were not satisfactory and sorption of cations, for most of the resins, was possible only when the acidity of the solution was lowered. The variations of the selectivity coefficient, K, with N M show that the resins are highly cross linked and the selectivity sequence: Cs + >K + >Na + >Li + , obtained for all the resins indicate that hydrated ions were involved in the exchange process. However, the increase in the selectivity was not accompanied by the release of water, but unusual uptake of water, during the exchange process. The characteristics of macroporous resins were not significantly different from those of the gel-type resins. The results are discussed in terms of heterogeneity in the polymer net work, improper sulphonation process resulting in the formation of functional groups at inaccessible sites with weak acidic character and the overall lack of control in the preparation of different resins. (author)
Maximizing Ion Current by Space Charge Neutralization using Negative Ions and Dust Particles
International Nuclear Information System (INIS)
Smirnov, A.; Raitses, Y.; Fisch, N.J.
2005-01-01
Ion current extracted from an ion source (ion thruster) can be increased above the Child-Langmuir limit if the ion space charge is neutralized. Similarly, the limiting kinetic energy density of the plasma flow in a Hall thruster might be exceeded if additional mechanisms of space charge neutralization are introduced. Space charge neutralization with high-mass negative ions or negatively charged dust particles seems, in principle, promising for the development of a high current or high energy density source of positive light ions. Several space charge neutralization schemes that employ heavy negatively charged particles are considered. It is shown that the proposed neutralization schemes can lead, at best, only to a moderate but nonetheless possibly important increase of the ion current in the ion thruster and the thrust density in the Hall thruster
Ion-selective electrode reviews
Thomas, J D R
1982-01-01
Ion-Selective Electrode Reviews, Volume 3, provides a review of articles on ion-selective electrodes (ISEs). The volume begins with an article on methods based on titration procedures for surfactant analysis, which have been developed for discrete batch operation and for continuous AutoAnalyser use. Separate chapters deal with detection limits of ion-selective electrodes; the possibility of using inorganic ion-exchange materials as ion-sensors; and the effect of solvent on potentials of cells with ion-selective electrodes. Also included is a chapter on advances in calibration procedures, the d
An all permanent magnet electron cyclotron resonance ion source for heavy ion therapy.
Cao, Yun; Li, Jia Qing; Sun, Liang Ting; Zhang, Xue Zhen; Feng, Yu Cheng; Wang, Hui; Ma, Bao Hua; Li, Xi Xia
2014-02-01
A high charge state all permanent Electron Cyclotron Resonance ion source, Lanzhou All Permanent ECR ion source no. 3-LAPECR3, has been successfully built at IMP in 2012, which will serve as the ion injector of the Heavy Ion Medical Machine (HIMM) project. As a commercial device, LAPECR3 features a compact structure, small size, and low cost. According to HIMM scenario more than 100 eμA of C(5+) ion beam should be extracted from the ion source, and the beam emittance better than 75 π*mm*mrad. In recent commissioning, about 120 eμA of C(5+) ion beam was got when work gas was CH4 while about 262 eμA of C(5+) ion beam was obtained when work gas was C2H2 gas. The design and construction of the ion source and its low-energy transportation beam line, and the preliminary commissioning results will be presented in detail in this paper.
Membrane properties of chick semicircular canal hair cells in situ during embryonic development.
Masetto, S; Perin, P; Malusà, A; Zucca, G; Valli, P
2000-05-01
The electrophysiological properties of developing vestibular hair cells have been investigated in a chick crista slice preparation, from embryonic day 10 (E10) to E21 (when hatching would occur). Patch-clamp whole-cell experiments showed that different types of ion channels are sequentially expressed during development. An inward Ca(2+) current and a slow outward rectifying K(+) current (I(K(V))) are acquired first, at or before E10, followed by a rapid transient K(+) current (I(K(A))) at E12, and by a small Ca-dependent K(+) current (I(KCa)) at E14. Hair cell maturation then proceeds with the expression of hyperpolarization-activated currents: a slow I(h) appears first, around E16, followed by the fast inward rectifier I(K1) around E19. From the time of its first appearance, I(K(A)) is preferentially expressed in peripheral (zone 1) hair cells, whereas inward rectifying currents are preferentially expressed in intermediate (zone 2) and central (zone 3) hair cells. Each conductance conferred distinctive properties on hair cell voltage response. Starting from E15, some hair cells, preferentially located at the intermediate region, showed the amphora shape typical of type I hair cells. From E17 (a time when the afferent calyx is completed) these cells expressed I(K, L), the signature current of mature type I hair cells. Close to hatching, hair cell complements and regional organization of ion currents appeared similar to those reported for the mature avian crista. By the progressive acquisition of different types of inward and outward rectifying currents, hair cell repolarization after both positive- and negative-current injections is greatly strengthened and speeded up.
Spontaneous compactification and Ricci-flat manifolds with torsion
International Nuclear Information System (INIS)
McInnes, B.
1985-06-01
The Freund-Rubin mechanism is based on the equation Rsub(ik)=lambdagsub(ik) (where lambda>0), which, via Myers' Theorem, implies ''spontaneous'' compactification. The difficulties connected with the cosmological constant in this approach can be resolved if torsion is introduced and lambda set equal to zero, but then compactification ''by hand'' is necessary, since the equation Rsub(ik)=0 can be satisfied both on compact and on non-compact manifolds. In this paper we discuss the global geometry of Ricci-flat manifolds with torsion, and suggest ways of restoring the ''spontaneity'' of the compactification. (author)
Nonlinear dust-ion-acoustic waves in a multi-ion plasma with ...
Indian Academy of Sciences (India)
The basic features of such dust-ion-acoustic solitary and shock waves have been ... ion plasmas because of its vital role in understanding different types of ... cannot support the usual ion-acoustic waves, but can support the DIA waves of ...
Low energy ion beam dynamics of NANOGAN ECR ion source
Energy Technology Data Exchange (ETDEWEB)
Kumar, Sarvesh, E-mail: sarvesh@iuac.res.in; Mandal, A.
2016-04-01
A new low energy ion beam facility (LEIBF) has been developed for providing the mass analyzed highly charged intense ion beams of energy ranging from a few tens of keV to a few MeV for atomic, molecular and materials sciences research. The new facility consists of an all permanent magnet 10 GHz electron cyclotron resonance (ECR) ion source (NANOGAN) installed on a high voltage platform (400 kV) which provides large currents of multiply charged ion beams. Higher emittance at low energy of intense ion beam puts a tremendous challenge to the beam optical design of this facility. The beam line consists of mainly the electrostatic quadrupoles, an accelerating section, analyzing cum switching magnet and suitable beam diagnostics including vacuum components. The accelerated ion beam is analyzed for a particular mass to charge (m/q) ratio as well as guided to three different lines along 75°, 90° and 105° using a large acceptance analyzing cum switching magnet. The details of transverse beam optics to all the beam lines with TRANSPORT and GICOSY beam optics codes are being described. Field computation code, OPERA 3D has been utilized to design the magnets and electrostatic quadrupoles. A theoretical estimation of emittance for optimized geometry of ion source is given so as to form the basis of beam optics calculations. The method of quadrupole scan of the beam is used to characterize the emittance of the final beam on the target. The measured beam emittance increases with m/q ratios of various ion beams similar to the trend observed theoretically.
Agro-processing opportunities identified through a novel mosquito repellent from a medicinal plant
CSIR Research Space (South Africa)
Maharaj, VJ
2008-11-01
Full Text Available Traditional healers provide CSIR scientists with indigenous knowledge (IK) that stimulates research and can eventually lead to discovery and development of new herbal remedies. The rights of these providers of IK, to share in future benefits...
Radioactive ion beam production challenges at the Holifield Heavy Ion Research Facility
International Nuclear Information System (INIS)
Meigs, M.J.; Alton, G.D.; Dowling, D.T.; Haynes, D.L.; Jones, C.M.; Juras, R.C.; Lane, S.N.; Mills, G.D.; Mosko, S.W.; Olsen, D.K.; Tatum, B.A.
1992-01-01
The radioactive ion beam (RIB) project at the Holifield Heavy Ion Research Facility (HHIRF) will provide for reconfiguration of the HHIRF accelerator system to enable provision of low-intensity RIBs for nuclear and astrophysics research. As we have progressed with the design of the reconfiguration, we have encountered several challenges that were not immediately obvious when first contemplating the project. The challenges do not seem insurmountable but should keep life interesting for those of us doing the work. A brief review of the project will allow a better understanding of the challenges in RIB production. Radioactive ion beams will be produced with the Isotope Separator On-Line (ISOL) postacceleration technique. In particular, radioactive atoms will be produced by reactions in the thick stopping target of an ISOL-type target-ion source assembly using intense beams from the Oak Ridge Isochronous Cyclotron equipped with a light-ion internal source. This ISOL target-ion source assembly will be mounted on a high-voltage platform with a mass separator. The target ion source will operate at potentials up to 50 kV with respect to the high voltage platform. The radioactive atoms produced by nuclear reactions in the target diffuse to the surface of the heated target material, desorb from this surface, and effuse through a heated transfer tube into an ion source where ionization and extraction take place. Two types of ion sources will be initially considered. A Forced Electron Beam Induced Arc Discharge source, similar to those used by the ISOLDE facility at CERN and by the UNISOR facility at ORNL, will be built to produce positive ions. These positive ions will be focused through an alkali vapor charge-exchange canal to produce negative ions for tandem injection. In addition, a direct negative surface ionization addition or modification to the above source will be built and investigated
Improvement of highly charged ion production in the ECR source of heavy ions
International Nuclear Information System (INIS)
Shirkov, G.D.
1996-01-01
Some physical limitations of the highly charged ion production in the ECR source are analyzed in this report. A few possible ways to improve the output of highly charged ions from the ECR source for heavy ions are proposed. A new library of computer codes for the numerical simulation of heavy ion production in the ECR ion source is used to examine these ways to improve the ECR source operation according to the CERN program of heavy ion acceleration. copyright 1996 American Institute of Physics
Plasma focus as an heavy ion source in the problem of heavy ion fusion
International Nuclear Information System (INIS)
Gribkov, V.A.; Dubrovskij, A.V.; Kalachev, N.V.; Krokhin, O.N.; Silin, P.V.; Nikulin, V.Ya.; Cheblukov, Yu.N.
1984-01-01
Results of experiments on the ion flux formation in a plasma focus (PF) to develop a multicharged ion source for thermonuclear facility driver are presented. In plasma focus accelerating section copper ions were injected. Advantages of the suggested method of ion beam formation are demonstrated. Beam emittance equalling < 0.1 cmxmrad is obtained. Plasma focus ion energy exceeds 1 MeV. Plasma focus in combination with a neodymium laser is thought to be a perspective ion source for heavy ion fusion
Scheers, Johan; Niedzicki, Leszek; Zukowska, Grażyna Z; Johansson, Patrik; Wieczorek, Władysław; Jacobsson, Per
2011-06-21
Molecular level interactions are of crucial importance for the transport properties and overall performance of ion conducting electrolytes. In this work we explore ion-ion and ion-solvent interactions in liquid and solid polymer electrolytes of lithium 4,5-dicyano-(2-trifluoromethyl)imidazolide (LiTDI)-a promising salt for lithium battery applications-using Raman spectroscopy and density functional theory calculations. High concentrations of ion associates are found in LiTDI:acetonitrile electrolytes, the vibrational signatures of which are transferable to PEO-based LiTDI electrolytes. The origins of the spectroscopic changes are interpreted by comparing experimental spectra with simulated Raman spectra of model structures. Simple ion pair models in vacuum identify the imidazole nitrogen atom of the TDI anion to be the most important coordination site for Li(+), however, including implicit or explicit solvent effects lead to qualitative changes in the coordination geometry and improved correlation of experimental and simulated Raman spectra. To model larger aggregates, solvent effects are found to be crucial, and we finally suggest possible triplet and dimer ionic structures in the investigated electrolytes. In addition, the effects of introducing water into the electrolytes-via a hydrate form of LiTDI-are discussed.
Experiments on secondary ion emission with multicharged keV ion bombardement
International Nuclear Information System (INIS)
Della Negra, S.; Depauw, J.; Joret, H.; Le Beyec, Y.; Schweikert, E.A.
1987-01-01
An electron cyclotron resonance ion source was used to study the influence of the incident charge state of keV ions on secondary ion emission. The experiments were run with 18 keV Arn+ (1 < n < 11) beams produced by a minimafios source. Various types of targets were bombarded by the ion beam and the sputtered ionized species were identified by time of flight mass spectrometry. The experimental arrangement is detailed and preliminary results are indicated
A heating mechanism of ions due to large amplitude coherent ion acoustic wave
International Nuclear Information System (INIS)
Yajima, Nobuo; Kawai, Yoshinobu; Kogiso, Ken.
1978-05-01
Ion heating mechanism in a plasma with a coherent ion acoustic wave is studied experimentally and numerically. Ions are accelerated periodically in the electrostatic potential of the coherent wave and their oscillation energy is converted into the thermal energy of ions through the collision with the neutral atoms in plasma. The Monte Carlo calculation is applied to obtain the ion temperature. The amplitude of the electrostatic potential, the mean number of collisions and the mean life time of ions are treated as parameters in the calculation. The numerical results are compared with the experiments and both of them agree well. It is found that the ion temperature increases as the amplitude of the coherent wave increases and the high energy tail in the distribution function of ions are observed for the case of large wave-amplitude. (author)
Molecular and negative ion production by a standard electron cyclotron resonance ion source
Energy Technology Data Exchange (ETDEWEB)
Racz, R. [Institute of Nuclear Research (ATOMKI), Bem ter 18/c, H-4026 Debrecen (Hungary); University of Debrecen, Egyetem ter 1, H-4010 Debrecen (Hungary); Biri, S.; Juhasz, Z.; Sulik, B. [Institute of Nuclear Research (ATOMKI), Bem ter 18/c, H-4026 Debrecen (Hungary); Palinkas, J. [University of Debrecen, Egyetem ter 1, H-4010 Debrecen (Hungary)
2012-02-15
Molecular and negative ion beams, usually produced in special ion sources, play an increasingly important role in fundamental and applied atomic physics. The ATOMKI-ECRIS is a standard ECR ion source, designed to provide highly charged ion (HCI) plasmas and beams. In the present work, H{sup -}, O{sup -}, OH{sup -}, O{sub 2}{sup -}, C{sup -}, C{sub 60}{sup -} negative ions and H{sub 2}{sup +}, H{sub 3}{sup +}, OH{sup +}, H{sub 2}O{sup +}, H{sub 3}O{sup +}, O{sub 2}{sup +} positive molecular ions were generated in this HCI-ECRIS. Without any major modification in the source and without any commonly applied tricks (such as usage of cesium or magnetic filter), negative ion beams of several {mu}A and positive molecular ion beams in the mA range were successfully obtained.
Shoji, Masafumi; Miyoshi, Yoshizumi; Katoh, Yuto; Keika, Kunihiro; Angelopoulos, Vassilis; Kasahara, Satoshi; Asamura, Kazushi; Nakamura, Satoko; Omura, Yoshiharu
2017-09-01
Electromagnetic plasma waves are thought to be responsible for energy exchange between charged particles in space plasmas. Such an energy exchange process is evidenced by phase space holes identified in the ion distribution function and measurements of the dot product of the plasma wave electric field and the ion velocity. We develop a method to identify ion hole formation, taking into consideration the phase differences between the gyromotion of ions and the electromagnetic ion cyclotron (EMIC) waves. Using this method, we identify ion holes in the distribution function and the resulting nonlinear EMIC wave evolution from Time History of Events and Macroscale Interactions during Substorms (THEMIS) observations. These ion holes are key to wave growth and frequency drift by the ion currents through nonlinear wave-particle interactions, which are identified by a computer simulation in this study.
Ion Dynamics at Shocks: Ion Reflection and Beam Formation at Quasi-perpendicular Shocks
International Nuclear Information System (INIS)
Kucharek, Harald; Moebius, Eberhard
2005-01-01
The physics of collisionless shocks is controlled by the ion dynamics. The generation of gyrating ions by reflection as well as the formation of field-aligned ion beams are essential parts of this dynamic. On the one hand reflection is most likely the first interaction of ions with the shock before they undergo the downstream thermalization process. On the other hand field-aligned ion beams, predominately found at the quasi-perpendicular bow shock, propagate into the distant foreshock region and may create wave activity. We revisit ion reflection, the source and basic production mechanism of field-aligned ion beams, by using multi-spacecraft measurements and contrast these observations with existing theories. Finally, we propose an alternative production mechanism
Generation and focusing of intense ion beams with an inverse pinch ion diode
International Nuclear Information System (INIS)
Hashimoto, Yoshiyuki; Sato, Morihiko; Yatsuzuka, Mitsuyasu; Nobuhara, Sadao
1992-01-01
Generation and focusing of ion beams using an inverse pinch ion diode with a flat anode has been studied. The ion beams generated with the inverse pinch ion diode were found to be focused at 120 mm from the anode by the electrostatic field in the diode. The energy and maximum current density of the ion beams were 180 keV and 420 A/cm 2 , respectively. The focusing angle of the ion beams was 4.3deg. The beam brightness was estimated to be 1.3 GW/cm 2 ·rad 2 . The focusing distance of the ion beams was found to be controllable by changing the diameters of the anode and cathode. (author)
Behaviour of tetraalkylammonium ions in high-field asymmetric waveform ion mobility spectrometry.
Aksenov, Alexander A; Kapron, James T
2010-05-30
High-field asymmetric waveform ion mobility spectrometry (FAIMS) is an ion-filtering technique recently adapted for use with liquid chromatography/mass spectrometry (LC/MS) to remove interferences during analysis of complex matrices. This is the first systematic study of a series of singly charged tetraalkylammonium ions by FAIMS-MS. The compensation voltage (CV) is the DC offset of the waveform which permits the ion to emerge from FAIMS and it was determined for each member of the series under various conditions. The electrospray ionization conditions explored included spray voltage, vaporizer temperature, and sheath and auxiliary gas pressure. The FAIMS conditions explored included carrier gas flow rate, electrode temperature and composition of the carrier gas. Optimum desolvation was achieved using sufficient carrier gas (flow rate > or = 2 L/min) to ensure stable response. Low-mass ions (m/z 100-200) are more susceptible to changes in electrode temperature and gas composition than high mass ions (m/z 200-700). As a result of this study, ions are reliably analyzed using standard FAIMS conditions (dispersion voltage -5000 V, carrier gas flow rate 3 L/min, 50% helium/50%nitrogen, inner electrode temperature 70 degrees C and outer electrode temperature 90 degrees C). Variation of FAIMS conditions may be of great use for the separation of very low mass tetraalkylammonium (TAA) ions from other TAA ions. The FAIMS conditions do not appear to have a major effect on higher mass ions. Copyright 2010 John Wiley & Sons, Ltd.
Specific ion effects on membrane potential and the permselectivity of ion exchange membranes
Geise, Geoffrey M.
