
Sample records for iodine 141

  1. Iodine (United States)

    ... Health Information Supplement Fact Sheets Frequently Asked Questions Making Decisions What you Need To Know About Supplements Dietary ... mild iodine deficiency and of iodine supplements on cognitive ... breasts. It mainly affects women of reproductive age but can also occur ...

  2. Iodine (United States)

    ... leg ulcers and reduce the chance of a future infection. Conjunctivitis (pinkeye). Research suggests that using eye ... National Institute of Medicine has set Adequate Intake (AI) of iodine for infants: 0 to 6 months, ...

  3. Iodine Deficiency (United States)

    ... Fax/Phone Home » Iodine Deficiency Leer en Español Iodine Deficiency Iodine is an element that is needed ... world’s population remains at risk for iodine deficiency. Iodine Deficiency FAQs WHAT IS THE THYROID GLAND? The ...

  4. Iodine volatility

    International Nuclear Information System (INIS)

    Beahm, E.C.; Shockley, W.E.


    The ultimate aim of this program is to couple experimental aqueous iodine volatilities to a fission product release model. Iodine partition coefficients, for inorganic iodine, have been measured during hydrolysis and radiolysis. The hydrolysis experiments have illustrated the importance of reaction time on iodine volatility. However, radiolysis effects can override hydrolysis in determining iodine volatility. In addition, silver metal in radiolysis samples can react to form silver iodide accompanied by a decrease in iodine volatility. Experimental data are now being coupled to an iodine transport and release model that was developed in the Federal Republic of Germany

  5. Iodine Deficiency

    NARCIS (Netherlands)

    Zimmermann, M.B.


    Iodine deficiency has multiple adverse effects in humans, termed iodine deficiency disorders, due to inadequate thyroid hormone production. Globally, it is estimated that 2 billion individuals have an insufficient iodine intake, and South Asia and sub-Saharan Africa are particularly affected.

  6. Radionuclide Basics: Iodine (United States)

    ... Centers Radiation Protection Contact Us Share Radionuclide Basics: Iodine Iodine (chemical symbol I) is a chemical element. ... in the environment Iodine sources Iodine and health Iodine in the Environment All 37 isotopes of iodine ...

  7. Risk of suboptimal iodine intake in pregnant Norwegian women. (United States)

    Brantsæter, Anne Lise; Abel, Marianne Hope; Haugen, Margaretha; Meltzer, Helle Margrete


    Pregnant women and infants are exceptionally vulnerable to iodine deficiency. The aims of the present study were to estimate iodine intake, to investigate sources of iodine, to identify predictors of low or suboptimal iodine intake (defined as intakes below 100 μg/day and 150 μg/day) in a large population of pregnant Norwegian women and to evaluate iodine status in a sub-population. Iodine intake was calculated based on a validated Food Frequency Questionnaire in the Norwegian Mother and Child Cohort. The median iodine intake was 141 μg/day from food and 166 μg/day from food and supplements. Use of iodine-containing supplements was reported by 31.6%. The main source of iodine from food was dairy products, contributing 67% and 43% in non-supplement and iodine-supplement users, respectively. Of 61,904 women, 16.1% had iodine intake below 100 μg/day, 42.0% had iodine intake below 150 μg/day and only 21.7% reached the WHO/UNICEF/ICCIDD recommendation of 250 μg/day. Dietary behaviors associated with increased risk of low and suboptimal iodine intake were: no use of iodine-containing supplements and low intake of milk/yogurt, seafood and eggs. The median urinary iodine concentration measured in 119 participants (69 μg/L) confirmed insufficient iodine intake. Public health strategies are needed to improve and secure the iodine status of pregnant women in Norway.

  8. Iodinated bleomycin

    International Nuclear Information System (INIS)

    Lunghi, F.; Riva, P.; Assone, F.; Villa, M.; Plassic, G.


    Bleomycin was labelled with iodine-131 by the iodine monochloride method. Iodination did not alter the chemical and chromatographic features and ''in vitro'' stability studies on freeze-dried 131 I-Bleomycin having a specific activity of 1 mCi/mg, stored at different temperatures, showed no appreciable variation of the free-iodine content. Tissue distribution of 131 I-Bleomycin has been evaluated in tumor bearing rats. Patients have been injected with 0.5-1.0 mCi of 131 I-Bleomycin corresponding to a maximum of 1.5 mg. No adverse reactions have been observed. Total body scans have been performed at 2, 6, 24 and 48 hours after injection. The iodinated Bleomycin was rapidly distributed and cleared from the body and showed an early uptake in the neoplastic tissue. A diagnostic accuracy of 90% has been observed in malignant deseases, while no false positive results have been, at the moment, recorded. (author)

  9. Iodine poisoning (United States)

    ... Iodine is also used during the production of methamphetamine. Note: This list may not be all inclusive. ... breathing machine (ventilator) Blood and urine tests Chest x-ray EKG (electrocardiogram, or heart tracing) Fluids through a ...

  10. Iodine in diet (United States)

    Diet - iodine ... Many months of iodine deficiency in a person's diet may cause goiter or hypothyroidism . Without enough iodine, ... and older children. Getting enough iodine in the diet may prevent a form of physical and intellectual ...

  11. Iodine Satellite (United States)

    Kamhawi, Hani; Dankanich, John; Martinez, Andres; Petro, Andrew


    The Iodine Satellite (iSat) spacecraft will be the first CubeSat to demonstrate high change in velocity from a primary propulsion system by using Hall thruster technology and iodine as a propellant. The mission will demonstrate CubeSat maneuverability, including plane change, altitude change and change in its closest approach to Earth to ensure atmospheric reentry in less than 90 days. The mission is planned for launch in fall 2017. Hall thruster technology is a type of electric propulsion. Electric propulsion uses electricity, typically from solar panels, to accelerate the propellant. Electric propulsion can accelerate propellant to 10 times higher velocities than traditional chemical propulsion systems, which significantly increases fuel efficiency. To enable the success of the propulsion subsystem, iSat will also demonstrate power management and thermal control capabilities well beyond the current state-of-the-art for spacecraft of its size. This technology is a viable primary propulsion system that can be used on small satellites ranging from about 22 pounds (10 kilograms) to more than 1,000 pounds (450 kilograms). iSat's fuel efficiency is ten times greater and its propulsion per volume is 100 times greater than current cold-gas systems and three times better than the same system operating on xenon. iSat's iodine propulsion system consists of a 200 watt (W) Hall thruster, a cathode, a tank to store solid iodine, a power processing unit (PPU) and the feed system to supply the iodine. This propulsion system is based on a 200 W Hall thruster developed by Busek Co. Inc., which was previously flown using xenon as the propellant. Several improvements have been made to the original system to include a compact PPU, targeting greater than 80 percent reduction in mass and volume of conventional PPU designs. The cathode technology is planned to enable heaterless cathode conditioning, significantly increasing total system efficiency. The feed system has been designed to

  12. Datablock: hd141

    Indian Academy of Sciences (India)


    Jan 15, 2016 ... checkCIF/PLATON page 2 1/3. checkCIF (basic structural check) running. checkCIF/PLATON (basic structural check). Structure factors have been supplied for datablock(s) hd141. THIS REPORT IS FOR GUIDANCE ONLY. IF USED AS PART OF A REVIEW.

  13. Iodine and Pregnancy


    Yarrington, Christina; Pearce, Elizabeth N.


    Iodine is a necessary element for the production of thyroid hormone. We will review the impact of dietary iodine status on thyroid function in pregnancy. We will discuss iodine metabolism, homeostasis, and nutritional recommendations for pregnancy. We will also discuss the possible effects of environmental contaminants on iodine utilization in pregnant women.

  14. Iodine intake in Denmark

    International Nuclear Information System (INIS)

    Pedersen, K.M.; Noehr, S.B.; Laurberg, P.


    Iodine deficiency with a high frequency of goitre and, in severely affected areas, cretinism is common in some areas of the world. In Denmark the iodine intake as evaluated by urinary iodine excretion has been at a stable low level for many years, except for the part of the population now taking iodine supplementation as part of vitamin/mineral preparations. The iodine intake is lowest in the western part to the country where an epidemiological study of elderly subjects has demonstrated a high frequency of goitre and hyperthyroidism in women. This supports the suggestion of a controlled moderate increase in iodine intake via an iodine supplementation program. (au) 40 refs

  15. Iodine intake in Ireland

    International Nuclear Information System (INIS)

    Smith, P.P.A.; Hetherton, A.M.; O'Carroll, D.; Smith, D.F.; O'Halloran, M.J.; O'Donovan, D.K.


    A study of urinary iodine excretion and thyroid gland uptake of radioactive iodine 131 I was undertaken in the Dublin area with a view to providing data on the current iodine status in Ireland. A mean urinary iodine excretion of 118±82μg/gram creatinine (Median 96) obtained from 821 subjects attending general hospital outpatient clinics in the Dublin area in 1987, while excluding severe iodine deficiency in this particular cohort, obscured the fact that 250 (30%) had iodine excretion values ≤70 μ/g creatinine, a value approximating to the minimum daily iodine requirement. The results provide sufficient evidence of sporadic iodine deficiency to justify a more widespread study of the iodine status of the Irish population with a view to making recommendations on the possible need for iodine prophylaxis

  16. Radioactive Iodine Treatment for Hyperthyroidism (United States)

    ... Balance › Radioactive Iodine for Hyperthyroidism Fact Sheet Radioactive Iodine for Hyperthyroidism April, 2012 Download PDFs English Zulu ... prepare for RAI or surgery. How does radioactive iodine treatment work? Iodine is important for making thyroid ...

  17. Iodine and thyroid function

    Directory of Open Access Journals (Sweden)

    Hye Rim Chung


    Full Text Available Severe iodine deficiency causes hypothyroidism that results in impaired somatic growth and motor development in children. Mild and moderate iodine deficiencies cause multifocal autonomous growth of thyroid, which results in thyrotoxicosis. On the other hand, iodine excess is associated with the development of hypothyroidism and thyroid autoimmunity. In areas of iodine deficiency, a sudden increase in iodine intake is associated with transient hyperthyroidism. Recent studies demonstrated that long-term thyroid function of subjects who experienced both iodine deficiency and iodine excess during childhood tended to be abnormal despite optimization of their current iodine intake. Iodine status in the Korean Peninsula is very unique because people in the Republic of Korea have been shown to have predominantly excessive iodine levels, whereas the Democratic People's Republic of Korea is known to be an iodine-deficient area. Further research is warranted to verify the optimal ranges of iodine intake and to clarify the effects of iodine intake on thyroid disorders in the Korean Peninsula.

  18. Iodination of phenol

    International Nuclear Information System (INIS)

    Christiansen, J.V.; Feldthus, A.; Carlsen, L.


    Phenol is iodinated in aqueous solution at pH 5 (acetate buffer) by elemental iodine or, if the iodine is present as iodide, enzymatically controlled by peroxidases. Generally mono-, di- and triiodophenols are obtained, the overall product composition being virtually identical for the two iodination modes. However, there is a tendency to a higher para to ortho ratio for the enzymatically controlled reaction. The mutual ratios of the single iodophenols depends on the initial concentration ratio between phenol and the iodinating species. The first step in the iodination leads preferentially to substitution in the ortho position rather than in the para position in contract to e.g. the corresponding bromination. The relative rates of the competive reactions in the combined iodination scheme has been derived. (author) 2 tabs., 3 ills., 15 refs

  19. Iodine deficiency and iodine excess in Jiangsu Province, China

    NARCIS (Netherlands)

    Zhao, J.


    iodine deficiency, iodine excess, endemic goiter, drinking water, iodine intake, thyroid function, thyroid size, iodized salt, iodized oil, IQ, physical development, hearing capacity, epidemiology, meta-analysis, IDD, randomized trial, intervention, USA, Bangladesh,

  20. Iodine deficiency disorders

    Energy Technology Data Exchange (ETDEWEB)

    Ali, S M [Pakistan Council for Science and Technology, Islamabad (Pakistan)


    Iodine deficiency (IDD) is one of the common problem in the diet. Iodine deficiency as prevalence of goiter in population occurs in the mountainous areas. There is consensus that 800 million people are at risk of IDD from living in iodine deficient area and 190 million from goiter. Very high prevalence of IDD in different parts of the world are striking. It has generally observed that in iodine-deficient areas about 50% are affected with goiter, 1-5% from cretinsim and 20% from impaired mental and/or mortor function. (A.B.).

  1. Marine geochemistry of iodine

    International Nuclear Information System (INIS)

    Kennedy, H.; Elderfield, H.


    Iodine has long been classified as a biophilic element with analyses showing that iodine is strongly enriched, relative to seawater concentrations in both plankton and particulate matter and that the concentration of iodine found in surface sediments is still further enriched relative to that found in the sedimenting particulate matter. The extent of enrichment of iodine relative to carbon in deep sea surface sediments has been shown to depend on the carbon accumulation rate. Iodine decomposition rates have been calculated and are shown to vary with the sedimentation rate in the same manner as has been shown for organic carbon. Vertical profiles of total dissolved iodine, iodate and iodide in interstitial waters of sediments from the north east Atlantic are characterised by three zones of reaction as identified by changes in the concentration of iodate and iodide. These reaction zones represent (i) iodide production (ii) iodide oxidation and (iii) iodate reduction. Pore water and solid phase iodine profiles from cores containing turbidite units have shown that iodine, released to pore waters as iodide during the oxidation of the organic matter, has been scavenged after diffusing upwards into a less reducing region of the sediment. (author)

  2. The iodine reactivity

    International Nuclear Information System (INIS)


    The iodine is an important element because it has long life isotopes (such as iodine 129) and a great mobility in natural media. Iodine presents a complex chemistry because of its volatility and its strong redox reactivity. The S.E.C.R. works to better understand the reactivity of this element in different natural, industrial or biological environments. It plays a part in thermochemical sites as a possible way of hydrogen formation. This seminar gives some aspects relative to the chemical reactivity of iodine, since its thermochemistry in the I/S cycles to produce hydrogen to its reactivity in the natural medium and its potential radiological impact. This document includes 4 presentations transparencies) dealing with: the 129 I cycle rejected in the low radioactive gaseous and liquid effluents of the La Hague reprocessing plant (C. Frechou); a bibliographic review of iodine retention in soils (F. Bazer-Bachi); the hydrogen production and the iodine/sulfur thermochemical cycle (role of iodine in the process); and the direct characterization by electro-spray ionization mass spectroscopy of iodine fixation by fulvic acids (P. Reiller, B. Amekraz, C. Moulin, V. Moulin)

  3. Iodine-deficiency disorders

    NARCIS (Netherlands)

    Zimmermann, M.B.; Jooste, P.L.; Pandav, C.S.


    billion individuals worldwide have insufficient iodine intake, with those in south Asia and sub-Saharan Africa particularly affected. Iodine deficiency has many adverse effects on growth and development. These effects are due to inadequate production of thyroid hormone and are termed

  4. Iodine mineral waters

    Directory of Open Access Journals (Sweden)

    Iluta Alexandru


    Full Text Available Iodine mineral waters are found especially in sub-Carpathian region, also in regions with Salif deposits. Waters are currently used iodine in drinking cure for chaps and Basedow. Are also indicated in balneology. Iodine water containing at least 1 mg L, there is pure iodine is usually given the nature of other types of mineral waters further: sodium chlorinated water (Bazna (50-70 mg iodine / l, Baile Govora (50 - 70 mg / l, Bălţăteşti (4-5 mg / l, salted Monteoru (30 mg / l, mine water mixed alkaline chlorination, sulphate, which are indicated for crenoterapie (hypo or isotonic to the bathrooms Olăneşti or Călimăneşti-Căciulata.

  5. Iodine leaflets in chapter D5 'Distribution of iodine pills'

    International Nuclear Information System (INIS)


    Jodine leaflet A will be distributed together with iodine pills in a nuclear disaster. Iodine leaflet B is suitable for informing the public in advance. Iodine leaflet C informs physicians in a scientific way on the benefits and risk of iodine pills. (orig./HP) [de

  6. Iodine generator for reclaimed water purification (United States)

    Wynveen, R. A.; Powell, J. D.; Schubert, F. H. (Inventor)


    The system disclosed is for controlling the iodine level in a water supply in a spacecraft. It includes an iodine accumulator which stores crystalline iodine, an electrochemical valve to control the input of iodine to the drinking water and an iodine dispenser. A pump dispenses fluid through the iodine dispenser and an iodine sensor to a potable water tank storage. The iodine sensor electronically detects the iodine level in the water, and through electronic means, produces a correction current control. The correction current control operates the electro-chemical iodine valve to release iodine from the iodine accumulator into the iodine dispenser.

  7. 40 CFR 141.700 - General requirements. (United States)


    ... described in §§ 141.721 through 141.722. (7) Systems must address significant deficiencies identified in... 40 Protection of Environment 22 2010-07-01 2010-07-01 false General requirements. 141.700 Section 141.700 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS...

  8. 40 CFR 141.89 - Analytical methods. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods. 141.89 Section 141...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Control of Lead and Copper § 141.89 Analytical methods. (a... shall be conducted with the methods in § 141.23(k)(1). (1) Analyses for alkalinity, calcium...

  9. Is placental iodine content related to dietary iodine intake?

    LENUS (Irish Health Repository)

    Burns, R


    Delivery of iodine to the foetus depends not only on maternal dietary iodine intake but also on the presence of a functioning placental transport system. A role for the placenta as an iodine storage organ has been suggested, and this study compares the iodine content of placentas from women giving birth at term in Ireland and Iran, areas with median urinary iodine of 79 and 206 μg\\/l respectively.

  10. Iodine in meat in Macedonia

    International Nuclear Information System (INIS)

    Bogdanov, Bogdan; Gonev, Mihajlo; Tadzher, Isak


    Iodine deficiency in Macedonia still persists in a mild form. In 1999 the iodination of salt rose to 20 m gr iodine in Kg salt. The consumption of salt diminished after the last war from 20-30 gr salt per day to 10-20 gr salt daily. This shows that the problem of the elimination of iodine deficiency is being vigorously tackled. Since 1956 the iodine in salt in Macedonia rose to 10 m gr KI/Kg salt. The content of iodine in the Macedonian diet seems to be important. The amount of iodine in milk, eggs and bread is low as found by the investigation of MANU. The content of iodine in meat is low, compared to British meat is 10 times lower. The average iodine content in Macedonian meat is 95.15 micro gr per Kg, whereas in British meat it is 850-1510 micro gr iodine per k gr meat. (Original)

  11. Controversies in urinary iodine determinations


    Soldin, Offie Porat


    Iodine deficiency (ID) is associated with increased prevalence of goiter, increased risk for neurodevelopmental disorders, and is the world’s leading cause of intellectual deficits. Iodine nutritional status of a population is assessed by measurements of urinary iodine concentrations which are also used to define, indicate, survey and monitor iodine deficiency and consequently its treatment. Several methods are available for urinary iodine determination. Discussed here are some of the limitat...

  12. Electrochemistry of iodine

    Energy Technology Data Exchange (ETDEWEB)

    Yaraliev, Ya.A. (AN Azerbajdzhanskoj SSR, Baku. Inst. Neorganicheskoj i Fizicheskoj Khimii)


    The review is devoted to investigations into oxidation-reduction processes in different systems including iodine. The data on adsorption of iodine on metals are discussed; the connection between the nature of iodine adsorption and the mechanism of its electrode reactions is considered. The metals studied can be placed in the following series taking into account the degree of I sorption on them: Cd approximately Tl < Sn approximately Pb < Ga < Bi < Hg < Co approximately Ni < Fe < Ag approximately Rh approximately Pd approximately Ir < Pt. The data are given of standard and equilibrium potentials in iodine systems. Electric oxidation and electric reduction of iodide ions is investigated using the methods of Faraday impedance and rectification, methods of voltamperometry and oscillopolarography, rotating disc electrode, chronopotentiometry. Anode and cathode processes of oxidation-reduction reactions in I/sup -//IO/sub 3//sup -/, I/sub 2//IO/sub 3//sup -/ and I/sub 2//I/sup +/ systems are analyzed.

  13. Iodine Hall Thruster (United States)

    Szabo, James


    Iodine enables dramatic mass and cost savings for lunar and Mars cargo missions, including Earth escape and near-Earth space maneuvers. The demonstrated throttling ability of iodine is important for a singular thruster that might be called upon to propel a spacecraft from Earth to Mars or Venus. The ability to throttle efficiently is even more important for missions beyond Mars. In the Phase I project, Busek Company, Inc., tested an existing Hall thruster, the BHT-8000, on iodine propellant. The thruster was fed by a high-flow iodine feed system and supported by an existing Busek hollow cathode flowing xenon gas. The Phase I propellant feed system was evolved from a previously demonstrated laboratory feed system. Throttling of the thruster between 2 and 11 kW at 200 to 600 V was demonstrated. Testing showed that the efficiency of iodine fueled BHT-8000 is the same as with xenon, with iodine delivering a slightly higher thrust-to-power (T/P) ratio. In Phase II, a complete iodine-fueled system was developed, including the thruster, hollow cathode, and iodine propellant feed system. The nominal power of the Phase II system is 8 kW; however, it can be deeply throttled as well as clustered to much higher power levels. The technology also can be scaled to greater than 100 kW per thruster to support megawatt-class missions. The target thruster efficiency for the full-scale system is 65 percent at high specific impulse (Isp) (approximately 3,000 s) and 60 percent at high thrust (Isp approximately 2,000 s).

  14. Iodine deficiency and thyroid disorders. (United States)

    Zimmermann, Michael B; Boelaert, Kristien


    Iodine deficiency early in life impairs cognition and growth, but iodine status is also a key determinant of thyroid disorders in adults. Severe iodine deficiency causes goitre and hypothyroidism because, despite an increase in thyroid activity to maximise iodine uptake and recycling in this setting, iodine concentrations are still too low to enable production of thyroid hormone. In mild-to-moderate iodine deficiency, increased thyroid activity can compensate for low iodine intake and maintain euthyroidism in most individuals, but at a price: chronic thyroid stimulation results in an increase in the prevalence of toxic nodular goitre and hyperthyroidism in populations. This high prevalence of nodular autonomy usually results in a further increase in the prevalence of hyperthyroidism if iodine intake is subsequently increased by salt iodisation. However, this increase is transient because iodine sufficiency normalises thyroid activity which, in the long term, reduces nodular autonomy. Increased iodine intake in an iodine-deficient population is associated with a small increase in the prevalence of subclinical hypothyroidism and thyroid autoimmunity; whether these increases are also transient is unclear. Variations in population iodine intake do not affect risk for Graves' disease or thyroid cancer, but correction of iodine deficiency might shift thyroid cancer subtypes toward less malignant forms. Thus, optimisation of population iodine intake is an important component of preventive health care to reduce the prevalence of thyroid disorders. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. 14 CFR 1264.141 - Judicial review. (United States)


    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1264.141 Section 1264.141... PENALTIES ACT OF 1986 § 1264.141 Judicial review. Section 3805 of Title 31, United States Code, authorizes judicial review by an appropriate United States District Court of a final decision of the authority head...

  16. 40 CFR 141.70 - General requirements. (United States)


    ...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.70 General requirements. (a... regulations establish criteria under which filtration is required as a treatment technique for public water... filtration requirements in § 141.73 and the disinfection requirements in § 141.72(b). (c) Each public water...

  17. 47 CFR 101.141 - Microwave modulation. (United States)


    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Microwave modulation. 101.141 Section 101.141... SERVICES Technical Standards § 101.141 Microwave modulation. (a) Microwave transmitters employing digital modulation techniques and operating below 25.25 GHz (except for MVDDS stations in the 12,200-12,700 MHz band...

  18. 40 CFR 141.76 - Recycle provisions. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Recycle provisions. 141.76 Section 141...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.76 Recycle provisions. (a... recycle spent filter backwash water, thickener supernatant, or liquids from dewatering processes must meet...

  19. 25 CFR 141.16 - Price marking. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Price marking. 141.16 Section 141.16 Indians BUREAU OF... AND ZUNI RESERVATIONS General Business Practices § 141.16 Price marking. The price of each article... visible to the customer and that affords the customer a reasonable opportunity to learn the price of the...

  20. 22 CFR 141.5 - Compliance information. (United States)


    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compliance information. 141.5 Section 141.5... DEPARTMENT OF STATE-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 141.5 Compliance information... such information, as a responsible Departmental official or his designee may determine to be necessary...

  1. 14 CFR 141.23 - Advertising limitations. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Advertising limitations. 141.23 Section 141...) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS General § 141.23 Advertising limitations. (a) The... certificate may not advertise that the school is certificated unless it clearly differentiates between courses...

  2. 10 CFR 63.141 - Scope. (United States)


    ... 10 Energy 2 2010-01-01 2010-01-01 false Scope. 63.141 Section 63.141 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) DISPOSAL OF HIGH-LEVEL RADIOACTIVE WASTES IN A GEOLOGIC REPOSITORY AT YUCCA MOUNTAIN, NEVADA Quality Assurance § 63.141 Scope. As used in this part, quality assurance comprises all those...

  3. 19 CFR 141.88 - Computed value. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Computed value. 141.88 Section 141.88 Customs... (CONTINUED) ENTRY OF MERCHANDISE Invoices § 141.88 Computed value. When the port director determines that information as to computed value is necessary in the appraisement of any class or kind of merchandise, he...

  4. 14 CFR 141.91 - Satellite bases. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Satellite bases. 141.91 Section 141.91... OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Operating Rules § 141.91 Satellite bases. The holder of a... assistant chief instructor is designated for each satellite base, and that assistant chief instructor is...

  5. 18 CFR 284.141 - Applicability. (United States)


    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Applicability. 284.141 Section 284.141 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... Certain Sales by Intrastate Pipelines § 284.141 Applicability. This subpart implements section 311(b) of...

  6. Volatilization of iodine from vegetation

    International Nuclear Information System (INIS)

    Amiro, B.D.; Johnston, F.L.


    Gaseous emissions of iodine were measured from bean plant foliage. A gamma-emitting iodine tracer, Na 125 I, was taken up by the plants from a hydroponic growth medium and released to a cuvette atmosphere. The dynamics of the flux were studied using a flow-through gamma detector. The relationship between leaf radioactive tracer activity and growth-medium activity was linear, as was the relationship between the iodine flux and both leaf and growth-medium activity. Iodine flux and leaf conductance to water responded similarly to changes in light levels, suggesting that the stomata may partially control the flux. The flux was inhibited by aeration of the hydroponic growth media, and we postulate that methylation causes the iodine flux. Iodine emissions from living vegetation probably contribute < 0.1% to the stable iodine concentration in the atmosphere above terrestrial areas. However, this pathway may be a direct route for radioactive iodine transport from contaminated soils to the atmosphere. (author)

  7. Radioactive iodine intake through foodstuff

    International Nuclear Information System (INIS)

    Omomo, Yoichiro


    The transition of radioactive iodine to human bodies is affected by the amount of coexisting stable iodine. The intake of stable iodine through foodstuffs was studied from the stand point of I) discussion of the literature which states the approximate amounts of stable iodine contained in environmental materials, and II) the authors' research on the consumption of foodstuffs. For example, the amounts of iodine intake of fishermen living in Kuji-cho (Ibaragi Prefecture) was estimated from I and II, and was revealed as 2704p. The national average iodine intake was about 800p indicating that the former estimated value was remarkably high. Eighty Four per cent of the 2.7 mg iodine intake was taken from marine products, indicating that marine products are important sources of iodine supply. (Tsukamoto, Y.)

  8. Mock iodine-125 radiation source

    International Nuclear Information System (INIS)

    Coffey, D.L.


    An intimate mixture of americium-241 and iodine-129 provides an energy spectrum that reliably simulates the spectrum of iodine-125 in a well-type detector. As such, it may be used as a long-lived standard to calibrate instruments such as well scintillation spectrometers in which measurements are to be made involving iodine-125

  9. Iodine in soil

    International Nuclear Information System (INIS)

    Johanson, Karl Johan


    A literature study of the migration and the appearance of iodine isotopes in the bio-sphere particularly in soil is presented. Some important papers in the field of iodine appearance in soil and the appearance of 129 I in the surroundings of reprocessing plants are discussed. The most important conclusions are: 1. Iodine binds to organic matter in the soil and also to some oxides of aluminium and iron. 2. If the iodine is not bound to the soil a large fraction of added 129 I is volatilized after a rather short period. 3. The binding and also the volatilisation seems to be due to biological activity in the soil. It may take place within living microorganisms or by external enzymes excreted from microorganisms. 4. Due to variations in the composition of soil there may be a large variation in the distribution of 129 I in the vertical profile of soil - usually most of the 129 I in the upper layer - which also results in large variations in the 129 I uptake to plants

  10. Iodine in soil

    Energy Technology Data Exchange (ETDEWEB)

    Johanson, Karl Johan [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Forest Mycology and Pathology


    A literature study of the migration and the appearance of iodine isotopes in the bio-sphere particularly in soil is presented. Some important papers in the field of iodine appearance in soil and the appearance of {sup 129}I in the surroundings of reprocessing plants are discussed. The most important conclusions are: 1. Iodine binds to organic matter in the soil and also to some oxides of aluminium and iron. 2. If the iodine is not bound to the soil a large fraction of added {sup 129}I is volatilized after a rather short period. 3. The binding and also the volatilisation seems to be due to biological activity in the soil. It may take place within living microorganisms or by external enzymes excreted from microorganisms. 4. Due to variations in the composition of soil there may be a large variation in the distribution of {sup 129}I in the vertical profile of soil - usually most of the {sup 129}I in the upper layer - which also results in large variations in the {sup 129}I uptake to plants.

  11. Iodine filters in nuclear installations

    International Nuclear Information System (INIS)

    Wilhelm, J.G.


    The present report discusses the significance for environmental exposure of the iodine released with the gaseous effluents of nuclear power stations and reprocessing plants in relation to releases of other airborne radionuclides. Iodine filtration processes are described. The release pathways and the composition of airborne fission product iodine mixtures and their bearing on environmental exposure are discussed on the basis of measured fission product iodine emissions. The sorbents which can be used for iodine filtration, their removal efficiencies and range of applications are dealt with in detail. The particular conditions governing iodine removal, which are determined by the various gaseous iodine species, are illustrated on the basis of experimentally determined retention profiles. Particular attention is given to the limitations imposed by temperature, humidity, radiation and filter poisoning. The types of filter normally used are described, their advantages and drawbacks discussed, the principles underlying their design are outlined and the sources of error indicated. The methods normally applied to test the efficiency of various iodine sorbents are described and assessed. Operating experience with iodine filters, gathered from surveillance periods of many years, is supplemented by a large number of test results and the findings of extensive experiments. Possible ways of prolonging the permissible service lives of iodine filters are discussed and information is given on protective measures. The various iodine removal processes applied in reprocessing plants are described and compared with reference to efficiency and cost. The latest developments in filter technology in reprocessing plants are briefly outlined

  12. Perchlorate, iodine supplements, iodized salt and breast milk iodine content

    Energy Technology Data Exchange (ETDEWEB)

    Kirk, Andrea B. [Department of Epidemiology, School of Public Health, University of North Texas Health Sciences Center, 3500 Camp Bowie Blvd., Fort Worth, TX 76107 (United States); Kroll, Martina; Dyke, Jason V.; Ohira, Shin-Ichi; Dias, Rukshan A.; Dasgupta, Purnendu K. [Department of Chemistry and Biochemistry, 700 Planetarium Place, University of Texas at Arlington, Arlington, TX 76019 (United States)


    This study was undertaken to determine if increasing maternal iodine intake through single dose tablets will decrease breast milk concentrations of the iodine-uptake inhibitor, perchlorate, through competitive inhibition. We also sought to determine if the timing of supplementation influences the fraction of iodine excreted in milk versus urine and to compare the effectiveness of iodized salt as a means of providing iodine to breastfed infants. Thirteen women who did not use supplements, seven of whom used iodized salt and six of whom used non-iodized salt, submitted four milk samples and a 24-h urine collection daily for three days. Women repeated the sampling protocol for three more days during which {approx} 150 {mu}g of iodine were taken in the evening and again for three days with morning supplementation. Samples were analyzed using isotope-dilution inductively-coupled plasma-mass spectrometry for iodine and isotope-dilution ion chromatography-tandem mass spectrometry for perchlorate. No statistically significant differences were observed in milk iodine or perchlorate concentrations during the two treatment periods. Estimated perchlorate intake was above the U.S. National Academy of Sciences suggested reference dose for most infants. Single daily dose iodine supplementation was not effective in decreasing milk perchlorate concentrations. Users of iodized salt had significantly higher iodine levels in milk than non-users. Iodized salt may be a more effective means of iodine supplementation than tablets. - Highlights: Black-Right-Pointing-Pointer Estimated infant exposures to perchlorate were, on a {mu}g/kg basis, {approx} 5 Multiplication-Sign higher than those of mothers. Black-Right-Pointing-Pointer Daily supplements are less effective than iodized salt in providing iodine to lactating women. Black-Right-Pointing-Pointer Low iodine and high perchlorate in milk may place infants at risk of iodine deficiency.

  13. Iodine Status in Pregnant & Breastfeeding Women

    DEFF Research Database (Denmark)

    Andersen, Stine Linding

    Iodine is required for the synthesis of thyroid hormones, which are crucial regulator of early brain development. The source of iodine in the fetus and the breastfed infant is maternal iodine, and adequate iodine intake in pregnant and breastfeeding is of major concern. Severe iodine deficiency can...... cause irreversible brain damage, whereas the consequences of mild to moderate iodine deficiency are less clear. Denmark was previously iodine deficient with regional differences (mild iodine deficiency in East Denmark and moderate iodine deficiency in West Denmark), and also pregnant and breastfeeding...... women suffered from iodine deficiency. A mandatory iodine fortification of household salt and salt used for commercial production of bread was introduced in Denmark in the year 2000. The PhD thesis investigates intake of iodine supplements and urinary iodine status in Danish pregnant and breastfeeding...

  14. The speciation of iodine in the environment

    International Nuclear Information System (INIS)

    Bulman, R.A.


    The speciation of iodine in the environment is discussed under the following topics: (i) sea surface to atmosphere, (ii) chemistry in bulk seawater, (iii) iodine in rocks, (iv) iodine in soils, (v) iodine in plants and (vi) iodine in solidified wastes. (author)

  15. Disposal of Iodine-129

    International Nuclear Information System (INIS)

    Morgan, M.T.; Moore, J.G.; Devaney, H.E.; Rogers, G.C.; Williams, C.; Newman, E.


    One of the problems to be solved in the nuclear waste management field is the disposal of radioactive iodine-129, which is one of the more volatile and long-lived fission products. Studies have shown that fission products can be fixed in concrete for permanent disposal. Current studies have demonstrated that practical cementitious grouts may contain up to 18% iodine as barium iodate. The waste disposal criterion is based on the fact that harmful effects to present or future generations can be avoided by isolation and/or dilution. Long-term isolation is effective in deep, dry repositories; however, since penetration by water is possible, although unlikely, release was calculated based on leach rates into water. Further considerations have indicated that sea disposal on or in the ocean floor may be a more acceptable alternative

  16. Atomic iodine laser

    International Nuclear Information System (INIS)

    Fisk, G.A.; Gusinow, M.A.; Hays, A.K.; Padrick, T.D.; Palmer, R.E.; Rice, J.K.; Truby, F.K.; Riley, M.E.


    The atomic iodine photodissociation laser has been under intensive study for a number of years. The physics associated with this system is now well understood and it is possible to produce a 0.1 nsec (or longer) near-diffraction-limited laser pulse which can be amplified with negligible temporal distortion and little spatial deformation. The output of either a saturated or unsaturated amplifier consists of a high-fidelity near-diffraction-limited, energetic laser pulse. The report is divided into three chapters. Chapter 1 is a survey of the important areas affecting efficient laser operation and summarizes the findings of Chap. 2. Chapter 2 presents detailed discussions and evaluations pertinent to pumps, chemical regeneration, and other elements in the overall laser system. Chapter 3 briefly discusses those areas that require further work and the nature of the work required to complete the full-scale evaluation of the applicability of the iodine photodissociation laser to the inertial confinement program

  17. Hyperthyroidism and radioactive iodine

    International Nuclear Information System (INIS)

    Corstens, F.H.M.