2014-08-26
© the Partner Organisations 2014. Membrane potential and permselectivity are critical parameters for a variety of electrochemically-driven separation and energy technologies. An electric potential is developed when a membrane separates electrolyte solutions of different concentrations, and a permselective membrane allows specific species to be transported while restricting the passage of other species. Ion exchange membranes are commonly used in applications that require advanced ionic electrolytes and span technologies such as alkaline batteries to ammonium bicarbonate reverse electrodialysis, but membranes are often only characterized in sodium chloride solutions. Our goal in this work was to better understand membrane behaviour in aqueous ammonium bicarbonate, which is of interest for closed-loop energy generation processes. Here we characterized the permselectivity of four commercial ion exchange membranes in aqueous solutions of sodium chloride, ammonium chloride, sodium bicarbonate, and ammonium bicarbonate. This stepwise approach, using four different ions in aqueous solution, was used to better understand how these specific ions affect ion transport in ion exchange membranes. Characterization of cation and anion exchange membrane permselectivity, using these ions, is discussed from the perspective of the difference in the physical chemistry of the hydrated ions, along with an accompanying re-derivation and examination of the basic equations that describe membrane potential. In general, permselectivity was highest in sodium chloride and lowest in ammonium bicarbonate solutions, and the nature of both the counter- and co-ions appeared to influence measured permselectivity. The counter-ion type influences the binding affinity between counter-ions and polymer fixed charge groups, and higher binding affinity between fixed charge sites and counter-ions within the membrane decreases the effective membrane charge density. As a result permselectivity decreases. The
Observations of strong ion-ion correlations in dense plasmas
Energy Technology Data Exchange (ETDEWEB)
Ma, T.; Fletcher, L.; Pak, A.; Chapman, D. A.; Falcone, R. W.; Fortmann, C.; Galtier, E.; Gericke, D. O.; Gregori, G.; Hastings, J.; Landen, O. L.; Le Pape, S.; Lee, H. J.; Nagler, B.; Neumayer, P.; Turnbull, D.; Vorberger, J.; White, T. G.; Wünsch, K.; Zastrau, U.; Glenzer, S. H.; Döppner, T.
2014-05-01
Using simultaneous spectrally, angularly, and temporally resolved x-ray scattering, we measure the pronounced ion-ion correlation peak in a strongly coupled plasma. Laser-driven shock-compressed aluminum at ~3× solid density is probed with high-energy photons at 17.9 keV created by molybdenum He-α emission in a laser-driven plasma source. The measured elastic scattering feature shows a well-pronounced correlation peak at a wave vector of k=4k=4Å-1. The magnitude of this correlation peak cannot be described by standard plasma theories employing a linear screened Coulomb potential. Advanced models, including a strong short-range repulsion due to the inner structure of the aluminum ions are however in good agreement with the scattering data. These studies have demonstrated a new highly accurate diagnostic technique to directly measure the state of compression and the ion-ion correlations. We have since applied this new method in single-shot wave-number resolved S(k) measurements to characterize the physical properties of dense plasmas.
New experimental initiatives using very highly charged ions from an 'electron beam ion trap'
International Nuclear Information System (INIS)
Schneider, D.
1996-01-01
A short review of the experimental program in highly-charged heavy ion physics conducted at the Lawrence Livermore National Laboratory Electron Beam Ion Trap (EBIT) facility is presented. The heavy-ion research, involving ions up to fully stripped U 92+ , includes precision x-ray spectroscopy and lifetime studies, electron impact ionization and excitation cross section measurements. The investigations of ion-surface interactions following the impact of high-Z highly charged ions on surfaces are aimed to study the neutralization dynamics effecting the ion and the response of the surface as well. (author)
Development of exploding wire ion source for intense pulsed heavy ion beam accelerator
International Nuclear Information System (INIS)
Ochiai, Y.; Murata, T.; Ito, H.; Masugata, K.
2012-01-01
A Novel exploding wire type ion source device is proposed as a metallic ion source of intense pulsed heavy ion beam (PHIB) accelerator. In the device multiple shot operations is realized without breaking the vacuum. The basic characteristics of the device are evaluated experimentally with an aluminum wire of diameter 0.2 mm, length 25 mm. Capacitor bank of capacitance 3 μF, charging voltage 30 kV was used and the wire was successfully exploded by a discharge current of 15 kA, rise time 5.3 μs. Plasma flux of ion current density around 70 A/cm 2 was obtained at 150 mm downstream from the device. The drift velocity of ions evaluated by a time-of-flight method was 2.7x10 4 m/sec, which corresponds to the kinetic energy of 100 eV for aluminum ions. From the measurement of ion current density distribution ion flow is found to be concentrated to the direction where ion acceleration gap is placed. From the experiment the device is found to be acceptable for applying PHIB accelerator. (author)
An all permanent magnet electron cyclotron resonance ion source for heavy ion therapy
Energy Technology Data Exchange (ETDEWEB)
Cao, Yun, E-mail: caoyun@impcas.ac.cn; Li, Jia Qing; Sun, Liang Ting; Zhang, Xue Zhen; Feng, Yu Cheng; Wang, Hui; Ma, Bao Hua; Li, Xi Xia [Institute of Modern Physics, CAS, Lanzhou 730000 (China)
2014-02-15
A high charge state all permanent Electron Cyclotron Resonance ion source, Lanzhou All Permanent ECR ion source no. 3-LAPECR3, has been successfully built at IMP in 2012, which will serve as the ion injector of the Heavy Ion Medical Machine (HIMM) project. As a commercial device, LAPECR3 features a compact structure, small size, and low cost. According to HIMM scenario more than 100 eμA of C{sup 5+} ion beam should be extracted from the ion source, and the beam emittance better than 75 π*mm*mrad. In recent commissioning, about 120 eμA of C{sup 5+} ion beam was got when work gas was CH{sub 4} while about 262 eμA of C{sup 5+} ion beam was obtained when work gas was C{sub 2}H{sub 2} gas. The design and construction of the ion source and its low-energy transportation beam line, and the preliminary commissioning results will be presented in detail in this paper.
Recent advances in high current vacuum arc ion sources for heavy ion fusion
Qi Nian Sheng; Prasad, R R; Krishnan, M S; Anders, A; Kwan, J; Brown, I
2001-01-01
For a heavy ion fusion induction linac driver, a source of heavy ions with charge states 1+-3+, approx 0.5 A current beams, approx 20 mu s pulse widths and approx 10 Hz repetition rates is required. Thermionic sources have been the workhorse for the Heavy Ion Fusion (HIF) program to date, but suffer from heating problems for large areas and contamination. They are limited to low (contact) ionization potential elements and offer relatively low ion fluxes with a charge state limited to 1+. Gas injection sources suffer from partial ionization and deleterious neutral gas effects. The above shortcomings of the thermionic ion sources can be overcome by a vacuum arc ion source. The vacuum arc ion source is a good candidate for HIF applications. It is capable of providing ions of various elements and different charge states in short and long pulse bursts and high beam current density. Under a Phase-I STTR from DOE, the feasibility of the vacuum arc ion source for the HIF applications was investigated. We have modifie...
Anomalous surface behavior of hydrated guanidinium ions due to ion pairing
Ekholm, Victor; Vazdar, Mario; Mason, Philip E.; Bialik, Erik; Walz, Marie-Madeleine; Öhrwall, Gunnar; Werner, Josephina; Rubensson, Jan-Erik; Jungwirth, Pavel; Björneholm, Olle
2018-04-01
Surface affinity of aqueous guanidinium chloride (GdmCl) is compared to that of aqueous tetrapropylammonium chloride (TPACl) upon addition of sodium chloride (NaCl) or disodium sulfate (Na2SO4). The experimental results have been acquired using the surface sensitive technique X-ray photoelectron spectroscopy on a liquid jet. Molecular dynamics simulations have been used to produce radial distribution functions and surface density plots. The surface affinities of both TPA+ and Gdm+ increase upon adding NaCl to the solution. With the addition of Na2SO4, the surface affinity of TPA+ increases, while that of Gdm+ decreases. From the results of MD simulations it is seen that Gdm+ and SO4 2 - ions form pairs. This finding can be used to explain the decreased surface affinity of Gdm+ when co-dissolved with SO4 2 - ions. Since SO4 2 - ions avoid the surface due to the double charge and strong water interaction, the Gdm+-SO4 2 - ion pair resides deeper in the solutions' bulk than the Gdm+ ions. Since TPA+ does not form ion pairs with SO4 2 -, the TPA+ ions are instead enriched at the surface.
Energy landscapes for mobile ions in ion conducting solids
Indian Academy of Sciences (India)
molecular dynamics (MD) simulations yields quantitative predictions of the ion transport characteristics. As ... Solid electrolytes; bond valence analysis; ion transport in glasses. 1. .... clusters are considered to contribute only to a.c. conduc-.
DETERMINATION OF STRONTIUM IONS IN WATERS WITH A HIGH CONTENT OF SODIUM IONS
Directory of Open Access Journals (Sweden)
Tatiana Mitina
2015-06-01
Full Text Available This paper reports on the influence of sodium ions on experimental determination of strontium ions concentration in waters with a high content of sodium ions by using emission flame photometry and atomic absorption spectroscopy. For the method of emission flame photometry it was shown that at a wavelength of 460.7 nm (spectral emission line of strontium the emission is linearly dependent on the concentration of sodium ions. The greatest impact of high concentrations of sodium ions on the result of determination the strontium ions concentration has been registered at low levels of strontium. The influence of nitric acid on the results is also discussed. In the case of using atomic absorption spectroscopy method no influence of sodium ions and nitric acid on the results of determination the strontium ions concentration was revealed. The metrological characteristics of both methods are evaluated.
An ion beam deceleration lens for ultra-low-energy ion bombardment of naked DNA
Energy Technology Data Exchange (ETDEWEB)
Thopan, P.; Prakrajang, K. [Plasma and Beam Physics Research Facility, Department of Physics and Materials Science, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Thongkumkoon, P. [Plasma and Beam Physics Research Facility, Department of Physics and Materials Science, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Thailand Center of Excellence in Physics, Commission on Higher Education, 328 Si Ayutthaya Road, Bangkok 10400 (Thailand); Suwannakachorn, D. [Plasma and Beam Physics Research Facility, Department of Physics and Materials Science, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Yu, L.D., E-mail: yuldyuld@gmail.com [Plasma and Beam Physics Research Facility, Department of Physics and Materials Science, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Thailand Center of Excellence in Physics, Commission on Higher Education, 328 Si Ayutthaya Road, Bangkok 10400 (Thailand)
2013-07-15
Highlights: ► An ion beam deceleration lens was designed and constructed. ► The deceleration lens was installed and tested. ► The decelerated ion beam energy was measured using an electrical field. ► Decelerated ultra-low-energy ion beam bombarded naked DNA. ► Ion beam with energy of a few tens of eV could break DNA strands. -- Abstract: Study of low-energy ion bombardment effect on biological living materials is of significance. High-energy ion beam irradiation of biological materials such as organs and cells has no doubt biological effects. However, ion energy deposition in the ion-bombarded materials dominantly occurs in the low-energy range. To investigate effects from very-low-energy ion bombardment on biological materials, an ion beam deceleration lens is necessary for uniform ion energy lower than keV. A deceleration lens was designed and constructed based on study of the beam optics using the SIMION program. The lens consisted of six electrodes, able to focus and decelerate primary ion beam, with the last one being a long tube to obtain a parallel uniform exiting beam. The deceleration lens was installed to our 30-kV bioengineering-specialized ion beam line. The final decelerated-ion energy was measured using a simple electrostatic field to bend the beam to range from 10 eV to 1 keV controlled by the lens parameters and the primary beam condition. In a preliminary test, nitrogen ion beam at 60 eV decelerated from a primary 20-keV beam bombarded naked plasmid DNA. The original DNA supercoiled form was found to change to relaxed and linear forms, indicating single or double strand breaks. The study demonstrated that the ion bombardment with energy as low as several-tens eV was possible to break DNA strands and thus potential to cause genetic modification of biological cells.
An ion beam deceleration lens for ultra-low-energy ion bombardment of naked DNA
International Nuclear Information System (INIS)
Thopan, P.; Prakrajang, K.; Thongkumkoon, P.; Suwannakachorn, D.; Yu, L.D.
2013-01-01
Highlights: ► An ion beam deceleration lens was designed and constructed. ► The deceleration lens was installed and tested. ► The decelerated ion beam energy was measured using an electrical field. ► Decelerated ultra-low-energy ion beam bombarded naked DNA. ► Ion beam with energy of a few tens of eV could break DNA strands. -- Abstract: Study of low-energy ion bombardment effect on biological living materials is of significance. High-energy ion beam irradiation of biological materials such as organs and cells has no doubt biological effects. However, ion energy deposition in the ion-bombarded materials dominantly occurs in the low-energy range. To investigate effects from very-low-energy ion bombardment on biological materials, an ion beam deceleration lens is necessary for uniform ion energy lower than keV. A deceleration lens was designed and constructed based on study of the beam optics using the SIMION program. The lens consisted of six electrodes, able to focus and decelerate primary ion beam, with the last one being a long tube to obtain a parallel uniform exiting beam. The deceleration lens was installed to our 30-kV bioengineering-specialized ion beam line. The final decelerated-ion energy was measured using a simple electrostatic field to bend the beam to range from 10 eV to 1 keV controlled by the lens parameters and the primary beam condition. In a preliminary test, nitrogen ion beam at 60 eV decelerated from a primary 20-keV beam bombarded naked plasmid DNA. The original DNA supercoiled form was found to change to relaxed and linear forms, indicating single or double strand breaks. The study demonstrated that the ion bombardment with energy as low as several-tens eV was possible to break DNA strands and thus potential to cause genetic modification of biological cells
Pulsed, Inductively Generated, Streaming Plasma Ion Source for Heavy Ion Fusion Linacs
International Nuclear Information System (INIS)
Steven C. Glidden; Howard D Sanders; John B. Greenly; Daniel L. Dongwoo
2006-01-01
This report describes a compact, high current density, pulsed ion source, based on electrodeless, inductively driven gas breakdown, developed to meet the requirements on normalized emittance, current density, uniformity and pulse duration for an ion injector in a heavy-ion fusion driver. The plasma source produces >10 (micro)s pulse of Argon plasma with ion current densities >100 mA/cm2 at 30 cm from the source and with strongly axially directed ion energy of about 80 eV, and sub-eV transverse temperature. The source has good reproducibility and spatial uniformity. Control of the current density during the pulse has been demonstrated with a novel modulator coil method which allows attenuation of the ion current density without significantly affecting the beam quality. This project was carried out in two phases. Phase 1 used source configurations adapted from light ion sources to demonstrate the feasibility of the concept. In Phase 2 the performance of the source was enhanced and quantified in greater detail, a modulator for controlling the pulse shape was developed, and experiments were conducted with the ions accelerated to >40 kV
Ion-selective electrode reviews
Thomas, J D R
1985-01-01
Ion-Selective Electrode Reviews, Volume 7 is a collection of papers that covers the applications of electrochemical sensors, along with the versatility of ion-selective electrodes. The coverage of the text includes solid contact in membrane ion-selective electrodes; immobilized enzyme probes for determining inhibitors; potentiometric titrations based on ion-pair formation; and application of ion-selective electrodes in soil science, kinetics, and kinetic analysis. The text will be of great use to chemists and chemical engineers.
Observation of ion-acoustic rarefaction solitons in a multicomponent plasma with negative ions
International Nuclear Information System (INIS)
Ludwig, G.O.; Ferreira, J.L.; Nakamura, Y.
1984-01-01
The propagation of ion-acoustic solitons in a plasma with negative ions has been observed. For sufficiently large concentration of negative ions, applied rarefactive (negative) voltage pulses break up into solitons, whereas compressive pulses evolve into wave trains, with exactly the opposite behavior as that for a plasma composed only of positive ions. There is a critical value of the negative-ion concentration for which a finite-amplitude pulse propagates without steepening
High charge state metal ion production in vacuum arc ion sources
International Nuclear Information System (INIS)
Brown, I.G.; Anders, A.; Anders, S.
1994-01-01
The vacuum arc is a rich source of highly ionized metal plasma that can be used to make a high current metal ion source. Vacuum arc ion sources have been developed for a range of applications including ion implantation for materials surface modification, particle accelerator injection for fundamental nuclear physics research, and other fundamental and applied purposes. Typically the source is repetitively pulsed with pulse length of order a millisecond and duty cycle or order 1% and operation of a dc embodiment has been demonstrated also. Beams have been produced from over 50 of the solid metals of the periodic table, with mean ion energy up to several hundred keV and with peak (pulsed) beam current up to several amperes. The ion charge state distribution has been extensively studied. Ion spectra have been measured for a wide range of metallic cathode materials, including Li, C, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Ge, Sr, Y, Zr, Nb, Mo, Pd, Ag, Cd, In, Sn, Sb, Ba, La, Ce, Pr, Nd, Sm, Gd, Dy, Ho, Er, Tm, Yb, Hf, Ta, W, Ir, Pt, Au, Pb, Bi, Th and U, as well as compound and alloy cathode materials such as TiC, SiC, UC, PbS, brass, and stainless steel. The ions generated are in general multiply-stripped with a mean charge state of from 1 to 3, depending on the particular metal species, and the charge state distribution can have components from Q = 1+ to 6+. Here the authors review the characteristics of vacuum arc ion sources from the perspective of their high charge state metal ion production
International Nuclear Information System (INIS)
Bazin, V.; Boduch, P.; Chesnel, J.Y.; Fremont, F.; Lecler, D.; Pacquet, J. Y.; Gaubert, G.; Leroy, R.
1999-01-01
Modifications in the ECR 4M ion source are described, which conducted to realization of the advanced source 'SUPERSHYPIE'. The Ar 8+ ion collision with Cs(6s,6p) were studied by photon spectroscopy at low energy, where the process is dominated by simple electron capture. Results obtained with 'SUPERSHYPIE' source are presented. The source was utilized also in ion-molecule collisions (CO, H 2 ) to study the spectra of recoil ions and Auger electron spectra in the Ar 17+ He collisions. The excellent performances of 'SUPERSHYPIE' in high charge production and concerning its accurate and fine control and stability are illustrated and underlined as compared with those of ECR 4M source
Sharma, S D; Gupta, R
2000-02-01
The chromatographic behavior of 40 metal ions is studied on titanium (IV) arsenate, titanium (IV) phosphate-, titanium (IV) molybdate-, titanium(IV) tungstate-, and titanium(IV) selenite-impregnated papers in 0.1M oxalic, citric, and tartaric acid as mobile phases. Similar studies are carried out on Whatman No. 1 papers for comparison. The ion-exchange capacity of these papers is determined, and their selectivity for different cations is discussed. The mechanism of migration is explained in terms of ion-exchange, precipitation, and adsorption. The prediction of elution sequence from RF values is also checked. The average Ri is found to be almost linearly dependent on the charge of the metal ions. The effect of the pKa of complexing acids on average RF values of 3d series metal ions is explained. A number of binary and ternary separations are achieved.
F.A.J. van den Bosch (Frans)
1993-01-01
textabstractInleiding. In mijn bijdrage wil ik zowel ingaan op de ontwikkelingen in de wetenschappelijke benadering van strategie- en omgevingsvraagstukken als een eerste analyse daarvan geven. Bij die analyse heb ik gekozen voor het perspectief van de longitudinale benadering. De in beschouwing
African Journals Online (AJOL)
AFRICAN JOURNALS ONLINE (AJOL) · Journals · Advanced Search · USING AJOL ... Submissions should be made in soft or hard copy, by either sending two hard copies to IKS mailing address or sending soft copy to iks@udsm.ac.tz or ...
Ion beam stabilization in ion implantation equipment
International Nuclear Information System (INIS)
Pina, L.
1973-01-01
The results are presented of experimental efforts aimed at ion beam current stabilization in an equipment for ion implantation in solids. The related problems of power supplies are discussed. Measured characteristics of laboratory equipment served the determination of the parameters to be required of the supplies as well as the design and the construction of the supplies. The respective wiring diagram is presented. (J.K.)
Structure of ion-implanted ceramics
International Nuclear Information System (INIS)
Naramoto, Hiroshi
1983-01-01
The variation of structure of LiF, MgO, Al 2 O 3 and TiO 2 accompanying annealing after ion implantation is explained. The analysis of structure is usually made by the perturbed gamma ray angular correlation, the internal electron Moessbauer method, or the ion scattering method. The results of analyses are discussed for alkali ion implantation, Fe-ion implantation, In-ion implantation, Au-ion implantation, Pt-ion implantation, Pb-ion implantation and transition metal ion implantation. The coupling of the implanted elements with lattice defects and matrix elements, and the compatibility between deposited elements and matrix crystal lattice were studied. The variation of physical properties due to ion implantation such as phase transition, volume change, the control of single crystal region, and the variation of hardness near surface were investigated, and the examples are presented. (Kato, T.)
Energy Technology Data Exchange (ETDEWEB)
Pikin, A.; Alessi, J.; Beebe, E.; Kponou, A.; Okamura, M.; Raparia, D.; Ritter, J.; Tan, Y.; Kuznetsov, G.
2011-09-10
RHIC EBIS has been commissioned to operate as a versatile ion source on RHIC injection facility supplying ion species from He to Au for Booster. Except for light gaseous elements RHIC EBIS employs ion injection from several external primary ion sources. With electrostatic optics fast switching from one ion species to another can be done on a pulse to pulse mode. The design of an ion optical structure and the results of simulations for different ion species are presented. In the choice of optical elements special attention was paid to spherical aberrations for high-current space charge dominated ion beams. The combination of a gridded lens and a magnet lens in LEBT provides flexibility of optical control for a wide range of ion species to satisfy acceptance parameters of RFQ. The results of ion transmission measurements are presented.
Ion beam analysis of metal ion implanted surfaces
Energy Technology Data Exchange (ETDEWEB)
Evans, P.J.; Chu, J.W.; Johnson, E.P.; Noorman, J.T. [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia); Sood, D.K. [Royal Melbourne Inst. of Tech., VIC (Australia)
1993-12-31
Ion implantation is an established method for altering the surface properties of many materials. While a variety of analytical techniques are available for the characterisation of implanted surfaces, those based on particle accelerators such as Rutherford backscattering (RBS) and nuclear reaction analysis (NRA) provide some of the most useful and powerful for this purpose. Application of the latter techniques to metal ion implantation research at ANSTO will be described with particular reference to specific examples from recent studies. Where possible, the information obtained from ion beam analysis will be compared with that derived from other techniques such as Energy Dispersive X-ray (EDX) and Auger spectroscopies. 4 refs., 5 figs.
Ion beam analysis of metal ion implanted surfaces
Energy Technology Data Exchange (ETDEWEB)
Evans, P J; Chu, J W; Johnson, E P; Noorman, J T [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia); Sood, D K [Royal Melbourne Inst. of Tech., VIC (Australia)
1994-12-31
Ion implantation is an established method for altering the surface properties of many materials. While a variety of analytical techniques are available for the characterisation of implanted surfaces, those based on particle accelerators such as Rutherford backscattering (RBS) and nuclear reaction analysis (NRA) provide some of the most useful and powerful for this purpose. Application of the latter techniques to metal ion implantation research at ANSTO will be described with particular reference to specific examples from recent studies. Where possible, the information obtained from ion beam analysis will be compared with that derived from other techniques such as Energy Dispersive X-ray (EDX) and Auger spectroscopies. 4 refs., 5 figs.
Ion beam analysis of metal ion implanted surfaces
International Nuclear Information System (INIS)
Evans, P.J.; Chu, J.W.; Johnson, E.P.; Noorman, J.T.; Sood, D.K.
1993-01-01
Ion implantation is an established method for altering the surface properties of many materials. While a variety of analytical techniques are available for the characterisation of implanted surfaces, those based on particle accelerators such as Rutherford backscattering (RBS) and nuclear reaction analysis (NRA) provide some of the most useful and powerful for this purpose. Application of the latter techniques to metal ion implantation research at ANSTO will be described with particular reference to specific examples from recent studies. Where possible, the information obtained from ion beam analysis will be compared with that derived from other techniques such as Energy Dispersive X-ray (EDX) and Auger spectroscopies. 4 refs., 5 figs
International Nuclear Information System (INIS)
Brown, I.G.
1989-06-01
The concept of high current ion source is both relative and evolutionary. Within the domain of one particular kind of ion source technology a current of microamperers might be 'high', while in another area a current of 10 Amperes could 'low'. Even within the domain of a single ion source type, what is considered high current performance today is routinely eclipsed by better performance and higher current output within a short period of time. Within their fields of application, there is a large number of kinds of ion sources that can justifiably be called high current. Thus, as a very limited example only, PIGs, Freemen sources, ECR sources, duoplasmatrons, field emission sources, and a great many more all have their high current variants. High current ion beams of gaseous and metallic species can be generated in a number of different ways. Ion sources of the kind developed at various laboratories around the world for the production of intense neutral beams for controlled fusion experiments are used to form large area proton deuteron beams of may tens of Amperes, and this technology can be used for other applications also. There has been significant progress in recent years in the use of microwave ion sources for high current ion beam generation, and this method is likely to find wide application in various different field application. Finally, high current beams of metal ions can be produced using metal vapor vacuum arc ion source technology. After a brief consideration of high current ion source design concepts, these three particular methods are reviewed in this paper
Cell swelling activates cloned Ca(2+)-activated K(+) channels: a role for the F-actin cytoskeleton
DEFF Research Database (Denmark)
Jorgensen, Nanna K; Pedersen, Stine F; Rasmussen, Hanne B
2003-01-01
Cloned Ca(2+)-activated K(+) channels of intermediate (hIK) or small (rSK3) conductance were expressed in HEK 293 cells, and channel activity was monitored using whole-cell patch clamp. hIK and rSK3 currents already activated by intracellular calcium were further increased by 95% and 125......%, respectively, upon exposure of the cells to a 33% decrease in extracellular osmolarity. hIK and rSK3 currents were inhibited by 46% and 32%, respectively, by a 50% increase in extracellular osmolarity. Cell swelling and channel activation were not associated with detectable increases in [Ca(2+)](i), evidenced...... by population and single-cell measurements. In addition, inhibitors of IK and SK channels significantly reduced the rate of regulatory volume decrease (RVD) in cells expressing these channels. Cell swelling induced a decrease, and cell shrinkage an increase, in net cellular F-actin content. The swelling...
Ion sources development at GANIL for radioactive beams and high charge state ions
International Nuclear Information System (INIS)
Leroy, R.; Barue, C.; Canet, C.; Dupuis, M.; Flambard, J.L.; Gaubert, G.; Gibouin, S.; Huguet, Y.; Jardin, P.; Lecesne, N.; Leherissier, P.; Lemagnen, F.; Pacquet, J.Y.; Pellemoine-Landre, F.; Rataud, J.P.; Saint-Laurent, M.G.; Villari, A.C.C.; Maunoury, L.
2001-01-01
The GANIL laboratory has in charge the production of ion beams for nuclear and non nuclear physics. This article reviews the last developments that are underway in the fields of radioactive ion beam production, increase of the metallic ion intensities and production of highly charges ion beams. (authors)
Salt stress induced ion accumulation, ion homeostasis, membrane ...
African Journals Online (AJOL)
Salt stress induced ion accumulation, ion homeostasis, membrane injury and sugar contents in salt-sensitive rice ( Oryza sativa L. spp. indica ) roots under isoosmotic conditions. ... The accumulation of sugars in PT1 roots may be a primary salt-defense mechanism and may function as an osmotic control. Key words: ...
Jo, Se-Hee; Park, Chanhun; Yi, Sung Chul; Kim, Dukjoon; Mun, Sungyong
2011-08-19
A three-zone carousel process, in which Cu(II)-imprinted polymer (Cu-MIP) and a buffer solution were employed as adsorbent and eluent respectively, has been developed previously for continuous separation of Cu²⁺ (product) from Mn²⁺ and Co²⁺ (impurities). Although this process was reported to be successful in the aforementioned separation task, the way of using a buffer solution as eluent made it inevitable that the product stream included the buffer-related metal ions (i.e., the constituent metal ions of the buffer solution) as well as copper ions. For a more perfect recovery of copper ions, it would be necessary to improve the previous carousel process such that it can remove the buffer-related metal ions from copper ions while maintaining the previous function of separating copper ions from the other 2 impure heavy-metal ions. This improvement was made in this study by proposing a four-zone carousel process based on the following strategy: (1) the addition of one more zone for performing the two-step re-equilibration tasks and (2) the use of water as the eluent of the washing step in the separation zone. The operating conditions of such a proposed process were determined on the basis of the data from a series of single-column experiments. Under the determined operating conditions, 3 runs of carousel experiments were carried out. The results of these experiments revealed that the feed-loading time was a key parameter affecting the performance of the proposed process. Consequently, the continuous separation of copper ions from both the impure heavy-metal ions and the buffer-related metal ions could be achieved with a purity of 91.9% and a yield of 92.8% by using the proposed carousel process based on a properly chosen feed-loading time. Copyright © 2011 Elsevier B.V. All rights reserved.
Optical effects of ion implantation
International Nuclear Information System (INIS)
Townsend, P.D.
1987-01-01
The review concerns the effects of ion implantation that specifically relate to the optical properties of insulators. Topics which are reviewed include: ion implantation, ion range and damage distributions, colour centre production by ion implantation, high dose ion implantation, and applications for integrated optics. Numerous examples are presented of both diagnostic and industrial examples of ion implantation effects in insulators. (U.K.)
Simulation study on ion extraction from electron cyclotron resonance ion sources
Fu, S.; Kitagawa, A.; Yamada, S.
1994-04-01
In order to study beam optics of NIRS-ECR ion source used in the HIMAC project, the EGUN code has been modified to make it capable of modeling ion extraction from a plasma. Two versions of the modified code are worked out with two different methods in which 1D and 2D sheath theories are used, respectively. Convergence problem of the strong nonlinear self-consistent equations is investigated. Simulations on NIRS-ECR ion source and HYPER-ECR ion source are presented in this paper, exhibiting an agreement with the experiment results.
Rotation characteristics of main ions and impurity ions in H-mode tokamak plasma
International Nuclear Information System (INIS)
Kim, J.; Burrell, K.H.; Gohil, P.; Groebner, R.J.; Kim, Y.; St. John, H.E.; Seraydarian, R.P.; Wade, M.R.
1994-01-01
Poloidal and toroidal rotation of the main ions (He 2+ ) and the impurity ions (C 6+ and B 5+ ) in H-mode helium plasmas have been measured via charge exchange recombination spectroscopy in the DIII-D tokamak. It was discovered that the main ion poloidal rotation is in the ion diamagnetic drift direction while the impurity ion rotation is in the electron diamagnetic drift direction, in qualitative agreement with the neoclassical theory. The deduced radial electric field in the edge is of the same negative-well shape regardless of which ion species is used, validating the fundamental nature of the electric field in L-H transition phenomenology
Atmospheric ions and pollution
International Nuclear Information System (INIS)
Renoux, A.
1977-01-01
The various types of atmospheric ions are defined, the main sources of natural atmospheric radioactivity inducing the formation of radioactive ions in the air are then recalled. The basic equations governing the formation of these ions are indicated and the most current experimental methods used for detecting them are described (Zeleny tubes, Erikson tubes). The special properties of these ions are examined, they are particularly emphasized for the smaller ones. The existence of a discret spectrum of mobilities is shown and the presence of big negative radioactive ions is investigated. Indicative information are given on the granulometric distribution of the atmospheric radioactivity in the air, from small positive Ra A ion fixation on aerosols [fr
Ion emission microscope microanalyzer
International Nuclear Information System (INIS)
Cherepin, V.T.; Olckovsky, V.L.
1977-01-01
In the ion microanalyzer (microprobe) the object is exposed to the bombardment of a highly focused ion beam, the secondary ions emitted from the object being analyzed by means of a mass filter. In order to be able to control the position of an analysis synchronous to the local analysis of an object an ion-optical converter (electron image with a fluorescent screen) is placed behind the aperture diaphragm in the direction of the secondary ion beam. The converter allows to make visible in front of the mass filter a non-split ion image characterizing the surface of the surface investigated. Then a certain section may be selected for performing chemical and isotope analyses. (DG) [de
Van Atta, C.M.; Beringer, R.; Smith, L.
1959-01-01
A linear accelerator of heavy ions is described. The basic contributions of the invention consist of a method and apparatus for obtaining high energy particles of an element with an increased charge-to-mass ratio. The method comprises the steps of ionizing the atoms of an element, accelerating the resultant ions to an energy substantially equal to one Mev per nucleon, stripping orbital electrons from the accelerated ions by passing the ions through a curtain of elemental vapor disposed transversely of the path of the ions to provide a second charge-to-mass ratio, and finally accelerating the resultant stripped ions to a final energy of at least ten Mev per nucleon.
Veerman, Christiaan C.; Zegers, Jan G.; Mengarelli, Isabella; Bezzina, Connie R.
2017-01-01
Human induced pluripotent stem cell-derived cardiomyocytes (hiPSC-CMs) hold great promise for studying inherited cardiac arrhythmias and developing drug therapies to treat such arrhythmias. Unfortunately, until now, action potential (AP) measurements in hiPSC-CMs have been hampered by the virtual absence of the inward rectifier potassium current (IK1) in hiPSC-CMs, resulting in spontaneous activity and altered function of various depolarising and repolarising membrane currents. We assessed whether AP measurements in “ventricular-like” and “atrial-like” hiPSC-CMs could be improved through a simple, highly reproducible dynamic clamp approach to provide these cells with a substantial IK1 (computed in real time according to the actual membrane potential and injected through the patch-clamp pipette). APs were measured at 1 Hz using perforated patch-clamp methodology, both in control cells and in cells treated with all-trans retinoic acid (RA) during the differentiation process to increase the number of cells with atrial-like APs. RA-treated hiPSC-CMs displayed shorter APs than control hiPSC-CMs and this phenotype became more prominent upon addition of synthetic IK1 through dynamic clamp. Furthermore, the variability of several AP parameters decreased upon IK1 injection. Computer simulations with models of ventricular-like and atrial-like hiPSC-CMs demonstrated the importance of selecting an appropriate synthetic IK1. In conclusion, the dynamic clamp-based approach of IK1 injection has broad applicability for detailed AP measurements in hiPSC-CMs. PMID:28867785
Xiang, Yun; Abliz, Zeper; Takayama, Mitsuo
2004-05-01
The dissociation reactions of the adduct ions derived from the four self-complementary deoxydinucleotides, d(ApT), d(TpA), d(CpG), d(GpC), and alkali-metal ions were studied in detail by positive ion electrospray ionization multiple-stage mass spectrometry (ESI-MS(n)). For the [M + H](+) ions of the four deoxydinucleotides, elimination of 5'-terminus base or loss of both of 5'-terminus base and a deoxyribose were the major dissociation pathway. The ESI-MS(n) spectra showed that Li(+), Na(+), and Cs(+) bind to deoxydinucleotides mainly by substituting the H(+) of phosphate group, and these alkali-metal ions preferred to bind to pyrimidine bases rather than purine bases. For a given deoxydinucleotide, the dissociation pathway of [M + K](+) ions differed clearly from that of [M + Li](+), [M + Na](+), and [M + Cs](+) ions. Some interesting and characteristic cleavage reactions were observed in the product-ion spectra of [M + K](+) ions, including direct elimination of deoxyribose and HPO(3) from molecular ions. The fragmentation behavior of the [M + K](+) and [M + W](+) (W = Li, Na, Cs) adduct ions depend upon the sequence of bases, the interaction between alkali-metal ions and nucleobases, and the steric hindrance caused by bases.
Determination of gas phase protein ion densities via ion mobility analysis with charge reduction.
Maisser, Anne; Premnath, Vinay; Ghosh, Abhimanyu; Nguyen, Tuan Anh; Attoui, Michel; Hogan, Christopher J
2011-12-28
We use a charge reduction electrospray (ESI) source and subsequent ion mobility analysis with a differential mobility analyzer (DMA, with detection via both a Faraday cage electrometer and a condensation particle counter) to infer the densities of single and multiprotein ions of cytochrome C, lysozyme, myoglobin, ovalbumin, and bovine serum albumin produced from non-denaturing (20 mM aqueous ammonium acetate) and denaturing (1 : 49.5 : 49.5, formic acid : methanol : water) ESI. Charge reduction is achieved through use of a Po-210 radioactive source, which generates roughly equal concentrations of positive and negative ions. Ions produced by the source collide with and reduce the charge on ESI generated drops, preventing Coulombic fissions, and unlike typical protein ESI, leading to gas-phase protein ions with +1 to +3 excess charges. Therefore, charge reduction serves to effectively mitigate any role that Coulombic stretching may play on the structure of the gas phase ions. Density inference is made via determination of the mobility diameter, and correspondingly the spherical equivalent protein volume. Through this approach it is found that for both non-denaturing and denaturing ESI-generated ions, gas-phase protein ions are relatively compact, with average densities of 0.97 g cm(-3) and 0.86 g cm(-3), respectively. Ions from non-denaturing ESI are found to be slightly more compact than predicted from the protein crystal structures, suggesting that low charge state protein ions in the gas phase are slightly denser than their solution conformations. While a slight difference is detected between the ions produced with non-denaturing and denaturing ESI, the denatured ions are found to be much more dense than those examined previously by drift tube mobility analysis, in which charge reduction was not employed. This indicates that Coulombic stretching is typically what leads to non-compact ions in the gas-phase, and suggests that for gas phase
Yoshio, Masaki; Kozawa, Akiya
2010-01-01
This book is a compilation of up-to-date information relative to Li-Ion technology. It provides the reader with a single source covering all important aspects of Li-Ion battery operations. It fills the gap between the old original Li-Ion technology and present state of the technology that has developed into a high state of practice. The book is designed to provide a single source for an up-to-date description of the technology associated with the Li-Ion battery industry. It will be useful to researchers interested in energy conversion for the direct conversion of chemical energy into electrica
Ibrahim, Yehia M.; Smith, Richard D.
2016-01-26
An ion trap device is disclosed. The device includes a series of electrodes that define an ion flow path. A radio frequency (RF) field is applied to the series of electrodes such that each electrode is phase shifted approximately 180 degrees from an adjacent electrode. A DC voltage is superimposed with the RF field to create a DC gradient to drive ions in the direction of the gradient. A second RF field or DC voltage is applied to selectively trap and release the ions from the device. Further, the device may be gridless and utilized at high pressure.
Kinetic treatment of nonlinear ion-acoustic waves in multi-ion plasma
Ahmad, Zulfiqar; Ahmad, Mushtaq; Qamar, A.
2017-09-01
By applying the kinetic theory of the Valsove-Poisson model and the reductive perturbation technique, a Korteweg-de Vries (KdV) equation is derived for small but finite amplitude ion acoustic waves in multi-ion plasma composed of positive and negative ions along with the fraction of electrons. A correspondent equation is also derived from the basic set of fluid equations of adiabatic ions and isothermal electrons. Both kinetic and fluid KdV equations are stationary solved with different nature of coefficients. Their differences are discussed both analytically and numerically. The criteria of the fluid approach as a limiting case of kinetic theory are also discussed. The presence of negative ion makes some modification in the solitary structure that has also been discussed with its implication at the laboratory level.
Fully stripped heavy ion yield vs energy for Xe and Au ions
International Nuclear Information System (INIS)
Thieberger, P.; Wegner, H.E.; Alonzo, J.; Gould, H.; Anholt, R.E.; Meyerhof, W.E.