    The study details the results of treatment of patients with hyperthyroidism using a combination of fractionated low doses radioactive iodine and anthithyroid drug therapy. The patients studied were treated according to this regimen after August 1968 and all reached euthyroidism before March 1979. None of the patients had been treated with radioactive iodine prior to the start of the protocol. A subgroup of the patients had received an unsuccessfull course with antithyroid drug therapy and, or, surgical therapy before the start of the protocol. Patients who had never been treated for hyperthyroidism were given antithyroid drug therapy for at least 6 months in an attempt to reach euthryroidism without the use of 131 I therapy. Therefore, all patients had experienced a course of unsuccessfull therapy prior to the start of the treatment protocol using combined fractionated low doses of 131 I and antithyroid drug therapy. (Auth.)

  18. Iodine immobilization in apatites

    International Nuclear Information System (INIS)

    Audubert, F.; Lartigue, J.E.


    In the context of a scientific program on long-lived radionuclide conditioning, a matrix for iodine 129 immobilization has been studied. A lead vanado-phosphate apatite was prepared from the melt of lead vanado-phosphate Pb 3 (VO 4 ) 1.6 (PO 4 ) 0.4 and lead iodide PbI 2 in stoichiometric proportions by calcination at 700 deg. C during 3 hours. Natural sintering of this apatite is not possible because the product decomposition occurs at 400 deg. C. Reactive sintering is the solution. The principle depends on the coating of lead iodide with lead vanado-phosphate. Lead vanado-phosphate coating is used as iodo-apatite reactant and as dense covering to confine iodine during synthesis. So the best condition to immobilize iodine during iodo-apatite synthesis is a reactive sintering at 700 deg. C under 25 MPa. We obtained an iodo-apatite surrounded with dense lead vanadate. Leaching behaviour of the matrix synthesized by solid-solid reaction is under progress in order to determine chemical durability, basic mechanisms of the iodo-apatite alteration and kinetic rate law. Iodo-apatite dissolution rates were pH and temperature dependent. We obtained a rate of 2.5 10 -3 g.m -2 .d -1 at 90 deg. C in initially de-ionised water. (authors)

  19. Separation and retention of iodine

    International Nuclear Information System (INIS)

    Thomas, T.R.


    Caustic and mercuric nitrate scrubbers have been used for iodine recovery from process offgas, but they exhibit low decontamination factors for organic iodide removal and produce liquid wastes that are unsuitable for final storage. The Iodox process gives high decontamination factors for both organic iodides and elemental iodine. The liquid waste can be evaporated to a solid or concentrated and fixed in cement. Efficient separation and retention of gaseous iodine species can be obtained with silver-loaded adsorbents. The waste is a dry solid easily handled and stored. Adsorbents containing cheaper metals appear to have lower iodine-loading capacities and may be unsuitable for bulk iodine removal from process offgas because of the large amounts of solid waste that would be generated. A potential method for regenerationg and recycling silver-loaded adsorbents is being evaluated. In conjunction with the regeneration, lead-exchanged zeolite is used as a secondary adsorbent for the final fixation and storage of the iodine

  20. Immobilization of iodine in concrete

    International Nuclear Information System (INIS)

    Clark, W.E.; Thompson, C.T.


    A method for immobilizing fission product radioactive iodine recovered from irradiated nuclear fuel comprises combining material comprising water, Portland cement and about 3 to 20 wt percent iodine as Ba(IO 3 ) 2 to provide a fluid mixture and allowing the fluid mixture to harden, said Ba(IO 3 ) 2 comprising said radioactive iodine. An article for solid waste disposal comprises concrete prepared by this method. 10 claims, 2 figures

  1. Iodine neutron capture therapy (United States)

    Ahmed, Kazi Fariduddin

    A new technique, Iodine Neutron Capture Therapy (INCT) is proposed to treat hyperthyroidism in people. Present thyroid therapies, surgical removal and 131I treatment, result in hypothyroidism and, for 131I, involve protracted treatment times and excessive whole-body radiation doses. The new technique involves using a low energy neutron beam to convert a fraction of the natural iodine stored in the thyroid to radioactive 128I, which has a 24-minute half-life and decays by emitting 2.12-MeV beta particles. The beta particles are absorbed in and damage some thyroid tissue cells and consequently reduce the production and release of thyroid hormones to the blood stream. Treatment times and whole-body radiation doses are thus reduced substantially. This dissertation addresses the first of the several steps needed to obtain medical profession acceptance and regulatory approval to implement this therapy. As with other such programs, initial feasibility is established by performing experiments on suitable small mammals. Laboratory rats were used and their thyroids were exposed to the beta particles coming from small encapsulated amounts of 128I. Masses of 89.0 mg reagent-grade elemental iodine crystals have been activated in the ISU AGN-201 reactor to provide 0.033 mBq of 128I. This activity delivers 0.2 Gy to the thyroid gland of 300-g male rats having fresh thyroid tissue masses of ˜20 mg. Larger iodine masses are used to provide greater doses. The activated iodine is encapsulated to form a thin (0.16 cm 2/mg) patch that is then applied directly to the surgically exposed thyroid of an anesthetized rat. Direct neutron irradiation of a rat's thyroid was not possible due to its small size. Direct in-vivo exposure of the thyroid of the rat to the emitted radiation from 128I is allowed to continue for 2.5 hours (6 half-lives). Pre- and post-exposure blood samples are taken to quantify thyroid hormone levels. The serum T4 concentration is measured by radioimmunoassay at

  2. Chemical generation of iodine atoms

    Energy Technology Data Exchange (ETDEWEB)

    Hewett, Kevin B. [Directed Energy Directorate, Air Force Research Laboratory, 3550 Aberdeen Avenue SE, Kirtland AFB, NM 87117-5776 (United States)]. E-mail:; Hager, Gordon D. [Directed Energy Directorate, Air Force Research Laboratory, 3550 Aberdeen Avenue SE, Kirtland AFB, NM 87117-5776 (United States); Crowell, Peter G. [Northrup Grumman Information Technology, Science and Technology Operating Unit, Advanced Technology Division, P.O. Box 9377, Albuquerque, NM 87119-9377 (United States)


    The chemical generation of atomic iodine using a chemical combustor to generate the atomic fluorine intermediate, from the reaction of F{sub 2} + H{sub 2}, followed by the production of atomic iodine, from the reaction of F + HI, was investigated. The maximum conversion efficiency of HI into atomic iodine was observed to be approximately 75%, which is in good agreement with the theoretical model. The conversion efficiency is limited by the formation of iodine monofluoride at the walls of the combustor where the gas phase temperature is insufficient to dissociate the IF.

  3. Radioactive Iodine (I-131) Therapy for Hyperthyroidism (United States)

    ... Physician Resources Professions Site Index A-Z Radioactive Iodine (I-131) Therapy Radioiodine therapy is a nuclear ... thyroid cancer. When a small dose of radioactive iodine I-131 (an isotope of iodine that emits ...

  4. 40 CFR 141.621 - Routine monitoring. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Routine monitoring. 141.621 Section....621 Routine monitoring. (a) Monitoring. (1) If you submitted an IDSE report, you must begin monitoring..., you must monitor at the location(s) and dates identified in your monitoring plan in § 141.132(f...

  5. 9 CFR 3.141 - Terminal facilities. (United States)


    ... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Terminal facilities. 3.141 Section 3.141 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  6. 40 CFR 141.704 - Analytical methods. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods. 141.704 Section... Monitoring Requirements § 141.704 Analytical methods. (a) Cryptosporidium. Systems must analyze for Cryptosporidium using Method 1623: Cryptosporidium and Giardia in Water by Filtration/IMS/FA, 2005, United States...

  7. 14 CFR 141.93 - Enrollment. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Enrollment. 141.93 Section 141.93 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND... limitations and simulated emergency landing instructions; and (x) A description of and instructions regarding...

  8. Iodine removal from a gas phase

    International Nuclear Information System (INIS)

    Vikis, A. Ch.


    Iodine, e.g. radioactive iodine, present as one or more organic iodides, optionally with elemental iodine, in a gas phase (e.g. air) are removed by photochemically decomposing the organic iodides to elemental iodine, reacting the iodine produced, and any initially present with excess ozone, preferably photochemically produced in situ in the gas phase to produce solid iodine oxides, and removing the solid oxides from the gas phase. (author)

  9. Iodine removal from a gas phase

    International Nuclear Information System (INIS)

    Vikis, A.C.


    Iodine, e.g. radioactive iodine, present as one or more organic iodides, optionally with elemental iodine, in a gas phase (e.g. air) are removed by photochemically decomposing the organic iodides to elemental iodine, reacting the iodine produced, and any initially present with excess ozone, preferably photochemically produced in situ in the gas phase to produce solid iodine oxides, and removing the solid oxides from the gas phase

  10. The Status of Iodine Nutrition and Iodine Deficiency Disorders ...

    African Journals Online (AJOL)

    Background: Iodine deficiency disorders are serious public health problems in Ethiopia. The aim of this study was to measure the prevalence and severity of iodine deficiency disorders among school children in Metekel Zone. Methods: A cross-sectional school based descriptive study was conducted between February 2011 ...

  11. Modelling the chemistry of iodine

    International Nuclear Information System (INIS)

    Paquette, J.


    We have assembled a kinetic model, based on elementary chemical reactions, that describes the chemical behaviour of iodine in aqueous solution as a function of time and various parameters such as pH, concentration and radiation field. The model is conceptually divided into six section: aqueous iodine chemistry, aqueous organic iodide chemistry, water radiolysis, radiolysis of iodine solutions, radiolysis of organic iodide solutions and mass transfer. The model indicates that, in the absence of a radiation field, the rate of production of volatile iodine species is controlled by the rate of oxidation of the iodide ion. The volatile iodine species are dominated by organic iodides if organic impurities are present. The single most important parameter controlling iodine volatility is the pH of the solution; high pH values tend to minimize iodine volatility. In the presence of a radiation field, the volatility of iodine is controlled by the radiation-induced oxidation of the iodide ion. Again, iodine volatility is dominated by organic iodides if organic impurities are present. High pH values minimize iodine volatility. A sensitivity analysis has been performed on some sections of the model to identify reactions to which the volatility of iodine is most sensitive. In the absence of a radiation field, the volatility is most sensitive, first, to the rate of oxidation of the iodide ion, and, second, to the rate of mass transfer of volatile species between the aqueous and the gaseous phases. This approach should be useful in identifying reactions for which accurate rate constants are required and in decreasing the complexity of the model. 37 refs

  12. Volatilization of iodine from vegetation

    Energy Technology Data Exchange (ETDEWEB)

    Amiro, B D; Johnston, F L [Atomic Energy of Canada Ltd., Pinawa, MB (Canada). Whiteshell Nuclear Research Establishment


    Gaseous emissions of iodine were measured from bean plant foliage. A gamma-emitting iodine tracer, Na {sup 125}I, was taken up by the plants from a hydroponic growth medium and released to a cuvette atmosphere. The dynamics of the flux were studied using a flow-through gamma detector. The relationship between leaf radioactive tracer activity and growth-medium activity was linear, as was the relationship between the iodine flux and both leaf and growth-medium activity. Iodine flux and leaf conductance to water responded similarly to changes in light levels, suggesting that the stomata may partially control the flux. The flux was inhibited by aeration of the hydroponic growth media, and we postulate that methylation causes the iodine flux. Iodine emissions from living vegetation probably contribute < 0.1% to the stable iodine concentration in the atmosphere above terrestrial areas. However, this pathway may be a direct route for radioactive iodine transport from contaminated soils to the atmosphere. (author).

  13. Iodine metabolism and food needs

    International Nuclear Information System (INIS)

    Mornex, R.


    Iodine is an element that is necessary for the growth and mental development of a child and for the maintenance of the activity of all cells at all ages. In this article, the author recalls the iodine sources, its metabolism and the food needs and contributions

  14. Breastfeeding and maternal and infant iodine nutrition. (United States)

    Azizi, Fereidoun; Smyth, Peter


    The aim of this review is to explore information available regarding iodine secretion in milk, both mothers and infants iodine nutrition during breastfeeding and to make recommendations for appropriate iodine supplementation during lactation. MEDLINE was queried for studies between 1960 and 2007 that included lactation and breastfeeding with iodine and iodine deficiency. Studies were selected if they studied (i) Secretion of iodine in breast milk; (ii) breastfeeding and iodine nutrition; (iii) factors affecting maternal iodine metabolism and (iv) recommendations for iodine supplementation during breastfeeding. Thirty-six articles met the selection criteria. The iodine content of breast milk varies with dietary iodine intake, being lowest in areas of iodine deficiency with high prevalence of goitre. Milk iodine levels are correspondingly higher when programs of iodine prophylaxis such as salt iodization or administration of iodized oil have been introduced. The small iodine pool of the neonatal thyroid turns over very rapidly and is highly sensitive to variations in dietary iodine intake. Expression of the sodium iodide symporter is up-regulated in the lactating mammary gland which results in preferential uptake of iodide. In areas of iodine sufficiency breast milk iodine concentration should be in the range of 100-150 microg/dl. Studies from France, Germany, Belgium, Sweden, Spain, Italy, Denmark, Thailand and Zaire have shown breast milk concentrations of nutrition. The current WHO/ICCIDD/UNICEF recommendation for daily iodine intake (250 microg for lactating mothers) has been selected to ensure that iodine deficiency dose not occur in the postpartum period and that the iodine content of the milk is sufficient for the infant's iodine requirement.

  15. Iodine removing means

    International Nuclear Information System (INIS)

    Takeshima, Masaki.


    Object: To employ exhaust gas from an incinerator to effect regeneration of an adsorbent such as active carbon which has adsorbed a radioactive gas such as iodine contained in the ventilating system exhaust gas of a boiling water reactor power plant. Structure: Radioactive exhaust gas such as iodine, xenon and krypton is led to an active carbon adsorbing means for removal through adsorption. When the adsorbing function of the active carbon adsorption means is reduced, the exhaust gas discharged from the incinerator is cooled down to 300 0 C and then caused to flow into the active carbon layer, and after depriving it of sulfur dioxide gas, oxides of nitrogen, daughter nuclides resulting from attenuation of radioactive gas and so forth, these being adsorbed by the carbon active layer, it is led again to the incinerator, whereby the radioactivity accompanying the regenerated gas is sealed as ash within the incinerator. Further, similarly accompanying fine active carbon particles and the like are utilized as a heat source for the incinerator. (Kamimura, M.)

  16. Effectiveness and risks of stable iodine prophylaxis

    International Nuclear Information System (INIS)

    Waight, P.J.


    The factors upon which the efficacy of stable iodine prophylaxis depends are reviewed, with particular reference to the dose of stable iodine, the timing of the dose, the influence of dietary iodine and the impact of the other prospective actions. The risks of stable iodine ingestion are estimated, and their application to the principle of Justification in outlined. (Author)

  17. 40 CFR 141.170 - General requirements. (United States)


    ... recontamination by surface water runoff and a point downstream before or at the first customer for filtered...) Compliance with the profiling and benchmark requirements under the provisions of § 141.172. (b) A public...

  18. Iodine in the environment revisited

    International Nuclear Information System (INIS)

    Christiansen, J.V.; Carlsen, L.


    The report gives an overview of the environmental cycle of iodine, especially focusing on the possible reactions being responsible for the retention of iodine in the terrestrial environment. During the last two decades evidence for the presence of iodine in soil as organically bound has been presented. The major part of inorganic iodine in the terrestrial environment will, under physical and chemical conditions normally prevailing, exist as iodide. No evidence for a direct reaction between iodide and organic material has been presented, whereas strong support for the engagement of microbial activity in the formation of organic iodine compounds in soil has been obtained. Incorporation of iodine in humic substances as a result of enzymatic catalysis, involving an enzyme of the perozidase group apperas reasonable. It is concluded that microbiological activity involving extracellular enzymes most probably is responsible for the possible retention of iodine in the terrestrial environment. It is suggested that these reactions in detail should be studied experimentally. (author) 3 tabs., 2 ills., 51 refs

  19. Iodine deficiency and nutrition in Scandinavia

    DEFF Research Database (Denmark)

    Manousou, Sofia; Dahl, Lisbeth; Heinsbaek Thuesen, Betina


    Iodine nutrition is a result of geological conditions, iodine fortification and monitoring strategies within a country together with the dietary habits of the population. This review summarizes the basis for the current iodine situation in the Scandinavian countries in order to identify gaps...... strategies have been used in Scandinavia to improve iodine nutrition. The major source of iodine is iodized salt in Sweden and from milk and dairy products in Norway. In Denmark, drinking water, milk, dairy products and iodized salt used in commercial production of bread are the important sources of iodine....... The current iodine status in Scandinavia is not optimal and action is ongoing to increase iodination in Denmark, where there is mild iodine deficiency in the general population. Data from all three countries indicate insufficient iodine nutrition during pregnancy and there is a need for data from children...

  20. Iodine excretion in school children in Copenhagen

    DEFF Research Database (Denmark)

    Rasmussen, Lone B.; Kirkegaard-Klitbo, Ditte Marie; Laurberg, Peter


    INTRODUCTION: Studies of dietary habits show a high iodine intake in children in Denmark. Iodine excretion in children has not previously been assessed. Iodine excretion in adults is below the recommended threshold, and it is therefore being discussed to increase the fortification level. The main...... objective of this study was to assess iodine excretion in children living in Copenhagen to establish whether a moderate increase in iodine fortification would lead to excess iodine intake in this group. METHODS: Children in first and fifth grade were recruited through schools in Copenhagen. In total, 244...... children de-ivered a urine sample. Urine samples were analysed for iodine and creatinine, and the results were expressed as urinary iodine concentration (UIC) and as estimated 24-h iodine excretion. Iodine excretion in children was also compared with that of adults living in the same area, investigated...

  1. Iodine isotopes and radiation safety

    International Nuclear Information System (INIS)

    Styro, B.; Nedvekajte, T.; Filistovich, V.


    Methods of concentration determination of stable and radioactive iodine isotopes in the Earth's different geospheres are described. Iodine isotopes concentration data, chemical forms and transformations as well as their exchange among separate geospheres of their global biochemical circulation (ocean, atmosphere, lithosphere and biosphere) are presented. Information on iodine isotopes as after-effects of nuclear installations accident (in particular, the Chernobyl accident) is generalized. The book is intended for scientists and practical workers in ecology and radioactivity protection and for a students of physics. 442 refs.; 82 figs.; 36 tabs

  2. Radiochemistry of iodine

    Energy Technology Data Exchange (ETDEWEB)

    Kahn, M.; Kleinberg, J.


    The preparation of isotopes of the element, with selected procedures for its determination in or separation from various media is described along with the separating of iodine species from each other. Each part of the introductory section is referenced separately from the remainder of the monograph. For the preparative and analytical sections there is an extensive, indexed bibliography which was developed from the indexes of Volumes 19 to 30 inclusive (1965-1974) of Nuclear Science Abstracts (NSA). From these indexes the NSA abstracts of possible pertinent references were selected for examination and a choice was made of those references which were to be included in the bibliography. The bibliography has both primary and secondary references. Although the monograph does not cover hot atom chemistry, the kinetics of exchange reactions, decay schemes, or physiological applications, papers in these areas were examined as possible sources of useful preparative and analytical procedures. (JRD)

  3. Radiochemistry of iodine

    International Nuclear Information System (INIS)

    Kahn, M.; Kleinberg, J.


    The preparation of isotopes of the element, with selected procedures for its determination in or separation from various media is described along with the separating of iodine species from each other. Each part of the introductory section is referenced separately from the remainder of the monograph. For the preparative and analytical sections there is an extensive, indexed bibliography which was developed from the indexes of Volumes 19 to 30 inclusive (1965-1974) of Nuclear Science Abstracts (NSA). From these indexes the NSA abstracts of possible pertinent references were selected for examination and a choice was made of those references which were to be included in the bibliography. The bibliography has both primary and secondary references. Although the monograph does not cover hot atom chemistry, the kinetics of exchange reactions, decay schemes, or physiological applications, papers in these areas were examined as possible sources of useful preparative and analytical procedures

  4. Current iodinated contrast media

    International Nuclear Information System (INIS)

    Stacul, F.


    The number of scientific papers on iodinated contrast media is declining. Indeed, comparative trials between high-osmolality and low-osmolality agents largely showed the higher safety and tolerability of the latter, and this is no longer a matter of discussion. Only financial constraints could prevent a total conversion to low-osmolality agents. Research comparing low-osmolality (nonionic monomers, ionic dimer) and iso-osmolality contrast media (nonionic dimers) are still ongoing. Both classes of nonionic compounds proved safer than the ionic dimer. The relative merits of nonionic monomers and nonionic dimers are a matter for debate, and criteria for a selective use of different agents for different procedures could be discussed. (orig.)

  5. Immobilization of iodine in concrete (United States)

    Clark, Walter E.; Thompson, Clarence T.


    A method for immobilizing fission product radioactive iodine recovered from irradiated nuclear fuel comprises combining material comprising water, Portland cement and about 3-20 wt. % iodine as Ba(IO.sub.3).sub.2 to provide a fluid mixture and allowing the fluid mixture to harden, said Ba(IO.sub.3).sub.2 comprising said radioactive iodine. An article for solid waste disposal comprises concrete prepared by this method. BACKGROUND OF THE INVENTION This invention was made in the course of, or under a contract with the Energy Research and Development Administration. It relates in general to reactor waste solidification and more specifically to the immobilization of fission product radioactive iodine recovered from irradiated nuclear fuel for underground storage.

  6. Milk Iodine Content in Slovakia

    Directory of Open Access Journals (Sweden)

    I. Paulíková


    Full Text Available The aim of this work was to map actual iodine status and its seasonal differences in raw milk of dairy cows, sheep, and goats in various regions of Slovakia. Iodine concentrations were determined in 457 samples of raw milk from dairy cows, 78 samples of sheep, and 16 samples of goat milk collected in various regions of Slovakia from 2002 to 2007. Among all the 457 samples of bovine milk, iodine content below 50 μg l-1 was recorded in 114 samples (24.94%; 294 samples (64.33% ranged between 50 and 200 μg l-1; 19 samples (4.16% from 200 to 500 μg l-1; 17 samples (3.72% between 500 and 1 000 μg l-1, and 13 samples (2.85% showed iodine concentrations over 1 000 μg l-1. regional concentrations showed the highest values in the Western, then Middle and Eastern Slovakia, and the lowest values in Northern Slovakia (p p -1 in 49 sheep (62.8% and in 6 goats below 60 μg l-1 (37.5%, which are indicative of iodine deficiency. When comparing seasonal differences, sheep and goat milk had higher iodine content during the winter feeding period, however, in dairy cows we recorded the opposite ratio. Except for goat milk (p < 0.01 the seasonal differences were not significant.

  7. 25 CFR 141.48 - Translation of disclosure statements. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Translation of disclosure statements. 141.48 Section 141.48 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS... Translation of disclosure statements. Disclosure required by §§ 141.46 and 141.47 shall be made in writing...

  8. Iodine filters in nuclear power stations

    International Nuclear Information System (INIS)

    Wilhelm, J.G.


    On the basis of calculated and recorded release rates of nuclear power plants, the significance of iodine releases in the invironmental impact relative to other nuclides is discussed. The release pathways for iodine in LWR-type reactors and the efficiency of various methods to lower the activity release are given. The airborne species of iodine are discussed with regard to their removal in iodine sorption filters and environmental impact. The technical status of iodine removal by means of iodine sorption filters is studied for normal operation and accident conditions in nuclear power stations on the basis of the data given in the relevant literature for the efficiency of a number of iodine sorption materials. The applicability of concepts for ventilation and containment and their influence on iodine filter systems are discussed. Design, structure, and testing of iodine sorption filters are treated in detail; recommendations for design are given, and failure sources are mentioned. (orig.) [de

  9. Iodine status in neonates in Denmark

    DEFF Research Database (Denmark)

    Nøhr, S B; Laurberg, Peter; Børlum, K G


    Iodine status of 147 neonates born in five different regions of Denmark was evaluated in relation to the iodine content of breast milk and iodine supplementation taken by the mother. Approximately two-thirds of the women had not received iodine supplementation. They had low iodine concentrations...... in breast milk and urinary iodine concentrations of the neonates at day 5 were low. The median values (milk/urine) were 33.6/31.7 micrograms/l (Randers 22/26, Ringkøbing 29/16, Aalborg 36/31. Arhus 54/41 and Copenhagen 55/59 micrograms/l). Higher values were found in the group where tablets containing...... iodine had been taken (milk/urine: 57.0/61.0 micrograms/l). In general, the values are low compared with internationally recommended levels. We suggest that mothers without autoimmune thyroid disease should receive iodine supplementation in the form of vitamin/mineral tablets containing iodine (150...

  10. Dicty_cDB: VHI141 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI141 (Link to dictyBase) - - - Contig-U15722-1 VHI141P (Link... to Original site) VHI141F 635 VHI141Z 922 VHI141P 1537 - - Show VHI141 Library VH (Link to library) Clone ID VHI141 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15722-1 Original site URL http://dict...LDCSTPNGTCDNNTGNCTCHNEHFGNSC EFTRCPLDCSTPNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHK...PNGTCDNNTGNCTCHNEHFGNGCEFTQCPLYCSTPNGTCDINSGICTCD NEHIGNGCEIKFIECKHKCSTKHGICDNDSG

  11. Chemisorption of organic iodine compounds forming from fission isotopes of radioactive iodine

    International Nuclear Information System (INIS)

    Tot, G.; Galina, F.; Zel'd, E.


    Studied is ethyl iodine adsorption, labelled by iodine 131, on palladium black and on aluminium oxide activized by palladium. The desorption of adsorbed iodine in the temperature range of 20-600 deg C by the mass spectroscopy and thermal gravimetric methods was investigated. At the ethyl iodine and palladium interaction the bond between carbon and iodine in the ethyl iodine molecule breaks down and extracting iodine reacts with palladium, forming a stable compound at high temperatures. Desorption of adsorbed iodine is insignificant up to the temperatures of 250-300 deg C. Thus, sorbents, containing palladium, may be successfully applied for iodine absorption from the organic iodine compounds. These compounds spontaneously appear from the iodine fragment ratio isotopes during their interaction with some environmental organic impurities

  12. Study of Iodine Prophylaxis Following Nuclear Accidents

    International Nuclear Information System (INIS)

    Sri Widayati; Tedjasari, R. S.; Elfida


    Study of iodine prophylaxis following nuclear accidents has been done. Giving stable iodine to a population exposed by I-131 is one of preventive action from internal radiation to the thyroid gland. Stable iodine could be given as Kl tablet in a range of dose of 30 mg/day to 130 mg/day. Improper giving of stable iodine could cause side effect to health, so then some factors should be considered i. e. dose estimation, age, dose of stable iodine to be given, duration of stable iodine prophylaxis and risk of health. (author)

  13. The radiotoxicology of iodine

    International Nuclear Information System (INIS)

    Taylor, D.M.


    Thirty radioisotopes of iodine are known but only those with mass numbers from 123 to 135 are of major radiotoxicological interest. Exposure of animals or man to inorganic 131 I or 125 I may result in the induction of benign or malignant thyroid tumors or depression of thyroid function; Bq for Bq 125 I is less toxic than 131 I. However, the shorter lived radioiodines 132 I, 133 I, and 135 I appear to be 10 to 100 times more toxic than 131 I alone. Little information is available about the toxicity of radioiodine containing organic compounds. The DNA precursor, iododeoxyuridine when labelled with 125 I becomes incorporated into the cell nucleus and produces severe and often irreparable damage due to the emission of Auger electrons. The risk estimate for the induction of thyroid carcinoma or adenoma by inorganic 131 I is considered to be 10 to 20x10 -6 persons Gy -1 y -1 , but may be up to 100 times larger for persons exposed to mixtures of short-lived radioiodines. (author)

  14. Iodine behaviour in severe accidents

    Energy Technology Data Exchange (ETDEWEB)

    Dutton, L M.C.; Grindon, E; Handy, B J; Sutherland, L [NNC Ltd., Knutsford (United Kingdom); Bruns, W G; Sims, H E [AEA Technology, Harwell (United Kingdom); Dickinson, S [AEA Technology, Winfrith (United Kingdom); Hueber, C; Jacquemain, D [IPSN/CEA, Cadarache, Saint Paul-Lez-Durance (France)


    A description is given of analyses which identify which aspects of the modelling and data are most important in evaluating the release of radioactive iodine to the environment following a potential severe accident at a PWR and which identify the major uncertainties which affect that release. Three iodine codes are used namely INSPECT, IODE and IMPAIR, and their predictions are compared with those of the PSA code MAAP. INSPECT is a mechanistic code which models iodine behaviour in the aqueous aerosol, spray water and sump water, and the partitioning of volatile species between the aqueous phases and containment gas space. Organic iodine is not modelled. IODE and IMPAIR are semi-empirical codes which do not model iodine behaviour in the aqueous aerosol, but model organic iodine. The fault sequences addressed are based on analyses for the Sizewell `B` design. Two types of sequence have been analysed.: (a) those in which a major release of fission products from the primary circuit to the containment occur, e.g. a large LOCAS, (b) those where the release by-passes the containment, e.g. a leak into the auxiliary building. In the analysis of the LOCA sequences where the pH of the sump is controlled to be a value of 8 or greater, all three codes predict that the oxidation of iodine to produce gas phase species does not make a significant contribution to the source term due to leakage from the reactor building and that the latter is dominated by iodide in the aerosol. In the case where the pH of the sump is not controlled, it is found that the proportion of gas phase iodine increases significantly, although the cumulative leakage predicted by all three codes is not significantly different from that predicted by MAAP. The radiolytic production of nitric acid could be a major factor in determining the pH, and if the pH were reduced, the codes predict an increase in gas phase iodine species leaked from the containment. (author) 4 figs., 7 tabs., 13 refs.

  15. [Assessment of dietary iodine intake of population in non-high-iodine areas in China]. (United States)

    Song, Xiaoyu; Li, Fengqin; Liu, Zhaoping; He, Yuna; Sui, Haixia; Mao, Weifeng; Liu, Sana; Yan, Weixing; Li, Ning; Chen, Junshi


    To assess the potential risk of dietary iodine insufficiency of population in non-high-iodine areas (water iodine China. The dietary iodine intake of 13 age-sex population groups were estimated by combining the data of iodine intake from food, table salt and drinking water. Two conditions were considered: consuming iodized salt or non-iodized salt. The data of food and table salt consumption were derived from the Chinese National Nutrition and Health Survey in 2002. Water consumption was calculated as the recommended water intake. Iodine contents of food, table salt and water were calculated from China Food Composition Table and iodine surveillance data. Under the condition of consuming iodized salt, the average iodine intake of all population groups was higher than the Recommended Nutrient Intake (RNI), while the iodine intakes of individuals above Upper Limits (UL) and below RNI were 5.8% and 13.4% respectively, and the iodine intake of individuals lower than the Estimated Average Requirement (EAR) was 9.4% in adults above 18 years of age (including pregnant and lactating women). If non-iodized salt was consumed, the average iodine intake of most sex-age population groups was higher than RNI, but the iodine intake of 97.6% of individuals would be lower than RNI, while the iodine intake of 97.4% of adults would be lower than EAR. The contribution of iodine from table salt was much higher than that from drinking water and food in the condition of consuming iodized salt, while food was the predominant contributor of dietary iodine in the condition of consuming non-iodized salt. The health risk of iodine deficiency was higher than that of iodine excess in areas where water iodine was China, and the risk of iodine insufficiency was much higher if non-iodized salt was consumed. Iodized salt should be the main sources of dietary iodine intake for population in areas where water iodine was China.

  16. Urinary Iodine Concentrations Indicate Iodine Deficiency in Pregnant Thai Women but Iodine Sufficiency in Their School-Aged Children

    NARCIS (Netherlands)

    Gowachirapant, S.; Winichagoon, P.; Wyss, L.; Tong, B.; Baumgartner, J.; Boonstra, A.; Zimmermann, M.B.


    The median urinary iodine concentration (UI) in school-aged children is recommended for assessment of iodine nutrition in populations. If the median UI is adequate in school-aged children, it is usually assumed iodine intakes are also adequate in the remaining population, including pregnant women.

  17. Iodinated contrast media nephrotoxicity

    International Nuclear Information System (INIS)

    Meyrier, A.


    In the late seventies, iodinated contrast agents (ICA) were considered to be a major cause of acute iatrogenic renal failure. Over the last decade new contrast agents have been synthesized, nonionic and less hyperosmolar. The incidence of acute renal failure due to ICAs, varies from 3.7 to 70% of cases according to the series, with an average figure of 10.2%. The pathophysiology of ICA nephrotoxicity was mainly studied in laboratory animal models. Three main factors are involved in an inducing ICA-mediated decrease in glomerular filtration rate: reduction of the renal plasma flow, a direct cytotoxic effect on renal tubular cells and erythrocyte alteration leading to intra-renal sludge. Excluding dysglobulinemias with urinary excretion of immunoglobulin light chains, which represent a special case of maximum nephrotoxicity, 4 main risk factors of renal toxicity have been identified in nondiabetic subjects: previous renal failure with serum creatinine levels greater than 140 μmol per liter, extracellular dehydration, age over 60 and use of high doses of ICA and/or repeated ICA injections before serum creatinine levels return to baseline. Preventive measures for avoiding ICA nephrotoxicity are threefold: maintain or restore adequate hydration with saline infusion, stop NSAID treatment several days before ICA administration, and allow a 5 day interval before repeating contrast media injections. New, nonionic and moderately hyperosmolar contrast agents appear to be much less nephrotoxic than conventional ICAs in laboratory animals and in high-risk patients. It is advisable to select such contrast media for investigating high-risk patients. This approach was recently substantiated in well designed, randomized clinical studies which included more than 2 000 patients. (author)

  18. Experimental reproduction of iodine deficiency in cattle. (United States)

    McCoy, M A; Smyth, J A; Ellis, W A; Arthur, J R; Kennedy, D G


    The role of iodine deficiency in stillbirth/perinatal weak calf syndrome was investigated in pregnant heifers. Five heifers were fed an iodine deficient diet (mean [sd] iodine concentration 0.06 [0.01] mg/kg dry matter [DM]) and six received an iodine sufficient diet (mean [sd] iodine concentration 1.45 [0.27] mg/kg DM). The diets consisted of wheat and soyabean meal with added minerals and vitamins (with or without iodine) and were fed to the heifers over the final four to five months of pregnancy. The iodine deficient diet produced clinicopathological changes and pathological changes in the thyroid glands of both the heifers and their offspring. However, all the calves in the iodine deficient group were born clinically normal.

  19. Thyroid disorders in mild iodine deficiency

    DEFF Research Database (Denmark)

    Laurberg, P; Nøhr, S B; Pedersen, K M


    Comparative epidemiologic studies in areas with low and high iodine intake and controlled studies of iodine supplementation have demonstrated that the major consequence of mild-to-moderate iodine deficiency for the health of the population is an extraordinarily high occurrence of hyperthyroidism...... endangered but the consequences of severe iodine deficiency for brain development are grave and a considerable safety margin is advisable. Moreover, a shift toward less malignant types of thyroid cancer and a lower radiation dose to the thyroid in case of nuclear fallout support that mild-to-moderate iodine...... deficiency should be corrected. However, there is evidence that a high iodine intake may be associated with more autoimmune hypothyroidism, and that Graves' disease may manifest at a younger age and be more difficult to treat. Hence, the iodine intake should be brought to a level at which iodine deficiency...

  20. Effect of iodine solutions on polyaniline films

    International Nuclear Information System (INIS)

    Ayad, M.M.; Amer, W.A.; Stejskal, J.


    Polyaniline (PANI) emeraldine-base films have been exposed to iodine solutions. The interaction between the films and the iodine solution was studied using the quartz-crystal microbalance (QCM) technique and the UV-visible absorption spectroscopy. The iodine-treated film of emeraldine base was subjected to dedoping process using 0.1 M ammonia solution. The resulting film was exposed again to the previously used iodine solution. Iodine was found to play multiple roles: the ring-iodination of PANI film, the oxidation of PANI to pernigraniline base, and iodine doping to PANI salt. A sensor based on PANI-coated electrode of QCM was developed to monitor the presence of iodine in solution.