1985-01-01
The Bevalac is now capable of accelerating U-238 ions to approximately 1 GeV/amu and measurements have shown that fully stripped U-238 ions are produced with good yield at these energies. However, knowing the stripping yields at different energies for U-238 does not allow an accurate prediction for other, lower Z projectiles. Consequently, extensive stripping yield measurements were made for Au-197 and Xe-139 ions. In addition to the stripping measurements from the direct Bevalac beam, pickup measurements were also made with specially prepared bare, one electron, and two electron ions. Since many research groups are considering heavy ion storage rings and/or synchrotrons, the pickup cross section for bare ions is important to estimate beam lifetime in terms of the average machine vacuum. Since the Mylar target provides a pickup probability similar to air, a preliminary analysis of the Xe 54+ and U 92+ data are presented along with predictions for other ions ranging down to Fe 26+ . 11 refs., 3 figs., 1 tab
Surrey Ion Beam Centre: the EPSRC MRF for ion beam applications - 01002
International Nuclear Information System (INIS)
Webb, R.P.
2016-01-01
The SIBC (Surrey Ion Beam Centre) is an element of the Virtual Ion Beam Centre that coordinates 3 U.K. experimental facilities: SIBC (University of Surrey) for implantation and ion beam applications, Miami and MEIS facility (University of Huddersfield) and gamma ray and neutron irradiation emulation facility (University of Manchester). The SIBC works actively with industry, developing bespoke processes and services, particularly for the photonics industry and provides ion beam facilities to about 20 companies across the world. It operates a stringent quality control program and is one of the few ion beam laboratories in the world to operate under ISO 9001 certification. The equipment of SIBC is presented and some applications of ion beam analysis concerning the identification of gunshot residues, the determination of the origin of a painting, the analysis of proteins are described. Different techniques such as PIXE (Particle Induced X-ray Emission), RBS (Rutherford Backscattering Spectroscopy), NRA (Nuclear Reaction Analysis), SIMS (Secondary Ion Mass Spectrometry) are also explained in the slides of the presentation that have been added at the end of the paper
Fully stripped heavy ion yield vs energy for Xe and Au ions
Energy Technology Data Exchange (ETDEWEB)
Thieberger, P.; Wegner, H.E.; Alonzo, J.; Gould, H.; Anholt, R.E.; Meyerhof, W.E.
1985-01-01
The Bevalac is now capable of accelerating U-238 ions to approximately 1 GeV/amu and measurements have shown that fully stripped U-238 ions are produced with good yield at these energies. However, knowing the stripping yields at different energies for U-238 does not allow an accurate prediction for other, lower Z projectiles. Consequently, extensive stripping yield measurements were made for Au-197 and Xe-139 ions. In addition to the stripping measurements from the direct Bevalac beam, pickup measurements were also made with specially prepared bare, one electron, and two electron ions. Since many research groups are considering heavy ion storage rings and/or synchrotrons, the pickup cross section for bare ions is important to estimate beam lifetime in terms of the average machine vacuum. Since the Mylar target provides a pickup probability similar to air, a preliminary analysis of the Xe/sup 54 +/ and U/sup 92 +/ data are presented along with predictions for other ions ranging down to Fe/sup 26 +/. 11 refs., 3 figs., 1 tab.
Sawtooth activity of the ion cloud in an electron-beam ion trap
International Nuclear Information System (INIS)
Radtke, R.; Biedermann, C.
2003-01-01
The dynamics of an ensemble of highly charged Ar and Ba ions in an electron-beam ion trap (EBIT) was studied by recording time-resolved x-ray spectra emitted from trapped ions. Sawtoothlike signatures manifest in the spectra for a variety of EBIT operating conditions indicating a sudden collapse of the ion inventory in the trap. The collapse occurs on a time scale of approximately 100 ms and the evolution of the sawteeth is very sensitive to parameters such as electron-beam current and axial trap depth. Analysis of the measurements is based on a time-dependent calculation of the trapping process showing that sawtooth activity is caused by the feedback between the low-Z argon and high-Z barium ions. This unexpected behavior demonstrates the importance of nonlinear effects in electron-beam traps containing more than a single ion species
Means for obtaining a metal ion beam from a heavy-ion cyclotron source
Hudson, E.D.; Mallory, M.L.
1975-08-01
A description is given of a modification to a cyclotron ion source used in producing a high intensity metal ion beam. A small amount of an inert support gas maintains the usual plasma arc, except that it is necessary for the support gas to have a heavy mass, e.g., xenon or krypton as opposed to neon. A plate, fabricated from the metal (or anything that can be sputtered) to be ionized, is mounted on the back wall of the ion source arc chamber and is bombarded by returning energetic low-charged gas ions that fail to cross the initial accelerating gap between the ion source and the accelerating electrode. Some of the atoms that are dislodged from the plate by the returning gas ions become ionized and are extracted as a useful beam of heavy ions. (auth)
Transition of ion-acoustic perturbations in multicomponent plasma with negative ions
International Nuclear Information System (INIS)
Sharma, Sumita Kumari; Devi, Kavita; Adhikary, Nirab Chandra; Bailung, Heremba
2008-01-01
Evolution of ion-acoustic compressive (positive) and rarefactive (negative) perturbations in a multicomponent plasma with negative ions has been investigated in a double plasma device. Transition of compressive solitons in electron-positive ion plasma, into a dispersing train of oscillations in a multicomponent plasma, when the negative ion concentration r exceeds a critical value r c , has been observed. On the other hand, an initial rarefactive perturbation initially evolves into a dispersing train of oscillations in electron-positive ion plasma and transforms into rarefactive solitons in a multicomponent plasma when the negative ion concentration is higher than the critical value. The Mach velocity and width of the compressive and rarefactive solitons are measured. The compressive solitons in the range 0 c and the rarefactive solitons in the range r>r c have different characteristics than the Korteweg-de Vries (KdV) solitons at r=0 and modified KdV solitons at r=r c . A nonlinear differential equation having two terms to account for the lower and higher order nonlinearity has been used to explain the observed results
Kurniawan, Andi; Tsuchiya, Yuki; Eda, Shima; Morisaki, Hisao
2015-12-01
Biofilm polymers contain both electrically positively and negatively charged sites. These charged sites enable the biofilm to trap and retain ions leading to an important role of biofilm such as nutrient recycling and pollutant purification. Much work has focused on the ion-exchange capacity of biofilms, and they are known to adsorb ions through an exchange mechanism between the ions in solution and the ions adsorbed to the charged sites on the biofilm polymer. However, recent studies suggest that the adsorption/desorption behavior of ions in a biofilm cannot be explained solely by this ion exchange mechanism. To examine the possibility that a substantial amount of ions are held in the interstitial region of the biofilm polymer by an electrostatic interaction, intact biofilms formed in a natural environment were immersed in distilled water and ion desorption was investigated. All of the detected ion species were released from the biofilms over a short period of time, and very few ions were subsequently released over more time, indicating that the interstitial region of biofilm polymers is another ion reserve. The extent of ion retention in the interstitial region of biofilms for each ion can be determined largely by charge density, |Z|/r, where |Z| is the ion valence as absolute value and r is the ion radius. The higher |Z|/r value an ion has, the stronger it is retained in the interstitial region of biofilms. Ion shape is also a key determinant of ion retention. Spherical and non-spherical ions have different correlations between the condensation ratio and |Z|/r. The generality of these findings were assured by various biofilm samples. Thus, the internal regions of biofilms exchange ions dynamically with the outside environment. Copyright © 2015 Elsevier B.V. All rights reserved.
Negative ion sources for tandem accelerator
International Nuclear Information System (INIS)
Minehara, Eisuke
1980-08-01
Four kinds of negative ion sources (direct extraction Duoplasmatron ion source, radial extraction Penniing ion source, lithium charge exchange ion source and Middleton-type sputter ion source) have been installed in the JAERI tandem accelerator. The ion sources can generate many negative ions ranging from Hydrogen to Uranium with the exception of Ne, Ar, Kr, Xe and Rn. Discussions presented in this report include mechanisms of negative ion formation, electron affinity and stability of negative ions, performance of the ion sources and materials used for negative ion production. Finally, the author will discuss difficult problems to be overcome in order to get any negative ion sufficiently. (author)
Tien jaar Nijmeegs onderzoek naar het leren van leraren op de werkplek
Bergen, T.C.M.
2005-01-01
Toen ik in 1994 de verantwoordelijkheid kreeg om een interfacultair onderzoekprogramma op te zetten dat relevant was voor de universitaire lerarenopleiding, kreeg ik van het toenmalige College van Bestuur ook de opdracht om te zorgen dat een groot deel van de universitaire lerarenopleiders in een
2012-09-04
... DEPARTMENT OF STATE [Public Notice 8009] Culturally Significant Object Imported for Exhibition Determinations: ``Dancing Into Dreams, Maya Vases From the IK'Kingdom'' SUMMARY: Notice is hereby given of the... exhibition ``Dancing Into Dreams, Maya Vases from the IK'Kingdom,'' imported from abroad for temporary...
Measurement of ultra-low ion energy of decelerated ion beam using a deflecting electric field
Energy Technology Data Exchange (ETDEWEB)
Thopan, P.; Suwannakachorn, D.; Tippawan, U. [Plasma and Beam Physics Research Facility, Department of Physics and Materials Science, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Yu, L.D., E-mail: yuld@thep-center.org [Plasma and Beam Physics Research Facility, Department of Physics and Materials Science, Faculty of Science, Chiang Mai University, Chiang Mai 50200 (Thailand); Thailand Center of Excellence in Physics, Commission on Higher Education, 328 Si Ayutthaya Road, Bangkok 10400 (Thailand)
2015-12-15
In investigation on ultra-low-energy ion bombardment effect on DNA, an ion beam deceleration lens was developed for high-quality ultra-low-energy ion beam. Measurement of the ion energy after deceleration was necessary to confirm the ion beam really decelerated as theoretically predicted. In contrast to conventional methods, this work used a simple deflecting electrostatic field after the deceleration lens to bend the ion beam. The beam bending distance depended on the ion energy and was described and simulated. A system for the measurement of the ion beam energy was constructed. It consisted of a pair of parallel electrode plates to generate the deflecting electrical field, a copper rod measurement piece to detect ion beam current, a vernier caliper to mark the beam position, a stepping motor to translate the measurement rod, and a webcam-camera to read the beam bending distance. The entire system was installed after the ion-beam deceleration lens inside the large chamber of the bioengineering vertical ion beam line. Moving the measurement rod across the decelerated ion beam enabled to obtain beam profiles, from which the beam bending distance could be known and the ion beam energy could be calculated. The measurement results were in good agreement with theoretical and simulated results.
International Nuclear Information System (INIS)
Luederwald, I.
1977-01-01
Instrumentation and technology of Ion-Cyclotron-Resonance and Fourier-Transform-Ion-Cyclotron-Resonance Spectroscopy are described. The method can be applied to studies of ion/molecule reactions in gas phase, to obtain thermodynamic data as gas phase acidity or basicity, proton and electron affinity, and to establish reaction mechanisms and ion structures. (orig.) [de
Ion structure and sequence of ion formation in acetylene flames
Energy Technology Data Exchange (ETDEWEB)
Larionova, I.A.; Fialkov, B.S.; Kalinich, K.YA.; Fialkov, A.B.; Ospanov, B.S.
1993-06-01
Results of a study of the ion composition of acetylene-air flames burning at low pressures are reported. Data on ion formation are compared for flames of saturated hydrocarbons, oxygen-containing fuels, and acetylene. It is shown that the characteristics of ion formation in the flame front and directly ahead of it are similar to those observed in flames of other fuels. These characteristics, however, are different in the low-temperature region. 9 refs.
Proton-bound cluster ions in ion mobility spectrometry
Ewing, R. G.; Eiceman, G. A.; Stone, J. A.
1999-01-01
Gaseous oxygen and nitrogen bases, both singly and as binary mixtures, have been introduced into ion mobility spectrometers to study the appearance of protonated molecules, and proton-bound dimers and trimers. At ambient temperature it was possible to simultaneously observe, following the introduction of molecule A, comparable intensities of peaks ascribable to the reactant ion (H2O)nH+, the protonated molecule AH+ and AH+ H2O, and the symmetrical proton bound dimer A2H+. Mass spectral identification confirmed the identifications and also showed that the majority of the protonated molecules were hydrated and that the proton-bound dimers were hydrated to a much lesser extent. No significant peaks ascribable to proton-bound trimers were obtained no matter how high the sample concentration. Binary mixtures containing molecules A and B, in some cases gave not only the peaks unique to the individual compounds but also peaks due to asymmetrical proton bound dimers AHB+. Such ions were always present in the spectra of mixtures of oxygen bases but were not observed for several mixtures of oxygen and nitrogen bases. The dimers, which were not observable, notable for their low hydrogen bond strengths, must have decomposed in their passage from the ion source to the detector, i.e. in a time less than approximately 5 ms. When the temperature was lowered to -20 degrees C, trimers, both homogeneous and mixed, were observed with mixtures of alcohols. The importance of hydrogen bond energy, and hence operating temperature, in determining the degree of solvation of the ions that will be observed in an ion mobility spectrometer is stressed. The possibility is discussed that a displacement reaction involving ambient water plays a role in the dissociation.
Caliko: An Inverse Kinematics Software Library Implementation of the FABRIK Algorithm
Directory of Open Access Journals (Sweden)
Alastair Lansley
2016-09-01
Full Text Available The Caliko library is an implementation of the FABRIK (Forward And Backward Reaching Inverse Kinematics algorithm written in Java. The inverse kinematics (IK algorithm is implemented in both 2D and 3D, and incorporates a variety of joint constraints as well as the ability to connect multiple IK chains together in a hierarchy. The library allows for the simple creation and solving of multiple IK chains as well as visualisation of these solutions. It is licensed under the MIT software license and the source code is freely available for use and modification at: https://github.com/feduni/caliko
Research into Traveling Wave Control in Flexible Structures
1990-06-15
Displacement is the measured variable in all of the rod examples. Y = F I s i n(k + k 0) _______________ ikEA 21- k [ (24)- -- .r k k 0 F - Choosing m = 4 in...the value of Eq. (25) function of position is given by becomes U2 for that mode. U(X)= F 4 ( 2 e + e (21) Figure 3 shows the magnitudes of the ikEA ...for providing a reasonable length sensor. ___ sin(k_ The dash-dot curve in Fig. 4 shows the ikEA 1- _ 2 1- e-as (28) magnitude and phase of a
Ion source based on Penning discharge for production of doubly charged helium ions
Directory of Open Access Journals (Sweden)
V. I. Voznyi
2017-11-01
Full Text Available The article presents the results of operation of ion source with Penning discharge developed in the IAP of NAS of Ukraine to produce doubly charged helium ions He2+ beam and to increase the energy of accelerated ions up to 3.2 MeV. This energy is necessary for ERDA channel when measuring hydrogen concentration in the structural materials used in nuclear engineering. The ion source parameters are the following: discharge voltage is 6 kV, discharge current is 0.8 - 1.2 mA, the current of singly charged helium ions He+ 24 μA, the current of doubly charged helium ions He2+ 0.5 μA.
Mode conversion of fast Alfvacute en waves at the ion endash ion hybrid resonance
International Nuclear Information System (INIS)
Ram, A.K.; Bers, A.; Schultz, S.D.; Fuchs, V.
1996-01-01
Substantial radio-frequency power in the ion-cyclotron range of frequencies can be effectively coupled to a tokamak plasma from poloidal current strap antennas at the plasma edge. If there exists an ion endash ion hybrid resonance inside the plasma, then some of the power from the antenna, delivered into the plasma by fast Alfvacute en waves, can be mode converted to ion-Bernstein waves. In tokamak confinement fields the mode-converted ion-Bernstein waves can damp effectively and locally on electrons [A. K. Ram and A. Bers, Phys. Fluids B 3, 1059 (1991)]. The usual mode-conversion analysis that studies the propagation of fast Alfvacute en waves in the immediate vicinity of the ion endash ion hybrid resonance is extended to include the propagation and reflection of the fast Alfvacute en waves on the high magnetic-field side of the ion endash ion hybrid resonance. It is shown that there exist plasma conditions for which the entire fast Alfvacute en wave power incident on the ion endash ion hybrid resonance can be converted to ion-Bernstein waves. In this extended analysis of the mode conversion process, the fast Alfvacute en waves can be envisioned as being coupled to an internal plasma resonator. This resonator extends from the low magnetic-field cutoff near the ion endash ion hybrid resonance to the high magnetic-field cutoff. The condition for 100% mode conversion corresponds to a critical coupling of the fast Alfvacute en waves to this internal resonator. As an example, the appropriate plasma conditions for 100% mode conversion are determined for the Tokamak Fusion Test Reactor (TFTR) [R. Majeski et al., Proceedings of the 11th Topical Conference on RF Power in Plasmas, Palm Springs (American Institute of Physics, New York, 1995), Vol. 355, p. 63] experimental parameters. copyright 1996 American Institute of Physics
Comparison of secondary ion emission yields for poly-tyrosine between cluster and heavy ion impacts
International Nuclear Information System (INIS)
Hirata, K.; Saitoh, Y.; Chiba, A.; Yamada, K.; Takahashi, Y.; Narumi, K.
2010-01-01
Emission yields of secondary ions necessary for the identification of poly-tyrosine were compared for incident ion impacts of energetic cluster ions (0.8 MeV C 8 + , 2.4 MeV C 8 + , and 4.0 MeV C 8 + ) and swift heavy monoatomic molybdenum ions (4.0 MeV Mo + and 14 MeV Mo 4+ ) with similar mass to that of the cluster by time-of-flight secondary ion mass analysis combined with secondary ion electric current measurements. The comparison revealed that (1) secondary ion emission yields per C 8 + impact increase with increasing incident energy within the energy range examined, (2) the 4.0 MeV C 8 + impact provides higher emission yields than the impact of the monoatomic Mo ion with the same incident energy (4.0 MeV Mo + ), and (3) the 2.4 MeV C 8 + impact exhibits comparable emission yields to that for the Mo ion impact with higher incident energy (14 MeV Mo 4+ ). Energetic cluster ion impacts effectively produce the characteristic secondary ions for poly-tyrosine, which is advantageous for highly sensitive amino acid detection in proteins using time-of-flight secondary ion mass analysis.
Mass spectrum of secondary ions knocked-out from copper surface by argon ion beam
International Nuclear Information System (INIS)
Koval', A.G.; Bobkov, V.V.; Klimovskij, Yu.A.; Fogel', Ya.M.
1976-01-01
The mass-spectrum of secondary ions was studied within a mass range of 1-400. The ions were knocked-out by the beam of ions Ar + from the copper surface with different content of oxygen and sulphur solved in the volume. The studies were conducted at three temperatures of the target. The atomic and molecular ions of the metal matrix, volumetric impurities of metal and ions of chemical compounds molecules of the metal under study with gas particles adsorbed on its surface and atoms of the metal volumetric admixtures may be observed in the mass spectrum. Detection of secondary ions of the copper multi-atomic complexes and ions of these complexes compounds with the adsorbed molecules is of interest
An enhanced production of highly charged ions in the ECR ion sources
International Nuclear Information System (INIS)
Schaechter, L.; Dobrescu, S.; Badescu- Singureanu, Al.I.; Stiebing, K.E.; Runkel, S.; Hohn, O.; Schmidt, L.; Schempp, A.; Schmidt - Boecking, H.
2000-01-01
The electron cyclotron resonance (ECR) ion source (ECRIS) are the ideal sources of highly charged heavy ions. Highly charged heavy ions are widely used in atomic physics research where they constitute a very efficient tool due to their very high electric potential of collision. The highly charged ions are also used in fusion plasma physics studies, in solid state surface physics investigations and are very efficient when injected in particle accelerators. More than 50 ECR ion sources are presently working in the whole world. Stable and intense highly charged heavy ions beams are extracted from ECR ion sources, in a wide range of ion species. RECRIS, the Romanian 14 GHz ECR Ion Source, developed in IFIN-HH, designed as a facility for atomic physics and materials studies, has been recently completed. The research field concerning the development of advanced ECRIS and the study of the physical processes of the ECR plasma are presently very dynamical , a fact well proved by the great number of scientific published works and the numerous dedicated international conferences and workshops. It is well established that the performance of ECRIS can substantially be enhanced if special techniques like a 'biased disk' or a special wall coating of the plasma chamber are employed. In the frame of a cooperation project between IFIN-HH ,Bucharest, Romania and the Institut fuer Kernphysik of the J. W. Goethe University, Frankfurt/Main, Germany we developed, on the basis of previous research carried out in IFIN-HH, a new method to strongly increase the intensity of the ion beams extracted from the 14.4 GHz ECRIS in Frankfurt. In our method a special metal-dielectric structure (MD cylinder) was introduced in the ECRIS plasma chamber. In the experiment analyzed beams of Ar 16+ ions were increased in intensity by a factor of 50 as compared to the standard set up with stainless steel chamber. These results have been communicated at the International Conference on Ion Sources held at
International Nuclear Information System (INIS)
Panov, M.N.; Afrosimov, V.V.; Basalaev, A.A.; Guschina, N.A.; Nikulin, V.K.
2006-01-01
The interactions of protons and alpha-particles with hydrocarbons are investigated. A quantum-mechanical computation of the electronic structure of all hydrocarbons from methane to butane and its fragment ions was performed in the Hartree-Fock RHF/UHF approximation using a GAMESS program (General Atomic Molecular Electron Structure System). The correlation energy was taken into account within the framework of MP2 perturbation theory. The structural parameters of the hydrocarbon molecules and their charged and neutral fragments were calculated in two cases: in the geometry of the parent molecule or of the relaxation states. The difference of the full energy of the same fragments in and out of brackets gives us the vibration excitation energies of the fragments at the moment of creation. Additional Mulliken effective charges (in electron charge units) of atoms in the fragments have been calculated. The calculations show that removing one electron from the ethane molecule without electronic excitation produced a single charged molecular ion in vibration state with binding energy of hydrogen atoms, some decimal eV. As results we obtain C 2 H 6 + and C 2 H 5 + . Additional fragmentation of hydrocarbon needs electronic excitation of produced single charged ions. Cross sections for electron capture and excitation processes in collisions between the hydrogen-like He + , B 4+ and O 7+ ions have been evaluated. The purpose of the theory within this project during the period under review was to get for the first time new data on Single-Electron Capture (SEC) and Excitation Processes (EP) in collisions of He + (1s) ions with hydrogen-like impurity ions B 4+ (1s) and O 7+ (1s) in the energy range for He + ions from 0.2 MeV to 3.0 MeV. The calculations were carried out by using the method of close-coupling equations with basis sets of eleven and ten quasimolecular two-electron states for reactions (1, 2) and (3, 4), respectively (entrance channel, seven charge transfer channels
International Nuclear Information System (INIS)
Iwaki, Masaya
1978-01-01
The distribution of implanted ions in iron, the friction characteristics and the corrosion of iron were studied. The distribution of Ni or Cr ions implanted into mild steel was measured. The accelerated voltage was 150 keV, and the beam current density was about 2 microampere/cm 2 . The measurement was made with an ion microanalyzer. The measured distribution was compared with that of LSS theory. Deep invasion of Ni was seen in the measured distribution. The distribution of Cr ions was different from the distribution calculated by the LSS theory. The relative friction coefficient of mild steel varied according to the dose of implanted Cu or N ions, and to the accelerating voltage. Formation of compound metals on the surfaces of metals by ion-implantation was investigated for the purpose to prevent the corrosion of metals. The resistance of mild steel in which Ni ions were implanted was larger than that of mild steel without any treatment. (Kato, T.)
Monitoring Ion Activities In and Around Cells Using Ion-Selective Liquid-Membrane Microelectrodes
Directory of Open Access Journals (Sweden)
Mark D. Parker
2013-01-01
Full Text Available Determining the effective concentration (i.e., activity of ions in and around living cells is important to our understanding of the contribution of those ions to cellular function. Moreover, monitoring changes in ion activities in and around cells is informative about the actions of the transporters and/or channels operating in the cell membrane. The activity of an ion can be measured using a glass microelectrode that includes in its tip a liquid-membrane doped with an ion-selective ionophore. Because these electrodes can be fabricated with tip diameters that are less than 1 μm, they can be used to impale single cells in order to monitor the activities of intracellular ions. This review summarizes the history, theory, and practice of ion-selective microelectrode use and brings together a number of classic and recent examples of their usefulness in the realm of physiological study.
Large-amplitude ion-acoustic double layers in a plasma with warm ions
International Nuclear Information System (INIS)
Roychoudury, R.K.; Bhattacharyya, S.; Varshni, Y.P.
1990-01-01
The conditions for the existence of an ion-acoustic double layer in a plasma with warm ions and two distinct groups of hot electrons have been studied using the Sagdeev potential method. A comparison is made with the published results of Bharuthram and Shukla for cold ions and a two temperature electron population. Numerical studies have been made to find out the effect of a finite ion temperature on the Mach number of the double layers
Very broad beam metal ion source for large area ion implantation application
International Nuclear Information System (INIS)
Brown, I.; Anders, S.; Dickinson, M.R.; MacGill, R.A.; Yao, X.
1993-01-01
The authors have made and operated a very broad beam version of vacuum arc ion source and used it to carry out high energy metal ion implantation of a particularly large substrate. A multiple-cathode vacuum arc plasma source was coupled to a 50 cm diameter beam extractor (multiple aperture, accel-decel configuration) operated at a net extraction voltage of up to 50 kV. The metal ion species chosen were Ni and Ta. The mean ion charge state for Ni and Ta vacuum arc plasmas is 1.8 and 2.9, respectively, and so the mean ion energies were up to about 90 and 145 keV, respectively. The ion source was operated in a repetitively pulsed mode with pulse length 250 μs and repetition rate several pulses per second. The extracted beam had a gaussian profile with FWHM about 35 cm, giving a nominal beam area of about 1,000 cm 2 . The current of Ni or Ta metal ions in the beam was up to several amperes. The targets for the ion implantation were a number of 24-inch long, highly polished Cu rails from an electromagnetic rail gun. The rails were located about 80 cm away from the ion source extractor grids, and were moved across a diameter of the vessel in such a way as to maximize the uniformity of the implant along the rail. The saturation retained dose for Ta was limited to about 4 x 10 16 cm -2 because of the rather severe sputtering, in accordance with the theoretical expectations for these implantation conditions. Here they describe the ion source, the implantation procedure, and the kinds of implants that can be produced in this way
Ion pairing of radical ions of aromatic alkenes and alkynes studied by pulse radiolysis
International Nuclear Information System (INIS)
Yamamoto, Satoshi; Yamamoto, Yukio; Hayashi, Koichiro
1991-01-01
Pulse radiolysis of 1,2-dichloroethane solutions of trans,trans-1,4-bis(2-phenylethenyl)benzene and 1,4-bis(2-phenylethynyl)benzene was undertaken in the presence of Bu 4 NPF 6 (Bu=butyl) to investigate the effect of ion pairing of the solute radical cations with PF 6 - . It was also undertaken for the tetrahydrofuran solutions of the above compounds in the presence of Bu 4 NPF 6 and NaBPh 4 , where the solute radical anions are generated and form ion pairs with Bu 4 N + and Na + . The decay of the radical ions, which is due to neutralization, is retarded by the ion pairing. The rate constants for the neutralization reactions in the free-ion and ion-paired states were determined. Also presented are the data for the radical ions of trans-stilbene, diphenylacetylene, trans,trans-1,4-diphenyl-1,3-butadiene, and diphenylbutadiene. The radical ions of the aromatic alkynes are less stabilized by the ion pairing than those of the aromatic alkenes having the same carbon skeletons probably because of more extensive charge delocalization of the former radical ions. Spectral shifts to shorter wavelengths caused by the ion pairing are appreciable for the radical anions. Dependence of the spectral shifts on the size of the radical anions is described. (author)
Development of intense pulsed heavy ion beam diode using gas puff plasma gun as ion source
International Nuclear Information System (INIS)
Ito, H.; Higashiyama, M.; Takata, S.; Kitamura, I.; Masugata, K.
2006-01-01
A magnetically insulated ion diode with an active ion source of a gas puff plasma gun has been developed in order to generate a high-intensity pulsed heavy ion beam for the implantation process of semiconductors and the surface modification of materials. The nitrogen plasma produced by the plasma gun is injected into the acceleration gap of the diode with the external magnetic field system. The ion diode is operated at diode voltage approx. =200 kV, diode current approx. =2 kA and pulse duration approx. =150 ns. A new acceleration gap configuration for focusing ion beam has been designed in order to enhance the ion current density. The experimental results show that the ion current density is enhanced by a factor of 2 and the ion beam has the ion current density of 27 A/cm 2 . In addition, the coaxial type Marx generator with voltage 200 kV and current 15 kA has been developed and installed in the focus type ion diode. The ion beam of ion current density approx. =54 A/cm 2 is obtained. To produce metallic ion beams, an ion source by aluminum wire discharge has been developed and the aluminum plasma of ion current density ∼70 A/cm 2 is measured. (author)
Thermal ions dilution and ITG suppression in ASDEX Upgrade ion ITBs
International Nuclear Information System (INIS)
Tardini, G.; Hobirk, J.; Igochine, V.G.; Maggi, C.F.; Martin, P.; McCune, D.; Peeters, A.G.; Sips, A.C.C.; Staebler, A.; Stober, J.
2007-01-01
Internal transport barriers (ITBs) in the ion channel in the tokamak ASDEX Upgrade allow for high energy confinement but collapse after only several energy confinement times. In this paper we show that in most cases the ITB phase is terminated clearly before the first ELM burst, thereby ruling out the ELMs as the main trigger of the ITB collapse. For the first time, the ITB formation and sustainment are found to be associated with a mechanism of transport suppression based on thermal ions dilution by the injected fast ions. Interestingly, such ITBs do not require reversed magnetic shear. The linear growth rate of the ion temperature gradient driven mode is computed as a function of the fast ion fraction with gyrokinetic stability analysis. Monte Carlo simulations predict the fast ion population to be above the gyrokinetic critical fraction in a region consistent with the experimental ITB width. The density threshold documented for the onset of ASDEX Upgrade ion ITBs is explained. The role of T i /T e and of the plasma sheared rotation for ITB sustainment are analysed. The stabilization mechanism presented here is consistent with the observed ITB lifetime of the order of the beam slowing down time. A possible runaway mechanism leading to ITB collapse is described. Finally, the relevance of this particular ITB scheme for ITER is discussed
Ion source with plasma cathode
International Nuclear Information System (INIS)
Yabe, E.
1987-01-01
A long lifetime ion source with plasma cathode has been developed for use in ion implantation. In this ion source, a plasma of a nonreactive working gas serves as a cathode in place of a thermionic tungsten filament used in the Freeman ion source. In an applied magnetic field, the plasma is convergent, i.e., filamentlike; in zero magnetic field, it turns divergent and spraylike. In the latter case, the plasma exhibits a remarkable ability when the working gas has an ionization potential larger than the feed gas. By any combination of a working gas of either argon or neon and a feed gas of AsF 5 or PF 5 , the lifetime of this ion source was found to be more than 90 h with an extraction voltage of 40 kV and the corresponding ion current density 20 mA/cm 2 . Mass spectrometry results show that this ion source has an ability of generating a considerable amount of As + and P + ions from AsF 5 and PF 5 , and hence will be useful for realizing a fully cryopumped ion implanter system. This ion source is also eminently suitable for use in oxygen ion production
Ion beam techniques for analyzing polymers irradiated by ions
International Nuclear Information System (INIS)
Rickards, J.; Zironi, E.P.; Andrade, E.; Dominguez, B.
1992-01-01
In the study of the effects of ion beam irradiation of polymers very large doses can be administered in short times. Thousands of MGy can be produced in a small volume of a sample in a few minutes by bombarding with typical ion beam currents. For instance, in an experiment done to observe the effects of 750 keV proton irradiation PVC, using a collimator of 1 mm diameter, 1 μC of charge integration deposits a dose of 50 MGy. The use of ion beams also opens up the possibility of using the same beam for irradiation and for analysis of the effects, using the well known ion beam analysis techniques. PIXE allows the measurement of chlorine in PVC. Polymers containing fluorine can be measured with the resonant nuclear reaction (RNR) technique, which is specific only to certain elements. The amount of hydrogen in the sample and its profile can be obtained using energy recoil detection analysis (ERDA); carbon, oxygen, and nitrogen can be measured and profiled using Rutherford backscattering (RBS) and also using the (d,p) and (d, α) nuclear reactions (NR). Loss of mass is one effect that can be studied using these techniques. It was studied in two different polymers, PVC and CR-39, in order to determine carbon buildup during ion irradiation. It was concluded that carbon builds up following different mechanisms in these two materials, due to the different possibilities of forming volatile compounds. It is also suggested that CR-39 should be a good material for ion beam lithography. (author)
DEFF Research Database (Denmark)
Larsen, Erik Huusfeldt; Hansen, Sven Hedegaard
1992-01-01
Arsenite, arsenate, monomethylarsonate, dimethylarsinate, arsenobetaine, arsenocholine and the tetramethylarsonium ion were subjected to ion-exchange and ion-pair reversed phase HPLC. The ion exchange method was superior in selectivity and time of analysis for the arsenic anions. The ammonium ions...... used for the ion-pair method only resulted in separation of some of the anionic arsenic compounds. Flame atomic absorption spectrometry was used for on-line arsenic-specific detection....
International Nuclear Information System (INIS)
Adair, H.L.; Kobisk, E.H.
1985-01-01
This chapter examines the characteristics of targets required in heavy-ion accelerator physics experiments. The effects of target parameters on heavy-ion experimental results are reviewed. The target fabrication and characterization techniques used to minimize experimental problems during heavy-ion bombardment are described. Topics considered include target thickness and uniformity, target lifetime, target purity, substrate materials, Doppler shift effects, metal preparations, and target preparation methods
Wang, Cheng-Zhong; Su, Yue; Wang, Hao-Yang; Guo, Yin-Long
2011-10-01
When using tetrachloromethane as the reagent gas in gas chromatography-ion trap mass spectrometry equipped with hybrid ionization source, the cation CCl{3/+} was generated in high abundance and further gas-phase experiments showed that such an electron-deficient reagent ion CCl{3/+} could undergo interesting ion-molecule reactions with various volatile organic compounds, which not only present some informative gas-phase reactions, but also facilitate qualitative analysis of diverse volatile compounds by providing unique mass spectral data that are characteristic of particular chemical structures. The ion-molecule reactions of the reagent ion CCl{3/+} with different types of compounds were studied, and results showed that such reactions could give rise to structurally diagnostic ions, such as [M + CCl3 - HCl]+ for aromatic hydrocarbons, [M - OH]+ for saturated cyclic ether, ketone, and alcoholic compounds, [M - H]+ ion for monoterpenes, M·+ for sesquiterpenes, [M - CH3CO]+ for esters, as well as the further fragment ions. The mechanisms of ion-molecule reactions of aromatic hydrocarbons, aliphatic ketones and alcoholic compounds with the reagent ion CCl{3/+} were investigated and proposed according to the information provided by MS/MS experiments and theoretical calculations. Then, this method was applied to study volatile organic compounds in Dendranthema indicum var. aromaticum and 20 compounds, including monoterpenes and their oxygen-containing derivatives, aromatic hydrocarbon and sesquiterpenes were identified using such ion-molecule reactions. This study offers a perspective and an alternative tool for the analysis and identification of various volatile compounds.
Mass-selective isolation of ions stored in a quadrupole ion trap. A simulation study
March, Raymond E.; Londry, Frank A.; Alfred, Roland L.; Franklin, Anthony M.; Todd, John F. J.
1992-01-01
Trajectories of single ions stored in the quadrupole ion trap have been calculated using a simulation program described as the specific program for quadrupolar resonance (SPQR). Previously, the program has been used for the investigation of quadrupolar resonance excitation of ions with a static working point (or co-ordinates) in the stability diagram. The program has been modified to accommodate continuous d.c. and/or r.f. voltage ramps so as to permit calculation of ion trajectories while the working point is being changed. The modified program has been applied to the calculation of ion trajectories during ion isolation, or mass-selective storage, in the ion trap. The quadrupolar resonance excitation aspect of SPQR was not used in this study. Trajectories are displayed as temporal variations of ion kinetic energy, and axial and radial excursions from the centre of the ion trap. The working points of three ion species (m/z 144, 146 and 148), located initially on the qz, axis with qz [approximate] 0.12, were moved to the vicinity of the upper apex by a combination of r.f. and d.c. voltages applied in succession. Stable trajectories were maintained only for the ion species of m/z 146 for which the working point lay within this apex; the other ion species were ejected either radially or axially. The d.c. voltage was then reduced to zero so as to restore the working point of the isolated ion species to the qz axis. The amplitude of the r.f voltage was reduced to its initial value so as to retrieve the initial working point for m/z 146. The process extended over a real time of 2.9 ms, and was collision-free. The trajectory of the isolated ion was stable during this process; the ion species with m/z value lower than that of the target ion, that is, m/z 144, was ejected axially at the [beta]z = 1 boundary, while that with higher m/z value, that is, m/z 148, was ejected radially at the [beta]r = 0 boundary, as expected. The moderating effects of buffer gas were not taken
Vrijheid, gelijkheid en eenzaamheid
Hofstee, E.W.
1980-01-01
Ik ben geboren en getogen en ik heb geleefd en gewerkt in en vanuit ' de Verlichtingsdenkbeelden. De Franse revolutie in haar ontwikkeling heeft te veel onplezierige aspecten om haar straks zonder reserve te herdenken. Men moet ernstig hopen, dat onze wereld zich nog tijdig van deze eenzijdigheid,
DEFF Research Database (Denmark)
Jensen, Birgit; Lübeck, Peter S; Jørgensen, Hans Jørgen Lyngs
2016-01-01
as the pathogen, whereas application 24 h after the pathogen had no effect. IK726 also reduced the sporulation capacity of B. sorokiniana. Microscopy of B. sorokiniana infection revealed that IK726 primarily inhibited conidial germination and appressorium formation while further pathogen development and host...
Fysieke veiligheid. Enkele trends en dilemma's
Menno van Duin
2012-01-01
In dit artikel ligt het zwaartepunt bij het thema fysieke veiligheid (ongevallen, rampen, crises). Ik schets enkele ontwikkelingen, trends en dilemma’s op het betreffende terrein. Daarbij wil ik niet de suggestie wekken in dit artikel alle trends en dilemma’s op het onderhavige terrein te
Behavioural Determinants of Dental Health Behaviour : a Meta-Analytical Review
Janneke Scheerman
2014-01-01
Op 28 augustus 2014 heb ik een 'oral presentation' gegeven op het European Health Psychology Society congres te Innsbruck. De abstract van het artikel die ik gepresenteerd heb is gepubliceerd op de website van EHPS (zie bijgevoegd de link) The aim was to quantify the relationship between
Our future is a question of energy
International Nuclear Information System (INIS)
In this information brochure the Informationskreis Kernenergie (IK), a group of scientists, energy experts and publicists introduce themselves to the public. After an explanation of the aims and functions of IK the currently existing programme which comes form publications and other mediums is put forward. (UA) [de
Specific ion effects on membrane potential and the permselectivity of ion exchange membranes
Geise, Geoffrey M.; Cassady, Harrison J.; Paul, Donald R.; Logan, Bruce E.; Hickner, Michael A.