  1. 40 CFR 141.173 - Filtration. (United States)


    ... PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection-Systems Serving 10,000 or More People § 141.173 Filtration. A public water system subject to the requirements of this subpart that does... treatment, direct filtration, slow sand filtration, or diatomaceous earth filtration. A public water system...

  2. 40 CFR 141.601 - Standard monitoring. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Standard monitoring. 141.601 Section... Standard monitoring. (a) Standard monitoring plan. Your standard monitoring plan must comply with paragraphs (a)(1) through (a)(4) of this section. You must prepare and submit your standard monitoring plan...

  3. 40 CFR 141.809 - Supplemental treatment. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Supplemental treatment. 141.809... treatment. (a) Any supplemental drinking water treatment units installed onboard existing or new aircraft... the manufacturer's plans and specifications and FAA requirements. (b) Water supplemental treatment and...

  4. 40 CFR 141.721 - Reporting requirements. (United States)


    ... operational data for toolbox options. Microbial Toolbox Reporting Requirements Toolbox option Systems must... coagulant (iv) At least 0.5-log mean reduction of influent turbidity or compliance with alternative State... treatment compliance date in § 141.713. (ii) If monthly average of daily max turbidity is greater than 1 NTU...

  5. 40 CFR 141.801 - Definitions. (United States)


    ... aircraft that supply water for human consumption to passengers or crew. Aircraft water system operations... distribution and consumption without further treatment, except as treatment necessary to maintain water quality...). (40 CFR 141.2) Human consumption means drinking, bathing, showering, hand washing, teeth brushing...

  6. 40 CFR 141.72 - Disinfection. (United States)


    ... PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.72 Disinfection. A public water... the direct influence of surface water and provides filtration treatment must provide disinfection...) Disinfection requirements for public water systems which provide filtration. Each public water system that...

  7. 40 CFR 141.803 - Coliform sampling. (United States)


    ...) NATIONAL PRIMARY DRINKING WATER REGULATIONS Aircraft Drinking Water Rule § 141.803 Coliform sampling. (a... aircraft water system, the sampling frequency must be determined by the disinfection and flushing frequency... disinfection and flushing frequency recommended by the aircraft water system manufacturer, when available...

  8. 40 CFR 141.73 - Filtration. (United States)


    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.73 Filtration. A public water system that uses a surface water source or a ground water source under the direct influence of surface water...

  9. 40 CFR 141.80 - General requirements. (United States)


    ... service line replacement, and public education. These requirements are triggered, in some cases, by lead... requirements. (1) All water systems shall install and operate optimal corrosion control treatment as defined in... specified by the State under § 141.83. (f) Lead service line replacement requirements. Any system exceeding...

  10. 40 CFR 60.141a - Definitions. (United States)


    ... steel production cycle are also included when the hot metal transfer station or skimming station is an... Process Steelmaking Facilities for Which Construction is Commenced After January 20, 1983 § 60.141a... amended or in subpart A of this part. Basic oxygen process furnace (BOPF) means any furnace with a...

  11. High spin states of 141Pm (United States)

    Bhattacharyya, Sarmishtha; Chanda, Somen; Bhattacharjee, Tumpa; Basu, Swapan Kumar; Bhowmik, R. K.; Muralithar, S.; Singh, R. P.; Ghugre, S. S.


    The high spin states in the N=80 odd- A141Pm nucleus have been investigated by in-beam γ-spectroscopic techniques following the reaction 133Cs( 12C, 4n) 141Pm at E=65 MeV using a modest γ detector array, consisting of seven Compton-suppressed high purity germanium detectors and a multiplicity ball of 14 bismuth germanate elements. Thirty new γ rays have been assigned to 141Pm on the basis of γ-ray singles and γγ-coincidence data. The level scheme of 141Pm has been extended upto an excitation energy of 5.2 MeV and spin {35}/{2}ℏ and 16 new levels have been proposed. Spin-parity assignments for most of the newly proposed levels have been made on the basis of the deduced directional correlation orientation ratios for strong transitions. The meanlives of a few excited states have been determined from the pulsed beam- γγ coincidence data using the generalised centroid-shift method. The level structure is discussed in the light of known systematics of neighbouring N=80 isotonic nuclei.

  12. 25 CFR 141.30 - Retaliation prohibited. (United States)


    ... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.30 Retaliation prohibited. No licensee may refuse service to any customer for the purpose of retaliating against that customer for...

  13. 25 CFR 141.22 - Subleasing prohibited. (United States)


    ... BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.22 Subleasing prohibited. No licensee may lease, sublet, rent, or sell any building that the licensee occupies for any purpose to any person...

  14. Non-natives: 141 scientists object

    NARCIS (Netherlands)

    Simberloff, D.; Van der Putten, W.H.


    Supplementary information to: Non-natives: 141 scientists object Full list of co-signatories to a Correspondence published in Nature 475, 36 (2011); doi: 10.1038/475036a. Daniel Simberloff University of Tennessee, Knoxville, Tennessee, USA. Jake Alexander Institute of Integrative

  15. Contrast induced hyperthyroidism due to iodine excess


    Mushtaq, Usman; Price, Timothy; Laddipeerla, Narsing; Townsend, Amanda; Broadbridge, Vy


    Iodine induced hyperthyroidism is a thyrotoxic condition caused by exposure to excessive iodine. Historically this type of hyperthyroidism has been described in areas of iodine deficiency. With advances in medicine, iodine induced hyperthyroidism has been observed following the use of drugs containing iodine—for example, amiodarone, and contrast agents used in radiological imaging. In elderly patients it is frequently difficult to diagnose and control contrast related hyperthyroidism, as most...

  16. Formation and behaviour of organic iodine

    International Nuclear Information System (INIS)

    Zilliacus, R.; Koukkar, P.; Karjunen, T.; Sjoevall, H.


    The report presents experimental studies on the formation of organic iodine in severe reactor accidents. The analyses were performed to evaluate the amount of alkaline chemical needed for effective pH control of containment water during the accidents. The formation of organic iodine in solutions used in the filtered venting system and the absorption of iodine compounds in the solutions were studied. Experiments for the formation of organic iodine on painted surfaces were also performed. (au)

  17. Mineral resource of the month: iodine (United States)

    Polyak, Désirée E.


    The article focuses on iodine, its benefits and adverse effects, and its production and consumption. It states that iodine is essential to humans for it produces thyroid hormones to nourish thyroid glands but excessive intake could cause goiter, hyperthyroidism or hypothyroidism. U.S. laws require salt iodization to help prevent diseases. Chile and Japan are the world's leading iodine producer while in the U.S. iodine is mined from deep well brines in northern Oklahoma.

  18. Iodine Prophylaxis and Nuclear Accidents

    International Nuclear Information System (INIS)

    Franic, Z.


    Iodine is a highly volatile element therefore being very mobile in the environment. It enters the metabolism of living organisms and is selectively taken up and concentrated in the thyroid gland. The plume (cloud-like formation) of radioactive material that might be released in the environment in the case of a serious nuclear accident, primarily consists of the radioactive isotopes of iodine. Among those, due to its decay properties, is the most important 131 I. The effective means of protecting the thyroid gland against exposure to radioactive iodine is an intake of stable iodine. Therefore, one of the central issues in the emergency planning is to determine whether and at which projected thyroid radiation dose stable iodine should be given to the population. The International Atomic Energy Agency (IAEA) set the generic optimized intervention value for iodine prophylaxis to 100 mGy of avertable committed dose to a thyroid.The prophylaxis is implemented by utilizing the pills of pills of potassium iodine (KI). The efficacy of KI in protecting the thyroid gland depends upon the time of intake relative to the start of exposure to radioactive iodine. The best results are obtained if KI is taken 1-2 hours before or immediately after the start of exposure. The recommended dosage, based upon the study performed by Il'in is 130 mg/day. KI should be taken at least three days after the acute exposure to radioiodine, to prevent accumulation in a thyroid gland of radioiodine excreted from the other compartments of the body. The largest epidemiological study on the effects of KI prophylaxis ever performed was the one in Poland after the Chernobyl accident. Stable iodine was given as single dose of KI solution to 10.5 million of children and 7 millions of adults. Among children no serious side effects were seen while only two adults (with previously recorded iodine sensitivity) had severe respiratory distresses. Polish experiences showed that rapid response to such

  19. Management modes for iodine-129

    International Nuclear Information System (INIS)

    White, I.F.; Smith, G.M.


    This study completes a two-stage programme, supported by the Commission of the European Communities, on management modes for iodine-129. The models for the radiological assessment of iodine-129 management modes have been reviewed and, where necessary, revised, and a generic radiological assessment has been carried out using these models. Cost benefit analysis has been demonstrated for a variety of iodine-129 management modes; for a wide range of assumptions, the costs of abatement of atmospheric discharges would be outweighed by the radiological benefits. The cost benefit analysis thus complements and confirms the preliminary conclusion of the previous study: iodine-129 should be trapped to a large extent from the off-gases of a large reprocessing plant and disposed of by other suitable means, in order to ensure that all exposures from this radionuclide are as low as reasonably achievable. Once the major fraction of the iodine-129 throughput of a reprocessing plant has been trapped from the dissolver off-gases, there are unlikely to be strong radiation protection incentives either for further trapping from the dissolver off-gases or for trapping from the vessel off-gases. In a generic study it is not possible to state an optimum choice of process(es) for abatement of atmospheric discharges of iodine-129. This choice must be determined by assessments in the specific context of a particular reprocessing plant, its site, the waste disposal routes that are actually available, and also in the wider context of the management plans for all radioactive wastes at the plant in question

  20. The importance of iodine nutrition during pregnancy. (United States)

    Glinoer, Daniel


    To examine the importance of iodine nutrition during pregnancy. Review of existing literature of iodine in pregnancy. Population surveys and metabolic studies. Pregnant women. The main changes in thyroid function associated with pregnancy are due to an increase in hormone requirements that begin in the first trimester of gestation. This increase can only be met by a proportional increase in hormone production, something that depends directly upon the availability of iodine. When dietary iodine is lacking, an adequate physiological adaptation is difficult to achieve and is progressively replaced by pathological alterations that occur in parallel with the degree and duration of iodine deprivation. Iodine prophylaxis should be given systematically to women during pregnancy. In most public health programmes dealing with the correction of iodine deficiency disorders, iodised salt has been used as the preferred means to deliver iodine to households. Iodised salt, however, is not the ideal means of delivering iodine in the specific instances of pregnancy, breast-feeding and complementary feeding because of the need to limit salt intake during these periods. In European countries, presently it is proposed that iodine is given to pregnant women and breast-feeding mothers by systematically administering multivitamin tablets containing iodine in order to reach the recommended dietary allowance of 250 microg iodine day-1.

  1. Iodine in Enteral and Parenteral Nutrition

    NARCIS (Netherlands)

    Zimmermann, M.B.; Crill, C.M.


    Iodine deficiency (ID) has multiple adverse effects on growth and development due to inadequate thyroid hormone production. Methods for assessment of iodine nutrition in individuals include the urinary iodine concentration (UI), thyroid size and thyroid function tests. The UI measured in several

  2. Industrial system for producing iodine-123

    International Nuclear Information System (INIS)

    Brantley, J.C.


    An industrial system to produce iodine-123 required a complex set of steps involving new approaches by the Food and Drug Administration, difficult distribution procedures, and evidence from potential users that either very pure iodine-123 or inexpensive iodine-123 is needed. Industry has shown its willingness to invest in new radionuclides but needs strong evidence as to product potential to justify those investments

  3. Iodine excretion in school children in Copenhagen

    DEFF Research Database (Denmark)

    Rasmussen, Lone B; Kirkegaard-Klitbo, Ditte Marie; Laurberg, Peter


    INTRODUCTION: Studies of dietary habits show a high iodine intake in children in Denmark. Iodine excretion in children has not previously been assessed. Iodine excretion in adults is below the recommended threshold, and it is therefore being discussed to increase the fortification level. The main...


    The environmental contaminant perchlorate disrupts thyroid homeostasis via inhibition of iodine uptake into the thyroid. This work tested whether iodine deficiency exacerbates the effects of perchlorate. Female 27 day-old LE rats were fed a custom iodine deficient diet with 0, 50...

  5. Chemical species of iodine in some seaweeds. Pt. 2. Iodine-bound biological macromolecules

    International Nuclear Information System (INIS)

    Xiaolin Hou; Chifang Chai; Xiaojun Yan


    The distribution of iodine in various biological macromolecules in Sargassum kjellmanianum was studied using neutron activation analysis combined with chemical and biochemical separation techniques. The results indicate that iodine is mainly bound with protein, part of iodine with pigment and polyphenol, and little with polysaccharides, such as algin, fucoidan and cellulose. This result is significant for the mechanism of enriching iodine of algae and utilization of alga iodine. (author)

  6. Transfer of gaseous iodine to Tradescantia

    International Nuclear Information System (INIS)

    Nakamura, Yuji; Ohmomo, Yoichiro.


    Transfer rates of gaseous elemental iodine and methyliodide from atmosphere to Tradescantia were investigated in relation to supposed genetic mutation due to radioactive iodine released from nuclear facilities. The estimated transfer rate of elemental iodine to the young buds of Tradescantia, which was given as the ratio of iodine uptake rate per unit weight of the plant to the concentration of the element in the air, was approximately 7 x 10 -2 cm 3 /g.sec, about 30 to 40 times higher than that of methyliodide. The contribution of direct deposition of elemental iodine was suggested to be significant, although methyliodide was mainly absorbed by respiration through stomata of the plant. (author)

  7. Dietary flavonoids and iodine Metabolism

    NARCIS (Netherlands)

    Elst, van der J.P.; Smit, J.W.A.; Romijn, H.A.; Heide, van der D.


    Flavonoids have inhibiting effects on the proliferation of cancer cells, including thyroidal ones. In the treatment of thyroid cancer the uptake of iodide is essential. Flavonoids are known to interfere with iodide organification ill vitro, and to cause goiter. The influence of flavonoids on iodine

  8. Thyroid disorders in mild iodine deficiency. (United States)

    Laurberg, P; Nøhr, S B; Pedersen, K M; Hreidarsson, A B; Andersen, S; Bülow Pedersen, I; Knudsen, N; Perrild, H; Jørgensen, T; Ovesen, L


    Comparative epidemiologic studies in areas with low and high iodine intake and controlled studies of iodine supplementation have demonstrated that the major consequence of mild-to-moderate iodine deficiency for the health of the population is an extraordinarily high occurrence of hyperthyroidism in elderly subjects, especially women, with risk of cardiac arrhythmias, osteoporosis, and muscle wasting. The hyperthyroidism is caused by autonomous nodular growth and function of the thyroid gland and it is accompanied by a high frequency of goiter. Pregnant women and small children are not immediately endangered but the consequences of severe iodine deficiency for brain development are grave and a considerable safety margin is advisable. Moreover, a shift toward less malignant types of thyroid cancer and a lower radiation dose to the thyroid in case of nuclear fallout support that mild-to-moderate iodine deficiency should be corrected. However, there is evidence that a high iodine intake may be associated with more autoimmune hypothyroidism, and that Graves' disease may manifest at a younger age and be more difficult to treat. Hence, the iodine intake should be brought to a level at which iodine deficiency disorders are avoided but not higher. Iodine supplementation programs should aim at relatively uniform iodine intake, avoiding deficient or excessive iodine intake in subpopulations. To adopt such a strategy, surveillance programs are needed.

  9. Iodine tablets and a nuclear accident

    International Nuclear Information System (INIS)

    Paile, W.


    Radioactive iodine is one of the major substances released during severe nuclear accidents. Radioactive iodine is easily gasified, and if present in fallout it can enter the lungs, and thereby the circulatory system, with the inhalation of air. Once in a body, radioactive iodine accumulates in the thyroid and may result in tumours in the thyroid and, in extreme cases, impaired thyroid function. Accumulation of radioactive iodine can be prevented by taking non-radioactive, 'cold' iodine as tablets. Iodine tablets dilute the radioactive iodine that has entered the body. A dose of iodine also paralyses the thyroid temporarily by saturating its iodine-carrying capacity. To be useful iodine tablets should be taken immediately when a radioactive emission has occurred. If the tablets are taken too early or too late, they give little protection. Iodine tablets should not be taken just to be on the safe side, since their use may involve harmful side effects. Dosing instructions should also be followed with care. (orig.)

  10. Iodine removing method in organic solvent

    International Nuclear Information System (INIS)

    Suzuki, Takeo; Sakurai, Manabu


    Purpose: To effectively remove iodine in an organic solvent to thereby remove iodine in the solvent that can be re-used or put to purning treatment. Method: Organic solvent formed from wastes of nuclear facilities is mixed with basic lead acetate, or silica gel or activated carbon incorporated with such a compound to adsorb iodine in the organic solvent to the basic lead acetate. Then, iodine in the organic solvent is removed by separating to eliminate the basic lead acetate adsorbing iodine from the organic solvent or by passing the organic solvent through a tower or column charged or pre-coated with silica gel or activated carbon incorporated with lead acetate. By using basic lead acetate as the adsorbents, iodine can effective by adsorbed and eliminated. Thus, the possibility of circumstantial release of iodine can be reduced upon reusing or burning treatment of the organic solvent. (Kamimura, M.)

  11. Prophylactic iodine treatment in radiation protection

    International Nuclear Information System (INIS)

    Oberhausen, E.


    Prophylactic iodine treatment is to prevent accumulation of radioactive iodine in the thyroid. This is done by administering a large amount of stable iodine before uptake of radioactive iodine so that further accummulation of iodine in the thyroid will be impossible. This blocking effect should be as complete as possible. This is achieved by administering an initial dose of 200 mg potassium iodide. As the release of radioactive iodine may last several hours or even days; for this reason, maintenance doses of 100 mg potassium iodide should be administered in 8-hour intervals. The risk of prophylactiv iodine treatment is rather low; however, provocation of latent hyperthyreoses must be expected in, at the most, 0.2% of the exposed population. (orig./MG) [de

  12. 40 CFR 141.623 - Reduced monitoring. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Reduced monitoring. 141.623 Section....623 Reduced monitoring. (a) You may reduce monitoring to the level specified in the table in this paragraph (a) any time the LRAA is ≤0.040 mg/L for TTHM and ≤0.030 mg/L for HAA5 at all monitoring locations...

  13. Non-natives: 141 scientists object


    Simberloff, Daniel; Vilà, Montserrat


    Supplementary information to: Non-natives: 141 scientists object Full list of co-signatories to a Correspondence published in Nature 475, 36 (2011); doi: 10.1038/475036a. Daniel Simberloff University of Tennessee, Knoxville, Tennessee, USA. Jake Alexander Institute of Integrative Biology, Zurich, Switzerland. Fred Allendorf University of Montana, Missoula, Montana, USA. James Aronson CEFE/CNRS, Montpellier, France. Pedro M. Antunes Algoma University, Sault Ste. Marie, Onta...

  14. Iodine status in neonates in Denmark: regional variations and dependency on maternal iodine supplementation

    DEFF Research Database (Denmark)

    Nøhr, S B; Laurberg, P; Børlum, K G


    Iodine status of 147 neonates born in five different regions of Denmark was evaluated in relation to the iodine content of breast milk and iodine supplementation taken by the mother. Approximately two-thirds of the women had not received iodine supplementation. They had low iodine concentrations...... in breast milk and urinary iodine concentrations of the neonates at day 5 were low. The median values (milk/urine) were 33.6/31.7 micrograms/l (Randers 22/26, Ringkøbing 29/16, Aalborg 36/31. Arhus 54/41 and Copenhagen 55/59 micrograms/l). Higher values were found in the group where tablets containing...... iodine had been taken (milk/urine: 57.0/61.0 micrograms/l). In general, the values are low compared with internationally recommended levels. We suggest that mothers without autoimmune thyroid disease should receive iodine supplementation in the form of vitamin/mineral tablets containing iodine (150...

  15. 36 CFR 406.141-406.148 - [Reserved (United States)


    ... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.141-406.148 Section 406.141-406.148 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.141-406.148 [Reserved] ...

  16. 44 CFR 206.141 - Disaster unemployment assistance. (United States)


    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Disaster unemployment assistance. 206.141 Section 206.141 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY... § 206.141 Disaster unemployment assistance. The authority to implement the disaster unemployment...

  17. 17 CFR 141.8 - Procedures for salary offset. (United States)


    ... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Procedures for salary offset. 141.8 Section 141.8 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION SALARY OFFSET § 141.8 Procedures for salary offset. (a) Deductions to liquidate an employee's debt will be by...

  18. 25 CFR 141.59 - Customer complaint procedures. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Customer complaint procedures. 141.59 Section 141.59... THE NAVAJO, HOPI AND ZUNI RESERVATIONS Enforcement Powers, Procedures and Remedies § 141.59 Customer complaint procedures. (a) Any customer of a licensee may file a complaint with the Commissioner alleging...

  19. 7 CFR 1.41 - Service of process. (United States)


    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Service of process. 1.41 Section 1.41 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Judicial Proceedings § 1.41 Service of... of the General Counsel, in order that service of process may be made. In the event an officer of the...

  20. 19 CFR 141.43 - Delegation to subagents. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Delegation to subagents. 141.43 Section 141.43 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Powers of Attorney § 141.43 Delegation to subagents. (a) Resident...

  1. 28 CFR 39.141-39.148 - [Reserved (United States)


    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.141-39.148 Section 39.141-39.148 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.141-39.148 [Reserved] ...

  2. 40 CFR 141.172 - Disinfection profiling and benchmarking. (United States)


    ... benchmarking. 141.172 Section 141.172 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... Disinfection-Systems Serving 10,000 or More People § 141.172 Disinfection profiling and benchmarking. (a... sanitary surveys conducted by the State. (c) Disinfection benchmarking. (1) Any system required to develop...

  3. 5 CFR 185.141 - Stay pending appeal. (United States)


    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Stay pending appeal. 185.141 Section 185.141 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PROGRAM FRAUD CIVIL REMEDIES § 185.141 Stay pending appeal. (a) An initial decision is stayed automatically pending...

  4. 20 CFR 1001.141 - Functions of DVOP staff. (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Functions of DVOP staff. 1001.141 Section 1001.141 Employees' Benefits OFFICE OF THE ASSISTANT SECRETARY FOR VETERANS' EMPLOYMENT AND TRAINING... Veterans Outreach Program (DVOP) § 1001.141 Functions of DVOP staff. Each DVOP specialist shall carry out...

  5. 45 CFR 2490.141-2490.148 - [Reserved (United States)


    ... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.141-2490.148 Section 2490.141-2490.148 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.141-2490.148 [Reserved] ...

  6. 40 CFR 141.42 - Special monitoring for corrosivity characteristics. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special monitoring for corrosivity characteristics. 141.42 Section 141.42 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Regulations and Prohibition on Lead Use § 141.42 Special monitoring for corrosivity characteristics. (a)-(c...

  7. 40 CFR 141.155 - Report delivery and recordkeeping. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Report delivery and recordkeeping. 141.155 Section 141.155 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Consumer Confidence Reports § 141.155...

  8. 19 CFR 141.41 - Surety on Customs bonds. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Surety on Customs bonds. 141.41 Section 141.41 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) ENTRY OF MERCHANDISE Powers of Attorney § 141.41 Surety on Customs bonds. Powers of...

  9. 18 CFR 141.500 - Cash management programs. (United States)


    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Cash management... OF 1978 STATEMENTS AND REPORTS (SCHEDULES) § 141.500 Cash management programs. Public utilities and... and § 141.1 or § 141.2 of this title that participate in cash management programs must file these...

  10. 26 CFR 1.141-13 - Refunding issues. (United States)


    ... management contract and takes over the operation of the facility. In 2009, C issues bonds to refund the 1999... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Refunding issues. 1.141-13 Section 1.141-13...) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-13 Refunding issues...

  11. 49 CFR 28.141-28.148 - [Reserved (United States)


    ... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.141-28.148 Section 28.141-28.148 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.141-28.148 [Reserved] ...

  12. 40 CFR 141.101 - Use of bottled water. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Use of bottled water. 141.101 Section 141.101 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Use of Non-Centralized Treatment Devices § 141.101...

  13. 25 CFR 141.55 - Price monitoring and control. (United States)


    ... be made a survey of the prices of flour, sugar, fresh eggs, lard, coffee, ground beef, bread, cheese... 25 Indians 1 2010-04-01 2010-04-01 false Price monitoring and control. 141.55 Section 141.55... THE NAVAJO, HOPI AND ZUNI RESERVATIONS Enforcement Powers, Procedures and Remedies § 141.55 Price...

  14. A Spectroscopic Method for Determining Free Iodine in Iodinated Fatty-Acid Esters (United States)

    Klyubin, V. V.; Klyubina, K. A.; Makovetskaya, K. N.


    It is shown that the concentration of free iodine in samples of iodinated fatty-acid esters can be measured using the electronic absorption spectra of their solutions in ethanol. The method proposed is rather simple in use and highly sensitive, allowing detection of presence of less than 10 ppm of free iodine in iodinated compounds. It is shown using the example of Lipiodol that this makes it possible to easily detect small amounts of free iodine in samples containing bound iodine in concentrations down to 40 wt %.

  15. Separation of iodine-131 from water using isotopic exchange with iodine-starch compound

    International Nuclear Information System (INIS)

    Ignatov, V.P.; Kolomejtseva, I.V.


    Conditions of iodine isotopic exchange with iodine-starch compound (ISC) were studied with the aim of compound utilizatoin for radioactive iodine separation from solution. It is shown that in pH range from 2 to 7 the degree of iodine extraction and coefficient of its distribution practically do not depend on pH, at pH>7 ISC destruction (decolorizing) starts and iodine extraction decreases. Rapid method of iodine separation from solution is suggested. The method can be used in radiochemical techniques. The degree of extraction equals 80 %, a higher degree of extraction can not be achieved owing to ISC formation peculiarities

  16. Radioactive iodine absorbing properties of tetrathiafulvalene

    Energy Technology Data Exchange (ETDEWEB)

    Ito, Tomiyasu; Nakamura, Asao (Ajinomoto Co. Inc., Kawasaki, Kanagawa (Japan). Central Research Labs.); Nogawa, Norio; Oohashi, Kunio; Morikawa, Naotake


    For the purpose of searching some effective absorbents of gaseous radioactive iodine, 16 substances considered as having an affinity for iodine were investigated with regular iodine and /sup 125/I. In a preliminary survey, only tetrathiafulvalene (TTF) was found to have satisfactory absorbing properties comparable to activated charcoal. A further detailed comparison of the properties between TTF and activated charcoal led us to the conclusion that the former has more preferable properties as absorbent of radioactive iodine than the latter in all points studied. The results are summarized as follows: (1) The absorption of iodine on TTF in atmosphere was about twice as much as that on activated charcoal. Desorption of iodine from saturatedly absorbed iodine on TTF was practically negligible except trace amount of initial desorption, while that on activated charcoal was considerable (3%/50h) even in the air at room temperature. (2) Absorbed amount of iodine on activated charcoal decreased with increasing gaseous iodine concentration, air flow rate, on humidity of flowing-air. On the other hand, those factors scarcely affected that on TTF. Under an air flow rate of 1m/s, activated charcoal absorbs only 80% of iodine, while TTF absorbs more than 99%. (3) In flowing-air saturated with water vapor, iodine absorbed on activated charcoal was gradually liberated although by small amount (0.08%/100h), while that on TTF was much more stable for a long period (0.004%/100h). As a conclusion, TTF is considered to be useful as a quite effective radioactive iodine absorbent, especially in the case where protection from radioactive iodine should be serious, though it is expensive now. (author).

  17. Radioactive iodine absorbing properties of tetrathiafulvalene

    International Nuclear Information System (INIS)

    Ito, Tomiyasu; Nakamura, Asao; Nogawa, Norio; Oohashi, Kunio; Morikawa, Naotake.


    For the purpose of searching some effective absorbents of gaseous radioactive iodine, 16 substances considered as having an affinity for iodine were investigated with regular iodine and 125 I. In a preliminary survey, only tetrathiafulvalene (TTF) was found to have satisfactory absorbing properties comparable to activated charcoal. A further detailed comparison of the properties between TTF and activated charcoal led us to the conclusion that the former has more preferable properties as absorbent of radioactive iodine than the latter in all points studied. The results are summarized as follows: (1) The absorption of iodine on TTF in atmosphere was about twice as much as that on activated charcoal. Desorption of iodine from saturatedly absorbed iodine on TTF was practically negligible except trace amount of initial desorption, while that on activated charcoal was considerable (3%/50h) even in the air at room temperature. (2) Absorbed amount of iodine on activated charcoal decreased with increasing gaseous iodine concentration, air flow rate, on humidity of flowing-air. On the other hand, those factors scarcely affected that on TTF. Under an air flow rate of 1m/s, activated charcoal absorbs only 80% of iodine, while TTF absorbs more than 99%. (3) In flowing-air saturated with water vapor, iodine absorbed on activated charcoal was gradually liberated although by small amount (0.08%/100h), while that on TTF was much more stable for a long period (0.004%/100h). As a conclusion, TTF is considered to be useful as a quite effective radioactive iodine absorbent, especially in the case where protection from radioactive iodine should be serious, though it is expensive now. (author)

  18. Geochemical Cycling of Iodine Species in Soils

    International Nuclear Information System (INIS)

    Hu, Q.; Moran, J.E.; Blackwood, V.


    Iodine is an important element in studies of environmental protection and human health, global-scale hydrologic processes and nuclear nonproliferation. Biogeochemical cycling of iodine in soils is complex, because iodine occurs in multiple oxidation states and as inorganic and organic species that may be hydrophilic, atmophilic, and biophilic. In this study, we applied new analytical techniques to study the content and speciation of stable iodine in representative surface soils, and sorption and transport behavior of iodine species (iodide, iodate, and 4-iodoaniline) in sediments collected at numerous nuclear facilities in the United States, where anthropogenic 129 I from prior nuclear fuel processing activities poses an environmental risk. The surface soil samples were chosen for their geographic locations (e.g., near the ocean or nuclear facilities) and for their differing physico-chemical characteristics (organic matter, texture, etc). Extracted solutions were analyzed by IC and ICP-MS methods to determine iodine concentrations and to examine iodine speciation (iodide, iodate, and organic iodine). In natural soils, iodine is mostly (nearly 90% of total iodine) present as organic species, while inorganic iodine becomes important (up to 50%) only in sediments with low organic matter. Results from laboratory column studies, aimed at examining transport of different iodine species, showed much greater retardation of 4-iodoaniline than iodide or iodate. Careful attention must be given to potential interconversion among species when interpreting the biogeochemical behavior of iodine in the environment. In addition to speciation, input concentration and residence time effects will influence the biogeochemical cycling of anthropogenic 129I deposited on surface soils

  19. Recovery of iodine as iodine-125 from biological materials prior to assay

    International Nuclear Information System (INIS)

    Jones, G.B.; Belling, G.B.; Buckley, R.A.


    In biological tissues iodine is usually present as iodoamino acids or iodoproteins. The organic material must be oxidised and the iodine converted into iodate prior to the final spectrophotometric determination. At parts per billion (10 9 ) levels, recoveries of added iodine are difficult to measure precisely as iodine can easily be lost from the sample and added inorganic iodine may not be recovered in the same proportions as the naturally occurring iodine. Iodine-125 provides a much more sensitive, specific and accurate means of testing the recovery of nanogram amounts of iodine from biological tissues and it can be incorporated into tissues in the naturally occurring compounds. Plants can be grown in a solution culture containing iodine-125 and animals can be injected with iodine-125 to provide tissues where naturally occurring iodine compounds are labelled with radioactive iodine. These tissues can be used to examine the recovery of iodine after oven drying, freeze drying, alkali ashing and acid digestion of the samples. Experimental details are given for spinach, tobacco, oats, cauliflower and thyroid. Results are given and discussed. (author)

  20. Nighttime atmospheric chemistry of iodine (United States)

    Saiz-Lopez, Alfonso; Plane, John M. C.; Cuevas, Carlos A.; Mahajan, Anoop S.; Lamarque, Jean-François; Kinnison, Douglas E.


    Little attention has so far been paid to the nighttime atmospheric chemistry of iodine species. Current atmospheric models predict a buildup of HOI and I2 during the night that leads to a spike of IO at sunrise, which is not observed by measurements. In this work, electronic structure calculations are used to survey possible reactions that HOI and I2 could undergo at night in the lower troposphere, and hence reduce their nighttime accumulation. The new reaction NO3+ HOI → IO + HNO3 is proposed, with a rate coefficient calculated from statistical rate theory over the temperature range 260-300 K and at a pressure of 1000 hPa to be k(T) = 2.7 × 10-12 (300 K/T)2.66 cm3 molecule-1 s-1. This reaction is included in two atmospheric models, along with the known reaction between I2 and NO3, to explore a new nocturnal iodine radical activation mechanism. The results show that this iodine scheme leads to a considerable reduction of nighttime HOI and I2, which results in the enhancement of more than 25 % of nighttime ocean emissions of HOI + I2 and the removal of the anomalous spike of IO at sunrise. We suggest that active nighttime iodine can also have a considerable, so far unrecognized, impact on the reduction of the NO3 radical levels in the marine boundary layer (MBL) and hence upon the nocturnal oxidizing capacity of the marine atmosphere. The effect of this is exemplified by the indirect effect on dimethyl sulfide (DMS) oxidation.

  1. New iodine filter pack design

    International Nuclear Information System (INIS)

    Blackbee, B.A.


    To enable Naval Emergency Monitoring Teams to fulfil their role in the field it was necessary to locate or design a replacement filter pack for the collection of radioactive iodine air samples. Collaboration with the Berkeley Laboratories of the Central Electricity Generating Board provided the necessary starting point for a suitable type of package. Further development by NGTE (West Drayton) yielded the improved filter pack which is the subject of this memorandum. (author)

  2. Iodine frequency references for space

    International Nuclear Information System (INIS)

    Schuldt, Thilo; Braxmaier, Claus; Döringshoff, Klaus; Peters, Achim; Oswald, Markus; Johann, Ulrich


    Optical frequency references are a key element for the realization of future space missions. They are needed for missions related to tests of fundamental physics, gravitational wave detection, Earth observation and navigation and ranging. In missions such as GRACE follow-on or LISA the optical frequency reference is used as light source for high-sensitivity inter-satellite distance metrology. While cavity-based systems are current baseline e.g. for LISA, frequency stabilization on a hyperfine transition in molecular iodine near 532 nm is a promising alternative. Due to its absolute frequency, iodine standards crucially simplify the initial spacecraft acquisition procedures. Current setups fulfill the GRACE-FO and LISA frequency stability requirements and are realized near Engineering Model level. We present the current status of our developments on Elegant Breadboard (EBB) and Engineering Model (EM) level taking into account specific design criteria for space compatibility such as compactness (size iodine spectroscopy EM: 38 × 18 × 10 cm 3 ) and robustness. Both setups achieved similar frequency stabilities of ∼ 1 · 10 −14 at an integration time of 1 s and below 5 · 10 −15 at integration times between 10 s and 1000 s. Furthermore, we present an even more compact design currently developed for a sounding rocket mission with launch in 2017. (paper)

  3. Iodine Absorption Cells Purity Testing

    Directory of Open Access Journals (Sweden)

    Jan Hrabina


    Full Text Available This article deals with the evaluation of the chemical purity of iodine-filled absorption cells and the optical frequency references used for the frequency locking of laser standards. We summarize the recent trends and progress in absorption cell technology and we focus on methods for iodine cell purity testing. We compare two independent experimental systems based on the laser-induced fluorescence method, showing an improvement of measurement uncertainty by introducing a compensation system reducing unwanted influences. We show the advantages of this technique, which is relatively simple and does not require extensive hardware equipment. As an alternative to the traditionally used methods we propose an approach of hyperfine transitions’ spectral linewidth measurement. The key characteristic of this method is demonstrated on a set of testing iodine cells. The relationship between laser-induced fluorescence and transition linewidth methods will be presented as well as a summary of the advantages and disadvantages of the proposed technique (in comparison with traditional measurement approaches.

  4. Iodine chemistry in a reactor regulation

    International Nuclear Information System (INIS)

    Powers, D.A.


    Radioactive iodine has always been an important consideration in the regulation of nuclear power reactors to assure the health and safety of the public. Regulators adopted conservatively bounding predictions of iodine behavior in the earliest days of the development of nuclear power because there was so little known about either accidents or the chemistry of iodine. Today there is a flood of new information and understanding of the chemistry of iodine under reactor accident conditions. This paper offers some thoughts on how the community of scientists engaged in the study of iodine chemistry can present the results of their work so that it is more immediately adopted by the regulator. It is suggested that the scientific community consider the concept of consensus standards so effectively used within the engineering community to define the status of the study of radioactive iodine chemistry for reactor safety. (author) 9 refs

  5. Iodine chemistry in a reactor regulation

    Energy Technology Data Exchange (ETDEWEB)

    Powers, D A [Nuclear Regulatory Commission, Washington, DC (United States). Advisory Committee on Reactor Safeguards


    Radioactive iodine has always been an important consideration in the regulation of nuclear power reactors to assure the health and safety of the public. Regulators adopted conservatively bounding predictions of iodine behavior in the earliest days of the development of nuclear power because there was so little known about either accidents or the chemistry of iodine. Today there is a flood of new information and understanding of the chemistry of iodine under reactor accident conditions. This paper offers some thoughts on how the community of scientists engaged in the study of iodine chemistry can present the results of their work so that it is more immediately adopted by the regulator. It is suggested that the scientific community consider the concept of consensus standards so effectively used within the engineering community to define the status of the study of radioactive iodine chemistry for reactor safety. (author) 9 refs.

  6. Application of radiopharmaceuticals in iodine disorder studies

    International Nuclear Information System (INIS)

    Rajurkar, N.S.


    Iodine is an essential trace element and is of much interest in nutritional research. It is essential for the production of the hormones in the thyroid gland. However, deficiency or excess of iodine can cause disorders, commonly known as iodine disorders. Total quantity of iodine present in the body is 15-20 mg, mostly in thyroid gland and the safe and adequate intake of iodine is in the range of 50-200 μg.d -1 . Most of the iodine taken from food is accumulated in thyroid glands which plays a vital role in the well being as it controls growth and metabolism. In some people gland becomes over active (hyper thyroiditis) and in some people gland becomes sluggish (hypo thyroiditis). However, both the conditions are unhealthy and lead to serious consequences. The condition can be detected and treated with the help of radioiodine

  7. Criteria for safe working with iodine-125

    International Nuclear Information System (INIS)

    Linsley, G.S.


    Radio-immunoassay and other saturation assay tests involving the use of iodine-125 are finding wide application for the determination of hormone concentrations in biological fluids. In such tests, iodinations involving concentrations of a milli-curie per micro-litre are common. Iodine-125 presents a problem from the monitoring standpoint because of its low energy photon emission (27 and 35 keV). Iodine is preferentially taken up by the thyroid gland and work involving moderate amounts of radio-iodine may give rise to a significant hazard in an accident situation. The general precautions which should be taken in work with unsealed radioactive substances are briefly summarized, working limits for iodine-125 are identified, and methods of personal protection and monitoring in an emergency situation described. (author)

  8. Local radiolytic effectiveness of Auger electrons of iodine-125 in benzene-iodine solutions

    International Nuclear Information System (INIS)

    Uenak, P.; Uenak, T.


    High radiotoxicity of iodine-125 has been mainly attributed to the local radiolytic effects of Auger electrons on biological systems. In the present study, experimental and theoretical results are compared. The agreement between the experimental and theoretical results explains that the energy absorption of iodine aggregates has an important role in the radiolytic effectiveness of Auger electrons and iodine-125 in benzene-iodine solutions. (author) 18 refs.; 3 figs

  9. Measurement of thyroid volume, iodine concentration and total iodine content by CT and its clinical significance

    International Nuclear Information System (INIS)

    Nakaji, Shunsuke; Imanishi, Yoshimasa; Okamoto, Kyouko; Shinagawa, Toshihito


    Recently, Imanishi et al have developed new CT software for quantitative in vivo measurement of thyroid iodine. Using a CT system with the software, we measured volume, iodine concentration and total iodine content of thyroids in 63 controls and 435 patients with various diffuse thyroid diseases and thyroid nodules. In controls, all of them showed no difference between the sexes. Although the iodine concentration of the thyroid showed no difference among children, adults and seniles, the volume and total iodine content of the thyroid appeared smaller in children and seniles than in adults. In addition, although the volume and iodine concentration of the thyroid had two peaks in distribution, the total iodine content had almost normal distribution. Normal range of volume, iodine concentration and total iodine content in adults were 5.2-15.5 cm 3 , 0.28831-0.85919 mg/cm 3 and 2.35-11.69 mg, respectively. In thyroid nodule, there is no significant difference in volume, iodine concentration and total iodine content between benign and malignant nodules. All nodules with iodine concentration of less than 0.00007 mg/cm 3 were benign. No thyroid was higher in iodine concentration than the normal range although the thyroid was lower in 78.7% of patients with diffuse thyroid diseases. In all thyroids with increasing iodine concentration and total iodine content in medication course, thyroidal symptoms and signs were uncontrollable by the medication. In 43.8% of patients with long-period systemic diseases, the thyroid showed abnormality in any of the three. We concluded that quantitative in vivo measurement of thyroid iodine by CT could assist the diagnosis of thyroid diseases and decision of therapeutic methods. (author)

  10. Equine goiter associated with excess dietary iodine. (United States)

    Eroksuz, H; Eroksuz, Y; Ozer, H; Ceribasi, A O; Yaman, I; Ilhan, N


    Naturally occurring goiter cases are described in 2 newborn Arabian foals whose mares were supplemented with excess iodine during the final 24 w of the pregnancy. Six nursing foals and 2 mares were also affected clinically with thyroid hypertrophy. At least 12 times the maximum tolerable level of iodine supplementation was given, as the daily iodine intake for each mare was 299 mg. The prevalence of goiter cases was 2 and 9% in the mares and foals, respectively.

  11. Salivary gland dysfunction following radioactive iodine therapy

    International Nuclear Information System (INIS)

    Wiesenfeld, D.; Webster, G.; Cameron, F.; Ferguson, M.M.; MacFadyen, E.E.; MacFarlane, T.W.


    Radioactive iodine is used extensively for the treatment of thyrotoxicosis and thyroid carcinoma. Iodine is actively taken up by the salivary glands and, following its use, salivary dysfunction may result as a consequence of radiation damage. The literature is reviewed and a case is reported in which a patient presented with a significant increase in caries rate attributed to salivary dysfunction following radioactive iodine therapy for a thyroid carcinoma

  12. Population living in the Red Sea State of Sudan may need urgent intervention to correct the excess dietary iodine intake. (United States)

    Izzeldin, H S; Crawford, M A; Jooste, P L


    Both inadequate and high intakes of iodine are associated with thyroid disease and associated abnormalities. Consumption of foods deficient in iodine induces hypothyroidism. Conversely, excessive intake of the nutrient precipitates hyperthyroidism. Iodine deficiency causes impairment of thyroid hormonogenesis resulting in goiter (struma), cretinism which is associated with increased prenatal and infant mortality, deafness, motor disabilities and mental retardation due to damage during fetal and neonatal brain development. We have assessed the iodine status of school children from the locality of Port Sudan, Red Sea State of Eastern Sudan. The primary sources of iodine of the children are mainly iodized salt and rations supplied by local donors and various aid agencies operating in the Sudan. Male and female children (n=141), aged 6 to 12 years (median age 9.8 years), were selected for the survey using a multistage random sampling technique, between May 22 and August 25, 2006. All the children were assessed for urinary iodine and visible goiter. In addition, the iodine content of twenty salt samples was determined using the lodometric titration method and spot test kits. The components of other foods that are routinely consumed by the children and households were noted using a questionnaire form. Urinary iodine concentration exceeded 300 microg/l and 1000 microg/l in 65% and 9.9% of the children, respectively. The highest urinary iodine level was 1470 microg/l. The prevalence of visible goiter was 17%. All the salt samples collected from the schools had more than 150mg potassium iodate per kg of salt. The results of this pilot survey reveal that excessive intake of iodine in children exists in Port Sudan. Inappropriate and unregulated local fortification of salt and lack of monitoring of the imported and donated salt is the primary reason for the excessive intake. There is an urgent need for a regulatory mechanism during the process of iodine fortification and at

  13. Estimation of iodine intake from various urinary iodine measurements in population studies

    DEFF Research Database (Denmark)

    Vejbjerg, P.; Knudsen, N.; Perrild, H.


    Background: Iodine intake is often measured by a surrogate measure, namely urine iodine excretion as almost all ingested iodine is excreted in the urine. However, the methods for urine collection and the reporting of the results vary. These methods, and their advantages and disadvantages, are con...

  14. Molecular environment of iodine in naturally iodinated humic substances: Insight from X-ray absorption spectroscopy

    International Nuclear Information System (INIS)

    Schlegel, Michel L.; Mercier-Bion, Florence; Barre, Nicole; Reiller, Pascal; Moulin, Valerie


    The molecular environment of iodine in reference inorganic and organic compounds, and in dry humic and fulvic acids (HAs and FAs) extracted from subsurface and deep aquifers was probed by iodine L-3-edge X-ray absorption spectroscopy. The X-ray absorption near-edge structure (XANES) of iodine spectra from HAs and FAs resembled those of organic references and displayed structural features consistent with iodine forming covalent bonds with organic molecules. Simulation of XANES spectra by linear combination of reference spectra suggested the predominance of iodine forming covalent bonds to aromatic rings (aromatic-bound iodine). Comparison of extended X-ray absorption fine structure (EXAFS) spectra of reference and samples further showed that iodine was surrounded by carbon shells at distances comparable to those for references containing aromatic-bound iodine. Quantitative analysis of EXAFS spectra indicated that iodine was bound to about one carbon at a distance d(I-C) of 2.01(4)-2.04(9) angstrom, which was comparable to the distances observed for aromatic-bound iodine in references (1.99(1)-2.07(6) angstrom), and significantly shorter than that observed for aliphatic-bound iodine (2.15(2)-2.16(2) angstrom). These results are in agreement with previous conclusions from X-ray photoelectron spectroscopy and from electro-spray ionization mass spectrometry. These results collectively suggest that the aromatic-bound iodine is stable in the various aquifers of this study. (authors)

  15. 127I Moessbauer study of some oxygen bonded iodine(I) and iodine(III) complexes

    International Nuclear Information System (INIS)

    Bardhan, M.; Birchall, T.; Frampton, C.; Kapoor, P.


    127 I Moessbauer spectra have been recorded at 4.2 0 K for a series of oxygen bonded iodine(I) and iodine(III) complexes. The sign of the quadrupole coupling constant is dependant only on the primary arrangement of ligands about the central iodine nucleus whereas the magnitude and the asymmetry parameter are more sensitive to ligand electronegativity and type. (orig.)

  16. Iodine deficiency in pregnancy and the effects of maternal iodine supplementation on the offspring: a review

    NARCIS (Netherlands)

    Zimmermann, M.B.


    The World Health Organization (WHO) recently increased their recommended iodine intake during pregnancy from 200 to 250 µg/d and suggested that a median urinary iodine (UI) concentration of 150-249 µg/L indicates adequate iodine intake in pregnant women. Thyrotropin concentrations in blood collected

  17. Iodine requirements and the risks and benefits of correcting iodine deficiency in populations

    NARCIS (Netherlands)

    Zimmermann, M.B.


    Iodine deficiency has multiple adverse effects on growth and development due to inadequate thyroid hormone production that are termed the iodine deficiency disorders (IDD). IDD remains the most common cause of preventable mental impairment worldwide. IDD assessment methods include urinary iodine

  18. Absorption spectrum of Iodine around 5915 A

    International Nuclear Information System (INIS)


    The iodine absorption spectrum around 5915 A is of interest for many authors especially the hyperfine structure of the iodine line. Lodine absorption spectrum was obtained due to the interaction of iodine vapour with dye laser [(R6G) (0.5A) scanning range around 5915 A] which is pumped by(Ar + )laser absorption spectrum. The decrease in the peak of the transmission line around 5915 A shows the signal futher decreased by heating the iodine cell. This analysis has been done using a monochromator

  19. Hygienic assessment of radioactive iodine isotopes

    International Nuclear Information System (INIS)

    Vasilenko, I.Ya.


    Sources of radioactive iodine isotopes and their biological significance depending on the way of intake are discussed. The degree of food contamination by radioactive iodine as well as products, which serve as the source of its intake into the human body, and results of their processing are considered. The danger of radioactive iodine intake by different groups of population as well as thyroid irradiation effects are discussed. Description of activities, directed to the human body protection against radioactive iodine and assessment of these protection measures efficiency is presented

  20. Iodine-129 in thyroids of grazing animals

    International Nuclear Information System (INIS)

    Ballad, R.V.; Holman, D.W.; Hennecke, E.W.; Johnson, J.E.; Manuel, O.K.; Nicholson, L.M.


    A combination of neutron activation and mass spectrometry has been used to determine the concentrations of fissiogenic 129 I and stable 127 I in thyroids of grazing animals and in mineral iodine. The 129 I/ 127 I ratios are lowest in mineral iodine and in a given area lower in cow thyroids than in deer thyroids. Near saturation levels of mineral iodine in commercial feeds and salt licks may account for differences in the 129 I levels of cows and deer. Values of the 129 I/ 127 I ratio in deer appear to vary inversely with the iodine concentration of the thyroid. (author)

  1. Photochemistry of DNA containing iodinated cytosine

    Energy Technology Data Exchange (ETDEWEB)

    Rahn, R O; Stafford, R S [Oak Ridge National Lab., TN (USA)


    Irradiation at 313 nm of compounds containing iodinated cytosine moieties results in the photolysis of iodine. Photolysis occurs with a quantum yield of 0.022-0.024 for 5-iododeoxycytidine and 5-iododeoxycytidine monophosphate, and 0.004-0.008 for iodinated DNA as well as for iodinated polycytidylate. Photodegradation of the cytosine moiety occurs when air is present during irradiation, presumably due to the reaction of oxygen with the cytosyl radical formed when iodine is lost. This oxygen promoted photodegradation destroys the cytosine chromophore and is complete in the monomers but occurs to only a limited extent in the polymers. In the absence of oxygen or in the presence of ethanol, photodegradation is prevented and the loss of iodine leads exclusively to the formation of the cytosine chromophore. In DNA, the loss of iodine is accompanied by the formation of sugar damage and/or chain breaks. As measured by sedimentation in alkaline sucrose gradients, approximately one break is made for every six iodines lost in denatured DNA. The frequency of chain breakage per iodine photolyzed is reduced 2-fold in renatured DNA. Analysis in neutral gradients suggests that half of the breaks observed in alkali are alkali-labile bonds. Both ethanol and cysteamine reduce the number of chain breaks in alkali by approximately 3-fold.

  2. Iodine: It's Important in Patients that Require Parenteral Nutrition

    NARCIS (Netherlands)

    Zimmermann, M.B.


    Iodine deficiency has multiple adverse effects on growth and development because of inadequate thyroid hormone production. Four methods are generally recommended for assessment of iodine nutrition: urinary iodine concentration, thyroid size, and blood concentrations of thyroid-stimulating hormone

  3. FDA regulations regarding iodine addition to foods and labeling of foods containing added iodine12 (United States)

    Trumbo, Paula R


    The US Food and Drug Administration (FDA) regulates the addition of iodine to infant formulas, the iodization of salt, and the addition of salt and iodine to foods. The required amount of iodine in infant formulas is based on caloric content, and the label must provide the iodine content per 100 kcal. Cuprous iodide and potassium iodide may be added to table salt as a source of dietary iodine at a maximum amount of 0.01%; if added, the label must indicate that the salt is iodized. Table salt to which iodine has not been added must bear the statement, “This salt does not supply iodide, a necessary nutrient.” If a nutrient is to be appropriately added to a food for the purpose of correcting a dietary insufficiency, there should be sufficient scientific information available to demonstrate a nutritional deficiency and/or identify a public health problem. Furthermore, the population groups that would benefit from the proposed fortification should be identified. If iodine is added to a food, the percent Daily Value of iodine must be listed. There are no FDA regulations governing ingredient standards for dietary supplements. As a result, some dietary supplements include iodine and others do not. If a supplement contains iodine, the Supplement Facts label must list iodine as a nutrient ingredient. If iodine is not listed on the Supplement Facts label, then it has not been added. There are similarities between the FDA, which establishes US food regulations and policies, and the Codex Alimentarius (Codex), which develops international food standards and guidelines under the aegis of the FAO and the WHO. Both the FDA and Codex call for the labeling of table salt to indicate fortification with iodine, voluntary labeling of iodine on foods, and a Daily Value (called a Nutrient Reference Value by Codex) of 150 μg for iodine. PMID:27534626

  4. Serum thyroglobulin and urinary iodine concentration are the most appropriate indicators of iodine status and thyroid function under conditions of increasing iodine supply in schoolchildren in Benin

    NARCIS (Netherlands)

    van den Briel, T.; West, C. E.; Hautvast, J. G.; Vulsma, T.; de Vijlder, J. J.; Ategbo, E. A.


    Iodine deficiency control programs have greatly reduced iodine deficiency disorders worldwide. For monitoring changes in iodine status, different indicators may be used. The aim of this study was to evaluate the suitability of indicators of iodine status and thyroid function, thyroglobulin (Tg),

  5. Consuming iodine enriched eggs to solve the iodine deficiency endemic for remote areas in Thailand

    Directory of Open Access Journals (Sweden)

    Teeyapant Punthip


    Full Text Available Abstract Background Evidence showed that the occurrence of iodine deficiency endemic areas has been found in every provinces of Thailand. Thus, a new pilot programme for elimination of iodine deficiency endemic areas at the community level was designed in 2008 by integrating the concept of Sufficient Economic life style with the iodine biofortification of nutrients for community consumption. Methods A model of community hen egg farm was selected at an iodine deficiency endemic area in North Eastern part of Thailand. The process for the preparation of high content iodine enriched hen food was demonstrated to the farm owner with technical transfer in order to ensure the sustainability in the long term for the community. The iodine content of the produced iodine enriched hen eggs were determined and the iodine status of volunteers who consumed the iodine enriched hen eggs were monitored by using urine iodine excretion before and after the implement of iodine enrichment in the model farm. Results The content of iodine in eggs from the model farm were 93.57 μg per egg for the weight of 55 - 60 g egg and 97.76 μg for the weight of 60 - 65 g egg. The biological active iodo-organic compounds in eggs were tested by determination of the base-line urine iodine of the volunteer villagers before and after consuming a hard boiled iodine enriched egg per volunteer at breakfast for five days continuous period in 59 volunteers of Ban Kew village, and 65 volunteers of Ban Nong Nok Kean village. The median base-line urine iodine level of the volunteers in these two villages before consuming eggs were 7.00 and 7.04 μg/dL respectively. After consuming iodine enriched eggs, the median urine iodine were raised to the optimal level at 20.76 μg/dL for Ban Kew and 13.95 μg/dL for Ban Nong Nok Kean. Conclusions The strategic programme for iodine enrichment in the food chain with biological iodo-organic compound from animal origins can be an alternative method to

  6. Distribution and Translocation of 141Ce (III) in Horseradish (United States)

    Guo, Xiaoshan; Zhou, Qing; Lu, Tianhong; Fang, Min; Huang, Xiaohua


    Background and Aims Rare earth elements (REEs) are used in agriculture and a large amount of them contaminate the environment and enter foods. The distribution and translocation of 141Ce (III) in horseradish was investigated in order to help understand the biochemical behaviour and toxic mechanism of REEs in plants. Method The distribution and translocation of 141Ce (III) in horseradish were investigated using autoradiography, liquid scintillation counting (LSC) and electron microscopic autoradiography (EMARG) techniques. The contents of 141Ce (III) and nutrient elements were analysed using an inductively coupled plasma-atomic emission spectrometer (ICP-AES). Results The results from autoradiography and LSC indicated that 141Ce (III) could be absorbed by horseradish and transferred from the leaf to the leaf-stalk and then to the root. The content of 141Ce (III) in different parts of horseradish was as follows: root > leaf-stalk > leaf. The uptake rates of 141Ce (III) in horseradish changed with the different organs and time. The content of 141Ce (III) in developing leaves was greater than that in mature leaves. The results from EMARG indicated that 141Ce (III) could penetrate through the cell membrane and enter the mesophyll cells, being present in both extra- and intra-cellular deposits. The contents of macronutrients in horseradish were decreased by 141Ce (III) treatment. Conclusions 141Ce (III) can be absorbed and transferred between organs of horseradish with time, and the distribution was found to be different at different growth stages. 141Ce (III) can enter the mesophyll cells via apoplast and symplast channels or via plasmodesmata. 141Ce (III) can disturb the metabolism of macronutrients in horseradish. PMID:17921527

  7. 21 CFR 146.141 - Canned orange juice. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned orange juice. 146.141 Section 146.141 Food... Beverages § 146.141 Canned orange juice. (a) Canned orange juice is the food prepared from orange juice as specified in § 146.135 or frozen orange juice as specified in § 146.137, or a combination of both, to which...

  8. Experimental study on iodine chemistry (EXSI) - Containment experiments with elemental iodine

    International Nuclear Information System (INIS)

    Kaerkelae, T.; Auvinen, A.; Holm, J.; Ekberg, C.; Glaenneskog, H.


    The behaviour of iodine during a severe accident has been studied in several experimental programs, ranging from the large-scale PHEBUS FP tests and intermediate-scale ThAI tests to numerous separate effect studies. Oxidation of iodine in gas phase has been one of the greatest remaining uncertainties in iodine behaviour during a severe accident. In this study the possible formation of iodine oxide aerosol due to radiolytic oxidation of gaseous iodine is experimentally tested and the reaction products are analysed. The experimental facility applied in this study is based on the sampling system built at VTT for ISTP program project CHIP conducted IRSN. The experimental facility and the measuring technology are sophisticated and unique in the area of nuclear research as well as in the field of aerosol science. The results from the experiments show an extensive particle formation when ozone and gaseous iodine react with each other. The formed particles were collected on filters, while gaseous iodine was trapped into bubbles. The particles were iodine oxides and the size of particles was approximately 100 nm. The transport of gaseous iodine through the facility decreased when both gaseous iodine and ozone were fed together into facility. Experimental study on radiolytic oxidation of iodine was conducted in co-operation between VTT and Chalmers University of Technology as a part of the NKS-R programs. (author)

  9. Experimental study on iodine chemistry (EXSI) - Containment experiments with elemental iodine

    Energy Technology Data Exchange (ETDEWEB)

    Kaerkelae, T.; Auvinen, A. (VTT Technical Research Centre of Finland (Finland)); Holm, J.; Ekberg, C. (Chalmers Univ. of Technology (Sweden)); Glaenneskog, H. (Vattenfall Power Consultant (Sweden))


    The behaviour of iodine during a severe accident has been studied in several experimental programs, ranging from the large-scale PHEBUS FP tests and intermediate-scale ThAI tests to numerous separate effect studies. Oxidation of iodine in gas phase has been one of the greatest remaining uncertainties in iodine behaviour during a severe accident. In this study the possible formation of iodine oxide aerosol due to radiolytic oxidation of gaseous iodine is experimentally tested and the reaction products are analysed. The experimental facility applied in this study is based on the sampling system built at VTT for ISTP program project CHIP conducted IRSN. The experimental facility and the measuring technology are sophisticated and unique in the area of nuclear research as well as in the field of aerosol science. The results from the experiments show an extensive particle formation when ozone and gaseous iodine react with each other. The formed particles were collected on filters, while gaseous iodine was trapped into bubbles. The particles were iodine oxides and the size of particles was approximately 100 nm. The transport of gaseous iodine through the facility decreased when both gaseous iodine and ozone were fed together into facility. Experimental study on radiolytic oxidation of iodine was conducted in co-operation between VTT and Chalmers University of Technology as a part of the NKS-R programs. (author)

  10. Altering iodine metabolism in the calf by feeding iodine-binding agents

    International Nuclear Information System (INIS)

    Miller, J.K.; Swanson, E.W.; Lyke, W.A.; Byrne, W.F.


    Effects of feeding cottonseed meal and anion-exchange resin on iodine absorption and excretion by calves were investigated. Each additional amount of resin fed from 0.3 to 3.5 g/kg body weight further increased fecal excretion from single oral iodine-131 and intravenous iodine-125 doses. By feeding 3 to 10 g cottonseed meal/kg body weight, excretion of oral iodine-131 given daily was increased 7 to 94 percent in feces and reduced as much as 35 percent in urine, but plasma iodine-131 was not changed. Introducing 1 g resin/kg body weight daily into the diet increased fecal iodine-131 excretion three to five times that with cottonseed meal alone and reduced both plasma and urinary iodine-131. The same amount of resin fed daily had similar effects on excretion of iodine-131 injected subcutaneously each day. Although iodine depletion by a highly efficient iodine binder (resin) in the gastrointestinal tract is probable, iodine binding by a natural feed constituent (cottonseed meal) was relatively inefficient. (U.S.)

  11. Altering iodine metabolism in the calf by feeding iodine-binding agents

    International Nuclear Information System (INIS)

    Miller, J.K.; Swanson, E.W.; Lyke, W.A.; Byrne, W.F.


    Effects of feeding cottonseed meal and anion-exchange resin on iodine absorption and excretion by calves were investigated. Each additional amount of resin fed from 0.3 to 3.5 g/kg body weight further increased fecal excretion from single oral iodine-131 and intravenous iodine-125 doses. By feeding 3 to 10 g cottonseed meal/kg body weight, excretion of oral iodine-131 given daily was increased 7 to 94 percent in feces and reduced as much as 35 percent in urine, but plasma iodine-131 was not changed. Introducing 1 g resin/kg body weight daily into the diet increased fecal iodine-131 excretion three to five times that with cottonseed meal alone and reduced both plasma and urinary iodine-131. The same amount of resin fed daily had similar effects on excretion of iodine-131 injected subcutaneously each day. Although iodine depletion by a highly efficient iodine binder (resin) in the gastrointestinal tract is probable, iodine binding by a natural feed constituent (cottonseed meal) was relatively inefficient. (auth)

  12. Iodine content in bread and salt in Denmark after iodization and the influence on iodine intake

    DEFF Research Database (Denmark)

    Rasmussen, Lone Banke; Ovesen, Lars; Christensen, Tue


    Objective To measure the iodine content in bread and household salt in Denmark after mandatory iodine fortification was introduced and to estimate the increase in iodine intake due to the fortification. Design The iodine content in rye breads, wheat breads and salt samples was assessed. The incre......, and the current fortification level of salt ( 13 ppm) seems reasonable.......% of the rye breads and 90% of the wheat breads were iodized. The median iodine intake from bread increased by 25 ( 13-43) mu g/day and the total median iodine intake increased by 63 (36-104) mu g/day. Conclusions The fortification of bread and salt has resulted in a desirable increase in iodine intake...

  13. Method for immobilizing radioactive iodine

    International Nuclear Information System (INIS)

    Babad, H.; Strachan, D. M.


    Radioactive iodine, present as alkali metal iodides or iodates in an aqueous solution, is incorporated into an inert solid material for long-term storage by adding to the solution a stoichiometric amount with respect to the formation of a sodalite (3M2O.3Al2O3. 6SiO2.2MX, where M alkali metal; X I - or IO 3- ) of an alkali metal, alumina and silica, stirring the solution to form a homogeneous mixture, drying the mixture to form a powder, compacting and sintering the compacted powder at 1073 to 1373 K (800 0 to 1100 0 C.) for a time sufficient to form sodalite

  14. Iodine laser for fusion research

    International Nuclear Information System (INIS)

    Dance, B.


    The most powerful iodine laser in the world, known as Asterix IV, is being prepared for operation at The Max Plank-Institut fuer Quantenoptik at Garching, near Munich, in West Germany. It is expected to produce 2kJ pulses of 1ns duration. Shorter pulses of about 200 ps duration should be obtainable at power levels of over 5 TW. Pulses of maximum power will be available every 20 minutes; this frequency is expected to be adequate for fusion experiments, although the short rate could be raised if necessary by greater gas circulation and cooling. (Author)

  15. Iodine Absorption Cells Purity Testing

    Czech Academy of Sciences Publication Activity Database

    Hrabina, Jan; Zucco, M.; Philippe, Ch.; Pham, Minh Tuan; Holá, Miroslava; Acef, O.; Lazar, Josef; Číp, Ondřej


    Roč. 17, č. 1 (2017), s. 1-13, č. článku 17010102. ISSN 1424-8220 R&D Projects: GA ČR GA15-18430S; GA MŠk(CZ) LO1212; GA MŠk ED0017/01/01 Institutional support: RVO:68081731 Keywords : iodine cells * absorption spectroscopy * laser spectroscopy * laser standards * frequency stability Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 2.677, year: 2016

  16. Craniopharyngioma: a clinicopathological study of 141 cases. (United States)

    Tavangar, Seyed Mohammad; Larijani, Bagher; Mahta, Ali; Hosseini, Seyed Mehdi Abdolahzadeh; Mehrazine, Masoud; Bandarian, Fatemeh


    Craniopharyngioma is a tumor of the suprasellar region that histologically has two distinct variants with some differences in clinical behavior. The papillary type is almost always seen in adults and has a more indolent course compared with the adamantinomatous type, which is more common in childhood. In the present study, surgical specimens of craniopharyngiomas from 141 patients were reviewed. Their histomorphologic types were determined and the clinical features and prognosis of each group were assessed. The sizes of papillary type tumors were smaller and during the follow-up period there was no recurrence in the squamous papillary group. Aside from surgical resection (total vs subtotal), the recurrence rate for papillary type craniopharyngioma was lower than for adamantinomatous type. Histologic typing of craniopharyngioma especially in adults is useful for decision making with regard to treatment and follow-up.

  17. Radiative β-decay in 141Ce

    International Nuclear Information System (INIS)

    Rao, K.S.G.; Sanjeeviah, H.


    The spectral distribution of the continuous gamma radiation accompanying non-unique first forbidden β-decay of 32 d 141 Ce has been measured in the energy range 200-560 keV with a 4.5 cm x 5.08 cm NaI(Tl) scintillation spectrometer. The source electrons were eliminated using an electromagnet. The raw spectrum was corrected for pile-up, finite energy resolution, Compton electron distribution and geometrical γ-detection efficiency using the method of Liden and Starfelt. The corrected distribution is compared with the direct and detour theories of Lewis and Ford, and Ford and Martin, respectively. Total disagreement between experiment and theory was observed over the entire region of the investigated spectrum. In the energy region from 200 to 350 keV, however, the measured spectrum lies between the direct and detour theories. (orig.)

  18. Iodine stress corrosion cracking in Zircaloy

    International Nuclear Information System (INIS)

    Andrade, A.H.P. de; Pelloux, R.M.N.


    The subcritical growth of iodine-induced cracks in unirradiated Zircaloy plates is investigated as a function of the stress intensity factor K. The testing variables are: crystallographic texture (f-Number), microstructure (grain directionaly), heat treatment (stress relieved vs recrystallized plate), and temperature. The iodine partial pressure is 40Pa. (author) [pt

  19. 21 CFR 558.295 - Iodinated casein. (United States)


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Iodinated casein. 558.295 Section 558.295 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS... in Animal Feeds § 558.295 Iodinated casein. (a) Approvals. See 017762 in § 510.600(c) of this chapter...

  20. Sorption of iodine onto Japanese soils

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Satoshi [National Inst. of Radiological Sciences, Hitachinaka, Ibaraki (Japan). Nakaminato Lab. Branch


    Soils were collected from various regions of Japan. Iodine concentrations in the soils were quantitatively determined. The adsorption ratio and the distribution coefficients of iodine onto the soils were derived and effects of co-existing ions were studied. (J.P.N.)

  1. Iodine deficiency disorders in Sarawak, Malaysia. (United States)

    Kiyu, A; Tambi, Z; Ahmad, Y


    The state of Sarawak in Malaysia has a high prevalence of iodine deficiency disorders (IDD). This has been revealed through a review of goitre surveys that were carried out in the State from the early 1970s to the 1990s. The primary cause was low iodine intake. Contributory factors were low iodine content in the soil and water as well as high cassava consumption. Virtual elimination of IDD is one of the nutritional goals of the IDD prevention and control programs. The strategies adopted include the iodination of coarse salt, which is sold in the market by shopkeepers and also provided free from government health clinics; legislation requiring that salt sold in IDD-gazetted areas must be iodised; and the use of iodinators to iodise water supplied by the gravity-feed system to villages and boarding schools in rural areas. The indicators used in the monitoring and evaluation of the program include the availability of iodised salt in the market and households, iodine levels in water supply that had been fitted with iodinators, goitre volume measured by ultrasound, and urinary iodine excretion among school children.

  2. Sorption of iodine onto Japanese soils

    International Nuclear Information System (INIS)

    Yoshida, Satoshi


    Soils were collected from various regions of Japan. Iodine concentrations in the soils were quantitatively determined. The adsorption ratio and the distribution coefficients of iodine onto the soils were derived and effects of co-existing ions were studied. (J.P.N.)

  3. Iodine budget in surface waters from Atacama: Natural and anthropogenic iodine sources revealed by halogen geochemistry and iodine-129 isotopes

    International Nuclear Information System (INIS)

    Álvarez, Fernanda; Reich, Martin; Snyder, Glen; Pérez-Fodich, Alida; Muramatsu, Yasuyuki; Daniele, Linda; Fehn, Udo


    Iodine enrichment in the Atacama Desert of northern Chile is widespread and varies significantly between reservoirs, including nitrate-rich “caliche” soils, supergene Cu deposits and marine sedimentary rocks. Recent studies have suggested that groundwater has played a key role in the remobilization, transport and deposition of iodine in Atacama over scales of millions-of-years. However, and considering that natural waters are also anomalously enriched in iodine in the region, the relative source contributions of iodine in the waters and its extent of mixing remain unconstrained. In this study we provide new halogen data and isotopic ratios of iodine ("1"2"9I/I) in shallow seawater, rivers, salt lakes, cold and thermal spring water, rainwater and groundwater that help to constrain the relative influence of meteoric, marine and crustal sources in the Atacama waters. Iodine concentrations in surface and ground waters range between 0.35 μM and 26 μM in the Tarapacá region and between 0.25 μM and 48 μM in the Antofagasta region, and show strong enrichment when compared with seawater concentrations (I = ∼0.4 μM). In contrast, no bromine enrichment is detected (1.3–45.7 μM for Tarapacá and 1.7–87.4 μM for Antofagasta) relative to seawater (Br = ∼600 μM). These data, coupled to the high I/Cl and low Br/Cl ratios are indicative of an organic-rich sedimentary source (related with an “initial” fluid) that interacted with meteoric water to produce a mixed fluid, and preclude an exclusively seawater origin for iodine in Atacama natural waters. Iodine isotopic ratios ("1"2"9I/I) are consistent with halogen chemistry and confirm that most of the iodine present in natural waters derives from a deep initial fluid source (i.e., groundwater which has interacted with Jurassic marine basement), with variable influence of at least one atmospheric or meteoric source. Samples with the lowest isotopic ratios ("1"2"9I/I from ∼215 to ∼1000 × 10"

  4. The high-power iodine laser (United States)

    Brederlow, G.; Fill, E.; Witte, K. J.

    The book provides a description of the present state of the art concerning the iodine laser, giving particular attention to the design and operation of pulsed high-power iodine lasers. The basic features of the laser are examined, taking into account aspects of spontaneous emission lifetime, hyperfine structure, line broadening and line shifts, stimulated emission cross sections, the influence of magnetic fields, sublevel relaxation, the photodissociation of alkyl iodides, flashlamp technology, excitation in a direct discharge, chemical excitation, and questions regarding the chemical kinetics of the photodissociation iodine laser. The principles of high-power operation are considered along with aspects of beam quality and losses, the design and layout of an iodine laser system, the scalability and prospects of the iodine laser, and the design of the single-beam Asterix III laser.