2014-01-01
-ions also appeared to influence permselectivity leading to ion-specific effects; co-ions that are charge dense and have low polarizability tended to result in high membrane permselectivity. This journal is
Indian Academy of Sciences (India)
Swift heavy ions interact predominantly through inelastic scattering while traversing any polymer medium and produce excited/ionized atoms. Here samples of the polycarbonate Makrofol of approximate thickness 20 m, spin coated on GaAs substrate were irradiated with 50 MeV Li ion (+3 charge state). Build-in ...
Morisawa, T; Hasegawa, J; Hama, R; Kitano, M; Kishimoto, Y; Kawasaki, H
1999-01-01
The effects of itopride hydrochloride, a new drug used to regulate motility in the gastrointestinal tract, on the delayed rectifier K+ current (I(K)) and the L-type Ca2+ current (I(Ca)) were evaluated in guinea-pig ventricular myocytes at concentrations of 1, 10 and 100 microM to determine whether the drug has a proarrhythmic effect through blockade of I(K). Itopride did not affect I(K) at concentrations of 100 microM or less, and no significant effects of 1, 10 or 100 microM itopride were observed on the inward rectifier K+ current (I(K1)) responsible for the resting potential and final repolarization phase of the action potential. We next investigated the effects of itopride on L-type Ca2+ current (I(Ca)). Significant inhibition of I(Ca) was observed at itopride concentrations greater than 10 microM. These results suggested that itopride hydrochloride has an inhibitory effect on I(Ca) at concentrations much higher than those in clinical use.
International Nuclear Information System (INIS)
Shults, Keith; Flye, Leanne; Green, Lisa; Daly, Thomas; Manro, Jason R; Lahn, Michael
2009-01-01
Multiparametric analyses of phospho-protein activation in patients with acute myeloid leukemia (AML) offers a quantitative measure to monitor the activity of novel intracellular kinase (IK) inhibitors. As recent clinical investigation with FMS-like tyrosine-3 inhibitors demonstrated, targeting IK with selective inhibitors can have a modest clinical benefit. Because multiple IKs are active in patients with AML, multikinase inhibitors may provide the necessary inhibition profile to achieve a more sustained clinical benefit. We here describe a method of assessing the activation of several IKs by flow cytometry. In 40 different samples of patients with AML we observed hyper-activated phospho-proteins at baseline, which is modestly increased by adding stem cell factor to AML cells. Finally, AML cells had a significantly different phospho-protein profile compared with cells of the lymphocyte gate. In conclusion, our method offers a way to determine the activation status of multiple kinases in AML and hence is a reliable assay to evaluate the pharmacodynamic activity of novel multikinase inhibitors
Production of highly charged ion beams from electron cyclotron resonance ion sources (invited)
International Nuclear Information System (INIS)
Xie, Z.Q.
1998-01-01
Electron cyclotron resonance ion source (ECRIS) development has progressed with multiple-frequency plasma heating, higher mirror magnetic fields, and better technique to provide extra cold electrons. Such techniques greatly enhance the production of highly charged ions from ECRISs. So far at continuous wave (CW) mode operation, up to 300 eμA of O 7+ and 1.15 emA of O 6+ , more than 100 eμA of intermediate heavy ions for charge states up to Ar 13+ , Ca 13+ , Fe 13+ , Co 14+ , and Kr 18+ , and tens of eμA of heavy ions with charge states to Kr 26+ , Xe 28+ , Au 35+ , Bi 34+ , and U 34+ were produced from ECRISs. At an intensity of at least 1 eμA, the maximum charge state available for the heavy ions are Xe 36+ , Au 46+ , Bi 47+ , and U 48+ . An order of magnitude enhancement for fully stripped argon ions (I≥60enA) were also achieved. This article will review the ECR ion source progress and discuss key requirement for ECRISs to produce the highly charged ion beams. copyright 1998 American Institute of Physics
Si-nanoparticle synthesis using ion implantation and MeV ion irradiation
Energy Technology Data Exchange (ETDEWEB)
Chulapakorn, T.; Wolff, M.; Primetzhofer, D.; Possnert, G. [Uppsala University, Department of Physics and Astronomy, P.O. Box 516, 751 20 Uppsala (Sweden); Sychugov, I.; Suvanam, S.S.; Linnros, J. [Royal Institute of Technology, School of Information and Communication Technology, P.O. Box Electrum 229, 164 40 Kista (Sweden); Hallen, A. [Uppsala University, Department of Physics and Astronomy, P.O. Box 516, 751 20 Uppsala (Sweden); Royal Institute of Technology, School of Information and Communication Technology, P.O. Box Electrum 229, 164 40 Kista (Sweden)
2015-12-15
A dielectric matrix with embedded Si-nanoparticles may show strong luminescence depending on nanoparticles size, surface properties, Si-excess concentration and matrix type. Ion implantation of Si ions with energies of a few tens to hundreds of keV in a SiO{sub 2} matrix followed by thermal annealing was identified as a powerful method to form such nanoparticles. The aim of the present work is to optimize the synthesis of Si-nanoparticles produced by ion implantation in SiO{sub 2} by employing MeV ion irradiation as an additional annealing process. The luminescence properties are measured by spectrally resolved photoluminescence including PL lifetime measurement, while X-ray reflectometry, atomic force microscopy and ion beam analysis are used to characterize the nanoparticle formation process. The results show that the samples implanted at 20%-Si excess atomic concentration display the highest luminescence and that irradiation of 36 MeV {sup 127}I ions affects the luminosity in terms of wavelength and intensity. It is also demonstrated that the nanoparticle luminescence lifetime decreases as a function of irradiation fluence. (copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Energy transfer and quenching processes of excited uranyl ion and lanthanide ions in solutions
International Nuclear Information System (INIS)
Yamamura, Tomoo; Tomiyasu, Hiroshi
1995-01-01
Deactivation processes of photoexcited uranyl ion by various lanthanide ions in aqueous solution were studied. Each lanthanide ions show different interaction with excited uranyl ion depending on its lowest excited energy level, the number of 4f electrons and the acid concentration of the solution. (author)
Liu, Chengfang; Liu, Enli; Luo, Tiane; Zhang, Weifang; He, Rongli
2016-08-01
Activation of the inward rectifier potassium current (IK1) channel has been reported to be associated with suppression of ventricular arrhythmias. In this study, we tested the hypothesis that opening of the IK1 channel with zacopride (ZAC) was involved in the modulation of tissue repair after myocardial infarction. Sprague-Dawley rats were subject to coronary artery ligation and ZAC was administered intraperitoneally (15 µg/kg/day) for 28 days. Compared with the ischemia group, treatment with ZAC significantly reduced the ratio of heart/body weight and the cross-sectional area of cardiomyocytes, suggesting less cardiac hypertrophy. ZAC reduced the accumulation of collagen types I and III, accompanied with decrease of collagen area, which were associated with a reduction of collagen deposition in the fibrotic myocardium. Echocardiography showed improved cardiac function, evidenced by the reduced left ventricular end-diastolic dimension and left ventricular end-systolic dimension, and the increased ejection fraction and fractional shortening in ZAC-treated animals (all P < 0.05 vs. ischemia group). In coincidence with these changes, ZAC up-regulated the protein level of the IK1 channel and down-regulated the phosphorylation of mammalian target of rapamycin (mTOR) and 70-kDa ribosomal protein S6 (p70S6) kinase. Administration of chloroquine alone, an IK1 channel antagonist, had no effect on all the parameters measured, but significantly blocked the beneficial effects of ZAC on cardiac repair. In conclusion, opening of the IK1 channel with ZAC inhibits maladaptive tissue repair and improves cardiac function, potentially mediated by the inhibition of ischemia-activated mTOR-p70S6 signaling pathway via the IK1 channel. So the development of pharmacological agents specifically targeting the activation of the IK1 channel may protect the heart against myocardial ischemia-induced cardiac dysfunction. © The Author 2016. Published by Oxford University Press on behalf of
Munoz, François; Ramesh, B R; Couteron, Pierre
2014-08-01
Understanding how local species assembly depends on the regional biogeographic and environmental context is a challenging task in community ecology. In spatially implicit neutral models, a single immigration parameter, I(k), represents the flux of immigrants from a regional pool that compete with local offspring for establishment in communities. This flux counterbalances the effect of local stochastic extinctions to maintain local species diversity. If some species within the regional pool are not adapted to the local environment (habitat filtering), the migrant flux is reduced beyond that of the neutral model, such that habitat filtering influences the value of I(k) in non-neutral situations. Here, we propose a novel model in which immigrants from the regional pool are filtered according to their habitat preferences and the local environment, while taxa potentially retain habitat preferences from their ancestors (niche conservatism). Using both analytical reasoning and simulations, we demonstrate that I(k) is expected to be constant when estimated based on the community composition at several taxonomic levels, not only under neutral assumptions, but also when habitat filtering occurs, unless there is substantial niche conservatism. In the latter case, I(k) is expected to decrease when estimated based on the composition at species to genus and family levels, thus allowing a signature of niche conservatism to be detected by simply comparing I(k) estimates across taxonomic levels. We applied this approach to three rain forest data sets from South India and Central America and found no significant signature of niche conservatism when I(k) was compared across taxonomic levels, except at the family level in South India. We further observed more limited immigration in South Indian forests, supporting the hypothesis of a greater impact of habitat filtering and heterogeneity there than in Central America. Our results highlight the relevance of studying variations of I(k
Lettry, J; Wallner, J; Sargsyan, E; CERN. Geneva. BE Department
2010-01-01
The MedAustron Ion therapy center will be constructed in Wiener Neustadt (Austria) in the vicinity of Vienna. Its accelerator complex consists of four ion sources, a linear accelerator, a synchrotron and a beam delivery system to the three medical treatment rooms and to the research irradiation room. The ion sources shall deliver beams of H31+, C4+ and light ions with utmost reliability and stability. This paper describes the features of the ion sources presently planned for the MedAustron facility; such as ion source main parameters, gas injection, temperature control and cooling systems. A dedicated beam diagnostics technique is proposed in order to characterize ECR ions beams; in the first drift region after the ion source, a fraction of the mixed beam is selected via moveable aperture. With standard beam diagnostics, we then aim to produce position-dependant observables such as ion-current density, beam energy distribution and emittance for each charge states to be compared to simulations of ECR e-heating...
International Nuclear Information System (INIS)
Crandall, D.H.
1982-01-01
This discussion concentrates on basic physics aspects of inelastic processes of excitation, ionization, and recombination that occur during electron-ion collisions. Except for cases of illustration along isoelectronic sequences, only multicharged (at least +2) ions will be specifically discussed with some emphasis of unique physics aspects associated with ionic charge. The material presented will be discussed from a primarily experimental viewpoint with most attention to electron-ion interacting beams experiments
Laser ion source with solenoid for Brookhaven National Laboratory-electron beam ion source.
Kondo, K; Yamamoto, T; Sekine, M; Okamura, M
2012-02-01
The electron beam ion source (EBIS) preinjector at Brookhaven National Laboratory (BNL) is a new heavy ion-preinjector for relativistic heavy ion collider (RHIC) and NASA Space Radiation Laboratory (NSRL). Laser ion source (LIS) is a primary ion source provider for the BNL-EBIS. LIS with solenoid at the plasma drift section can realize the low peak current (∼100 μA) with high charge (∼10 nC) which is the BNL-EBIS requirement. The gap between two solenoids does not cause serious plasma current decay, which helps us to make up the BNL-EBIS beamline.
Laser ion source with solenoid for Brookhaven National Laboratory-electron beam ion source
International Nuclear Information System (INIS)
Kondo, K.; Okamura, M.; Yamamoto, T.; Sekine, M.
2012-01-01
The electron beam ion source (EBIS) preinjector at Brookhaven National Laboratory (BNL) is a new heavy ion-preinjector for relativistic heavy ion collider (RHIC) and NASA Space Radiation Laboratory (NSRL). Laser ion source (LIS) is a primary ion source provider for the BNL-EBIS. LIS with solenoid at the plasma drift section can realize the low peak current (∼100 μA) with high charge (∼10 nC) which is the BNL-EBIS requirement. The gap between two solenoids does not cause serious plasma current decay, which helps us to make up the BNL-EBIS beamline.
Laser ion source with solenoid for Brookhaven National Laboratory-electron beam ion sourcea)
Kondo, K.; Yamamoto, T.; Sekine, M.; Okamura, M.
2012-02-01
The electron beam ion source (EBIS) preinjector at Brookhaven National Laboratory (BNL) is a new heavy ion-preinjector for relativistic heavy ion collider (RHIC) and NASA Space Radiation Laboratory (NSRL). Laser ion source (LIS) is a primary ion source provider for the BNL-EBIS. LIS with solenoid at the plasma drift section can realize the low peak current (˜100 μA) with high charge (˜10 nC) which is the BNL-EBIS requirement. The gap between two solenoids does not cause serious plasma current decay, which helps us to make up the BNL-EBIS beamline.
Ion-induced particle desorption in time-of-flight medium energy ion scattering
Lohmann, S.; Primetzhofer, D.
2018-05-01
Secondary ions emitted from solids upon ion impact are studied in a time-of-flight medium energy ion scattering (ToF-MEIS) set-up. In order to investigate characteristics of the emission processes and to evaluate the potential for surface and thin film analysis, experiments employing TiN and Al samples were conducted. The ejected ions exhibit a low initial kinetic energy of a few eV, thus, requiring a sufficiently high acceleration voltage for detection. Molecular and atomic ions of different charge states originating both from surface contaminations and the sample material are found, and relative yields of several species were determined. Experimental evidence that points towards a predominantly electronic sputtering process is presented. For emitted Ti target atoms an additional nuclear sputtering component is suggested.
International Nuclear Information System (INIS)
Oaks, E.; Yushkov, G.
1996-01-01
The positive ion sources are now of interest owing to both their conventional use, e.g., as injectors in charged-particle accelerators and the promising capabilities of intense ion beams in the processes related to the action of ions on various solid surfaces. For industrial use, the sources of intense ion beams and their power supplies should meet the specific requirements as follows: They should be simple, technologically effective, reliable, and relatively low-cost. Since the scanning of an intense ion beam is a complicated problem, broad ion beams hold the greatest promise. For the best use of such beams it is desirable that the ion current density be uniformly distributed over the beam cross section. The ion beam current density should be high enough for the treatment process be accomplished for an acceptable time. Thus, the ion sources used for high-current, high-dose metallurgical implantation should provide for gaining an exposure dose of ∼ 10 17 cm -2 in some tens of minutes. So the average ion current density at the surface under treatment should be over 10 -5 A/cm 2 . The upper limit of the current density depends on the admissible heating of the surface under treatment. The accelerating voltage of an ion source is dictated by its specific use; it seems to lie in the range from ∼1 kV (for the ion source used for surface sputtering) to ∼100 kV and over (for the ion sources used for high-current, high-dose metallurgical implantation)
Graphene defects induced by ion beam
Gawlik, Grzegorz; Ciepielewski, Paweł; Baranowski, Jacek; Jagielski, Jacek
2017-10-01
The CVD graphene deposited on the glass substrate was bombarded by molecular carbon ions C3+ C6+ hydrocarbon ions C3H4+ and atomic ions He+, C+, N+, Ar+, Kr+ Yb+. Size and density of ion induced defects were estimated from evolution of relative intensities of Raman lines D (∼1350 1/cm), G (∼1600 1/cm), and D‧ (∼1620 1/cm) with ion fluence. The efficiency of defect generation by atomic ions depend on ion mass and energy similarly as vacancy generation directly by ion predicted by SRIM simulations. However, efficiency of defect generation in graphene by molecular carbon ions is essentially higher than summarized efficiency of similar group of separate atomic carbon ions of the same energy that each carbon ion in a cluster. The evolution of the D/D‧ ratio of Raman lines intensities with ion fluence was observed. This effect may indicate evolution of defect nature from sp3-like at low fluence to a vacancy-like at high fluence. Observed ion graphene interactions suggest that the molecular ion interacts with graphene as single integrated object and should not be considered as a group of atomic ions with partial energy.
Frequency-scanning MALDI linear ion trap mass spectrometer for large biomolecular ion detection.
Lu, I-Chung; Lin, Jung Lee; Lai, Szu-Hsueh; Chen, Chung-Hsuan
2011-11-01
This study presents the first report on the development of a matrix-assisted laser desorption ionization (MALDI) linear ion trap mass spectrometer for large biomolecular ion detection by frequency scan. We designed, installed, and tested this radio frequency (RF) scan linear ion trap mass spectrometer and its associated electronics to dramatically extend the mass region to be detected. The RF circuit can be adjusted from 300 to 10 kHz with a set of operation amplifiers. To trap the ions produced by MALDI, a high pressure of helium buffer gas was employed to quench extra kinetic energy of the heavy ions produced by MALDI. The successful detection of the singly charged secretory immunoglobulin A ions indicates that the detectable mass-to-charge ratio (m/z) of this system can reach ~385 000 or beyond.
International Nuclear Information System (INIS)
Kunin, R.
1977-01-01
This paper presents the history and theory of ion exchange technology and discusses the usefulness of ion exchange resins which found broad applications in chemical operations. It is demonstrated that the theory of ion exchange technology seems to be moving away from the physical chemist back to the polymer chemist where it started originally. This but confronted the polymer chemists with some knotty problems. It is pointed out that one has still to learn how to use ion exchange materials as efficiently as possible in terms of the waste load that is being pumped into the environment. It is interesting to note that, whereas ion exchange is used for abating pollution, it is also a polluter. One must learn how to use ion exchange as an antipollution device, and at the same time minimize its polluting properties
Study of the negative ion extraction mechanism from a double-ion plasma in negative ion sources
International Nuclear Information System (INIS)
Goto, I.; Nishioka, S.; Hatayama, A.; Miyamoto, K.
2015-01-01
We have developed a 2D3V-PIC model of the extraction region, aiming to clarify the basic extraction mechanism of H − ions from the double-ion plasma in H − negative ion sources. The result shows the same tendency of the H − ion density n H − as that observed in the experiments, i.e.,n H − in the upstream region away from the plasma meniscus (H − emitting surface) has been reduced by applying the extraction voltage. At the same time, relatively slow temporal oscillation of the electric potential compared with the electron plasma frequency has been observed in the extraction region. Results of the systematic study using a 1D3V-PIC model with the uniform magnetic field confirm the result that the electrostatic oscillation is identified to be lower hybrid wave. The effect of this oscillation on the H − transport will be studied in the future
Study of the negative ion extraction mechanism from a double-ion plasma in negative ion sources
Energy Technology Data Exchange (ETDEWEB)
Goto, I.; Nishioka, S.; Hatayama, A. [Graduate school of Science and Technology, Keio University, 3-14-1 Hiyoshi, Kohoku-ku, Yokohama 223-8522 (Japan); Miyamoto, K. [Naruto University of Education, 748 Nakashima, Takashima, Naruto-cho, Naruto-shi, Tokushima 772-8502 (Japan)
2015-04-08
We have developed a 2D3V-PIC model of the extraction region, aiming to clarify the basic extraction mechanism of H{sup −} ions from the double-ion plasma in H{sup −} negative ion sources. The result shows the same tendency of the H{sup −} ion density n{sub H{sup −}} as that observed in the experiments, i.e.,n{sub H{sup −}} in the upstream region away from the plasma meniscus (H{sup −} emitting surface) has been reduced by applying the extraction voltage. At the same time, relatively slow temporal oscillation of the electric potential compared with the electron plasma frequency has been observed in the extraction region. Results of the systematic study using a 1D3V-PIC model with the uniform magnetic field confirm the result that the electrostatic oscillation is identified to be lower hybrid wave. The effect of this oscillation on the H{sup −} transport will be studied in the future.