  5. Treatment of hyperthyroidism with radioactive iodine

    International Nuclear Information System (INIS)

    Bell, R.L.


    While radioactive iodine is clearly the therapy of choice for Graves' disease (even in younger patients) the use of radioactive iodine for therapy of the toxic multinodular or uninodular goiter presents an entirely different problem. Although these two entities can be treated with radioactive iodine provided there is some suppression of the tissue that is not autonomous, transient release of thyroid hormone may induce symptoms of thyroid storm in the very large multinodular toxic goiter treated with radioiodine therapy. These toxic nodules generally require much larger doses of radioiodine than is commonly used for classical Graves' disease and may either require fractional administration of radioisotopes or concomitant use of antithyroid drugs and iodides. In general, surgery remains the treatment of choice for large toxic multinodular goiters, after proper preparation by medical means including radioactive iodine. Radioactive iodine therapy for hyperthyroidism is contraindicated in pregnancy and generally is not used in children below five years of age. (U.S.)

  6. Iodine in eggs in an iodopenic region

    International Nuclear Information System (INIS)

    Bogdanov, Bogdan; Gonev, Mihail; Tadzher, Isak S.


    Macedonia is a region with a recognized precarious iodine balance, due to iodine deficiency in almost all water sources. Five percent iodine intake through eggs in the daily diet of adults is significant in this balance. The content of 40-220 micro g I - /kg eggs is lower than the British one (average 340-370 micro g I - /kg). The amount per egg is 3-6 micro g I' far less than 711 micro g I - in special iodine-enriched eggs designed for treatment of thyroid and metabolic disorders by feeding chickens with kelp additives. The iodine content of our manufacturers, provides substantial part of former Yugoslavia with eggs, is entirely dependent on imported fishmeal in chicken feed. (Author)

  7. Overview of the ACEX project iodine work

    Energy Technology Data Exchange (ETDEWEB)

    Merilo, M


    The ACEX project is an internationally sponsored research program that focuses on several aspects of severe accidents. The areas addressed are iodine behavior in containments, pool scrubbing, molten corium concrete interactions, and ex-vessel core debris coolability. These areas all represent extensions to the previous and current ACE and MACE programs respectively. The ACE-Phase B (iodine) project, and other recent research efforts, have clarified the roles of the important phenomena that influence iodine volatility in reactor containments during severe accidents. The ACE Iodine Chemistry Subcommittee concluded that even though enough data has been generated to support reasonably good quantification of the important phenomena, a few important areas remain where quantification is still uncertain. This is due to a lack of agreement on how to utilize the existing database, as well as the possible absence of critical test and/or property data. Technical resolution of the overall iodine behavior issue is therefore not feasible until these uncertainties are fully assessed and practical solutions have been identified, implemented, and verified. The overall objectives of the ACEX iodine research program are to ensure that the iodine database can be used to predict the airborne concentration of iodine, the conditions for iodine reservoir stability, and to provide a mechanistic understanding for these phenomena. The first phase of this work involves a comprehensive review and interpretation of the existing database in order to formulate practical strategies for dealing with significant uncertainties and/or deficiencies. Several projects are underway involving the effects of organic reactions and structural surface interactions. In addition effort is being expended on standardizing the aqueous iodine kinetics database, specifying useful mass transfer models, and defining methodology for pH prediction. (Abstract Truncated)

  8. Content iodine in sauces of type emulsion

    Directory of Open Access Journals (Sweden)

    M. Bakirov


    Full Text Available Introduction. The scarcity of natural resources arouse a necessity to find additional sources of protein, fat, carbohydrates, and their complexes with scarce mineral compounds. Therefore, a relevant issue is to enrich the diets deficient iodine compounds through research and development of new food products. Materials and methods. Investigation of iodine content in emulsion-type sauces at all stages was performed using Xray -fluorescence analyzer «Elvax». X-ray -fluorescence method consists of the appearance characteristic X-radiation of atoms of a chemical element at infringement they the primary X-ray irradiation. Results and discussion. Investigated for the determination of organic and inorganic forms of iodine in content of food items, and installed the total loss of iodine in sauces after cooking and storage at +5 ... +10 ° C for 30 days. Using iodine-proteinaceous additive from 0.5 ... 2.5% by mass of iodine 0.01% can be achieved from 15 to 50% of the human daily requirement by iodine. The resulting product does not lose its organoleptic, physico - chemical, consumer characteristics and meets the requirements of normative documents. As a result of our research, it was found that the addition of the supplements enriched protein-mineral (SEPM in composition sauces does not adversely affect the physical -chemical characteristics of sauces, but due to the stabilizing effect of additives iodine-proteinaceous increased emulsion stability up to 98 - 100% without additional foo d additives (emulsifiers. This additive has passed a series of tests that indicate on compliance with requirements normative and technical documentation. Conclusions. Used methodical approach allowed us to estimate the level of organic and inorganic iodine, as well as describe in more detail and correctly interpret the chemical composition of foods fortified with iodine and predict their health properties.

  9. Overview of the ACEX project iodine work

    International Nuclear Information System (INIS)

    Merilo, M.


    The ACEX project is an internationally sponsored research program that focuses on several aspects of severe accidents. The areas addressed are iodine behavior in containments, pool scrubbing, molten corium concrete interactions, and ex-vessel core debris coolability. These areas all represent extensions to the previous and current ACE and MACE programs respectively. The ACE-Phase B (iodine) project, and other recent research efforts, have clarified the roles of the important phenomena that influence iodine volatility in reactor containments during severe accidents. The ACE Iodine Chemistry Subcommittee concluded that even though enough data has been generated to support reasonably good quantification of the important phenomena, a few important areas remain where quantification is still uncertain. This is due to a lack of agreement on how to utilize the existing database, as well as the possible absence of critical test and/or property data. Technical resolution of the overall iodine behavior issue is therefore not feasible until these uncertainties are fully assessed and practical solutions have been identified, implemented, and verified. The overall objectives of the ACEX iodine research program are to ensure that the iodine database can be used to predict the airborne concentration of iodine, the conditions for iodine reservoir stability, and to provide a mechanistic understanding for these phenomena. The first phase of this work involves a comprehensive review and interpretation of the existing database in order to formulate practical strategies for dealing with significant uncertainties and/or deficiencies. Several projects are underway involving the effects of organic reactions and structural surface interactions. In addition effort is being expended on standardizing the aqueous iodine kinetics database, specifying useful mass transfer models, and defining methodology for pH prediction. The results of this work are expected to identify where additional data

  10. Low-level seaweed supplementation improves iodine status in iodine-insufficient women. (United States)

    Combet, Emilie; Ma, Zheng Feei; Cousins, Frances; Thompson, Brett; Lean, Michael E J


    Iodine insufficiency is now a prominent issue in the UK and other European countries due to low intakes of dairy products and seafood (especially where iodine fortification is not in place). In the present study, we tested a commercially available encapsulated edible seaweed (Napiers Hebridean Seagreens® Ascophyllum nodosum species) for its acceptability to consumers and iodine bioavailability and investigated the impact of a 2-week daily seaweed supplementation on iodine concentrations and thyroid function. Healthy non-pregnant women of childbearing age, self-reporting low dairy product and seafood consumption, with no history of thyroid or gastrointestinal disease were recruited. Seaweed iodine (712 μg, in 1 g seaweed) was modestly bioavailable at 33 (interquartile range (IQR) 28-46) % of the ingested iodine dose compared with 59 (IQR 46-74) % of iodine from the KI supplement (n 22). After supplement ingestion (2 weeks, 0·5 g seaweed daily, n 42), urinary iodine excretion increased from 78 (IQR 39-114) to 140 (IQR 103-195) μg/l (Pseaweed was palatable and acceptable to consumers as a whole food or as a food ingredient and effective as a source of iodine in an iodine-insufficient population. In conclusion, seaweed inclusion in staple foods would serve as an alternative to fortification of salt or other foods with KI.

  11. Urinary Iodine Clearance following Iodinated Contrast Administration: A Comparison of Euthyroid and Postthyroidectomy Subjects

    Directory of Open Access Journals (Sweden)

    Janice D. Ho


    Full Text Available Purpose. To compare iodine clearance following iodinated contrast administration in thyroidectomised thyroid cancer patients and euthyroid individuals. Methods. A convenience population (6 thyroidectomised thyroid cancer patients and 7 euthyroid controls was drawn from patients referred for iodinated contrast-enhanced computed tomography (CT studies. Subjects had sequential urine samples collected up to 6 months (50 samples from the thyroidectomised and 63 samples from the euthyroid groups. t-tests and generalised estimating equations (GEE were used to test for group differences in urinary iodine creatinine ratios. Results. Groups had similar urinary iodine creatinine ratios at baseline, with a large increase 2 weeks following iodinated contrast (P=0.005. Both groups had a return of urinary iodine creatinine ratios to baseline by 4 weeks, with no significant group differences overall or at any time point. Conclusions. Thyroidectomised patients did not have a significantly different urinary iodine clearance than euthyroid individuals following administration of iodinated contrast. Both had a return of urinary iodine creatinine ratios to baseline within 4 weeks.

  12. 7 CFR 58.141 - Alternate quality control program. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Alternate quality control program. 58.141 Section 58... Service 1 Quality Specifications for Raw Milk § 58.141 Alternate quality control program. When a plant has in operation an acceptable quality program, at the producer level, which is approved by the...

  13. 19 CFR 141.1 - Liability of importer for duties. (United States)


    ... Customs by the broker. (c) Claim against estate of importer. The claim of the Government for unpaid duties... 19 Customs Duties 2 2010-04-01 2010-04-01 false Liability of importer for duties. 141.1 Section 141.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT...

  14. 40 CFR 141.41 - Special monitoring for sodium. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Special monitoring for sodium. 141.41... and Prohibition on Lead Use § 141.41 Special monitoring for sodium. (a) Suppliers of water for... distribution system for the determination of sodium concentration levels; samples must be collected and...

  15. 25 CFR 141.14 - Trade in livestock restricted. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Trade in livestock restricted. 141.14 Section 141.14... livestock restricted. (a) No person other than an enrolled member of the tribe or any association... livestock from tribal members without a special permit issued by the Commissioner. (b) The Commissioner...

  16. 40 CFR 141.400 - General requirements and applicability. (United States)


    ... system with fecally contaminated source water or with significant deficiencies subject to the treatment... 40 Protection of Environment 22 2010-07-01 2010-07-01 false General requirements and applicability. 141.400 Section 141.400 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER...

  17. 40 CFR 141.171 - Criteria for avoiding filtration. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Criteria for avoiding filtration. 141.171 Section 141.171 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection...

  18. 40 CFR 141.13 - Maximum contaminant levels for turbidity. (United States)


    ... turbidity. 141.13 Section 141.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Maximum contaminant levels for turbidity. The maximum contaminant levels for turbidity are applicable to... part. The maximum contaminant levels for turbidity in drinking water, measured at a representative...

  19. 40 CFR 141.25 - Analytical methods for radioactivity. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Analytical methods for radioactivity... § 141.25 Analytical methods for radioactivity. (a) Analysis for the following contaminants shall be conducted to determine compliance with § 141.66 (radioactivity) in accordance with the methods in the...

  20. 12 CFR 410.141-410.148 - [Reserved (United States)


    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.141-410.148 Section 410.141-410.148 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...

  1. 26 CFR 1.141-6 - Allocation and accounting rules. (United States)


    ... 1.141-6 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Tax Exemption Requirements for State and Local Bonds § 1.141-6.... Thus, allocations generally may be made using any reasonable, consistently applied accounting method...

  2. 40 CFR 141.134 - Reporting and recordkeeping requirements. (United States)


    ... meeting the criterion in § 141.135(a)(2)(vi). (vi) The running annual average of source water alkalinity for systems meeting the criterion in § 141.135(a)(2)(iii) and of treated water alkalinity for systems...) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Disinfectant Residuals...

  3. 21 CFR 150.141 - Artificially sweetened fruit jelly. (United States)


    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Artificially sweetened fruit jelly. 150.141 Section 150.141 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... locust bean gum), guar gum, gum karaya, gum tragacanth, algin (sodium alginate), sodium...

  4. 37 CFR 1.41 - Applicant for patent. (United States)


    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Applicant for patent. 1.41 Section 1.41 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES National Processing Provisions Who May Apply for A...

  5. 14 CFR 121.141 - Airplane flight manual. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane flight manual. 121.141 Section 121... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Manual Requirements § 121.141 Airplane flight manual. (a) Each certificate holder shall keep a current approved airplane flight manual for each type of...

  6. 14 CFR 141.11 - Pilot school ratings. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot school ratings. 141.11 Section 141.11 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) SCHOOLS AND... rating course. (x) Aircraft type rating course. (2) Special preparation courses. (Appendix K). (i) Pilot...

  7. 40 CFR 141.205 - Content of the public notice. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Content of the public notice. 141.205 Section 141.205 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS..., especially those who may not have received this notice directly (for example, people in apartments, nursing...

  8. Iodine tablets - many benefits and few disadvantages

    International Nuclear Information System (INIS)

    Paile, W.


    The number of thyroid cancers among children has increased steeply around Chernobyl after the nuclear catastrophe. An iodine tablet taken at the right time would have protected the thyroid from the effects of radioiodine. Nuclear fallout may contain large amounts of radioactive iodine. If this enters the body, either through inhalation or ingestion, most of it ends up in the thyroid. As a result, the thyroid may be exposed to a considerable radiation dose. High doses endanger the functioning of the thyroid, and even smaller doses may cause benign or malignant tumours in the thyroid. Sensitivity of the thyroid to radiation depends largely on the person's age. The younger the child, the higher the risk. Adults probably have a low risk. It has not been shown that people over 40 years of age would have any risk of contracting radiation-induced thyroid cancer. Iodine tablets are particularly important for children. Iodine has fewer side effects than had been thought previously. At least for children, the risk of side effects caused by one dose of iodine is so small that it can be ignored when considering whether iodine should be given in a fallout situation. The risk increases with age. It must unconditionally be left for the authorities to decide who should be given iodine tablets and when. (orig.)

  9. Active molecular iodine photochemistry in the Arctic. (United States)

    Raso, Angela R W; Custard, Kyle D; May, Nathaniel W; Tanner, David; Newburn, Matt K; Walker, Lawrence; Moore, Ronald J; Huey, L G; Alexander, Liz; Shepson, Paul B; Pratt, Kerri A


    During springtime, the Arctic atmospheric boundary layer undergoes frequent rapid depletions in ozone and gaseous elemental mercury due to reactions with halogen atoms, influencing atmospheric composition and pollutant fate. Although bromine chemistry has been shown to initiate ozone depletion events, and it has long been hypothesized that iodine chemistry may contribute, no previous measurements of molecular iodine (I 2 ) have been reported in the Arctic. Iodine chemistry also contributes to atmospheric new particle formation and therefore cloud properties and radiative forcing. Here we present Arctic atmospheric I 2 and snowpack iodide (I - ) measurements, which were conducted near Utqiaġvik, AK, in February 2014. Using chemical ionization mass spectrometry, I 2 was observed in the atmosphere at mole ratios of 0.3-1.0 ppt, and in the snowpack interstitial air at mole ratios up to 22 ppt under natural sunlit conditions and up to 35 ppt when the snowpack surface was artificially irradiated, suggesting a photochemical production mechanism. Further, snow meltwater I - measurements showed enrichments of up to ∼1,900 times above the seawater ratio of I - /Na + , consistent with iodine activation and recycling. Modeling shows that observed I 2 levels are able to significantly increase ozone depletion rates, while also producing iodine monoxide (IO) at levels recently observed in the Arctic. These results emphasize the significance of iodine chemistry and the role of snowpack photochemistry in Arctic atmospheric composition, and imply that I 2 is likely a dominant source of iodine atoms in the Arctic.

  10. Iodine nutrition and risk of thyroid irradiation from nuclear accidents

    International Nuclear Information System (INIS)

    Delange, F.


    The objectives of this paper are to discuss the following aspects of physiopathology of iodine nutrition related to thyroid irradiation by nuclear accidents: (1) The cycle of iodine in nature, the dietary sources of iodine and the recommended dietary allowances for iodine. (2) The anomalies of thyroid metabolism induced by iodine deficiency. The caricatural situation as seen in endemic goitre will be used as mode. (3) The specific paediatric aspects of adaptation to iodine deficiency. (4) The present status of iodine nutrition in Europe. (author)

  11. Present status of iodine research at IPSN

    Energy Technology Data Exchange (ETDEWEB)

    Bardelay, J [IPSN/DPEA/SEAC (France)


    Since several years, IPSN has conducted an effort in order to evaluate the release of radioactive iodine in case of hypothetical severe accident in a realistic manner. This source-term evaluation is performed with IODE code which is a module of the EXCADRE system of codes. This code is validated against: -analytical experiments: in these experiments, IPSN studies radiolytic effects and chemical processes in the sump, organic formation, mass transfer, effect of spray (CARAIDAS experiment), - the CAIMAN semi global experiment; this experiment will allow to study the phenomena linked to iodine behavior under representative containment geometry in the presence of painted surfaces and global irradiation, - the PHEBUS FP program. The paper consists to describe succinctly the current status of IODE and the various experiments for its validation. In case of hypothetical severe accident iodine can induce important perturbations of human organism. The effects are principally radiological, in particular on the thyroid. At short term, radioactive iodine is the most important contributor for the sanitary risk. It represents 55% of effective dose and 92% of thyroid dose at 10 km in case of controlled rejects with current assumptions. This is the reason why it must be actively studied. In France, the safety evaluations are performed with mechanistic codes or lumped parameter codes like EXCADRE which contains a module devoted to iodine studies: IODINE. The objective of the French experimental program on iodine is to understand and quantify important phenomena in order to put kinetic parameters in IODE module. The experiments can be classified in analytical experiments, the semi-global experiment CAIMAN which takes into account different phenomena studied in analytical experiments and the global experiment PHEBUS PF, not only devoted to iodine behavior study. In the following text we will present the needs of IODINE code and these different experiments. (author).

  12. Present status of iodine research at IPSN

    International Nuclear Information System (INIS)

    Bardelay, J.


    Since several years, IPSN has conducted an effort in order to evaluate the release of radioactive iodine in case of hypothetical severe accident in a realistic manner. This source-term evaluation is performed with IODE code which is a module of the EXCADRE system of codes. This code is validated against: -analytical experiments: in these experiments, IPSN studies radiolytic effects and chemical processes in the sump, organic formation, mass transfer, effect of spray (CARAIDAS experiment), - the CAIMAN semi global experiment; this experiment will allow to study the phenomena linked to iodine behavior under representative containment geometry in the presence of painted surfaces and global irradiation, - the PHEBUS FP program. The paper consists to describe succinctly the current status of IODE and the various experiments for its validation. In case of hypothetical severe accident iodine can induce important perturbations of human organism. The effects are principally radiological, in particular on the thyroid. At short term, radioactive iodine is the most important contributor for the sanitary risk. It represents 55% of effective dose and 92% of thyroid dose at 10 km in case of controlled rejects with current assumptions. This is the reason why it must be actively studied. In France, the safety evaluations are performed with mechanistic codes or lumped parameter codes like EXCADRE which contains a module devoted to iodine studies: IODINE. The objective of the French experimental program on iodine is to understand and quantify important phenomena in order to put kinetic parameters in IODE module. The experiments can be classified in analytical experiments, the semi-global experiment CAIMAN which takes into account different phenomena studied in analytical experiments and the global experiment PHEBUS PF, not only devoted to iodine behavior study. In the following text we will present the needs of IODINE code and these different experiments. (author)

  13. Consensus statement on iodine deficiency disorders in Hong Kong. (United States)

    But, Betty; Chan, C W; Chan, Fredriech; Chan, K W; Cheng, Anna W F; Cheung, Patrick; Choi, K L; Chow, C B; Chow, Francis C C; Eastman, Creswell; Fok, T F; Fung, L M; Gomes, Cynthia; Huen, K F; Ip, T P; Kung, Annie W C; Lam, Karen S L; Lam, Y Y; Lao, Terence; Lee, C Y; Lee, K F; Leung, Jenny; Leung, N K; Li, Dominic; Li, June; Lo, K W; Lo, Louis; Ng, K L; Siu, S C; Tam, Sidney; Tan, Kathryn C B; Tiu, S C; Tse, H Y; Tse, Winnie; Wong, Gary; Wong, Shell; Wong, William; Yeung, Vincent T F; Young, Rosie; Yu, C M; Yu, Richard


    This article reviews the available data on the study of iodine deficiency disorders in Hong Kong and to discuss the approach towards preventing such disorders in Hong Kong. The importance of iodine and iodine deficiency disorders is described, and the available data on the dietary iodine intake and urinary iodine concentration in different populations of Hong Kong are summarised and discussed. Dietary iodine insufficiency among pregnant women in Hong Kong is associated with maternal goitrogenesis and hypothyroxinaemia as well as neonatal hypothyroidism. Borderline iodine deficiency exists in the expectant mothers in Hong Kong. Women of reproductive age, and pregnant and lactating women should be made aware and educated to have an adequate iodine intake, such as iodised salt, as an interim measure. A steering group involving all stakeholders should be formed to advise on the strategy of ensuring adequate iodine intake, including universal iodisation of salt in Hong Kong. Continuous surveillance of iodine status in the Hong Kong population is necessary.

  14. Study on iodine levels in thyroids of iodine-supplemented rats by epithermal neutron activation analysis

    International Nuclear Information System (INIS)

    Wang Xuefei; Zhang Fang; Xu Qing; Liu Nianqing; Chai Zhifang; Zhao Xueqin; Zuo Aijun


    The second generation female Wistar rats that have been treated with iodine-deficient food, after their delivery, are divided into three groups i.e. excessive-iodine (EI), adequate-iodine (AI) and iodine-deficient (ID) according to the KIO 3 concentration in the drinking water (3.0, 0.4, 0 mg/L). In addition, the normal rats with low iodine food and 0.4 mg/L KIO 3 water are used as the control group (C). The iodine content in thyroid and the serum thyroid hormone levels of the third generation rats are measured by means of epithermal neutron activation analysis (ENAA), and the method of enzyme-linked immunosorbent assay (ELISA), respectively. The results indicate that the total thyroxine (TT 4 ) and the free thyroxine (FT 4 ) of the EI, compared with those of the controls, are significantly decreased (p 3 ) evidently increased (p 4 , FT 4 and goiter

  15. Effect of chronic douching with polyvinylpyrrolidone-iodine on iodine absorption and thyroid function

    International Nuclear Information System (INIS)

    Safran, M.; Braverman, L.E.


    Daily vaginal douching with polyvinylpyrrolidone-iodine in 12 euthyroid volunteers for 14 days resulted in a significant increase in serum total iodine concentration and urine iodine excretion. The increase in serum total iodine was associated with a marked decrease in 24-hour 123 I uptake by the thyroid and a small but significant increase in serum thyrotropin (TSH) concentration. However, values for serum TSH never rose above the normal range. No significant changes in serum thyroxine (T4), free T4 index (FTI), or triiodothyronine concentrations were observed, although serum T4 and FTI did decrease slightly during treatment. The findings suggest that iodine is absorbed across the vaginal mucosa and that the subsequent increase in serum total iodine does induce subtle increases in serum TSH concentration. There was no evidence, however, of overt hypothyroidism in these euthyroid women

  16. Modeling an Iodine Hall Thruster Plume in the Iodine Satellite (ISAT) (United States)

    Choi, Maria


    An iodine-operated 200-W Hall thruster plume has been simulated using a hybrid-PIC model to predict the spacecraft surface-plume interaction for spacecraft integration purposes. For validation of the model, the plasma potential, electron temperature, ion current flux, and ion number density of xenon propellant were compared with available measurement data at the nominal operating condition. To simulate iodine plasma, various collision cross sections were found and used in the model. While time-varying atomic iodine species (i.e., I, I+, I2+) information is provided by HPHall simulation at the discharge channel exit, the molecular iodine species (i.e., I2, I2+) are introduced as Maxwellian particles at the channel exit. Simulation results show that xenon and iodine plasma plumes appear to be very similar under the assumptions of the model. Assuming a sticking coefficient of unity, iodine deposition rate is estimated.

  17. Iodine in drinking water varies by more than 100-fold in Denmark. Importance for iodine content of infant formulas

    DEFF Research Database (Denmark)

    Pedersen, K M; Laurberg, P; Nøhr, S


    The iodine intake level of the population is of major importance for the occurrence of thyroid disorders in an area. The aim of the present study was to evaluate the importance of drinking water iodine content for the known regional differences in iodine intake in Denmark and for the iodine content...

  18. Iodine-123 program at the TRIUMF laboratory

    International Nuclear Information System (INIS)

    Vincent, J.S.


    A research program for the production and utilization of iodine-123 is described. From 1979 to 1982 the spallation of elemental cesium by 500-MeV protons was used to provide 100 mCi/hr at the end of bombardment (EOB). Contaminants were 3% iodine-125 and 0.15% tellurium-121 at EOB + 36 hr. The material from weekly runs was used by remote clinics in Canada for evaluation as a radiochemical and for labeling studies. A new facility at TRIUMF will be operational in 1983 to produce iodine-123 by the (p,5n) reaction

  19. Autoradiography for iodine-125 seeds

    International Nuclear Information System (INIS)

    Alberti, W.; Divoux, S.; Pothmann, B.; Tabor, P.; Hermann, K.P.; Harder, D.


    To study the interior design of model 6702 and 6711 iodine-125 seeds, contact autoradiographs were performed using mammography film. Improved resolution was obtained using a pin-hole camera with a hole of 0.1 mm x 0.1 mm. With these techniques, qualitative determination of the relative activity distribution within each seed was possible. The number of the activated resin spheres and the positions of the centers of these spheres can be exactly determined. A model calculation shows that variations in the arrangement of the activated spheres within a seed have a moderate influence on the dose distribution at source distances below 10 mm. Knowing the exact source configuration may be useful when comparing dose calculations with measured data for model 6702 125 I seeds which are currently employed in ophthalmic plaque and implant therapy of other tumors. 16 refs., 5 figs., 2 tabs

  20. Iodine-123 in Western Europe

    International Nuclear Information System (INIS)

    Qaim, S.M.; Stoecklin, G.; Weinreich, R.


    The major object of this panel was to obtain information on the state of art of Iodine-123 production in Western Europe. Technical, medical and organizational problems were discussed extensively during the one-day meeting and a stimulating exchange of information between the various 123 I-producers and users has been initiated. Some specific examples of medical application were also included in order to get a feeling of the degree of acceptance by the medical community and the demand for this isotope. The meeting clearly demonstrated the great demand for this isotope but it also showed that the present rate of production is well below the demand. In order to fill this gap, not only further technical development is needed but also the organizational question of distribution has to be solved, perhaps within a network of collaborating cyclotrons, a task which is considerably more difficult in Western Europe than in the USA. (orig./HP) [de

  1. Studies in iodine metabolism. Progress report, April 1975-- March 1976

    International Nuclear Information System (INIS)

    Van Middlesworth, L.


    Investigations during the past twelve months have included the following subjects: factors which influence release of radioiodine from thyroid glands; contamination of commercially available low-iodine diets; effects of hypoxia on release of iodine from thyroid glands of rats and mice; development of practical tests for available iodine in low-iodine diets; reproduction and abnormal thyroglobulin of rats maintained on low-iodine diets; observations on radioactivity in animal thyroids; collaboration with other laboratories regarding radium in bovine thyroids

  2. A model to secure a stable iodine concentration in milk

    Directory of Open Access Journals (Sweden)

    Gisken Trøan


    Full Text Available Background: Dairy products account for approximately 60% of the iodine intake in the Norwegian population. The iodine concentration in cow's milk varies considerably, depending on feeding practices, season, and amount of iodine and rapeseed products in cow fodder. The variation in iodine in milk affects the risk of iodine deficiency or excess in the population. Objective: The first goal of this study was to develop a model to predict the iodine concentration in milk based on the concentration of iodine and rapeseed or glucosinolate in feed, as a tool to securing stable iodine concentration in milk. A second aim was to estimate the impact of different iodine levels in milk on iodine nutrition in the Norwegian population. Design: Two models were developed on the basis of results from eight published and two unpublished studies from the past 20 years. The models were based on different iodine concentrations in the fodder combined with either glucosinolate (Model 1 or rapeseed cake/meal (Model 2. To illustrate the impact of different iodine concentrations in milk on iodine intake, we simulated the iodine contribution from dairy products in different population groups based on food intake data in the most recent dietary surveys in Norway. Results: The models developed could predict iodine concentration in milk. Cross-validation showed good fit and confirmed the explanatory power of the models. Our calculations showed that dairy products with current iodine level in milk (200 µg/kg cover 68, 49, 108 and 56% of the daily iodine requirements for men, women, 2-year-old children, and pregnant women, respectively. Conclusions: Securing a stable level of iodine in milk by adjusting iodine concentration in different cow feeds is thus important for preventing excess intake in small children and iodine deficiency in pregnant and non-pregnant women.

  3. Quantitative method for determination of body inorganic iodine

    International Nuclear Information System (INIS)

    Filatov, A.A.; Tatsievskij, V.A.


    An original method of quantitation of body inorganic iodine, based upon a simultaneous administration of a known dose of stable and radioactive iodine with subsequent radiometry of the thyroid was proposed. The calculation is based upon the principle of the dilution of radiactive iodine in human inorganic iodine space. The method permits quantitation of the amount of inorganic iodine with regard to individual features of inorganic space. The method is characterized by simplicity and is not invasive for a patient

  4. Method of removing iodine and compounds thereof from gaseous effluents

    International Nuclear Information System (INIS)

    Keener, R.L.; Kittle, P.A.


    Anion exchange resins including an acrylic backbone formed by the suspension polymerization of a mixture of an acrylic and a crosslinking monomer are useful in the removal of iodine and iodine compounds from gaseous effluents. Removal of radioactive iodine contaminants, particularly alkyl iodine compounds or hydrogen iodine, under extreme conditions, namely temperatures up to 180 0 C and humidities up to 100 percent, from effluents resulting from a major nuclear accident could probably be adsorbed by these resins described herein

  5. Analysis of iodine content in seaweed by GC-ECD and estimation of iodine intake

    Directory of Open Access Journals (Sweden)

    Tai Sheng Yeh


    Full Text Available Edible seaweed products have been consumed in many Asian countries. Edible seaweeds accumulate iodine from seawater, and are therefore a good dietary source of iodine. An adequate consumption of seaweed can eliminate iodine deficiency disorders, but excessive iodine intake is not good for health. The recommended dietary reference intake of 0.15 mg/d and 0.14 mg/d for iodine has been established in the United States and Taiwan, respectively. In this study, 30 samples of seaweed were surveyed for iodine content. The samples included 10 nori (Porphyra, 10 wakame (Undaria, and 10 kombu (Laminaria products. The iodine in seaweed was derivatized with 3-pentanone and detected by gas chromatography-electron capture detector (GC-ECD. The method detection limit was 0.5 mg/kg. The iodine content surveyed for nori was 29.3–45.8 mg/kg, for wakame 93.9–185.1 mg/kg, and for kombu 241–4921 mg/kg. Kombu has the highest average iodine content 2523.5 mg/kg, followed by wakame (139.7 mg/kg and nori (36.9 mg/kg. The GC-ECD method developed in this study is a low-cost alternative to inductively coupled plasma-optical emission spectroscopy for iodine detection in seaweeds. The iodine intake from seaweed in the current survey was calculated and compared with the iodine dietary reference intake of Taiwan. The risk and benefit of seaweed consumption is also discussed.

  6. Iodine binding to humic acid. (United States)

    Bowley, H E; Young, S D; Ander, E L; Crout, N M J; Watts, M J; Bailey, E H


    The rate of reactions between humic acid (HA) and iodide (I(-)) and iodate (IO3(-)) have been investigated in suspensions spiked with (129)I at concentrations of 22, 44 and 88 μg L(-1) and stored at 10 °C. Changes in the speciation of (129)I(-), (129)IO3(-) and mixed ((129)I(-) + (129)IO3(-)) spikes were monitored over 77 days using liquid chromatography inductively coupled plasma mass spectrometry (LC-ICP-MS). In suspensions spiked with (129)I(-) 25% of the added I(-) was transformed into organic iodine (Org-(129)I) within 77 days and there was no evidence of (129)IO3(-) formation. By contrast, rapid loss of (129)IO3(-) and increase in both (129)I(-) and Org-(129)I was observed in (129)IO3(-)-spiked suspensions. However, the rate of Org-(129)I production was greater in mixed systems compared to (129)IO3(-)-spiked suspensions with the same total (129)I concentration, possibly indicating IO3(-)I(-) redox coupling. Size exclusion chromatography (SEC) demonstrated that Org-(129)I was present in both high and low molecular weight fractions of the HA although a slight preference to bond with the lower molecular weight fractions was observed indicating that, after 77 days, the spiked isotope had not fully mixed with the native (127)I pool. Iodine transformations were modelled using first order rate equations and fitted rate coefficients determined. However, extrapolation of the model to 250 days indicated that a pseudo-steady state would be attained after ∼200 days but that the proportion of (129)I incorporated into HA was less than that of (127)I indicating the presence of a recalcitrant pool of (127)I that was unavailable for isotopic mixing. Copyright © 2016 Elsevier Ltd. All rights reserved.

  7. The retention of iodine by iodine filters in nuclear power plants in the case of fire

    International Nuclear Information System (INIS)

    Giraud, V.


    Due to the liberation of considerable amounts of gaseous combustion products, fires in nuclear power plants may lead to a deterioration in the retention of radioiodine by iodine filters. The combustion products of the burnable materials, i.e., insulations, lubricants and paints, vary considerably with the development of the fire. Combustion product analyses of these materials have been performed only to a limited extent. The reaction of iodine with combustion products as well as the retention of the resulting iodine reaction products by sorbents have not yet been investigated. The reduction in the removal efficiencies of iodine sorbents due to the presence of combustion products is unknown. (orig.) [de

  8. Iodine deficiency in pregnancy in Denmark. Regional variations and frequency of individual iodine supplementation

    DEFF Research Database (Denmark)

    Nøhr, S B; Laurberg, P; Børlum, K G


    micrograms/g creatinine). These values are far below internationally recommended levels. The consequences remain to be evaluated and no firm recommendations can be given. It seems reasonable, however, to recommend a high intake of food containing iodine (e.g. milk products) during pregnancy and lactation...... containing vitamin/mineral tablets. Approximately one third of the women had received tablets containing iodine. In women who had not received iodine supplementation urinary iodine was low with a median value of 39.7 micrograms/g creatinine (Aalborg 28, Randers 33, Ringkøbing 34, Arhus 43 and Copenhagen 62...

  9. Iodine deficiency in pregnancy in Denmark. Regional variations and frequency of individual iodine supplementation

    DEFF Research Database (Denmark)

    Nøhr, S B; Laurberg, Peter; Børlum, K G


    Iodine requirements are increased during pregnancy and lactation and adequate iodine intake is important for normal brain development of the fetus/newborn child. The aim of the present study was to evaluate the extent to which this increase in iodine requirement is met in pregnant women living...... micrograms/g creatinine). These values are far below internationally recommended levels. The consequences remain to be evaluated and no firm recommendations can be given. It seems reasonable, however, to recommend a high intake of food containing iodine (e.g. milk products) during pregnancy and lactation...

  10. Iodination and stability of somatostatin analogues: comparison of iodination techniques. A practical overview. (United States)

    de Blois, Erik; Chan, Ho Sze; Breeman, Wouter A P


    For iodination ((125/127)I) of tyrosine-containing peptides, chloramin-T, Pre-Coated Iodo-Gen(®) tubes and Iodo-Beads(®) (Pierce) are commonly used for in vitro radioligand investigations and there have been reliant vendors hereof for decades. However, commercial availability of these radio-iodinated peptides is decreasing. For continuation of our research in this field we investigated and optimized (radio-)iodination of somatostatin analogues. In literature, radioiodination using here described somatostatin analogues and iodination techniques are described separately. Here we present an overview, including High Performance Liquid Chromatography (HPLC) separation and characterisation by mass spectrometry, to obtain mono- and di-iodinated analogues. Reaction kinetics of (125/127)I iodinated somatostatin analogues were investigated as function of reaction time and concentration of reactants, including somatostatin analogues, iodine and oxidizing agent. To our knowledge, for the here described somatostatin analogues, no (127)I iodination and optimization are described. (Radio-)iodinated somatostatin analogues could be preserved with a >90% radiochemical purity for 1 month after reversed phase HPLC-purification.

  11. Suboptimal Iodine Concentration in Breastmilk and Inadequate Iodine Intake among Lactating Women in Norway. (United States)

    Henjum, Sigrun; Lilleengen, Anne Marie; Aakre, Inger; Dudareva, Anna; Gjengedal, Elin Lovise Folven; Meltzer, Helle Margrete; Brantsæter, Anne Lise


    Breastfed infants depend on sufficient maternal iodine intake for optimal growth and neurological development. Despite this, few studies have assessed iodine concentrations in human milk and there is currently no published data on iodine status among lactating women in Norway. The aim of this study was to assess iodine concentrations in breast milk (BMIC) in lactating women and estimate iodine intake. Five Mother and Child Health Centres in Oslo were randomly selected during 2016, and 175 lactating women between 2nd and 28th weeks postpartum participated. Each of the women provided four breastmilk samples which were pooled and analysed for iodine concentrations. Participants also provided information on iodine intake from food and supplements covering the last 24 h and the habitual iodine intake (food frequency questionnaire). The median (p25, p75 percentiles) BMIC was 68 (45, 98) µg/L and 76% had BMIC food (p25, p75) was 121 (82, 162) µg/day and the total intake (food and supplements) was 134 (95, 222) µg/day. The majority of lactating women had suboptimal BMIC and inadequate intake of iodine from food and supplements.

  12. Iodine and creatinine testing in urine dried on filter paper

    Energy Technology Data Exchange (ETDEWEB)

    Zava, Theodore T., E-mail: [ZRT Laboratory, 8605 SW Creekside Place, Beaverton, OR 97008 (United States); Kapur, Sonia, E-mail: [ZRT Laboratory, 8605 SW Creekside Place, Beaverton, OR 97008 (United States); Zava, David T., E-mail: [ZRT Laboratory, 8605 SW Creekside Place, Beaverton, OR 97008 (United States)


    Highlights: ► Dried urine iodine and creatinine extract quantitatively correlates well with liquid urine. ► Filter paper strips can be easily shipped and stored. ► Urine iodine and creatinine are stable at ambient temperature when dried on filter paper. ► Dried urine iodine and creatinine are run using a 96-well format. -- Abstract: Iodine deficiency is a world-wide health problem. A simple, convenient, and inexpensive method to monitor urine iodine levels would have enormous benefit in determining an individual's recent iodine intake or in identifying populations at risk for iodine deficiency or excess. Current methods used to monitor iodine levels require collection of a large volume of urine and its transport to a testing laboratory, both of which are inconvenient and impractical in parts of the world lacking refrigerated storage and transportation. To circumvent these limitations we developed and validated methods to collect and measure iodine and creatinine in urine dried on filter paper strips. We tested liquid urine and liquid-extracted dried urine for iodine and creatinine in a 96-well format using Sandell–Kolthoff and Jaffe reactions, respectively. Our modified dried urine iodine and creatinine assays correlated well with established liquid urine methods (iodine: R{sup 2} = 0.9483; creatinine: R{sup 2} = 0.9782). Results demonstrate that the dried urine iodine and creatinine assays are ideal for testing the iodine status of individuals and for wide scale application in iodine screening programs.

  13. Development of Databases on Iodine in Foods and Dietary Supplements (United States)

    Ershow, Abby G.; Skeaff, Sheila A.; Merkel, Joyce M.; Pehrsson, Pamela R.


    Iodine is an essential micronutrient required for normal growth and neurodevelopment; thus, an adequate intake of iodine is particularly important for pregnant and lactating women, and throughout childhood. Low levels of iodine in the soil and groundwater are common in many parts of the world, often leading to diets that are low in iodine. Widespread salt iodization has eradicated severe iodine deficiency, but mild-to-moderate deficiency is still prevalent even in many developed countries. To understand patterns of iodine intake and to develop strategies for improving intake, it is important to characterize all sources of dietary iodine, and national databases on the iodine content of major dietary contributors (including foods, beverages, water, salts, and supplements) provide a key information resource. This paper discusses the importance of well-constructed databases on the iodine content of foods, beverages, and dietary supplements; the availability of iodine databases worldwide; and factors related to variability in iodine content that should be considered when developing such databases. We also describe current efforts in iodine database development in the United States, the use of iodine composition data to develop food fortification policies in New Zealand, and how iodine content databases might be used when considering the iodine intake and status of individuals and populations. PMID:29342090

  14. Iodine and creatinine testing in urine dried on filter paper

    International Nuclear Information System (INIS)

    Zava, Theodore T.; Kapur, Sonia; Zava, David T.


    Highlights: ► Dried urine iodine and creatinine extract quantitatively correlates well with liquid urine. ► Filter paper strips can be easily shipped and stored. ► Urine iodine and creatinine are stable at ambient temperature when dried on filter paper. ► Dried urine iodine and creatinine are run using a 96-well format. -- Abstract: Iodine deficiency is a world-wide health problem. A simple, convenient, and inexpensive method to monitor urine iodine levels would have enormous benefit in determining an individual's recent iodine intake or in identifying populations at risk for iodine deficiency or excess. Current methods used to monitor iodine levels require collection of a large volume of urine and its transport to a testing laboratory, both of which are inconvenient and impractical in parts of the world lacking refrigerated storage and transportation. To circumvent these limitations we developed and validated methods to collect and measure iodine and creatinine in urine dried on filter paper strips. We tested liquid urine and liquid-extracted dried urine for iodine and creatinine in a 96-well format using Sandell–Kolthoff and Jaffe reactions, respectively. Our modified dried urine iodine and creatinine assays correlated well with established liquid urine methods (iodine: R 2 = 0.9483; creatinine: R 2 = 0.9782). Results demonstrate that the dried urine iodine and creatinine assays are ideal for testing the iodine status of individuals and for wide scale application in iodine screening programs

  15. A mathematical model for iodine kinetics

    International Nuclear Information System (INIS)

    Silva, E.A.T. da.


    A mathematical model for the iodine kinetics in thyroid is presented followed by its analytical solution. An eletroanalogical model is also developed for a simplified stage and another is proposed for the main case [pt

  16. Cement materials for cesium and iodine confinement

    International Nuclear Information System (INIS)

    Nicolas, G.; Lequeux, N.; Boch, P.; Prene, S.


    The following topics were dealt with: radioactive waste storage, cement materials reacting with radioactive cesium and iodine, chemical barrier formation against radioactive pollution, ceramization, long term stability, XRD, PIXE analysis

  17. Iodine behaviour in the SLOWPOKE nuclear reactor

    Energy Technology Data Exchange (ETDEWEB)

    Bekeris, P A; Evans, G J [Toronto Univ., ON (Canada). Dept. of Chemical Engineering and Applied Chemistry


    The purpose of this project is to measure and attempt to explain the presence and volatility of iodine isotopes present as fission products in the SLOWPOKE-2 reactor. Liquid sampling and extraction procedures developed indicated that approximately 40% of the reactor iodine is in the form of iodate (IO{sub 3}{sup -}), and 60% is in the form of iodide (I{sup -}). No appreciable amount in non-polar forms such as molecular iodine (I{sub 2}) or organic iodides (RI) were detected. This goes contrary to past expectations that all of the iodine in the liquid phase would be in the form of I{sup -}. In addition partition coefficients for I-131 were determined as 2-6x10{sup 6} at a neutral pH. Kr-88 is suspected as a possible interfering isotope in the measurement of I-131 in the liquid and gas phases. (author). 9 refs., 2 tabs., 2 figs.

  18. The determination of iodine 129 in thyroids

    International Nuclear Information System (INIS)

    Gros, Roger; Cappellini, Liliane; Goujon de Beauvivier, Michel; Jeanmaire, Lucien; Patti, Francois.


    Activation analysis was used for the determination of 129 I in thyroids. Iodine is first extracted from the thyroid and irradiated as lead iodate, thus giving enough sensitivity and making it possible to use common laboratory material. The results showed that the present activity levels in France are between 1 and 50 pCi per gram of iodine; the values found in Argentina are clearly lower [fr

  19. LWR severe accident simulation: Iodine behaviour in FPT2 experiment and advances on containment iodine chemistry

    Energy Technology Data Exchange (ETDEWEB)

    Girault, N., E-mail: [Institut de Radioprotection et de Surete Nucleaire (IRSN), BP3 - 13115 St.-Paul-lez-Durance (France); Bosland, L. [Institut de Radioprotection et de Surete Nucleaire (IRSN), BP3 - 13115 St.-Paul-lez-Durance (France); Dickinson, S. [National Nuclear Laboratory, Harwell, Oxon OX11 0QT (United Kingdom); Funke, F. [AREVA NP Gmbh, PO Box 1109, 91001 Erlangen (Germany); Guentay, S. [Paul Scherrer Institut, 5232 Villigen PSI (Switzerland); Herranz, L.E. [Centro des Investigaciones Energeticas, MedioAmbiantales y Tecnologicas, av. Complutense 2, 28040 Madrid (Spain); Powers, D. [Sandia National Laboratories, New Mexico, PO Box 5800, Albuquerque, NM 87185 (United States)


    Highlights: Black-Right-Pointing-Pointer Short term gaseous iodine fraction can be produced either in primary circuit or on containment condensing surfaces. Black-Right-Pointing-Pointer Gaseous radiolytic reactions convert volatile iodine into non-volatile iodine oxide particulates. Black-Right-Pointing-Pointer Alkaline and evaporating sump decrease the iodine volatility in containment. Black-Right-Pointing-Pointer Release of volatile iodine from containment surfaces explained the long term stationary residual gaseous iodine concentration. - Abstract: The Phebus Fission Product (FP) Program studies key phenomena of severe accidents in water-cooled nuclear reactors. In the framework of the Phebus program, five in-pile experiments have been performed that cover fuel rod degradation and behaviour of fission products released via the coolant circuit into the containment vessel. The focus of this paper is on iodine behaviour during the Phebus FPT2 test. FPT2 used a 33 GWd/t uranium dioxide fuel enriched to 4.5%, re-irradiated in situ for 7 days to a burn-up of 130 MWd/t. This test was performed to study the impact of steam-poor conditions and boric acid on the fission product chemistry. For the containment vessel, more specifically, the objective was to study iodine chemistry in an alkaline sump under evaporating conditions. The iodine results of the Phebus FPT2 test confirmed many of the essential features of iodine behaviour in the containment vessel provided by the first two Phebus tests, FPT0 and FPT1. These are the existence of an early gaseous iodine fraction, the persistence of low gaseous iodine concentrations and the importance of the sump in suppressing the iodine partitioning from sump to atmosphere. The main new insights provided by the Phebus FPT2 test were the iodine desorption from stainless steel walls deposits and the role of the evaporating sump in further iodine depletion in the containment atmosphere. The current paper presents an interpretation of

  20. Iodine nutritional status in Asturian schoolchildren. (United States)

    Riestra Fernández, María; Menéndez Torre, Edelmiro; Díaz Cadórniga, Francisco; Fernández Fernández, Juan Carlos; Delgado Álvarez, Elías


    Iodine deficiency is a public health problem, and iodine nutritional status should therefore be regularly measured. To ascertain iodine nutritional status in Asturias and its relation to use of iodized salt and to other sociodemographic and nutritional parameters. A descriptive, observational study was conducted in a random sample of schoolchildren aged 5 to 14 years, in whom urinary iodine levels were measured by high-performance liquid chromatography. Families completed a survey on use of iodized salt, consumption of dairy products and fish, and sociodemographic data. The study sample consisted of 705 schoolchildren (51.1% females) with a mean age of 9.9 years (SD 2.6). In a total of 620 valid measurements, mean urinary iodine level was 204.1 μg/L (SD 120.6), while the median value was 180.7 μg/L (P 25 -P 75 : 124-252.3 μg/L, interquartile range 128.3 μg/L). Urinary iodine levels were y SED. Publicado por Elsevier España, S.L.U. All rights reserved.

  1. Iodine Gas Trapping using Granular Porous Bismuth

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jae Hwan; Shin, Jin Myeong; Park, Jang Jin; Park, Geun Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Yim, Mansung [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)


    {sup 129}I is a radionuclide with a very long half-life of 1.57 Χ 10{sup 7} years and has negative health effects to the human body. Therefore, the emission of {sup 129}I into the air is closely regulated by the Environmental Protection Agency (EPA). Many methods for trapping gaseous {sup 129}I have been developed thus far, including wet scrubbing and adsorption using silver loaded zeolites. Although wet scrubbing can effectively remove iodine, it suffers from corrosion of the vessel due to high concentration of the scrubbing solution. Silver loaded zeolites also show effectiveness in capturing {sup 129}I gas, yet weak thermal stability of physisorbed iodine remains a challenge. We studied a novel and facile method to trap iodine gas using bismuth. Granular bismuth having many pores was synthesized using bismuth nitrate and polyvinyl alcohol as a bismuth precursor and pore forming agent, respectively. Reaction of iodine and our samples resulted in an iodine capturing capacity of more than 2 times that of the commercial grade silver exchanged zeolite (AgX). Granular porous bismuths synthesized using bismuth nitrate and PVA show a promising performance in capturing iodine gas. The use of bismuth in trapping {sup 129}I gas can reduce the process cost as bismuth is cheap. Further study is going on to improve the mechanical property of granular porous bismuths for their easy handling.

  2. Iodine Gas Trapping using Granular Porous Bismuth

    International Nuclear Information System (INIS)

    Yang, Jae Hwan; Shin, Jin Myeong; Park, Jang Jin; Park, Geun Il; Yim, Mansung


    129 I is a radionuclide with a very long half-life of 1.57 Χ 10 7 years and has negative health effects to the human body. Therefore, the emission of 129 I into the air is closely regulated by the Environmental Protection Agency (EPA). Many methods for trapping gaseous 129 I have been developed thus far, including wet scrubbing and adsorption using silver loaded zeolites. Although wet scrubbing can effectively remove iodine, it suffers from corrosion of the vessel due to high concentration of the scrubbing solution. Silver loaded zeolites also show effectiveness in capturing 129 I gas, yet weak thermal stability of physisorbed iodine remains a challenge. We studied a novel and facile method to trap iodine gas using bismuth. Granular bismuth having many pores was synthesized using bismuth nitrate and polyvinyl alcohol as a bismuth precursor and pore forming agent, respectively. Reaction of iodine and our samples resulted in an iodine capturing capacity of more than 2 times that of the commercial grade silver exchanged zeolite (AgX). Granular porous bismuths synthesized using bismuth nitrate and PVA show a promising performance in capturing iodine gas. The use of bismuth in trapping 129 I gas can reduce the process cost as bismuth is cheap. Further study is going on to improve the mechanical property of granular porous bismuths for their easy handling

  3. Iodine-Catalyzed Isomerization of Dimethyl Muconate

    Energy Technology Data Exchange (ETDEWEB)

    Settle, Amy E [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Berstis, Laura R [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Zhang, Shuting [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Rorrer, Nicholas [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Hu, Haiming [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Richards, Ryan [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Beckham, Gregg T [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Crowley, Michael F [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Vardon, Derek R [National Renewable Energy Laboratory (NREL), Golden, CO (United States)


    cis,cis-Muconic acid is a platform biobased chemical that can be upgraded to drop-in commodity and novel monomers. Among the possible drop-in products, dimethyl terephthalate can be synthesized via esterification, isomerization, Diels-Alder cycloaddition, and dehydrogenation. The isomerization of cis,cis-dimethyl muconate (ccDMM) to the trans,trans-form (ttDMM) can be catalyzed by iodine; however, studies have yet to address (i) the mechanism and reaction barriers unique to DMM, and (ii) the influence of solvent, potential for catalyst recycle, and recovery of high-purity ttDMM. To address this gap, we apply a joint computational and experimental approach to investigate iodine-catalyzed isomerization of DMM. Density functional theory calculations identified unique regiochemical considerations due to the large number of halogen-diene coordination schemes. Both transition state theory and experiments estimate significant barrier reductions with photodissociated iodine. Solvent selection was critical for rapid kinetics, likely due to solvent complexation with iodine. Under select conditions, ttDMM yields of 95% were achieved in <1 h with methanol, followed by high purity recovery (>98%) with crystallization. Lastly, post-reaction iodine can be recovered and recycled with minimal loss of activity. Overall, these findings provide new insight into the mechanism and conditions necessary for DMM isomerization with iodine to advance the state-of-the-art for biobased chemicals.

  4. Ultrahigh iodine adsorption in porous organic frameworks

    KAUST Repository

    Pei, Cuiying


    We present two porous organic frameworks (POFs), PAF-1 and JUC-Z2, with ultrahigh iodine capture capacity. The iodine vapor uptake of PAF-1 and JUC-Z2 were 1.86 g g-1 and 1.44 g g-1 respectively at 298 K per 40 Pa, which is extremely high for such low pressure sorption conditions. In addition, PAF-1 and JUC-Z2 could adsorb iodine over water with the selectivity of 5.1 and 6.5 respectively. The isosteric enthalpy at zero surface coverage, calculated by a virial equation with the iodine vapor sorption isotherms at 298 K and 313 K of JUC-Z2, reached -51.1 kJ mol-1, which was much higher than the coverage of PAF-1 (-14.9 kJ mol-1). Raman measurement confirmed the polyiodide to be I5 - in POFs. Furthermore, solvents with different polarities, such as n-hexane, chloroform, and methanol, were chosen to conduct iodine binding measurements on PAF-1 and JUC-Z2. The formation constant Kf for POFs in n-hexane, chloroform and methanol drastically decreased with the increase in polarity, thus illustrating the important role of solvents in iodine binding. © the Partner Organisations 2014.

  5. Dietary Iodine Intake of the Australian Population after Introduction of a Mandatory Iodine Fortification Programme

    Directory of Open Access Journals (Sweden)

    Karen Charlton


    Full Text Available To address mild iodine deficiency in Australia, a mandatory fortification program of iodised salt in bread was implemented in 2009. This study aimed to determine factors associated with achieving an adequate dietary iodine intake in the Australian population post-fortification, and to assess whether bread consumption patterns affect iodine intake in high-risk groups. Using nationally representative data of repeated 24-h dietary recalls from the 2011–2012 Australian National Nutrition and Physical Activity Survey, dietary iodine intakes and food group contributions were compared by age, socioeconomic status (SES, and geographical remoteness (N = 7735. The association between fortified bread intake and adequacy of iodine intake (meeting age and sex-specific Estimated Average Requirements was investigated using logistic regression models in women of childbearing age 14–50 years (n = 3496 and children aged 2–18 years (n = 1772. The effect of SES on bread consumption was further investigated in a sub group of children aged 5–9 years (n = 488. Main sources of iodine intake at the time of the survey were cereal and cereal products, followed by milk products and dishes. Differences in iodine intake and dietary iodine habits according to age, SES and location were found (p < 0.001 for women of child-bearing age. Fortified bread consumption at ≥100 g/day was associated with five times greater odds of achieving an adequate iodine intake (OR 5.0, 95% CI 4.96–5.13; p < 0.001 compared to lower bread consumption in women and 12 times in children (OR 12.34, 95% CI 1.71–89.26; p < 0.001. Disparities in dietary iodine intake exist within sectors of the Australian population, even after mandatory fortification of a staple food. On-going monitoring and surveillance of iodine status is required.

  6. Theoretical and experimental investigations on the behaviour of iodine during severe accidents: volatile iodine. Final report

    International Nuclear Information System (INIS)

    Funke, F.; Zeh, P.; Greger, G.U.; Hellmann, S.


    Analysis of the consequences of severe accidents in nuclear power plants requires knowledge of the behaviour of radionuclides relevant from the radiological viewpoint, especially the iodine. The current modelling of iodine behaviour is not conclusive, owing to insufficiently known data. This project is intended to eliminate some of these data gaps in critical areas. 350 tests on the radiation-induced oxidation of elemental iodine (I 2 ) in the containment atmosphere were performed yielding an extended database. Moreover, irradiation tests were performed on the formation and decomposition of ozone which is a reaction partner for I 2 . The reaction with ozone converts volatile I 2 into non-volatile iodine oxides or iodate. An improved kinetic modelling was developed for the iodine accident code IMPAIR. Now the model is valid also for steam-containing atmospheres and, additionally, considers dose rate and thus the actual ozone concentration. An assessment of the literature concludes that β and γ radiation have no different impact on iodine chemistry and thus do not need to be modelled separately in iodine accident codes. An assessment of the literature shows a partly significant chemical interaction of volatile iodine with aerosols. Since such reactions lead to a faster decrease of volatile iodine at least at high aerosol concentrations, a modelling should be foreseen in the future. In the frame of the international ISP-41 project, calculations to an integral test in the Canadian Radioiodine Test Facility (RTF) were performed with IMPAIR. The existing model of the radiation-induced I 2 formation in the sump in IMPAIR is identified as a weakness requiring future improvement. A theoretical assessment on the iodine chemistry in the droplets of a spray system concludes that a modelling is necessary in case of spraying with fresh water, and that this is already contained in available spray models. During recirculation spraying in an examplary, hypothetical EPR case, no

  7. Iodine nutrition status in lactating mothers residing in countries with mandatory and voluntary iodine fortification programs: an updated systematic review. (United States)

    Nazeri, Pantea; Mirmiran, Parvin; Shiva, Niloofar; Mehrabi, Yadollah; Mojarrad, Mehdi; Azizi, Fereidoun


    The aim of this review is to assess data available on iodine nutrition status in lactating mothers residing in countries with mandatory and voluntary iodine fortification programs and/or iodine supplementation. A systematic review was conducted by searching articles published between 1964 and 2013 in Pub Med, ISI Web, and Cochrane Library using iodine nutrition, lactation, iodine supplementation, and iodine fortification as keywords for titles and/or abstracts. Relevant articles were included if they reported urinary iodine concentration (UIC) in lactating mothers and, if determined, the type of iodine fortification program and/or iodine supplementation. Forty-two studies met the inclusion criteria. Among these, 21 studies assessed lactating mothers in countries with a mandatory iodine fortification program, 17 studies were from countries with voluntary and/or without iodine fortification programs, and four studies assessed iodine nutrition status in lactating mothers undergoing iodine supplementation. Among countries with mandatory iodine fortification programs, the range of salt iodization level in lactating mothers with a UIC 100 μg/L, it was between 15 and 60 ppm. Levels of UIC Chile, Iran, Mongolia, New Guinea, and Nigeria, the median or mean of UIC was >100 μg/L. There was a median or mean UIC program was voluntary, including Switzerland, Australia, New Zealand, Ireland, and Germany. However, in some countries with voluntary iodine fortification programs, such as the United States, Spain, and Japan, a mean or median UIC of >100 μg/L has been reported. Although universal salt iodization is still the most feasible and cost-effective approach for iodine deficiency control in pregnant and lactating mothers, UIC in lactating mothers of most countries with voluntary programs and in areas with mandatory iodine fortification is still within the iodine deficiency range, indicating that iodine supplementation in daily prenatal vitamin/mineral supplements in

  8. Schostakowitsch: Sinfonie N15, Op. 141 / Hanspeter Krellmann

    Index Scriptorium Estoniae

    Krellmann, Hanspeter


    Uuest heliplaadist "Schostakowitsch: Sinfonie N15, Op. 141, Oktober, Op. 131, Ouvertüre über russische und kirgisische Volksthemen, Op. 115. Göteborger Sinfonie-Orchester, Neeme Järvi". DG CD 427 616-2

  9. 40 CFR 141.808 - Audits and inspections. (United States)


    ... (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Aircraft Drinking Water Rule § 141.808 Audits and..., disinfection and flushing, and general maintenance and self-inspections of aircraft water system. (b) Air... delivery of safe drinking water. ...

  10. A rechargeable iodine-carbon battery that exploits ion intercalation and iodine redox chemistry. (United States)

    Lu, Ke; Hu, Ziyu; Ma, Jizhen; Ma, Houyi; Dai, Liming; Zhang, Jintao


    Graphitic carbons have been used as conductive supports for developing rechargeable batteries. However, the classic ion intercalation in graphitic carbon has yet to be coupled with extrinsic redox reactions to develop rechargeable batteries. Herein, we demonstrate the preparation of a free-standing, flexible nitrogen and phosphorus co-doped hierarchically porous graphitic carbon for iodine loading by pyrolysis of polyaniline coated cellulose wiper. We find that heteroatoms could provide additional defect sites for encapsulating iodine while the porous carbon skeleton facilitates redox reactions of iodine and ion intercalation. The combination of ion intercalation with redox reactions of iodine allows for developing rechargeable iodine-carbon batteries free from the unsafe lithium/sodium metals, and hence eliminates the long-standing safety issue. The unique architecture of the hierarchically porous graphitic carbon with heteroatom doping not only provides suitable spaces for both iodine encapsulation and cation intercalation but also generates efficient electronic and ionic transport pathways, thus leading to enhanced performance.Carbon-based electrodes able to intercalate Li + and Na + ions have been exploited for high performing energy storage devices. Here, the authors combine the ion intercalation properties of porous graphitic carbons with the redox chemistry of iodine to produce iodine-carbon batteries with high reversible capacities.

  11. Longitudinal study of iodine in toenails following IV administration of an iodine-containing contrast agent

    International Nuclear Information System (INIS)

    Spate, V.L.; Morris, J.S.; Nichols, T.A.; Baskett, C.K.; Mason, M.M.; Horsman, T.L.; McDougall, I.R.


    The literature on the relationship between diet and thyroid cancer (TC) risk and the higher incidence of TC among Asian immigrants to the US compared to second and third generation subgroups has prompted epidemiologists to hypothesize that increased levels of iodine consumption may be associated with TC risk, particularly among persons with a history of clinical or subclinical thyroid dysfunction. At the University of Missouri Research Reactor (MURR), we have applied epiboron neutron activation analysis to investigate human nails as a dietary monitor for iodine. Preliminary studies have indicated a positive correlation between dietary iodine intake and the concentration of iodine in toenails. However, these studies are confounded by high iodine levels (up to 30 ppm) in approximately 5% of the nails studied. We hypothesize that, in the subjects we have studied, the high iodine levels may be due to iodine-containing medications, in particular contrast-agents containing iopamidol. This paper will report on longitudinal studies using contrast agent subjects who where followed-up for almost two years compared to a longitudinal control and a population mean. Based on this study, we suggest that iodine-containing contrast agents contaminate nail samples via non-specific binding in the short term followed by incorporation in the nail as a result of absorption. (author)

  12. Determination of iodine and iodine compounds in marine samples by ICPMS and HPLC-ICPMS

    DEFF Research Database (Denmark)

    Hansen, Maiken Sødergreen; Lewandowski, Daniel Jacob; Rasmussen, Rie Romme


    seaweed and fish, which contain elevated levels of iodine (fish typically 1-10 mg/kg and seaweed up to 8000 mg/kg). These marine food items may contain different iodine species, which may have different bioavailability and toxicity, and hence there is an increased interest in developing analytical methods...

  13. Thyroid volume and urinary iodine in European schoolchildren: standardization of values for assessment of iodine deficiency

    NARCIS (Netherlands)

    Delange, F.; Benker, G.; Caron, P.; Eber, O.; Ott, W.; Peter, F.; Podoba, J.; Simescu, M.; Szybinsky, Z.; Vertongen, F.; Vitti, P.; Wiersinga, W.; Zamrazil, V.


    Up to 1992, most European countries used to be moderately to severely iodine deficient. The present study aimed at evaluating possible changes in the status of iodine nutrition in 12 European countries during the past few years. Thyroid volume was measured by ultrasonography in 7599 schoolchildren

  14. The impact of iodised salt or iodine supplements on iodine status during pregnancy lactation and infancy

    NARCIS (Netherlands)

    Zimmermann, M.B.


    Objectives: Monitoring of iodine status during pregnancy, lactation and infancy is difficult as there are no established reference criteria for urinary iodine concentration (UI) for these groups; so it is uncertain whether iodized salt programs meet the needs of these life stages. Design and

  15. Intravascular enhancement with identical iodine delivery rate using different iodine contrast media in a circulation phantom. (United States)

    Mihl, Casper; Wildberger, Joachim E; Jurencak, Tomas; Yanniello, Michael J; Nijssen, Estelle C; Kalafut, John F; Nalbantov, Georgi; Mühlenbruch, Georg; Behrendt, Florian F; Das, Marco


    Both iodine delivery rate (IDR) and iodine concentration are decisive factors for vascular enhancement in computed tomographic angiography. It is unclear, however, whether the use of high-iodine concentration contrast media is beneficial to lower iodine concentrations when IDR is kept identical. This study evaluates the effect of using different iodine concentrations on intravascular attenuation in a circulation phantom while maintaining a constant IDR. A circulation phantom with a low-pressure venous compartment and a high-pressure arterial compartment simulating physiological circulation parameters was used (heart rate, 60 beats per minute; stroke volume, 60 mL; blood pressure, 120/80 mm Hg). Maintaining a constant IDR (2.0 g/s) and a constant total iodine load (20 g), prewarmed (37°C) contrast media with differing iodine concentrations (240-400 mg/mL) were injected into the phantom using a double-headed power injector. Serial computed tomographic scans at the level of the ascending aorta (AA), the descending aorta (DA), and the left main coronary artery (LM) were obtained. Total amount of contrast volume (milliliters), iodine delivery (grams of iodine), peak flow rate (milliliter per second), and intravascular pressure (pounds per square inch) were monitored using a dedicated data acquisition program. Attenuation values in the AA, the DA, and the LM were constantly measured (Hounsfield unit [HU]). In addition, time-enhancement curves, aortic peak enhancement, and time to peak were determined. All contrast injection protocols resulted in similar attenuation values: the AA (516 [11] to 531 [37] HU), the DA (514 [17] to 531 [32] HU), and the LM (490 [10] to 507 [17] HU). No significant differences were found between the AA, the DA, and the LM for either peak enhancement (all P > 0.05) or mean time to peak (AA, 19.4 [0.58] to 20.1 [1.05] seconds; DA, 21.1 [1.0] to 21.4 [1.15] seconds; LM, 19.8 [0.58] to 20.1 [1.05] seconds). This phantom study demonstrates that

  16. The placenta as a compensatory iodine storage organ.

    LENUS (Irish Health Repository)

    Burns, Robert


    The production of iodine-containing thyroid hormones necessary for brain development in the fetus depends not only on maternal dietary intake but also on placental iodine transport. The optimum level of iodine nutrition during pregnancy and the proportion of the pregnant population reaching this level have previously been evaluated. Little information exists on the ability of the placenta to either accumulate or store iodine. This study aims to investigate iodine uptake and tissue iodine content within placental tissue obtained from women delivering at term.

  17. Iodine-129 Dose in LLW Disposal Facility Performance Assessments

    International Nuclear Information System (INIS)

    Wilhite, E.L.


    Iodine-129 has the lowest Performance Assessment derived inventory limit in SRS disposal facilities. Because iodine is concentrated in the body to one organ, the thyroid, it has been thought that dilution with stable iodine would reduce the dose effects of 129I.Examination of the dose model used to establish the Dose conversion factor for 129I shows that, at the levels considered in performance assessments of low-level waste disposal facilities, the calculated 129I dose already accounts for ingestion of stable iodine. At higher than normal iodine ingestion rates, the uptake of iodine by the thyroid itself decrease, which effectively cancels out the isotopic dilution effect

  18. [Application of iodine metabolism analysis methods in thyroid diseases]. (United States)

    Han, Jian-hua; Qiu, Ling


    The main physiological role of iodine in the body is to synthesize thyroid hormone. Both iodine deficiency and iodine excess can lead to severe thyroid diseases. While its role in thyroid diseases has increasingly been recognized, few relevant platforms and techniques for iodine detection have been available in China. This paper summarizes the advantages and disadvantages of currently iodine detection methods including direct titration, arsenic cerium catalytic spectrophotometry, chromatography with pulsed amperometry, colorimetry based on automatic biochemistry, inductively coupled plasma mass spectrometry, so as to optimize the iodine nutrition for patients with thyroid diseases.

  19. Mixed-layered bismuth--oxygen--iodine materials for capture and waste disposal of radioactive iodine (United States)

    Krumhansl, James L; Nenoff, Tina M


    Materials and methods of synthesizing mixed-layered bismuth oxy-iodine materials, which can be synthesized in the presence of aqueous radioactive iodine species found in caustic solutions (e.g. NaOH or KOH). This technology provides a one-step process for both iodine sequestration and storage from nuclear fuel cycles. It results in materials that will be durable for repository conditions much like those found in Waste Isolation Pilot Plant (WIPP) and estimated for Yucca Mountain (YMP). By controlled reactant concentrations, optimized compositions of these mixed-layered bismuth oxy-iodine inorganic materials are produced that have both a high iodine weight percentage and a low solubility in groundwater environments.

  20. Mixed-layered bismuth-oxygen-iodine materials for capture and waste disposal of radioactive iodine (United States)

    Krumhansl, James L; Nenoff, Tina M


    Materials and methods of synthesizing mixed-layered bismuth oxy-iodine materials, which can be synthesized in the presence of aqueous radioactive iodine species found in caustic solutions (e.g. NaOH or KOH). This technology provides a one-step process for both iodine sequestration and storage from nuclear fuel cycles. It results in materials that will be durable for repository conditions much like those found in Waste Isolation Pilot Plant (WIPP) and estimated for Yucca Mountain (YMP). By controlled reactant concentrations, optimized compositions of these mixed-layered bismuth oxy-iodine inorganic materials are produced that have both a high iodine weight percentage and a low solubility in groundwater environments.

  1. Dimethyl sulfoxide complexing with iodine

    Energy Technology Data Exchange (ETDEWEB)

    Borovikov, Yu Ya; Serguchev, Yu A; Staninets, V I


    Dielectrometry, conductometry, IR-spectroscopy are used to study dimethyl sulfoxide complexing with iodine in binary system and in CCl/sub 4/, C/sub 6/H/sub 6/, C/sub 6/H/sub 5/Cl, C/sub 6/H/sub 5/CF/sub 3/, 1, 2-dichloroethane solutions. Complexes of 1:1 composition are formed in solutions, in the binary system of 2:1 and 2:2 composition. I/sub 2/ molecules add to oxygen atoms. In CCl/sub 4/ and in binary system gradual transformation of so called external charge transfer complexes (CTC-1) to internal ones (CTC-2) that are described by the 1st order reaction kinetic equations is observed. On dissolution of CTC of 2:2 composition they disproportionate into two CTC molecules 1:1. Enthalpy of forming CTC-1 1:1 is approximately 4 kcal/mol, CTC-2 1:1 - 8, CTC-1 2:1 - 8 kcal/mol.

  2. Active molecular iodine photochemistry in the Arctic

    Energy Technology Data Exchange (ETDEWEB)

    Raso, Angela R.; Custard, Kyle D.; May, Nathaniel W.; Tanner, David; Newburn, Matthew K.; Walker, Lawrence R.; Moore, Ronald J.; Huey, L. G.; Alexander, Lizabeth; Shepson, Paul B.; Pratt, Kerri A.


    During springtime, the Arctic atmospheric boundary layer undergoes frequent rapid depletions in ozone and gaseous elemental mercury due to reactions with halogen atoms, influencing atmospheric composition and pollutant fate. Although bromine chemistry has been shown to initiate ozone depletion events, and it has long been hypothesized that iodine chemistry may contribute, no previous measurements of molecular iodine (I2) have been reported in the Arctic. Iodine chemistry also contributes to atmospheric new particle formation and therefore cloud properties and radiative forcing. Here we present Arctic atmospheric I2 and snowpack iodide (I-) measurements, which were conducted near Utqiagvik, AK, in February 2014. Using chemical ionization mass spectrometry, I2 was observed in the atmosphere at mole ratios of 0.3–1.0 ppt, and in the snowpack interstitial air at mole ratios up to 22 ppt under natural sunlit conditions and up to 35 ppt when the snowpack surface was artificially irradiated, suggesting a photochemical production mechanism. Further, snow meltwater I-measurements showed enrichments of up to ~1,900 times above the seawater ratio of I-/Na+, consistent with iodine activation and recycling. Modeling shows that observed I2 levels are able to significantly increase ozone depletion rates, while also producing iodine monoxide (IO) at levels recently observed in the Arctic. These results emphasize the significance of iodine chemistry and the role of snowpack photochemistry in Arctic atmospheric composition, and imply that I2 is likely a dominant source of iodine atoms in the Arctic.