Analytical applications of ion exchangers
Inczédy, J
1966-01-01
Analytical Applications of Ion Exchangers presents the laboratory use of ion-exchange resins. This book discusses the development in the analytical application of ion exchangers. Organized into 10 chapters, this book begins with an overview of the history and significance of ion exchangers for technical purposes. This text then describes the properties of ion exchangers, which are large molecular water-insoluble polyelectrolytes having a cross-linked structure that contains ionic groups. Other chapters consider the theories concerning the operation of ion-exchange resins and investigate th
Energy Technology Data Exchange (ETDEWEB)
Stupakov, G V [Stanford Linear Accelerator Center, Menlo Park, CA (United States)
1996-08-01
The ionization of residual gas by an electron beam in an accelerator generates ions that can resonantly couple to the beam through a wave propagating in the beam-ion system. Results of the study of a beam-ion instability are presented for a multi-bunch train taking into account the decoherence of ion oscillations due to the ion frequency spread and spatial variation of the ion frequency. It is shown that the combination of both effects can substantially reduce the growth rate of the instability. (author)
Cooling of molecular ion beams
International Nuclear Information System (INIS)
Wolf, A.; Krohn, S.; Kreckel, H.; Lammich, L.; Lange, M.; Strasser, D.; Grieser, M.; Schwalm, D.; Zajfman, D.
2004-01-01
An overview of the use of stored ion beams and phase space cooling (electron cooling) is given for the field of molecular physics. Emphasis is given to interactions between molecular ions and electrons studied in the electron cooler: dissociative recombination and, for internally excited molecular ions, electron-induced ro-vibrational cooling. Diagnostic methods for the transverse ion beam properties and for the internal excitation of the molecular ions are discussed, and results for phase space cooling and internal (vibrational) cooling are presented for hydrogen molecular ions
Brown, I.
2013-12-16
The vacuum arc ion source has evolved into a more or less standard laboratory tool for the production of high-current beams of metal ions, and is now used in a number of different embodiments at many laboratories around the world. Applications include primarily ion implantation for material surface modification research, and good performance has been obtained for the injection of high-current beams of heavy-metal ions, in particular uranium, into particle accelerators. As the use of the source has grown, so also have the operational characteristics been improved in a variety of different ways. Here we review the principles, design, and performance of vacuum arc ion sources.
Ion-acoustic plasma turbulence
International Nuclear Information System (INIS)
Bychenkov, V.Y.; Silin, V.P.
1982-01-01
A theory is developed of the nonlinear state that is established in a plasma as a result of development of ion-acoustic instability. Account is taken simultaneously of the linear induced scattering of the waves by the ions and of the quasilinear relaxation of the electrons by the ion-acoustic pulsations. The distribution of the ion-acoustic turbulence in frequency and in angle is obtained. An Ohm's law is established and expressions are obtained for the electronic heat flux and for the relaxation time of the electron temperature in a turbulent plasma. Anomalously large absorption and scattering of the electromagnetic waves by the ion-acoustic pulsations is predicted
International Nuclear Information System (INIS)
Tsuji, Hiroshi; Okayama, Yoshio; Toyota, Yoshitaka; Gotoh, Yasuhito; Ishikawa, Junzo; Sakai, Shigeki; Tanjyo, Masayasu; Matsuda, Kouji.
1994-01-01
Positive ion implantation has been utilized as the method of impurity injection in ultra-LSI production, but the problem of substrate charging cannot be resolved by conventional charge compensation method. It was forecast that by negative ion implantation, this charging problem can be resolved. Recently the experiment on the negative ion implantation into insulated electrodes was carried out, and the effect of negative ion implantation to this problem was proved. However, the dependence of charged potential on the increase of negative ion current at the time of negative ion implantation is a serious problem in large current negative ion implantation hereafter. The charged potential of insulated conductor substrates was measured by the negative ion implantation using the current up to several mA/cm 2 . The experimental method is explained. Medium current density and high current density negative ion implantation and charged potential are reported. Accordingly in negative ion implantation, if current density is optimized, the negative ion implantation without charging can be realized. (K.I.)
Super TOF secondary ion mass spectroscopy using very highly charged primary ions up to Th70+
International Nuclear Information System (INIS)
Briere, M.A.; Schenkel, T.; Schneider, D.
1995-01-01
The LLNL Electron Beam Ion Trap (EBIT) has made low emittance beams of slow highly charged ions available for ion-solid interaction studies. Such interactions feature the dominance of electronic over collisional effects, and the shock waves generated by the ionized target atoms can desorb large numbers of large molecular species from the surface. This paper presents the first systematic study of the sputtering process due to the incidence of slow very highly charged ions; Th 70+ ions are extracted from EBIT at 7 keV * q and directed onto thin SiO 2 films on Si. Results suggest secondary ion yields of up to 25 per incident ion for Th 70+ (secondary ion yield is increased over that for singly or moderately charged ions). Correlations of the negative, positive, and negative cluster ion yields show promise for application of highly charged ion induced sputtering for enhanced sensitivity and quantitative (absolute) SIMS analysis of deep submicron scale surface layers and polymeric and biomolecular material analysis
International Nuclear Information System (INIS)
Humphries, S. Jr.; Sudan, R.N.
1977-01-01
Methods and apparatus for producing intense megavolt ion beams are disclosed. In one embodiment, a reflex triode-type pulsed ion accelerator is described which produces ion pulses of more than 5 kiloamperes current with a peak energy of 3 MeV. In other embodiments, the device is constructed so as to focus the beam of ions for high concentration and ease of extraction, and magnetic insulation is provided to increase the efficiency of operation
International Nuclear Information System (INIS)
Kalita, B. C.; Barman, S. N.
2009-01-01
The propagation of ion-acoustic solitary waves in magnetized plasma with cold ions and ion-beams together with electron inertia has been investigated theoretically through the Korteweg-de Vries equation. Subject to the drift velocity of the ion beam, the existence of compressive solitons is found to become extinct as α (=cold ion mass/ion-beam mass) tends to 0.01 when γ=0.985 (γ is the beam velocity/phase velocity). Interestingly, a transitional direction of propagation of solitary waves has been unearthed for change over, from compressive solitons to rarefactive solitons based on α and σ υ (=cosine of the angle θ made by the wave propagation direction ξ with the direction of the magnetic field) for fixed Q(=electron mass/ion mass). Further, the direction of propagation of ion-acoustic waves is found to be the deterministic factor to admit compressive or rarefactive solitons subject to beam outsource.
Selection and design of ion sources for use at the Holifield radioactive ion beam facility
International Nuclear Information System (INIS)
Alton, G.D.; Haynes, D.L.; Mills, G.D.; Olsen, D.K.
1994-01-01
The Holifield Radioactive Ion Beam Facility now under construction at the Oak Ridge National Laboratory will use the 25 MV tandem accelerator for the acceleration of radioactive ion beams to energies appropriate for research in nuclear physics; negative ion beams are, therefore, required for injection into the tandem accelerator. Because charge exchange is an efficient means for converting initially positive ion beams to negative ion beams, both positive and negative ion sources are viable options for use at the facility. The choice of the type of ion source will depend on the overall efficiency for generating the radioactive species of interest. Although direct-extraction negative ion sources are clearly desirable, the ion formation efficiencies are often too low for practical consideration; for this situation, positive ion sources, in combination with charge exchange, are the logical choice. The high-temperature version of the CERN-ISOLDE positive ion source has been selected and a modified version of the source designed and fabricated for initial use at the facility because of its low emittance, relatively high ionization efficiencies, and species versatility, and because it has been engineered for remote installation, removal, and servicing as required for safe handling in a high-radiation-level ISOL facility. The source will be primarily used to generate ion beams from elements with intermediate to low electron affinities. Prototype plasma-sputter negative ion sources and negative surface-ionization sources are under design consideration for generating radioactive ion beams from high-electron-affinity elements. The design features of these sources and expected efficiencies and beam qualities (emittances) will be described in this report
Electrodeionization 2: the migration of nickel ions adsorbed in a flexible ion-exchange resin
Spoor, P.B.; Veen, ter W.R.; Janssen, L.J.J.
2001-01-01
The removal of nickel ions from a low cross-linked ion-exchange resin using an applied electrical potential gradient was studied. The potential gradient across a bed of ion-exchange particles, in which nickel ions were absorbed, was varied by two methods. One involved a change of cell voltage across
Ji, Yuan; Varkevisser, Rosanne; Opacic, Dragan; Bossu, Alexandre; Kuiper, Marion; Beekman, Jet D.M.; Yang, Sihyung; Khan, Azinwi Phina; Dobrev, Dobromir; Voigt, Niels; Wang, Michael Zhuo; Verheule, Sander; Vos, Marc A.; van der Heyden, Marcel A.G.
2017-01-01
Background and Purpose: The density of the inward rectifier current (IK1) increases in atrial fibrillation (AF), shortening effective refractory period and thus promoting atrial re-entry. The synthetic compound pentamidine analogue 6 (PA-6) is a selective and potent IK1 inhibitor. We tested PA-6 for
Coeckelbergh, Mark
2007-01-01
In deze presentatie onderzoek ik hoe Dewey’s moraalfilosofie kan bijdragen aan een vernieuwing van de hedendaagse ethiek door te kijken naar de rol die Dewey ziet voor verbeelding en principes in moreel redeneren. Ik toon dat zijn werk kan gebruikt worden om te argumenteren voor een omwenteling in
Towards a harmonised protection of indigenous knowledge systems ...
African Journals Online (AJOL)
This article explores the need for a policy, regional dialogue and cooperation on the protection of IKS in the Southern African Development Community (SADC). Since 2002 the SADC countries have held annual SADC programmes in the form of workshops on IKS policy development and cooperation. Steady progress has ...
Ion acoustic waves in pair-ion plasma: Linear and nonlinear analyses
International Nuclear Information System (INIS)
Saeed, R.; Mushtaq, A.
2009-01-01
Linear and nonlinear properties of low frequency ion acoustic wave (IAW) in pair-ion plasma in the presence of electrons are investigated. The dispersion relation and Kadomtsev-Petviashvili equation for linear/nonlinear IAW are derived from sets of hydrodynamic equations where the ion pairs are inertial while electrons are Boltzmannian. The dispersion curves for various concentrations of electrons are discussed and compared with experimental results. The predicted linear IAW propagates at the same frequencies as those of the experimentally observed IAW if n e0 ∼10 4 cm -3 . It is found that nonlinear profile of the ion acoustic solitary waves is significantly affected by the percentage ratio of electron number density and temperature. It is also determined that rarefactive solitary waves can propagate in this system. It is hoped that the results presented in this study would be helpful in understanding the salient features of the finite amplitude localized ion acoustic solitary pulses in a laboratory fullerene plasma.
Physical mechanisms leading to high currents of highly charged ions in laser-driven ion sources
International Nuclear Information System (INIS)
Haseroth, Helmut; Hora, Heinrich; Regensburg Inst. of Tech.
1996-01-01
Heavy ion sources for the big accelerators, for example, the LHC, require considerably more ions per pulse during a short time than the best developed classical ion source, the electron cyclotron resonance (ECR) provides; thus an alternative ion source is needed. This can be expected from laser-produced plasmas, where dramatically new types of ion generation have been observed. Experiments with rather modest lasers have confirmed operation with one million pulses of 1 Hz, and 10 11 C 4+ ions per pulse reached 2 GeV/u in the Dubna synchrotron. We review here the complexities of laser-plasma interactions to underline the unique and extraordinary possibilities that the laser ion source offers. The complexities are elaborated with respect to keV and MeV ion generation, nonlinear (ponderomotive) forces, self-focusing, resonances and ''hot'' electrons, parametric instabilities, double-layer effects, and the few ps stochastic pulsation (stuttering). Recent experiments with the laser ion source have been analyzed to distinguish between the ps and ns interaction, and it was discovered that one mechanism of highly charged ion generation is the electron impact ionization (EII) mechanism, similar to the ECR, but with so much higher plasma densities that the required very large number of ions per pulse are produced. (author)
Physical mechanisms leading to high currents of highly charged ions in laser-driven ion sources
Energy Technology Data Exchange (ETDEWEB)
Haseroth, Helmut [European Organization for Nuclear Research, Geneva (Switzerland); Hora, Heinrich [New South Wales Univ., Kensington, NSW (Australia)]|[Regensburg Inst. of Tech. (Germany). Anwenderzentrum
1996-12-31
Heavy ion sources for the big accelerators, for example, the LHC, require considerably more ions per pulse during a short time than the best developed classical ion source, the electron cyclotron resonance (ECR) provides; thus an alternative ion source is needed. This can be expected from laser-produced plasmas, where dramatically new types of ion generation have been observed. Experiments with rather modest lasers have confirmed operation with one million pulses of 1 Hz, and 10{sup 11} C{sup 4+} ions per pulse reached 2 GeV/u in the Dubna synchrotron. We review here the complexities of laser-plasma interactions to underline the unique and extraordinary possibilities that the laser ion source offers. The complexities are elaborated with respect to keV and MeV ion generation, nonlinear (ponderomotive) forces, self-focusing, resonances and ``hot`` electrons, parametric instabilities, double-layer effects, and the few ps stochastic pulsation (stuttering). Recent experiments with the laser ion source have been analyzed to distinguish between the ps and ns interaction, and it was discovered that one mechanism of highly charged ion generation is the electron impact ionization (EII) mechanism, similar to the ECR, but with so much higher plasma densities that the required very large number of ions per pulse are produced. (author).
A high-flux low-energy hydrogen ion beam using an end-Hall ion source
Veldhoven, J. van; Sligte, E. te; Janssen, J.P.B.
2016-01-01
Most ion sources that produce high-flux hydrogen ion beams perform best in the high energy range (keV). Alternatively, some plasma sources produce very-lowenergy ions (<< 10 eV). However, in an intermediate energy range of 10-200 eV, no hydrogen ion sources were found that produce high-flux beams.
Yadav, Pooja; Samadder, S R
2018-06-01
Selection of suitable municipal solid waste management (MSWM) options is one of the major challenges in urban areas of the developing countries. Success of MSWM requires accurate data of generation rate, composition and physico-chemical characteristics of solid wastes. Improper handling of solid waste can have significant environmental and aesthetical impacts. The present study proposes a new method (applicability index - P ik values) for identifying the most appropriate disposal option with the help of applicability values of Composting-C P , Incineration-I P and Landfill-L P for individual components of MSW based on the results of the physico-chemical analysis of the collected representative solid waste samples from the study area, Dhanbad, India. The mean values of moisture content, carbon, hydrogen, oxygen, nitrogen, sulfur, volatile organic carbon, fixed carbon, ash content, density and calorific values (CV) of individual components were used as input values in this process. Based on the proposed applicability index (P ik ), the highest P ik values were obtained for incineration (I P ) for plastics, polythene, paper, coconut shell, wood, cardboard, textile, thermocol (polystyrene), rubber, sugarcane bagasse, cow dung and leather wastes (I P > C P > L P ) due to high CV of these solid waste components; the highest P ik values were obtained for composting (C P ) of kitchen waste (C P > I P > L P ); and the highest P ik values for inert wastes were obtained for landfill option (L P > I P > C P ). The highest P ik value for a particular waste for a specific treatment option signifies that the waste is suitable for treatment/disposal using that option.
Zhang, Zhenxiong; Zhuang, Jianguo; Zhang, Cancan; Xu, Fadi
2013-04-01
Inhalation of isoflurane (ISO), a widely used volatile anesthetic, can produce clinical tachypnea. In dogs, this response is reportedly mediated by bronchopulmonary C-fibers (PCFs), but the relevant mechanisms remain unclear. Activation of transient A-type potassium current (IA) channels and delayed rectifier potassium current (IK) channels hyperpolarizes neurons, and inhibition of both channels by ISO increases neural firing. Due to the presence of these channels in the cell bodies of rat PCFs, we determined whether ISO could stimulate PCFs to produce tachypnea in anesthetized rats, and, if so, whether this response resulted from ISO-induced depolarization of the pulmonary C neurons via the inhibition of IA and IK. We recorded ventilatory responses to 5% ISO exposure in anesthetized rats before and after blocking PCF conduction and the responses of pulmonary C neurons (extracellularly recorded) to ISO exposure. ISO-induced (1mM) changes in pulmonary C neuron membrane potential and IA/IK were tested using the perforated patch clamp technique. We found that: (1) ISO inhalation evoked a brief tachypnea (∼7s) and that this response disappeared after blocking PCF conduction; (2) the ISO significantly elevated (by 138%) the firing rate of most pulmonary C neurons (17 out of 21) in the nodose ganglion; and (3) ISO perfusion depolarized the pulmonary C neurons in the vitro and inhibited both IA and IK, and this evoked-depolarization was largely diminished after blocking both IA and IK. Our results suggest that ISO is able to stimulate PCFs to elicit tachypnea in rats, at least partly, via inhibiting IA and IK, thereby depolarizing the pulmonary C neurons. Copyright © 2013. Published by Elsevier B.V.
Parajuli, Shankar P; Hristov, Kiril L; Soder, Rupal P; Kellett, Whitney F; Petkov, Georgi V
2013-01-01
Background and Purpose Overactive bladder (OAB) is often associated with abnormally increased detrusor smooth muscle (DSM) contractions. We used NS309, a selective and potent opener of the small or intermediate conductance Ca2+-activated K+ (SK or IK, respectively) channels, to evaluate how SK/IK channel activation modulates DSM function. Experimental Approach We employed single-cell RT-PCR, immunocytochemistry, whole cell patch-clamp in freshly isolated rat DSM cells and isometric tension recordings of isolated DSM strips to explore how the pharmacological activation of SK/IK channels with NS309 modulates DSM function. Key Results We detected SK3 but not SK1, SK2 or IK channels expression at both mRNA and protein levels by RT-PCR and immunocytochemistry in DSM single cells. NS309 (10 μM) significantly increased the whole cell SK currents and hyperpolarized DSM cell resting membrane potential. The NS309 hyperpolarizing effect was blocked by apamin, a selective SK channel inhibitor. NS309 inhibited the spontaneous phasic contraction amplitude, force, frequency, duration and tone of isolated DSM strips in a concentration-dependent manner. The inhibitory effect of NS309 on spontaneous phasic contractions was blocked by apamin but not by TRAM-34, indicating no functional role of the IK channels in rat DSM. NS309 also significantly inhibited the pharmacologically and electrical field stimulation-induced DSM contractions. Conclusions and Implications Our data reveal that SK3 channel is the main SK/IK subtype in rat DSM. Pharmacological activation of SK3 channels with NS309 decreases rat DSM cell excitability and contractility, suggesting that SK3 channels might be potential therapeutic targets to control OAB associated with detrusor overactivity. PMID:23145946
Electric force on plasma ions and the momentum of the ion-neutrals flow
Makrinich, G.; Fruchtman, A.; Zoler, D.; Boxman, R. L.