  3. Absorption of gaseous iodine by water droplets

    International Nuclear Information System (INIS)

    Albert, M.F.


    A new model has been developed for predicting the rate at which gaseous molecular iodine is absorbed by water sprays. The model is a quasi-steady state mass transfer model that includes the iodine hydrolysis reactions. The parameters of the model are spray drop size, initial concentration of the gas and liquid phases, temperature, pressure, buffered or unbuffered spray solution, spray flow rate, containment diameter and drop fall height. The results of the model were studied under many values of these parameters. Plots of concentration of iodine species in the drop versus time have been produced by varying the initial gas phase concentration of molecular iodine over the range of 1 x 10 -5 moles/liter to 1 x 10 -10 moles/liter and a drop size of 1000 microns. Results from the model are compared to results available from Containment Systems Experiments at Pacific Northwest Laboratory. The difference between the model predictions and the experimental data ranges from -120.5% to 68.0% with the closest agreement 7.7%. The new spray model is also compared to previously existing spray models. At high concentrations of gaseous molecular iodine, the new spray model is considered to be less accurate but at low concentrations, the new model predicts results that are closer to the experimental data than the model called the realistic model from WASH-1329. Inclusion of the iodine hydrolysis reaction is shown to be a feature important to a model intended for determining the removal of molecular iodine over a wide range of conditions

  4. Breast-Milk Iodine Concentrations and Iodine Levels of Infants According to the Iodine Status of the Country of Residence: A Systematic Review and Meta-Analysis. (United States)

    Nazeri, Pantea; Kabir, Ali; Dalili, Hosein; Mirmiran, Parvin; Azizi, Fereidoun


    Iodine, an essential micronutrient, plays a critical role in normal growth and development, especially during the first two years of life. This systematic review and meta-analysis is among the first to evaluate breast-milk iodine concentrations and infant iodine status in countries characterized by iodine sufficiency or deficiency. PubMed, Web of Science, Cochrane Library, Google Scholar, and other relevant databases, as well as reference lists of previous reviews, were searched for relevant studies published between 1986 and 2016. Mean or median breast-milk and infant urinary iodine concentrations, along with other relevant data, were extracted from eligible studies. Each study was assessed for quality and risk of bias. Of the 496 identified studies, 57 met the criteria for inclusion in the meta-analysis. The mean (confidence interval [CI]) iodine concentrations in maternal colostrum were 152.0 μg/L [CI 106.2-198.7 μg/L] and 57.8 μg/L [CI 41.4-74.1 μg/L] in iodine-sufficient and -deficient countries, respectively, indicating a significant difference between the two iodine statuses. By contrast, the corresponding values in mature milk did not differ significantly between mothers in iodine-sufficient and -deficient countries (71.5 μg/L [CI 51.0-92.0 μg/L] and 28.0 μg/L [CI -13.8 to 69.9 μg/L], respectively]. The weighted urinary iodine levels [CIs] of breast-fed infants in iodine-sufficient countries were significantly higher than those in iodine-deficient countries (164.5 μg/L [CI 116.4-212.7 μg/L] vs. 70.4 μg/L [CI 46.2-94.6 μg/L]). Similarly, a significant difference was observed in the pooled estimates of urinary iodine levels [CIs] among formula-fed infants in iodine-sufficient versus iodine-deficient countries (310.3 μg/L [CI 287.4-342.1 μg/L] vs. 38.3 μg/L [CI 23.4-53.2 μg/L]). The meta-analysis reveals that in iodine-sufficient countries, the mean iodine concentrations in colostrum and mature breast milk

  5. Clinical and Biochemical Uses of Stable Iodine Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Koutras, D. A. [Thyroid Section, Alexandra Hospital, Athens (Greece)


    Iodine and thyroid function are closely linked, since the only known role of iodine is its participation in the synthesis of thyroid hormones. Iodine metabolism may be represented as a metabolic cycle consisting of three main pools: the Plasma Inorganic Iodine (PIl) pool into which dietary iodine goes and from where it is either taken up by the thyroid or excreted by the kidneys, the intrathyroidal iodine pool, where. thyroid hormone synthesis occurs, and finally the peripheral pool of thyroid hormones, of which about 80% are deiodinated and 20% excreted with the faeces. Endemic goitre is usually due to iodine deficiency. There is no renal homeostatic mechanism to keep the PII level constant, and so adaptation to iodine deficiency occurs by increasing the thyroidal iodide clearance rate. Stable iodine measurements are necessary for a complete study of iodine metabolism. Estimates of the serum Protein-Bound Iodine (PBl) are the best index of thyroid function, estimates of the PII and of the urinary iodine are the best indices of iodine nutrition. (author)

  6. Teratology public affairs committee position paper: iodine deficiency in pregnancy. (United States)

    Obican, Sarah G; Jahnke, Gloria D; Soldin, Offie P; Scialli, Anthony R


    Iodine deficiency is an important nutritional deficiency, with more than 2 billion people worldwide estimated to be at risk. The developing fetus and young children are particularly at risk. During pregnancy and lactation, iodine requirements increase, whether in iodine-poor or iodine-sufficient countries, making the mother and the developing fetus vulnerable. The American Thyroid Association (ATA) recommends 250 micrograms per day of iodine intake for pregnant and lactating women. The thyroid gland is able to adapt to the changes associated with pregnancy as long as sufficient iodine is present. Dietary intake is the sole source of iodine, which is essential to the synthesis of thyroid hormones. Iodine is found in multiple dietary sources including iodized salt, dairy products, seaweed, and fish. Prenatal vitamins containing iodine are a good source of iodine, but iodine content in multivitamin supplements is highly variable. Congenital hypothyroidism is associated with cretinism. Clinical hypothyroidism has been associated with increased risk of poor perinatal outcome including prematurity, low birth weight, miscarriage, preeclampsia, fetal death, and impaired fetal neurocognitive development. Subclinical hypothyroidism is also associated with poor pregnancy outcomes and potential fetal neurocognitive deficits, but the data are more variable than those for clinical hypothyroidism. We concur with the ATA recommendation that all pregnant and lactating women should ingest (through diet and supplements) 250 micrograms of iodine daily. To achieve this goal, we recommend that all pregnant and lactating women take daily iodine supplementation of 150 micrograms. Copyright © 2012 Wiley Periodicals, Inc.

  7. The kinetic study of oxidation of iodine by hydrogen peroxide

    International Nuclear Information System (INIS)

    Cantrel, L.; Chopin, J.


    Iodine chemistry is one of the most important subjects of research in the field of reactor safety because this element can form volatile species which represent a biological hazard for environment. As the iodine and the peroxide are both present in the sump of the containment in the event of a severe accident on a light water nuclear reactor, it can be important to improve the knowledge on the reaction of oxidation of iodine by hydrogen peroxide. The kinetics of iodine by hydrogen peroxide has been studied in acid solution using two different analytical methods. The first is a UV/Vis spectrophotometer which records the transmitted intensity at 460 nm as a function of time to follow the decrease of iodine concentration, the second is an amperometric method which permits to record the increase of iodine+1 with time thanks to the current of reduction of iodine+1 to molecular iodine. The iodine was generated by Dushman reaction and the series of investigations were made at 40 o C in a continuous stirring tank reactor. The influence of the initial concentrations of iodine, iodate, hydrogen peroxide, H + ions has been determined. The kinetics curves comprise two distinct chemical phases both for molecular iodine and for iodine+1. The relative importance of the two processes is connected to the initial concentrations of [I 2 ], [IO 3 - ], [H 2 O 2 ] and [H + ]. A rate law has been determined for the two steps for molecular iodine. (author) figs., tabs., 22 refs

  8. Biofortification of lettuce (Lactuca sativa L.) with iodine: The effect of iodine form and concentration in the nutrient solution on growth, development and iodine uptake of lettuce grown in water culture

    NARCIS (Netherlands)

    Voogt, W.; Holwerda, H.T.; Khodabaks, M.R.


    BACKGROUND: Iodine is an essential trace element for humans. Two billion individuals have insufficient iodine intake. Biofortification of vegetables with iodine offers an excellent opportunity to increase iodine intake by humans. The main aim was to study the effect of iodine form and concentration

  9. Mobile Iodine Mineralization Based on Malachite Transformation

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seung Yeop; Baik, Min Hoon [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)


    Our new method that is proposed here, however, offer drastic cost cutting by using copper. Moreover, the selectivity of iodine in anion-rich water is advantage to lower the disposal cost by reducing the radioactive waste volume. Iodide (I{sup -}) is soluble and mobile in water, so it is very difficult to capture and precipitate it with common adsorbents. Until now, various exchanger and getter materials have been developed to capture radioactive iodine in wastewater. The materials developed generally showed a good performance under acidic conditions. However, the adsorption amounts were not relatively large in neutral and high pH conditions. Furthermore, the capacity to capture iodine is limited by their properties, such as the specific surface area and adsorbing affinity. Recently, Ag-coated materials have attracted attention as adsorbents. They have shown higher uptake for I- compared to other substances, but they are costly. Our new method that is proposed here, however, offer drastic cost cutting by using copper. Moreover, the selectivity of iodine in anion-rich water is advantage to lower the disposal cost by reducing the radioactive waste volume. Radioactive iodine isotopes are characterized as volatile and mobile species that are difficult to capture by adsorbents. In our study, we developed a new way to uptake and crystallize the mobile iodide as cuprous iodide (CuI). This method will be a promising way to simply stabilize iodide in a solid form with compacted volume.

  10. Iodine release from sodium pool combustion

    International Nuclear Information System (INIS)

    Sagawa, N.; Fukushima, Y.; Yokota, N.; Akagane, K.; Mochizuki, K.


    Iodine release associated with sodium pool combustion was determined by heating 20 gr sodium containing sodium iodide, which was labelled with 131 I and dissolved in the sodium in concentration of 1∼1,000 ppm, to burn on a nickel crucible in conditioned atmosphere in a closed vessel of 0.4 m 3 . Oxygen concentration was changed in 5∼21% and humidity in 0∼89% by mixing nitrogen gas and air. Combustion products were trapped by a Maypack filter composed of particle filters, copper screens and activated charcoal beds and by a glass beads pack cooled by liquid argon. Iodine collected on these filter elements was determined by radio-gas chromatography. When the sodium sample burned in the atmosphere of air at room temperature, the release fractions observed were 6∼33% for sodium and 1∼20% for iodine added in the sodium. The release iodine was present in aerosol at a ratio of 98%, and the remainder in the gas form. The release fraction of iodine trended to decrease as oxygen concentration and humidity in the atmosphere increased. No organic iodide was detected in the combustion products. (author)

  11. Contamination of pasture by iodine 131

    International Nuclear Information System (INIS)

    Angeletti, Livio


    The reassessment of the experimental data on the transfer of iodine to aerial parts of rye-gras leads to the following significant findings: 1 - Water content of herbage depending markedly on time and location, the contamination of the vegetals has to be expressed on a dry weight basis. 2 - The value of the geometrical mean of the deposition velocity of iodine vapour as derived from 19 experiments carried out over 4 years is 0.76 cm/s. This value agrees very well with the value of V(d)=0.80 obtained in the USA during experiments comparable as to the number of tests and their duration. Consequently we propose a value of V(d)=0.76 cm/s for the evaluation of pasture land contamination by iodine resulting from routine releases. For accidental releases, however, we propose a value of V(d)=2 cm/s, which was the upper limit in about 90% of our experimental results. 3 - The analysis of data on wet deposition of iodine on the aerial parts of rye-grass shows that the initial retention when expressed as percent of the total deposit decreases with aspersion intensities. If expressed as retention factor, the initial retention is constant, for all aspersion intensities. The average initial iodine retention being lower by a factor of 2.3 than water retention the value of the latter will therefore be the upper limit for this radionuclide [fr

  12. Seaweed tablet: a natural source of iodine

    International Nuclear Information System (INIS)

    Briones, Annabelle V.; Ambal, Wilhelmina O.; Monroyo, Evangelina C.; Bonifacio, Teresita S.; Sison, Fe M.


    Species of seaweeds namely: Halymenia durvillaei, Laurencia flexilis and Sargassum gigantifolium were processed into dried form and formulated as tablet. Prior to tablet formulation, the seaweeds were assayed for iodine and trace elements. The seaweeds that exhibited significance values of iodine and trace elements were further analyzed for the presence of heavy metals followed by acute oral toxicity test (LD 50 ). Among the seaweeds evaluated, H. durvilaei was found to contain high level of iodine (0.255% w/w) and magnesium (1.65% w/w) with sufficient amount of zinc (25.69 ppm) and phosporous (11.68 ppm). Analysis of heavy metals showed minute amount of mercury (0.0055 ppm), cadmium (0.67 ppm) and lead (1.80 ppm). The median lethal dose (LD 50 ) of H. durvillaei administered orally in Swiss male mice is 119.1489 ± 4.9873 g/kg. Tablet formulation was based on the U.S. recommended daily allowance of 0.15 mg. of iodine per adult and children. The final product was comparable to imported Kelp pills (available in the local market) in terms of physical properties and iodine content. (Author)

  13. The behaviour of iodine in the terrestrial environment

    International Nuclear Information System (INIS)

    Christiansen, J.V.


    Literature on the geochemistry of iodine is surveyed, focusing on fundamental chemical aspects which influence the migration behaviour of iodine in the terrestrial environment. It is stated that the organic fraction in soil plays the predominant role in the retention of iodine. Simple aromatic molecules serve as simple models for humic acid, and humic acid is iodinated catalyzed by haloperoxidases. The enzymatically controlled iodination of humic acid is described in detail and it is demonstrated that the results may reflect a kind of equilibrium. It is shown that soil extracts are able to catalyze the iodination of humic acid and it is suggested that extracellular peroxidases in soil are reponsible for the reaction. The enzymatically controlled iodination of humic acid is discussed and some considerations about the influence on the migration of iodine in the terrestrial environment are given. (author) 4 tabs., 26 ills., 82 refs

  14. Iodine Supplementation in Pregnancy and the Dilemma of Ambiguous Recommendations

    DEFF Research Database (Denmark)

    Andersen, Stine Linding; Laurberg, Peter


    Iodine requirements are increased during pregnancy, predominantly caused by an increase in renal iodide clearance and in the use of iodine for thyroid hormone production. Because iodine deficiency (ID) in pregnancy may be associated with neurodevelopmental deficits in the offspring, a pertinent...... sufficient for at least 2 years. However, guidance on this differs between scientific societies. This review discusses iodine supplementation in pregnancy. Based on current evidence, the recommendations given by WHO/UNICEF/ICCIDD in 2007 provide a valid guidance on the use of iodine supplements in pregnant...... women. Women living in a population with a median urinary iodine concentration (UIC) at or above 100 µg/l are not in need of iodine supplementation in pregnancy. On the other hand, if the population median UIC is below 100 µg/l, pregnant women should take iodine-containing supplements until...

  15. Iodine Excess is a Risk Factor for Goiter Formation

    African Journals Online (AJOL)

    Key Words: Iodine excess, Goiter, Sub Saharan Africa. Iodine Excess is a ... synthesis leading to increased thyroid stimulating hormone ..... study done in Uganda revealed a similar picture ... significant association, probably due to recall bias.

  16. Comprehensive handbook of iodine: nutritional, biochemical, pathological and therapeutic aspects

    National Research Council Canada - National Science Library

    Preedy, Victor R; Burrow, Gerard N; Watson, Ronald R


    ... for Monitoring Effects of Iodine/Thyroid Status in Populations Inge Bülow Pedersen and Peter Laurberg 3 15 29 39 47 55 65 Section 2: General Aspects of Iodine Sources and Intakes in the Diet, Mai...

  17. Iodine Intakes of Victorian Schoolchildren Measured Using 24-h Urinary Iodine Excretion

    Directory of Open Access Journals (Sweden)

    Kelsey Beckford


    Full Text Available Mandatory fortification of bread with iodized salt was introduced in Australia in 2009, and studies using spot urine collections conducted post fortification indicate that Australian schoolchildren are now replete. However an accurate estimate of daily iodine intake utilizing 24-h urinary iodine excretion (UIE μg/day has not been reported and compared to the estimated average requirement (EAR. This study aimed to assess daily total iodine intake and status of a sample of primary schoolchildren using 24-h urine samples. Victorian primary school children provided 24-h urine samples between 2011 and 2013, from which urinary iodine concentration (UIC, μg/L and total iodine excretion (UIE, μg/day as an estimate of intake was determined. Valid 24-h urine samples were provided by 650 children, mean (SD age 9.3 (1.8 years (n = 359 boys. The mean UIE of 4–8 and 9–13 year olds was 94 (48 and 111 (57 μg/24-h, respectively, with 29% and 26% having a UIE below the age-specific EAR. The median (IQR UIC was 124 (83,172 μg/L, with 36% of participants having a UIC < 100 μg/L. This convenience sample of Victorian schoolchildren were found to be iodine replete, based on UIC and estimated iodine intakes derived from 24-h urine collections, confirming the findings of the Australian Health Survey.

  18. Study on adsorption performance of coal based activated carbon to radioactive iodine and stable iodine

    International Nuclear Information System (INIS)

    Zhou, Junbo; Hao, Shan; Gao, Liping; Zhang, Youchen


    Highlights: • The impregnated coal-based activated carbons as adsorbent for removing methyl iodide. • The coal-based activated carbons to remove stable iodine. • Iodine residues are under 0.5 μg/ml after adsorption treatment. • The decontamination factor is much higher than 1000. - Abstract: Nuclear power plant, nuclear reactors and nuclear powered ship exhaust contains a large amount of gaseous radioactive iodine, and can damage to the workplace and the surrounding environment. The quantitative test to remove methyl iodide and the qualitative test for removing stable iodine were investigated using the impregnated coal-based activated carbons and coal-based activated carbons as adsorbents. The research conducted in this work shows that iodine residues were under 0.5 μg/ml after adsorption treatment and the decontamination factor of the coal-based activated carbon for removing the stable iodine was more than 1000, which can achieve the purpose of removing harmful iodine, and satisfy the requirement of gaseous waste treatment of nuclear powered vessel and other nuclear plants

  19. Veganism as a cause of iodine deficient hypothyroidism. (United States)

    Yeliosof, Olga; Silverman, Lawrence A


    Iodine deficiency is the most common cause of acquired hypothyroidism worldwide. Although uncommon in the Western world, the incidence of iodine deficiency may be rising due to the increased use of restrictive diets. We present a 23-month-old boy diagnosed with iodine deficiency hypothyroidism, induced by a vegan diet. This case highlights the risk for iodine deficiency in children on a vegan diet after discontinuation of breast/formula feeding that could lead to acquired hypothyroidism.

  20. Estimation of iodine in soils by neutron activation analysis

    International Nuclear Information System (INIS)

    Krishnamoorthy, K.R.; Iyer, R.K.


    This paper reports the determination of the iodine content of soils by neutron activation analysis. The irradiated sample is fused with alkali in presence of 131 I tracer. From the aqueous extract, iodine activity is extracted into carbon tetrachloride and stripped back to aqueous phase with a high selectivity for iodine. 131 I tracer is used to measure chemical yield. Iodine contents in the range 1 to 20 ppm. have been determined by this technique. (author)

  1. Iodine oxides in large-scale THAI tests

    International Nuclear Information System (INIS)

    Funke, F.; Langrock, G.; Kanzleiter, T.; Poss, G.; Fischer, K.; Kühnel, A.; Weber, G.; Allelein, H.-J.


    Highlights: ► Iodine oxide particles were produced from gaseous iodine and ozone. ► Ozone replaced the effect of ionizing radiation in the large-scale THAI facility. ► The mean diameter of the iodine oxide particles was about 0.35 μm. ► Particle formation was faster than the chemical reaction between iodine and ozone. ► Deposition of iodine oxide particles was slow in the absence of other aerosols. - Abstract: The conversion of gaseous molecular iodine into iodine oxide aerosols has significant relevance in the understanding of the fission product iodine volatility in a LWR containment during severe accidents. In containment, the high radiation field caused by fission products released from the reactor core induces radiolytic oxidation into iodine oxides. To study the characteristics and the behaviour of iodine oxides in large scale, two THAI tests Iod-13 and Iod-14 were performed, simulating radiolytic oxidation of molecular iodine by reaction of iodine with ozone, with ozone injected from an ozone generator. The observed iodine oxides form submicron particles with mean volume-related diameters of about 0.35 μm and show low deposition rates in the THAI tests performed in the absence of other nuclear aerosols. Formation of iodine aerosols from gaseous precursors iodine and ozone is fast as compared to their chemical interaction. The current approach in empirical iodine containment behaviour models in severe accidents, including the radiolytic production of I 2 -oxidizing agents followed by the I 2 oxidation itself, is confirmed by these THAI tests.

  2. Effect of iodinated contrast media on thyroid: a brief review

    Directory of Open Access Journals (Sweden)

    Şerife Mehlika Kuşkonmaz


    Full Text Available In parallel to the increased use of computed tomography, iodinated contrast agents are increasingly becoming a source of excess iodide. Iodinated contrast agents may induce thyroid dysfunction in exposed patients, especially in the presence of an underlying thyroid disease. Thus, an ordinary dose of the contrast used for the imaging, can induce hyper or hypothyroidism in a patient with subtle thyroid disease. This review will briefly discuss the physiology of iodine and the clinical evaluation of iodine induced thyroid dysfunction.

  3. Prospects of the high power iodine laser

    International Nuclear Information System (INIS)

    Hohla, K.; Brederlow, G.; Fill, E.; Volk, R.; Witte, K.J.


    The characteristic properties of the iodine laser (gaseous laser substance, photolytic pump mechanism, variable stimulated emission cross-section) made it possible in a relatively short time to generate ns pulses in the kJ range. The Asterix II and III iodine laser systems at IPP are working successfully, and the question arises what prospects are afforded for further iodine laser development. What are the problems that have to be clarified in order to build 10 or 100 kJ systems for laser fusion experiments. According to our experience these can be classified as follows: 1) Short pulse generation and contrast ratio, 2) pulse shaping in a high-gain laser and amplification in the coherent time range, 3) non-linear properties at high intensities, 4) scalable pumping schemes and chemical processes. (orig./WL) [de

  4. Micromethod of Iodine Measurement in Vrine

    Directory of Open Access Journals (Sweden)

    M Arbuzova


    Full Text Available Iodine concentration in urine is the direct quantity indicator of the current consumption of iodine in the population. The most widespread method of determination of iodine in urine is cerium-arsenic method with preliminary processing samples of urine using the solution ammonium persulfate. The purpose of work was to develop updating of the given method for reduction of the formation of toxic products of the reaction. Described method has good characteristics (the limit of the detection of this method 11 ug/l, CV < 10 %, the coefficient of the correlation with reference method 0.99, the amount of toxic substances formed during reaction decreases in 3 times, the cost price of research is reduced owing to reduction of the volume of reagents and water.

  5. Iodine-129 in the European Environment

    Energy Technology Data Exchange (ETDEWEB)

    Michel, R.; Daraoui, A.; Gorny, M.; Jakob, D.; Sachse, R.; Tosch, L. [Institut fuer Radiooekologie und Strahlenschutz, Leibniz Universitaet, Hannover (Germany); Alfimov, V.; Synal, H. -A. [Labor fuer Ionenstrahlphysik, ETH Hoenggerberg, Zuerich (Switzerland); Nies, H.; Herrmann, J.; Goroncy, I. [Bundesamt fuer Seeschifffahrt und Hydrographie, Hamburg (Germany)


    Due to former atmospheric nuclear weapon tests, accidents in nuclear facilities and releases from nuclear reprocessing plants, the natural occurrence of the radionuclide {sup 129}I has been affected on a long term scale by human activities. Particularly in Western Europe, these changes are continuing due to discharges from the nuclear reprocessing plants La Hague and Sellafield. A survey is given on the environmental abundances of {sup 129}I and {sup 127}I in the North Sea, the Northeast Atlantic, as well as on the atmospheric transport of iodine isotopes from the sea to the continent and their pathways to animals and man. Today, the environmental {sup 129}I /{sup 127}I isotope ratios range from 10{sup -10} to 10{sup -6} and are far above the pre-nuclear ratio of {approx}10{sup -12}. The iodine isotopes are in severe disequilibrium in the different environmental compartments and serve as tracers of the complex environmental chemistry of iodine. (author)

  6. Reaction rate of hydrolysis of iodine

    International Nuclear Information System (INIS)

    Miyake, Yoshikazu; Eguchi, Wataru; Adachi, Motonari


    Absorption rates of dilute iodine vapor contained in air by aqueous mixtures of sodium hydroxide and boric acid were measured using a laminar liquid jet column absorber at 298 K. Absorption rates in this system are controlled by a series of complex reactions taking place in the liquid phase. The reaction rate constant of iodine hydrolysis in the aqueous phase was determined from the absorption rates observed under the conditions that the base-catalytic hydrolysis reaction of iodine can be considered to be irreversible and that other reactions can be neglected. The absorption rates calculated theoretically with the rate constant value obtained above were in good accordance with the whole experimental data observed for a wide range of experimental conditions. (author)

  7. Iodine Support of Population in Vinnytsa Region

    Directory of Open Access Journals (Sweden)

    M.V. Vlasenko


    Full Text Available In 9 localities in Vinnitsa region the study of iodine support of population was conducted. 810 persons were examined including 540 children aged 7–12 years old living under the conditions of combined influence of geochemical and anthropogenic ecological factors. Vinnitsa region was found to be the territory with the mild iodine deficiency. Schoolboys with endemic increase of thyroid gland appeared to have typically higher prevalence of chronic somatic pathology. The peculiarities of goitrous endemia confirm complex pathogenesis of thyromegaly in children under conditions of combined influence of anthropogenic and geochemical factors, caused not only by the absolute iodine insufficiency but also by influence of additional goiterous factors. These peculiarities determine the necessity of complex approach to perform preventive antithyroid measures.


    Directory of Open Access Journals (Sweden)

    F. S. Bazrova


    Full Text Available The article discusses the new iodine-containing supplements (ID derived from organic media collagenous animal protein (pork rind, carpatina and collagen and protein concentrates brands SCANGEN and PROMIL C95. It is shown that the use of these proteins as carriers of iodine is due to the high content of the amino acids glycine and alanine, which correlates with the degree of binding of iodine objects. New additives in addition to the special focus improve rheological properties of foods, including texture, appearance and functional properties. To assess the quality'ID and selection of preferred option the proposed qualitative assessment and a systematic approach to consider all'ID as a system to allocate its elements, to justify the principles of its construction and the requirements imposed on it, to build a General decision tree. For the construction of complex criterion for assessing the quality'ID proposed procedure formalization based on selection and evaluation of individual indicators, the definition of the laws of their change, depending on the dose, duration and temperature of exposure, and functional efficiency. For comparative evaluation of single and calculation of group indicators all of them were reduced to a single dimension by introducing the dimensionless coefficients of adequately describing the analyzed indicators. The article presents the calculated values of single and group of indicators characterizing technological properties 'ID: the degree of binding of iodine, the binding rate of iodine, heat losses of iodine and basic functional and technological properties of meat stuffing systems (water-binding, moisture-holding, emulsifying capacity and emulsion stability, obtained by the introduction of stuffing in the system studied'ID. At the final stage is the selection of the best 'ID, on the basis of an assessment of group performance.

  9. Iodine-125 and Iodine-131 in the Thames Valley and other areas

    International Nuclear Information System (INIS)

    Howe, J.R.; Lloyd, M.K.; Bowlt, C.


    Part of the Iodine-125 and Iodine-131 waste from hospitals and research centres is discarded down drains and passes through sewage and water reclamation works into the river system. Relatively high concentration of radioiodine occur in outfalls that discharge into the river Thames, lower levels are found in the mainstream river and less still in the reservoirs and tap water supplies abstracted from the river. The pathway from waste to drinking water could account for the low levels of Iodine-125 found in the thyroid glands of some farm animals and human beings in the Thames valley

  10. Iodine content in drinking water and other beverages in Denmark

    DEFF Research Database (Denmark)

    Rasmussen, Lone Banke; Larsen, Erik Huusfeldt; Ovesen, L.


    Objective: To investigate the variation in iodine content in drinking water in Denmark and to determine the difference in iodine content between organic and non-organic milk. Further, to analyse the iodine content in other beverages. Design and setting: Tap water samples were collected from 41 ev...

  11. 21 CFR 520.1157 - Iodinated casein tablets. (United States)


    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Iodinated casein tablets. 520.1157 Section 520...) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS ORAL DOSAGE FORM NEW ANIMAL DRUGS § 520.1157 Iodinated casein tablets. (a) Specifications. Each 1-gram tablet contains 25 milligrams of iodinated casein. (b) Sponsor...

  12. The importance of prevention with iodine after nuclear accidents

    International Nuclear Information System (INIS)

    Mornealo, Elena; Chirca, Lucia


    Medical negative consequences of the disastrous accident from the Chernobyl are tangible till present and the thyroid pathology has a special place among them. It is caused by the actions of radioactive iodine and can be greatly minimized by the implementation of prophylaxis with stable iodine. The basic principles, benefits and risks of iodine prophylaxis are reported in this article. (authors)

  13. Iodine. Do we need an enrichment program in Denmark?

    DEFF Research Database (Denmark)

    Rasmussen, Lone Banke; Andersson, G.; Haraldsdottir, J.


    A working group was established to evaluate the need for iodine enrichment in Denmark. Judged from studies of urinary iodine excretion and one dietary survey the intake of iodine in Denmark is low compared with recommended intakes. The occurrence of non-toxic goitre is relatively high; between 9...

  14. Progress towards eliminating iodine deficiency in South Africa

    NARCIS (Netherlands)

    Jooste, P.; Zimmermann, M.B.


    Before the introduction of salt iodisation in 1954, South Africa was one of the many countries of the world with a lack of iodine in most of its territory and hence there was a need for a salt iodisation programme. The understanding of the iodine situation in South Africa, the basics of iodine

  15. Iodine supplementation in pregnancy and its effest on child cognition

    NARCIS (Netherlands)

    Boonstra, A.; Gowachirapant, S.; Jaiswal, A.K.; Winichagoon, P.; Srinivasan, K.; Zimmerman, M.B.


    Maternal hypothyroidism and hypothyroxenemia due to iodine deficiency have been shown to affect development of the newborn negatively. Maternal iodine supplementation may therefore improve cognitive performance of the offspring, even in areas of mild-to-moderate iodine deficiency (ID). Several

  16. Knowledge, attitudes and practices regarding iodine among patients ...

    African Journals Online (AJOL)

    Keywords: hyperthyroidism; iodine; iodised salt; knowledge-attitude-practice study; South Africa ... While iodine deficiency has been reported to facilitate the development ... the health of children if they did not get enough iodine, almost all of the .... in South Africa. The use of local mass media could be considered during the.

  17. Development of Databases with Iodine in Foods and Dietary Supplements (United States)

    Iodine is an essential micronutrient required for normal growth and development, thus an adequate intake of iodine is particularly important in pregnant and lactating women, and throughout childhood. Low levels of iodine in the soil and groundwater are common in many parts of the world, often leadi...

  18. Thyroid cancer in South Africa - an indicator of regional iodine ...

    African Journals Online (AJOL)

    Objective. Because follicular thyroid cancers predominate in iodine-deficient and papillary cancers predominate in iodine·replete populations. we have analysed national and regional (former Transvaal) incidences of these cancer types as a surrogate measure of the population iodine nutritional status in South Africa.

  19. Evaluating iodine deficiency in pregnant women and young infants

    DEFF Research Database (Denmark)

    Laurberg, Peter; Andersen, S.; Bjarnadottir, R. I.


    pregnancy is not a sign of maternal iodine deficiency; 5) a higher concentration of TSH and Tg in cord blood than in maternal blood is not a sign of iodine deficiency in the mother or neonate; and 6) thyroid function in a full-term foetus, a neonate or a small child is not more sensitive to a mild iodine...

  20. Considerations regarding iodine prophylaxis in radiological accidents

    International Nuclear Information System (INIS)

    Perez, M.R.; Gisone, P.; Rojo, A.M.; Dubner, D.; Bruno, H.


    The indication for the blockade of thyroid gland by the administration of stable iodide is the main countermeasure for diminishing the thyroid uptake of radioiodine following radiological accidents with potential release of radioiodine into the environment in order to avoid deterministic effects and to decrease the probability of stochastic effects. Iodine prophylaxis should be considered along with other countermeasures like sheltering indoors, evacuation and control on contaminated foods. In this communication different factors related to accidental situations regarding iodine prophylaxis are evaluated. A therapeutical scheme is proposed in order to be applied in countries of this region. (author). 4 refs

  1. Thyroid disorders in mild iodine deficiency

    DEFF Research Database (Denmark)

    Laurberg, P; Nøhr, S B; Pedersen, K M


    in elderly subjects, especially women, with risk of cardiac arrhythmias, osteoporosis, and muscle wasting. The hyperthyroidism is caused by autonomous nodular growth and function of the thyroid gland and it is accompanied by a high frequency of goiter. Pregnant women and small children are not immediately...... endangered but the consequences of severe iodine deficiency for brain development are grave and a considerable safety margin is advisable. Moreover, a shift toward less malignant types of thyroid cancer and a lower radiation dose to the thyroid in case of nuclear fallout support that mild-to-moderate iodine...

  2. Methods to determine iodine plate-out

    International Nuclear Information System (INIS)

    Hougaard, H.; Solgaard, P.; Zak, W.


    A literature study on iodines behaviour after release from irradiated fuel rods and a detailed dscription of the ventilation system in the hot cell facility form the basis of chosen conditions for some preliminary experiments using non-radioactive iodine. The conclusion states that the system is well suited for the purpose as is the method of sampling from the surface of the ventilation duct, while the releasing technique and the chemical analysis has to be further developed, neutron activation analysis being most promising. (author)

  3. [Overall child development: beyond pharmacological iodine supplementation]. (United States)

    Gavilán, Enrique; Jiménez de Gracia, Laura


    Iodine deficiency is a factor that may compromise child development, but is not the only one. Other health determinants, some of them outside the healthcare system, are able to influence development. Fighting iodine deficiency may be a pragmatic and useful strategy if it is found to be not maleficent, beneficial to health, and cost-effective, and does not make us lose the notion that child development goes beyond psychomotor or cognitive performance. This article analyzes such constraints from a critical point of view. Copyright © 2013 SEEN. Published by Elsevier Espana. All rights reserved.

  4. Anaphylactoid reactions after iodinated contrast media

    International Nuclear Information System (INIS)

    Strejcek, J.; Sehr, A.


    A survey is presented of data published in the literature on the incidence of undesirable and especially anaphylactoid reactions to intravenously administered iodinated contrast media used in radiodiagnosis, this with regard to age, sex, allergy in the patient's history, previously administered contrast media, possible previous reaction. A detailed description is presented of the assumed mechanisms of these reactions. There does not exist any reliable premedication. It is always indispensable to consider the indications of the examination using iodinated contrast agents and the possibilities of immediate and qualified resuscitation. (author). 2 tabs., 36 refs

  5. Mysterious iodine-overabundance in Antarctic meteorites (United States)

    Dreibus, G.; Waenke, H.; Schultz, L.


    Halogen as well as other trace element concentrations in meteorite finds can be influenced by alteration processes on the Earth's surface. The discovery of Antarctic meteorites offered the opportunity to study meteorites which were kept in one of the most sterile environment of the Earth. Halogen determination in Antartic meteorites was compared with non-Antarctic meteorites. No correlation was found between iodine concentration and the weathering index, or terrestrial age. The halogen measurements indicate a contaminating phase rich in iodine and also containing chlorine. Possible sources for this contamination are discussed.