2018-05-01
The electric force on ions in plasma and the momentum flux carried by the mixed ion-neutral flow were measured and found to be equal. The experiment was performed in a direct-current gas discharge of cylindrical geometry with applied radial electric field and axial magnetic field. The unmagnetized plasma ions, neutralized by magnetized electrons, were accelerated radially outward transferring part of the gained momentum to neutrals. Measurements were taken for various argon gas flow rates between 13 and 100 Standard Cubic Centimeter per Minute, for a discharge current of 1.9 A and a magnetic field intensity of 136 G. The plasma density, electron temperature, and plasma potential were measured at various locations along the flow. These measurements were used to determine the local electric force on the ions. The total electric force on the plasma ions was then determined by integrating radially the local electric force. In parallel, the momentum flux of the mixed ion-neutral flow was determined by measuring the force exerted by the flow on a balance force meter (BFM). The maximal plasma density was between 6 × 1010 cm-3 and 5 × 1011 cm-3, the maximal electron temperature was between 8 eV and 25 eV, and the deduced maximal electric field was between 2200 V/m and 5800 V/m. The force exerted by the mixed ion-neutral flow on the BFM agreed with the total electric force on the plasma ions. This agreement showed that it is the electric force on the plasma ions that is the source of the momentum acquired by the mixed ion-neutral flow.
Effect of Coulomb collision on the negative ion extraction mechanism in negative ion sources.
Goto, I; Miyamoto, K; Nishioka, S; Mattei, S; Lettry, J; Abe, S; Hatayama, A
2016-02-01
To improve the H(-) ion beam optics, it is necessary to understand the energy relaxation process of surface produced H(-) ions in the extraction region of Cs seeded H(-) ion sources. Coulomb collisions of charged particles have been introduced to the 2D3V-PIC (two dimension in real space and three dimension in velocity space particle-in-cell) model for the H(-) extraction by using the binary collision model. Due to Coulomb collision, the lower energy part of the ion energy distribution function of H(-) ions has been greatly increased. The mean kinetic energy of the surface produced H(-) ions has been reduced to 0.65 eV from 1.5 eV. It has been suggested that the beam optics of the extracted H(-) ion beam is strongly affected by the energy relaxation process due to Coulomb collision.
Influence of Chloride-Ion Adsorption Agent on Chloride Ions in Concrete and Mortar
Directory of Open Access Journals (Sweden)
Gai-Fei Peng
2014-04-01
Full Text Available The influence of a chloride-ion adsorption agent (Cl agent in short, composed of zeolite, calcium aluminate hydrate and calcium nitrite, on the ingress of chloride ions into concrete and mortar has been experimentally studied. The permeability of concrete was measured, and the chloride ion content in mortar was tested. The experimental results reveal that the Cl agent could adsorb chloride ions effectively, which had penetrated into concrete and mortar. When the Cl agent was used at a dosage of 6% by mass of cementitious materials in mortar, the resistance to the penetration of chloride ions could be improved greatly, which was more pronounced when a combination of the Cl agent and fly ash or slag was employed. Such an effect is not the result of the low permeability of the mortar, but might be a result of the interaction between the Cl agent and the chloride ions penetrated into the mortar. There are two possible mechanisms for the interaction between the Cl agent and chloride ion ingress. One is the reaction between calcium aluminate hydrate in the Cl agent and chloride ions to form Friedel’s salt, and the other one is that calcium aluminate hydrate reacts with calcium nitrite to form AFm during the early-age hydration of mortar and later the NO2− in AFm is replaced by chloride ions, which then penetrate into the mortar, also forming Friedel’s salt. More research is needed to confirm the mechanisms.
Generation of intense, high-energy ion pulses by magnetic compression of ion rings
International Nuclear Information System (INIS)
Kapetanakos, C.A.
1981-01-01
A system based on the magnetic compression of ion rings, for generating intense (High-current), high-energy ion pulses that are guided to a target without a metallic wall or an applied external magnetic field includes a vacuum chamber; an inverse reflex tetrode for producing a hollow ion beam within the chamber; magnetic coils for producing a magnetic field, bo, along the axis of the chamber; a disc that sharpens a magnetic cusp for providing a rotational velocity to the beam and causing the beam to rotate; first and second gate coils for producing fast-rising magnetic field gates, the gates being spaced apart, each gate modifying a corresponding magnetic mirror peak (Near and far peaks) for trapping or extracting the ions from the magnetic mirror, the ions forming a ring or layer having rotational energy; a metal liner for generating by magnetic flux compression a high, time-varying magnetic field, the time-varying magnetic field progressively increasing the kinetic energy of the ions, the magnetic field from the second gate coil decreasing the far mirror peak at the end of the compression for extracting the trapped rotating ions from the confining mirror; and a disc that sharpens a magnetic half-cusp for increasing the translational velocity of the ion beam. The system utilizes the self-magnetic field of the rotating, propagating ion beam to prevent the beam from expanding radially upon extraction
Numerical investigation of depth profiling capabilities of helium and neon ions in ion microscopy
Directory of Open Access Journals (Sweden)
Patrick Philipp
2016-11-01
Full Text Available The analysis of polymers by secondary ion mass spectrometry (SIMS has been a topic of interest for many years. In recent years, the primary ion species evolved from heavy monatomic ions to cluster and massive cluster primary ions in order to preserve a maximum of organic information. The progress in less-damaging sputtering goes along with a loss in lateral resolution for 2D and 3D imaging. By contrast the development of a mass spectrometer as an add-on tool for the helium ion microscope (HIM, which uses finely focussed He+ or Ne+ beams, allows for the analysis of secondary ions and small secondary cluster ions with unprecedented lateral resolution. Irradiation induced damage and depth profiling capabilities obtained with these light rare gas species have been far less investigated than ion species used classically in SIMS. In this paper we simulated the sputtering of multi-layered polymer samples using the BCA (binary collision approximation code SD_TRIM_SP to study preferential sputtering and atomic mixing in such samples up to a fluence of 1018 ions/cm2. Results show that helium primary ions are completely inappropriate for depth profiling applications with this kind of sample materials while results for neon are similar to argon. The latter is commonly used as primary ion species in SIMS. For the two heavier species, layers separated by 10 nm can be distinguished for impact energies of a few keV. These results are encouraging for 3D imaging applications where lateral and depth information are of importance.
Development of a beam ion velocity detector for the heavy ion beam probe
International Nuclear Information System (INIS)
Fimognari, P. J.; Crowley, T. P.; Demers, D. R.
2016-01-01
In an axisymmetric plasma, the conservation of canonical angular momentum constrains heavy ion beam probe (HIBP) trajectories such that measurement of the toroidal velocity component of secondary ions provides a localized determination of the poloidal flux at the volume where they originated. We have developed a prototype detector which is designed to determine the beam angle in one dimension through the detection of ion current landing on two parallel planes of detecting elements. A set of apertures creates a pattern of ion current on wires in the first plane and solid metal plates behind them; the relative amounts detected by the wires and plates determine the angle which beam ions enter the detector, which is used to infer the toroidal velocity component. The design evolved from a series of simulations within which we modeled ion beam velocity changes due to equilibrium and fluctuating magnetic fields, along with the ion beam profile and velocity dispersion, and studied how these and characteristics such as the size, cross section, and spacing of the detector elements affect performance.
Development of a beam ion velocity detector for the heavy ion beam probe
Energy Technology Data Exchange (ETDEWEB)
Fimognari, P. J., E-mail: PJFimognari@XanthoTechnologies.com; Crowley, T. P.; Demers, D. R. [Xantho Technologies, LLC, Madison, Wisconsin 53705 (United States)
2016-11-15
In an axisymmetric plasma, the conservation of canonical angular momentum constrains heavy ion beam probe (HIBP) trajectories such that measurement of the toroidal velocity component of secondary ions provides a localized determination of the poloidal flux at the volume where they originated. We have developed a prototype detector which is designed to determine the beam angle in one dimension through the detection of ion current landing on two parallel planes of detecting elements. A set of apertures creates a pattern of ion current on wires in the first plane and solid metal plates behind them; the relative amounts detected by the wires and plates determine the angle which beam ions enter the detector, which is used to infer the toroidal velocity component. The design evolved from a series of simulations within which we modeled ion beam velocity changes due to equilibrium and fluctuating magnetic fields, along with the ion beam profile and velocity dispersion, and studied how these and characteristics such as the size, cross section, and spacing of the detector elements affect performance.
Ion optics of a high resolution multipassage mass spectrometer with electrostatic ion mirrors
Energy Technology Data Exchange (ETDEWEB)
Sakurai, T [Osaka Univ. (Japan). Dept. of Physics; Baril, M [Departement de Physique, Faculte des Sciences et de Genie, Universite Laval, Ste-Foy, Quebec G1K 7P4 (Canada)
1995-09-01
Ion trajectories in an electrostatic ion mirror are calculated. The interferences of the extended fringing fields of the mirror with finite aperture are studied. The results of the calculations are represented by three transfer matrices, which describe ion trajectories under the effects of a fringing field at the entrances, of an idealized mirror region, and of a fringing field at the exit. The focusing effects and ion-optical properties of mass spectrometers with electrostatic ion mirrors can be evaluated by using these transfer matrices. A high performance multipassage mass spectrometer is designed. The system has one magnet and four electrostatic sector analyzers and two ion mirrors. The double focusing condition and stigmatic focusing condition are achieved in any passage of the system. The mass resolution increases linearly with the number of passages in a magnet. (orig.).
Transport of heavy ions through matter within ion optical systems
International Nuclear Information System (INIS)
Schwab, T.
1991-04-01
In this thesis for the first time higher-order ion-optical calculations were connected with the whole phase-space changes of the heavy ions in passing through matter. With the developed programs and the newly proposed analytical methods atomic and nuclear interactions of the heavy ions within ion optical systems can be described realistically. The results of this thesis were applied to the conception of the fragment separator (FRS) and to the planning and preparation of experiments at the new GSI accelerator facility. Especially for the description of the ion-optical combination of FRS and the storage ring ESR the developed programs and methods proved to be necessary. A part of the applied theories on the atomic stopping could be confirmed in the framework of this thesis in an experiment with the high-resolving spectrometer SPEC at GANIL. The method of the isotopically pure separation of projectile fragments by means of magnetic analysis and the electronic energy loss could be also experimentally successfully tested at several energies (60-400 MeV/u). Furthermore in this thesis also application-related problems regarding a tumor therapy with heavy ions were solved. A concept for a medical separator (BMS) was developed, which separates light diagnosis beams isotopically purely and beyond improves the energy sharpness by means of an especially shaped (monoenergetic) stopper so that an in-situ range determination is possible with an accuracy of about one millimeter. (orig./HSI) [de
Ion thruster performance model
International Nuclear Information System (INIS)
Brophy, J.R.
1984-01-01
A model of ion thruster performance is developed for high flux density cusped magnetic field thruster designs. This model is formulated in terms of the average energy required to produce an ion in the discharge chamber plasma and the fraction of these ions that are extracted to form the beam. The direct loss of high energy (primary) electrons from the plasma to the anode is shown to have a major effect on thruster performance. The model provides simple algebraic equations enabling one to calculate the beam ion energy cost, the average discharge chamber plasma ion energy cost, the primary electron density, the primary-to-Maxwellian electron density ratio and the Maxwellian electron temperature. Experiments indicate that the model correctly predicts the variation in plasma ion energy cost for changes in propellant gas (Ar, Kr, and Xe), grid transparency to neutral atoms, beam extraction area, discharge voltage, and discharge chamber wall temperature
Mayer, Thomas; Borsdorf, Helko
2016-02-15
We optimized an atmospheric pressure ion funnel (APIF) including different interface options (pinhole, capillary, and nozzle) regarding a maximal ion transmission. Previous computer simulations consider the ion funnel itself and do not include the geometry of the following components which can considerably influence the ion transmission into the vacuum stage. Initially, a three-dimensional computer-aided design (CAD) model of our setup was created using Autodesk Inventor. This model was imported to the Autodesk Simulation CFD program where the computational fluid dynamics (CFD) were calculated. The flow field was transferred to SIMION 8.1. Investigations of ion trajectories were carried out using the SDS (statistical diffusion simulation) tool of SIMION, which allowed us to evaluate the flow regime, pressure, and temperature values that we obtained. The simulation-based optimization of different interfaces between an atmospheric pressure ion funnel and the first vacuum stage of a mass spectrometer require the consideration of fluid dynamics. The use of a Venturi nozzle ensures the highest level of transmission efficiency in comparison to capillaries or pinholes. However, the application of radiofrequency (RF) voltage and an appropriate direct current (DC) field leads to process optimization and maximum ion transfer. The nozzle does not hinder the transfer of small ions. Our high-resolution SIMION model (0.01 mm grid unit(-1) ) under consideration of fluid dynamics is generally suitable for predicting the ion transmission through an atmospheric-vacuum system for mass spectrometry and enables the optimization of operational parameters. A Venturi nozzle inserted between the ion funnel and the mass spectrometer permits maximal ion transmission. Copyright © 2015 John Wiley & Sons, Ltd. Copyright © 2015 John Wiley & Sons, Ltd.
Resolving key heavy-ion fusion target issues with relativistic heavy-ion research accelerators
International Nuclear Information System (INIS)
Arnold, R.C.
1988-01-01
Heavy-ion accelerators designed for relativistic nuclear research experiments can also be adapted for target research in heavy-ion driver inertial fusion. Needle-shaped plasmas can be created that are adequate for studying basic properties of matter at high energy density. Although the ion range is very long, the specific deposited power nevertheless increases with kinetic energy, as the focus spot can be made smaller and more ions can be accumulated in larger rings
International Nuclear Information System (INIS)
Lettry, J.; Penescu, L.; Wallner, J.; Sargsyan, E.
2010-01-01
The MedAustron Ion therapy center will be constructed in Wiener Neustadt (Austria) in the vicinity of Vienna. Its accelerator complex consists of four ion sources, a linear accelerator, a synchrotron, and a beam delivery system to the three medical treatment rooms and to the research irradiation room. The ion sources shall deliver beams of H 3 1+ , C 4+ , and light ions with utmost reliability and stability. This paper describes the features of the ion sources presently planned for the MedAustron facility, such as ion source main parameters, gas injection, temperature control, and cooling systems. A dedicated beam diagnostics technique is proposed in order to characterize electron cyclotron resonance (ECR) ion beams; in the first drift region after the ion source, a fraction of the mixed beam is selected via moveable aperture. With standard beam diagnostics, we then aim to produce position-dependant observables such as ion-current density, beam energy distribution, and emittance for each charge states to be compared to simulations of ECR e-heating, plasma simulation, beam formation, and transport.
Directory of Open Access Journals (Sweden)
Jürgen Jaspers
2014-10-01
Full Text Available Despite the fact that linguistic contact phenomena have been observed in various cities across the Netherlands and Flanders, it may be imprudent to label these phenomena with names such as Murks, straattaal and recently Illegaals. We argue that these labels, in particular Illegaals, so far have functioned as floating signifiers that are variably attributed to a wide range of different linguistic targets such as imitations of accented Dutch, learner Dutch or even competent fluent Dutch. We suggest that these signifiers donot so much hint at the existence of new separate urban varieties of language, but rather offer clues for how speakers navigate linguistic complexity and difference in contemporary cities, and what language use may come to be seen as normal, attractive and worth pursuing in the future.
Kinetic plasma simulation of ion beam extraction from an ECR ion source
International Nuclear Information System (INIS)
Elliott, S.M.; White, E.K.; Simkin, J.
2012-01-01
Designing optimized ECR (electron cyclotron resonance) ion beam sources can be streamlined by the accurate simulation of beam optical properties in order to predict ion extraction behavior. The complexity of these models, however, can make PIC-based simulations time-consuming. In this paper, we first describe a simple kinetic plasma finite element simulation of extraction of a proton beam from a permanent magnet hexapole ECR ion source. Second, we analyze the influence of secondary electrons generated by ion collisions in the residual gas on the space charge of a proton beam of a dual-solenoid ECR ion source. The finite element method (FEM) offers a fast modeling environment, allowing analysis of ion beam behavior under conditions of varying current density, electrode potential, and gas pressure. The new version of SCALA/TOSCA v14 permits the making of simulations in tens of minutes to a few hours on standard computer platforms without the need of particle-in-cell methods. The paper is followed by the slides of the presentation. (authors)
Trapping behaviour of deuterium ions implanted into tungsten simultaneously with carbon ions
International Nuclear Information System (INIS)
Kobayashi, Makoto; Suzuki, Sachiko; Wang, Wanjing; Kurata, Rie; Kida, Katsuya; Oya, Yasuhisa; Okuno, Kenji; Ashikawa, Naoko; Sagara, Akio; Yoshida, Naoaki
2009-01-01
The trapping behaviour of deuterium ions implanted into tungsten simultaneously with carbon ions was investigated by thermal desorption spectroscopy (TDS) and x-ray photoelectron spectroscopy (XPS). The D 2 TDS spectrum consisted of three desorption stages, namely desorption of deuterium trapped by intrinsic defects, ion-induced defects and carbon with the formation of the C-D bond. Although the deuterium retention trapped by intrinsic defects was almost constant, that by ion-induced defects increased as the ion fluence increased. The retention of deuterium with the formation of the C-D bond was saturated at an ion fluence of 0.5x10 22 D + m -2 , where the major process was changed from the sputtering of tungsten with the formation of a W-C mixture to the formation of a C-C layer, and deuterium retention as the C-D bond decreased. It was concluded that the C-C layer would enhance the chemical sputtering of carbon with deuterium with the formation of CD x and the chemical state of carbon would control the deuterium retention in tungsten under C + -D 2 + implantation.
Treatment of Soil Decontamination Solution by the Cs{sup +} Ion Selective Ion Exchange Resin
Energy Technology Data Exchange (ETDEWEB)
Won, Hui Jun; Kim, Gye Nam; Jung, Chung Hun; Oh, Won Zin [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
2005-07-01
Occasionally, radioactively contaminated soils have been excavated and stored at the temporary storage facility. Cesium as a radionuclide is one of the most toxic elements and it has a long half decay life. During the operation of nuclear facility, soils near the facility would be contaminated with radioactive cesium and it will cause the deleterious effect to human body and environment. In this study, Cs{sup +} ion selective ion exchange resin was prepared by changing the functional group of commercial anion exchange resin for a ferrocyanide ion. Ion exchange capability of using the soil decontamination solution was investigated. We also performed the feasibility test of recycling the spent Cs ion selective ion exchange resin.
Modification of graphene by ion beam
Gawlik, G.; Ciepielewski, P.; Jagielski, J.; Baranowski, J.
2017-09-01
Ion induced defect generation in graphene was analyzed using Raman spectroscopy. A single layer graphene membrane produced by chemical vapor deposition (CVD) on copper foil and then transferred on glass substrate was subjected to helium, carbon, nitrogen, argon and krypton ions bombardment at energies from the range 25 keV to 100 keV. A density of ion induced defects and theirs mean size were estimated by using Raman measurements. Increasing number of defects generated by ion with increase of ion mass and decrease of ion energy was observed. Dependence of ion defect efficiency (defects/ion) on ion mass end energy was proportional to nuclear stopping power simulated by SRIM. No correlation between ion defect efficiency and electronic stopping power was observed.
Kluge, Heinz-Jürgen
2004-01-01
Trapping devices for atomic and nuclear physics experiments with radioactive ions are becoming more and more important at accelerator facilities. While about ten years ago only one online Penning trap experiment existed, namely ISOLTRAP at ISOLDE/CERN, meanwhile almost every radioactive beam facility has installed or plans an ion trap setup. This article gives an overview on ion traps in the operation, construction or planing phase which will be used for fundamental studies with short-lived radioactive nuclides such as mass spectrometry, laser spectroscopy and nuclear decay spectroscopy. In addition, this article summarizes the use of gas cells and radiofrequency quadrupole (Paul) traps at different facilities as a versatile tool for ion beam manipulation like retardation, cooling, bunching, and cleaning.