  6. Mysterious iodine-overabundance in Antarctic meteorites

    International Nuclear Information System (INIS)

    Dreibus, G.; Waenke, H.; Schultz, L.


    Halogen as well as other trace element concentrations in meteorite finds can be influenced by alteration processes on the Earth's surface. The discovery of Antarctic meteorites offered the opportunity to study meteorites which were kept in one of the most sterile environment of the Earth. Halogen determination in Antartic meteorites was compared with non-Antarctic meteorites. No correlation was found between iodine concentration and the weathering index, or terrestrial age. The halogen measurements indicate a contaminating phase rich in iodine and also containing chlorine. Possible sources for this contamination are discussed

  7. Iodine-129 in the environment

    International Nuclear Information System (INIS)

    Tikhomirov, F.A.; Moiseev, I.T.


    The quantitative ratio of aerial and soil entries of 129 I into plants, parameters of its migration in the system of atmosphere-soil-plants-river water, dynamics of transformation and biological availability of 129 I in soil for plants were studied on the basis of field observations and experiments using the radioactive tracers. The doses of human thyroid gland irradiation by 129 I under atmospheric and soil pathways of its transport into diet are estimated. 129 I content in soil due to its systematic, for 50 years, releases into atmosphere is shown to be negligible, agricultural production contamination by 129 I resulting mainly from its fallout onto overground phytomass. The period, needed to achieve 129 I concentration equilibrium in the atmosphere-soil system under constant average 129 I content in the air, varies depending on the soil type from several hundred years (for podzolic soils) up to several thousand years (for chernozem). The 129 I half-accumulation period is equal to 150 years for soddy-podzolic soil and to 700 years for chernozem. In case of 129 I fallout lasting for 100 years the annual increase of its content in overground phytomass due to the transport from soil will account for 0,3% of its atmospheric entry way for soddy-podzolic soil and for 0,1% for chernozem, respectively. For a number of sierozem, yellow soil and calcareous chernozem types this addition is higher (up to 1%). Under constant iodine-129 concentration in air (1 Bq/m3) the absorbed dose for one-year child's thyroid gland in continental area is approximately equal to 2 (Gy/y)/(Bq/m3). The absorbed dose from globally dissipated 129 I under 99% efficiency of gas purification will not exceed 2·10 -7 Gy/y. The input of globally dissipated 129 I, originating from deep underground disposal of nuclear wastes can account for not more than 10 -9 Gy/y. In total, 129 I releases for the coming century is not going to produce limitations for nuclear energetics development. (author)

  8. Low iodine content in the diets of hospitalized preterm infants. (United States)

    Belfort, Mandy B; Pearce, Elizabeth N; Braverman, Lewis E; He, Xuemei; Brown, Rosalind S


    Iodine is critical for normal thyroid hormone synthesis and brain development during infancy, and preterm infants are particularly vulnerable to the effects of both iodine deficiency and excess. Use of iodine-containing skin antiseptics in intensive care nurseries has declined substantially in recent years, but whether the current dietary iodine intake meets the requirement for hospitalized preterm infants is unknown. The aim of the study was to measure the iodine content of enteral and parenteral nutrition products commonly used for hospitalized preterm infants and estimate the daily iodine intake for a hypothetical 1-kg infant. We used mass spectrometry to measure the iodine concentration of seven preterm infant formulas, 10 samples of pooled donor human milk, two human milk fortifiers (HMF) and other enteral supplements, and a parenteral amino acid solution and soy-based lipid emulsion. We calculated the iodine provided by typical diets based on 150 ml/kg · d of formula, donor human milk with or without HMF, and parenteral nutrition. Preterm formula provided 16.4-28.5 μg/d of iodine, whereas unfortified donor human milk provided only 5.0-17.6 μg/d. Adding two servings (six packets) of Similac HMF to human milk increased iodine intake by 11.7 μg/d, whereas adding two servings of Enfamil HMF increased iodine intake by only 0.9 μg/d. The other enteral supplements contained almost no iodine, nor did a parenteral nutrition-based diet. Typical enteral diets for hospitalized preterm infants, particularly those based on donor human milk, provide less than the recommended 30 μg/d of iodine, and parenteral nutrition provides almost no iodine. Additional iodine fortification should be considered.

  9. Simulation of ISTP-EPICUR Iodine Chemistry Tests with RAIM

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Han-Chul; Cho, Yeong-Hun; Jang, Dong-Ju; Ryu, Myung-Hyun [Nuclear Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)


    The amount of iodine release largely depends on its volatility in the containment. Iodine has several chemical forms including aerosols, vapor, and gas. Among them gaseous iodine such as I{sub 2} and organic iodide are dominating due to their high volatility. Therefore, such iodine behavior has been extensively examined. Korea Institute of Nuclear Safety (KINS) has been joining the relevant international programs such as ISTP-EPICUR, OECD-BIP and OECD-STEM. In the course of this study, a simple iodine model, RAIM (Radio-Active Iodine chemistry Model) has been developed, based on the IMOD methodology and other previous studies. This model deals with chemical reactions associated with formation and destruction of iodine species in the containment atmosphere and the sump in a simple manner, as shown in Fig. 1. It also treats adsorption and desorption of volatile iodine on the paint surface. The iodine species modeled are inorganic volatile iodine, organic iodides of high volatility (HVRI) and low volatility (LVRI), non-volatiles, non-aqueous iodine, and iodine oxide aerosols (IO{sub x}). Many other material participating in the iodine reactions, e.g., air radiolysis products (ARP) such as ozone, are also modeled. This paper especially shows the analysis results after addition of gaseous reaction model to RAIM, which was further accompanied by adjustments of the existing reaction rate constants even for the aqueous reactions. After integration of iodine reaction models for gas and aqueous phase, RAIM was applied the S1-9 and S1-11 tests which were carried out in aqueous phase. In addition, re-analysis of the S2-6-5-2 test, for which iodine-loaded coupons were tested in gas phase, was also performed.

  10. Weight, iodine content and iodine uptake of the thyroid gland of normal Japanese

    International Nuclear Information System (INIS)

    Yoshizawa, Yasuo; Kusama, Tomoko


    Various questions arise in the application of ICRP ''Standard Man'' values to Japanese. One of the questions is that ''Standard Man'' values of the thyroid are different from normal Japanese values. A systematic survey of past reports was carried out with a view to search for normal Japanese values of the thyroid. The subjects of search were weight, iodine content and iodine uptake rate (f sub(w)) of the thyroid. These are important factors in the estimation of the radiation dose of the thyroid caused by internal contamination of radioiodine, and are foreseen to have the difference between Japanese and ''Standard Man''. The result of study suggested that the weight of the thyroid of normal Japanese is about 19 g for adult male and about 17 g for adult female, and that the iodine content is 12-22 mg and iodine uptake rate (f sub(w)) is about 0.2. (auth.)

  11. Status of urinary iodine and I-131 uptake after universal iodination of common salt

    International Nuclear Information System (INIS)

    Alam, F.; Begum, F.; Haque, M.; Karim, M.A.; Faruque, O.; Ali, L.; Khan, A.K.A.


    This work was carried out in the Institute of Institute of Nuclear Medicine (INM), Bangabandhu Sheikh Mujib Medical University and Bangladesh Institute of Research and Rehabilitation in Diabetes, Endocrine and Metabolic Disorders, Dhaka. Here we have tried to explore present status of urinary iodine and uptake status in Bangabandhu. Period study was from 1998 to 2000. Total study population was 300, of them 84 was male and 216 was female. Populations of all social and economic strata have been studied, starting from bottoms to top-level income groups as well as urban, rural and suburban populations are included randomly. We studied I-131 uptake and urinary iodine. I-131 given orally in liquid form and the quantity accumulated by the thyroid gland at 24 hours intervals of time is measured using a gamma scintillation counter. Gamma-ray emission of 364 keV energy by I-131 is detected gamma scintillation counter. Urinary iodine is estimated by CIS-BIO kit. Urine is digested with chloric acid under mild conditions and determined manually by its catalytic role in the reduction of ceric ammonium sulfate in the presence of arsenious acid. The uptake was grouped into four categories according to their uptake percentage. Group-A; (lowest uptake group) 99 subject, have uptake between 0 to 4.9%, Group-B; 100 subjects, (relatively low uptake) who have uptake between 4.91-9.9%, group-C; 73 subjects, who have uptake between 10-30% and in-group D, there was 28 subjects their uptake was above 30%. We have also found in group-A median uptake is 3.0% and urinary iodine level is 43.31 μg/dl, in group-B median uptake is 7.0% and urinary iodine level is 33.95 μg/dl, in group-C median uptake is 23.0% and urinary iodine level is 12.97 μg/dl, in group-D median uptake is 34.0% and urinary iodine level is 9.35 μg/dl. We have found 1.04% have severe type low urinary iodine, 3.48% moderate type of low urinary iodine, 3.48%, 16.72% mild type of low urinary iodine and 78.74% have normal

  12. Retrospective reconstruction of Iodine-131 distribution through the analysis of Iodine-129 (United States)

    Matsuzaki, Hiroyuki; Muramatsu, Yasuyuki; Ohno, Takeshi; Mao, Wei


    Iodine-131 distribution released from the Fukushima Dai-ichi Nuclear Power Plant accident was reconstructed through the iodine-129 measurements. From nearly 1,000 surface soil samples iodine was extracted by the pyro hydrolysis method. Extracted iodine was then mixed with carrier, purified and finally collected as silver iodide. Silver iodide sample was pressed into the cathode holder and set at the ion source of the MALT facility, The University of Tokyo. The isotopic ratio 129I/127I was measured by means of Accelerator Mass Spectrometry. From 129I data obtained, 131I deposition map was constructed. There observed various fine structures in the map which could not estimated neither by the simulation nor 137Cs distribution.

  13. Dry method for recycling iodine-loaded silver zeolite

    International Nuclear Information System (INIS)

    Thomas, T.R.; Staples, B.A.; Murphy, L.P.


    Fission product iodine is removed from a waste gas stream and stored by passing the gas stream through a bed of silver-exchanged zeolite until the zeolite is loaded with iodine, passing dry hydrogen gas through the bed to remove the iodine and regenerate the bed, and passing the hydrogen stream containing the hydrogen iodide thus formed through a lead-exchanged zeolite which absorbs the radioactive iodine from the gas stream and permanently storing the lead-exchanged zeolite loaded with radioactive iodine

  14. Iodine and microbial interactions in an organic soil

    International Nuclear Information System (INIS)

    Sheppard, M.I.; Hawkins, J.L.


    Iodine-129 in groundwater discharging from a geological disposal vault could accumulate in wetlands by chemical sorption onto low pH, highly organic solid surfaces or by direct or indirect microbial processes. Previous work indicated that saturation of anion sorption sites, microbial toxicity, or swamping of the I reduction/oxidation reaction decreased the retention of a wetland sphagnum for iodine with increased iodine porewater concentrations. Bog water and peat of an iodine-rich bog were studied to elucidate the role of micro-organisms in the retention and accumulation of iodine in a temperate wetland. (author)

  15. Severe Hypothyroidism From Iodine Deficiency Associated With Parenteral Nutrition. (United States)

    Golekoh, Marjorie C; Cole, Conrad R; Jones, Nana-Hawa Yayah


    Parenteral nutrition is crucial for supply of nutrients in children who cannot tolerate a full enteral diet. In the United States, it is not standard of care to give iodine to children dependent on parenteral nutrition, hence iodine is not routinely included in the micronutrient package. Herein, we present a case of a boy with hypothyroidism secondary to iodine deficiency after prolonged exclusive use of parenteral nutrition. Our case highlights the importance of screening for iodine deficiency and administering timely iodine supplementation in these at-risk children to prevent iatrogenic hypothyroidism. © 2015 American Society for Parenteral and Enteral Nutrition.

  16. Chemical oxygen-iodine laser with atomic iodine generated via fluorine atoms

    Czech Academy of Sciences Publication Activity Database

    Jirásek, Vít; Čenský, Miroslav; Špalek, Otomar; Kodymová, Jarmila; Picková, Irena; Jakubec, Ivo


    Roč. 345, č. 1 (2008), 14-22 ISSN 0301-0104 R&D Projects: GA ČR GA202/05/0359 Institutional research plan: CEZ:AV0Z10100523; CEZ:AV0Z40320502 Keywords : atomic iodine * atomic fluorine * chemical oxygen–iodine laser * COIL Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.961, year: 2008

  17. Generation of atomic iodine via fluorine for chemical oxygen-iodine laser

    Czech Academy of Sciences Publication Activity Database

    Jirásek, Vít; Špalek, Otomar; Čenský, Miroslav; Picková, Irena; Kodymová, Jarmila; Jakubec, Ivo


    Roč. 334, - (2007), s. 167-174 ISSN 0301-0104 R&D Projects: GA ČR GA202/05/0359 Grant - others:USAF European Office for Research and Development(XE) FA 8655-05-M-4027 Institutional research plan: CEZ:AV0Z10100523; CEZ:AV0Z40320502 Keywords : atomic iodine * atomic fluorine * chemical oxygen-iodine laser Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.805, year: 2007

  18. Dissociation of molecular iodine in RF discharge for oxygen-iodine laser

    Czech Academy of Sciences Publication Activity Database

    Jirásek, Vít; Schmiedberger, Josef; Čenský, Miroslav; Kodymová, Jarmila


    Roč. 66, č. 4 (2012), 1-6 ISSN 1434-6060 R&D Projects: GA ČR GA202/09/0310 Grant - others:European Office for Aerospace R&D(XE) FA8655-09-1-3092 Institutional research plan: CEZ:AV0Z10100523 Keywords : molecular iodine * RF discharge * dissociation * oxygen-iodine laser * COIL Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.513, year: 2012

  19. Current iodine nutrition status and progress toward elimination of iodine deficiency disorders in Jazan, Saudi Arabia

    Directory of Open Access Journals (Sweden)

    Alsanosy Rashad Mohammed


    Full Text Available Abstract Background The term iodine deficiency disorders (IDD refers to all the effects of iodine deficiency on growth and development in human and animal populations that can be prevented by correction of the iodine deficiency. The objective of this paper was to determine the iodine nutrition status among schoolchildren in the Jazan Region of the Kingdom of Saudi Arabia (KSA, by measuring urinary iodine concentrations and by clinical assessments of goiter rate. Methods A school-based cross-sectional survey was conducted in the Jazan region of southwestern KSA from May to November 2010. A total of 311 children, aged 6–13 years, drawn from 12 schools, were selected by a three-stage cluster random sampling method. Data on sociodemographic characteristics were collected using a structured questionnaire. Urine samples were collected and physical examinations were conducted to determine the presence or absence of goiter. Data were analyzed using SPSS version 17.0. Chi square and independent t-tests were used for proportions and mean comparisons between groups. Results Out of 360 selected children, 311 were examined. There were 131 males (42% and 180 females (58%. The median urinary iodine concentration (UIC of the study group was 421 μg/L. The study population proportion with UIC > 300 μg/L was 74% with a higher proportion among males and urban populations. The proportion of children with UIC of 100–300 μg/L was only 21% and was significantly higher among females compared with males (p Conclusions The present study demonstrates a remarkable achievement in Universal Salt Iodization (USI and IDD elimination goals in the Jazan area. However, UIC levels reflect excessive iodine intake and may put the population at risk of adverse health consequences like iodine-induced hyperthyroidism and autoimmune thyroid diseases.

  20. High power atomic iodine photodissociation lasers

    International Nuclear Information System (INIS)

    Palmer, R.E.; Padrick, T.D.; Jones, E.D.


    The atomic iodine photodissociation laser has developed into a system capable of producing nanosecond or shorter pulses of near infrared radiation with energies well in excess of a hundred J. Discussed are the operating characteristics, advantages, and potential problem areas associated with this laser

  1. Direct solar-pumped iodine laser amplifier (United States)

    Han, Kwang S.; Hwang, In Heon


    The optimum conditions of a solar pumped iodine laser are found in this research for the case of a continuous wave operation and a pulsed operation. The optimum product of the pressure(p) inside the laser tube and the tube diameter(d) was pd=40 approx. 50 torr-cm on the contrary to the case of a high intensity flashlamp pumped iodine laser where the optimum value of the product is known to be pd=150 torr-cm. The pressure-diameter product is less than 1/3 of that of the high power iodine laser. During the research period, various laser materials were also studied for solar pumping. Among the laser materials, Nd:YAG is found to have the lowest laser threshold pumping intensity of about 200 solar constant. The Rhodamine 6G was also tested as the solar pumped laser material. The threshold pumping power was measured to be about 20,000 solar constant. The amplification experiment for a continuously pumped iodine laser amplifier was performed using Vortek solar simulator and the amplification factors were measured for single pass amplification and triple pass amplification of the 15 cm long amplifier tube. The amplification of 5 was obtained for the triple pass amplification.

  2. Iodine insufficiency: a global health problem? (United States)

    Swanson, Christine A; Pearce, Elizabeth N


    As a result of collaborative efforts with international organizations and the salt industry, many developing and developed countries practice universal salt iodization (USI) or have mandatory salt fortification programs. As a consequence, the prevalence of iodine deficiency decreased dramatically. The United States and Canada are among the few developed countries that do not practice USI. Such an undertaking would require evidence of deficiency among vulnerable population groups, including pregnant women, newborns, and developing infants. Government agencies in the United States rely heavily on data from NHANES to assess the iodine status of the general population and pregnant women in particular. NHANES data suggest that pregnant women in the United States remain mildly deficient. This is important, because the developing fetus is dependent on maternal iodine intake for normal brain development throughout pregnancy. Professional societies have recommended that pregnant and lactating women, or those considering pregnancy, consume a supplement providing 150 μg iodine daily. The United States and Canada collaborate on the daily recommended intake and are also confronted with the challenge of identifying the studies needed to determine if USI is likely to be beneficial to vulnerable population groups without exposing them to harm.

  3. The behavior of gaseous iodine in sand

    International Nuclear Information System (INIS)

    Takahashi, Kanji


    Radioactive iodine gas was passed through 10 different sands collected at rivers and hills. The relation between the amount of the loaded gas and the amount of adsorbed gas was determined at room temperature, 50 -- 60 0 C, and 90 -- 100 0 C under humidity of 2 sand. This amount was about 1 -- 3 times as much as that of monomolecular membrane adsorption, 0.2 -- 0.3 μg/cm 2 . The decrease of adsorption amount that accompanies the increase of humidity is attributable to the decrease of effective surface area of sand due to the presence of water. The transport of iodine in sand was studied by passing gaseous iodine through a glass tubing packed with sand. The distribution in the flow direction of iodine indicated that the ease of desorption depends upon the situation of adsorption. Easily desorbed case was named Henry type adsorption. Hardly desorbed case was named absorption type. Discussion is made on experimental results. (Fukutomi, T.)

  4. Volatile suppressing method for radioactive iodine

    International Nuclear Information System (INIS)

    Ohara, Atsushi; Haruguchi, Keiko.


    In the present invention, a metal plate is disposed above the pool water surface of a suppression chamber disposed to a reactor container in order to reduce evaporation of radioactive iodine released from a suppression pool. A metal plate is disposed above the pool water surface of the suppression chamber disposed to the reactor container. In addition, a metal plate is disposed around the space connecting a bent tube extending from a dry well to underwater of suppression pool water and a gas bent tube extending from the suppression chamber to an emergency gas processing system. Spray water is supplied for cooling the suppression chamber d as a means for cooling the metal plate. Then, among iodine released to the suppression chamber, elemental iodine liberated from the pool water is deposited on the surface of the metal plate, and the amount of iodine to be flown into and processed by an emergency gas processing system or a filter bent system can be reduced. (T.M.)

  5. Mechanism for iodine cracking of zirconium claddings

    International Nuclear Information System (INIS)

    Novikov, V.V.


    The mechanism of iodine cracking of zirconium cladding is analyzed taking into account the effect of stresses on diffusion. A decisive effect of the stress gradiemt on crack propagation in an agressive medium is shown. The experimental data are compared with the proposed model

  6. Radio-active iodine uptake in vitiligo

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, V.; Shankar, V.; Chaudhary, S.; Bhatia, K.K.; Mehta, L.K.; Arora, D.R. (Medical College and Hospital, Rohtak-124001 (India))


    Vitiligo and thyroid disease are commonly associated disorders. Twenty-two clinically euthyroid vitiligo patients were studied for functional assessment of thyroid by radioactive iodine uptake assay. Half of them showed abnormal uptake values at 24 hours. Of these patients, 90% had lower values indicating a tendency towards developing hypothyroid state. Subclinical thyroid dysfunction in vitiligo appears to be an adaptive change. (author).

  7. Radio-active iodine uptake in vitiligo

    International Nuclear Information System (INIS)

    Kumar, V.; Shankar, V.; Chaudhary, S.; Bhatia, K.K.; Mehta, L.K.; Arora, D.R.


    Vitiligo and thyroid disease are commonly associated disorders. Twenty-two clinically euthyroid vitiligo patients were studied for functional assessment of thyroid by radioactive iodine uptake assay. Half of them showed abnormal uptake values at 24 hours. Of these patients, 90% had lower values indicating a tendency towards developing hypothyroid state. Subclinical thyroid dysfunction in vitiligo appears to be an adaptive change. (author)

  8. Iodine-125 seeds for cancer treatment

    Energy Technology Data Exchange (ETDEWEB)

    Rostelato, Maria E.C.M.; Zeituni, Carlos A.; Feher, Anselmo; Moura, Joao A.; Moura, Eduardo S.; Nagatomi, Helio R.; Manzoli, Jose E.; Souza, Carla D., E-mail: elisaros@ipen.b, E-mail:, E-mail: afeher@ipen.b, E-mail:, E-mail: esmoura@ipen.b, E-mail: hrnagato@ipen.b, E-mail: jemanzoli@ipen.b, E-mail: cdsouza@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Karam, Dib, E-mail: dib.karan@usp.b [Universidade de Sao Paulo (USP), SP (Brazil). Escola de Artes, Ciencias e Humanidades


    In Brazil, cancer has become one of the major public health problems. An estimate by the Health Ministry showed that 466,430 people had the disease in the country in 2008. The prostate cancer is the second largest death cause among men. The National Institute of Cancer estimated the occurrence of 50,000 new cases for 2009. Some of these patients are treated with Brachytherapy, using Iodine-125 seeds. By this technique, small seeds with Iodine-125, a radioactive material, are implanted in the prostate. The advantages of radioactive seed implants are the preservation of healthy tissues and organs near the prostate, besides the low rate of impotence and urinary incontinence. The Energy and Nuclear Research Institute - IPEN, which belongs to the Nuclear Energy National Commission - CNEN, established a program for the development of the technique and production of Iodine-125 seeds in Brazil. The estimate for the 125-Iodine seeds demand is of 8,000 seeds/month and the laboratory to be implanted will need this production capacity. The purpose of this paper is to explain the project status and show some data about the seeds used in the country. The project will be divided in two phases: technological development of a prototype and a laboratory implementation for the seeds production. (author)


    African Journals Online (AJOL)

    Preferred Customer

    Chem. Soc. Ethiop. 2014, 28(2). 306 solvent. After completion of the reaction, the mixture was cooled to room temperature and filtered. The excess of iodine was removed from the filtrate by drop wise addition of sodium bisulfite solution (1 M). The organic layers were separated, dried over magnesium sulfate, filtered, and the ...

  10. Iodine 131 and 133 as Fission Indicators

    Energy Technology Data Exchange (ETDEWEB)

    Broda, E.


    This report was written by E. Broda at the Cavendish Laboratory (Cambridge) in September 1944 and is about the possible use of Iodine 131 and 133 as fission indicators. Additionally, the description of the chemical procedure for I 131 and I 133 and the corresponding results can be found in this report. (nowak)

  11. Speciation of 127I and 129I in atmospheric aerosols at Risø, Denmark: insight into sources of iodine isotopes and their species transformations

    Directory of Open Access Journals (Sweden)

    L. Zhang


    Full Text Available Speciation analysis of iodine in aerosols is a very useful approach for understanding geochemical cycling of iodine in the atmosphere. In this study, overall iodine species, including water-soluble iodine species (iodide, iodate and water-soluble organic iodine, NaOH-soluble iodine, and insoluble iodine have been determined for 129I and 127I in the aerosols collected at Risø, Denmark, during March and May 2011 (shortly after the Fukushima nuclear accident and in December 2014. The measured concentrations of total iodine are in the range of 1.04–2.48 ng m−3 for 127I and (11.3–97.0  ×  105 atoms m−3 for 129I, corresponding to 129I ∕ 127I atomic ratios of (17.8–86.8  ×  10−8. The contribution of Fukushima-derived 129I (peak value of 6.3  ×  104 atoms m−3 is estimated to be negligible (less than 6 % compared to the total 129I concentration in northern Europe. The concentrations and species of 129I and 127I in the aerosols are found to be strongly related to their sources and atmospheric pathways. Aerosols that were transported over the contaminated seas contained higher concentrations of 129I than aerosols transported over the European continent. The high 129I concentrations of the marine aerosols are attributed to secondary emission of marine discharged 129I in the contaminated seawater in the North Sea, North Atlantic Ocean, English Channel, Kattegat, etc., rather than direct gaseous release from the European nuclear reprocessing plants (NRPs. Water-soluble iodine was found to be a minor fraction to the total iodine for both 127I (7.8–13.7 % and 129I (6.5–14.1 % in ocean-derived aerosols, but accounted for 20.2–30.3 % for 127I and 25.6–29.5 % for 129I in land-derived aerosols. Iodide was the predominant form of water-soluble iodine, accounting for more than 97 % of the water-soluble iodine. NaOH-soluble iodine seems to be independent of the sources of aerosols. The significant

  12. Iodine kinetics and effectiveness of stable iodine prophylaxis after intake of radioiodine: a review

    International Nuclear Information System (INIS)

    Geoffroy, B.; Verger, P.; Le Guen, B.


    Ingestion of stable iodine (potassium iodide) offers an efficient protection against the irradiation of the thyroid when an accidental exposure to radioiodine occurs. This prophylaxis aims at obtaining a rapid and maximum thyroid protection without antithyroid effects. This article reviews studies on iodine kinetics in the human and on stable iodine effectiveness to protect the thyroid. In adults with a normal thyroid function, ingestion of 100 mg of iodide just before exposure to radioiodine allows a percentage of thyroid averted dose equal or greater than 95%. If the exposure persists after iodide ingestion (100 mg), the percentage of averted dose may decrease significantly. Repeated ingestion of daily amounts of 15 mg of stable iodine would then allow to maintain a 90% effectiveness. Iodide effectiveness and antithyroid effects also depend on external and individual factors such as iodine amounts in the diet, thyroid function and age. It is recommended to adapt the amount of ingested stable iodine according to age at the time of exposure. (author)

  13. Determination of iodide, iodate and organo-iodine in waters with a new total organic iodine measurement approach. (United States)

    Gong, Tingting; Zhang, Xiangru


    The dissolved iodine species that dominate aquatic systems are iodide, iodate and organo-iodine. These species may undergo transformation to one another and thus affect the formation of iodinated disinfection byproducts during disinfection of drinking waters or wastewater effluents. In this study, a fast, sensitive and accurate method for determining these iodine species in waters was developed by derivatizing iodide and iodate to organic iodine and measuring organic iodine with a total organic iodine (TOI) measurement approach. Within this method, organo-iodine was determined directly by TOI measurement; iodide was oxidized by monochloramine to hypoiodous acid and then hypoiodous acid reacted with phenol to form organic iodine, which was determined by TOI measurement; iodate was reduced by ascorbic acid to iodide and then determined as iodide. The quantitation limit of organo-iodine or sum of organo-iodine and iodide or sum of organo-iodine, iodide and iodate was 5 μg/L as I for a 40 mL water sample (or 2.5 μg/L as I for an 80 mL water sample, or 1.25 μg/L as I for a 160 mL water sample). This method was successfully applied to the determination of iodide, iodate and organo-iodine in a variety of water samples, including tap water, seawater, urine and wastewater. The recoveries of iodide, iodate and organo-iodine were 91-109%, 90-108% and 91-108%, respectively. The concentrations and distributions of iodine species in different water samples were obtained and compared. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. The distribution and transformations of iodine in the environment

    International Nuclear Information System (INIS)

    Whitehead, D.C.


    Iodine in the atmosphere is derived largely from seawater. It is probable that the biological production of methyl iodide is important in this transfer. Subsequent photolytic dissociation and oxidation of the methyl iodide, together with other inputs, with partial sorption of the products by aerosols, results in the atmospheric iodine being distributed between various gaseous and particulate forms. Atmospheric iodine is the major source of the iodine in soils, and the process of enrichment continues throughout soil formation and development until ultimately an equilibrium concentration is attained. The atmosphere is also a direct source of iodine for plants, and in some situations may be more important than the soil. Iodine may be lost from soils by leaching, volatilization, and removal in crops. The amounts of iodine reported in groundwaters, and in rivers and lakes remote from human activity, suggest that some leaching of iodine is widespread. Increased amounts of iodine occur in rivers receiving effluent from sewage works. Milk and milk products are now major dietary sources of iodine because their content is often increased by concentrate feedingstuffs supplemented with iodine and/or by the use in dairies of iodophor detergents and sterilants. (author)

  15. Instrumental determination of iodine in milk by neutron activation analysis

    International Nuclear Information System (INIS)

    Isaac Olive, K.; Chatt, A.


    Iodine is an essential trace element. It is related to thyroid functions and its deficiency or excess can be harmful. Deficiency of iodine leads to brain damage including cretinism, excess of iodine blocks the thyroid gland ultimately producing iodine deficiency as well. World Health Organization has set a daily iodine intake dose of 150 μg d -1 . Currently there are 740 million people in the world at risk of iodine deficiency disorders; therefore the monitoring of iodine intake is necessary. Although the iodized salt policy has been adopted in many countries, milk is also one of the major natural sources of iodine and it is also the principal food in children. Therefore, the determination of iodine in milk is needed. This work deals with the determination of iodine in milk by neutron activation analysis. Different methods of irradiation-counting are compared in terms of sensitivity and detection limits. The quantification of iodine was calculated using also two methods, the classic relative one and the standardization of k 0 parameter. A brief analysis of the uncertainty sources in the analytical method is also discussed.(Full text)

  16. A Review: Radiographic Iodinated Contrast Media-Induced Thyroid Dysfunction (United States)

    Leung, Angela M.; Braverman, Lewis E.; Brent, Gregory A.; Pearce, Elizabeth N.


    Context: Thyroid hormone production is dependent on adequate iodine intake. Excess iodine is generally well-tolerated, but thyroid dysfunction can occur in susceptible individuals after excess iodine exposure. Radiological iodinated contrast media represent an increasingly common source of excess iodine. Objective: This review will discuss the thyroidal response after acute exposure to excess iodine; contrast iodine-induced thyroid dysfunction; risks of iodine-induced thyroid dysfunction in vulnerable populations, such as the fetus, neonate, and patients with impaired renal function; and recommendations for the assessment and treatment of contrast iodine-induced thyroid dysfunction. Methods: Data for this review were identified by searching PubMed, Google Scholar, and references from relevant articles from 1948 to 2014. Conclusions: With the increase in the use of computed tomography scans in the United States, there is increasing risk of contrast-induced thyroid dysfunction. Patients at risk of developing iodine-induced thyroid dysfunction should be closely monitored after receiving iodinated contrast media and should be treated as needed. PMID:25375985

  17. WHO's new recommendations about iodine prophylaxis at nuclear catastrophes

    International Nuclear Information System (INIS)

    Paile, Wendla


    WHO has prepared new advice about using stable iodine as protection against emission of radioactive iodine from nuclear catastrophes. The experiences from Chernobyl show that the risk for thyroid gland cancer after emission of radio-iodine is significant. The risk of serious side effects of stable iodine as single dose is stated to be minimal. Stable iodine is a safe, effective remedy for protecting the thyroid gland against radioactive iodine. It is recommended to adjust different criteria for iodine prophylaxis for new-born, children, young people and adults older than 40 years. For children of the age up to 18 years iodine prophylaxis should be considered at 10 mGy thyroid gland doses, and for young adults at 100 mGy. For adults of 40 years or more the cancer risk of radioactive iodine is very low and iodine prophylaxis is unnecessary provided that the expected does not exceed 5 Gy. The new information about risk and advantage must be considered in planning for distribution and storage of stable iodine. WHO also commends that everybody has the possibility to buy it in a pharmacy. (EHS)

  18. Effects of elevated iodine in milk replacer on calf performance. (United States)

    Jenkins, K J; Hidiroglou, M


    Calves were fed milk replacer containing .57, 10, 50, 100, or 200 ppm iodine (from ethylenediaminedihydroiodide) in DM, from 3 to 38 d of age, to estimate the minimum toxic concentration of iodine. Only the 200 ppm iodine intake reduced weight gains, DM intake, feed efficiency, and DM digestibility. At the 100 and 200 ppm iodine intakes, protein digestibility was reduced, and calves showed typical symptoms of iodine toxicity (nasal discharge, excessive tear and saliva formation, and coughing from tracheal congestion). Thyroid iodine increased with every elevation in iodine intake. Iodine in plasma, bile, and non-thyroid tissues started to increase at the 50 ppm intake and, except for muscle, tended to increase again at the 100 and 200 ppm intakes. Thus, the preruminant calf tolerated up to 50 ppm iodine in milk replacer DM for 5 wk postpartum. However, as iodine concentrations in plasma and nonthyroid tissues started to increase at 50 ppm iodine, an upper limit of 10 ppm would be more preferable.

  19. An assessment of iodine in cheese in Macedonia

    International Nuclear Information System (INIS)

    Bogdanov, Bogdan; Gonev, Mihail; Tadzher, Isak S.


    We assessed some products in Macedonian food containing iodine: milk, bread, eggs, iodized salt. These nutritional items are deficient in iodine compared to western technology of,food preparation. Cheese prepared as white cheese from sheep and cow's milk is a much-used nutritional product. According to the Central Macedonian Statistical Bureau at the. Ministry of Health the laboratory measured iodine dosage in order to have an estimation of what the contribution of cheese is in the daily Macedonian diet. The collection of cheese was independently performed by the food inspectors in all regions of Macedonia. In June 1998 all specimens were in the laboratory. Macedonian white cheese has 57 micro g/dl iodine. In comparison to other nutritional items as milk, eggs and bread with a low contingent of iodine, the Macedonian cheese covers a good part of daily iodine necessity. We present our results with a brief comment on iodine metabolism. (Original)

  20. Evaluation of soil-plant transfer factors of iodine. Estimation of annual ingestion for iodine from the diet

    International Nuclear Information System (INIS)

    Saas, Arsene.


    The author presents the iodine middle contents of the soils and vegetables. A synthesis on the iodine evolution in the soils and vegetables allows to conclude that the vegetable absorption of this isotope is correlated with the isotopiquely exchangeable iodine of the soil. The soil-plant transfer-factors are calculated for the vegetables, cereals, fruits from the stable iodine quantitative analysis. The annual iodine ingestion has been estimated from the dietary of the European Communites areas. This one is a little different of the quantity estimated by CRESTA-LACOURLY-R 2979, yet the contribution by consummation unity is different [fr

  1. Aged anthropogenic iodine in a boreal peat bog

    International Nuclear Information System (INIS)

    Maillant, S.; Sheppard, M.I.; Denys, S.; Leclerc Cessac, E.


    Iodine-129 is a radionuclide of major concern in the international safety assessments for deep geological storage and disposal of nuclear waste because it migrates quickly through the geosphere to the biosphere and then from the soil to humans through the food-chain. However, in organic soils the 129 I may be immobilized over a long time period, and so these soils represent a potential accumulation point in the biosphere. Effects of long residence times of iodine in soils are scarce. The present paper gives some insight on the aging of stable iodine, under natural conditions. Stable iodine was introduced as KI in 1987 at the base of a small natural sphagnum bog to simulate arrival of iodine via a groundwater discharge from the geosphere. Previous data revealed the spread of the iodine outwards spatially from the basal spike and also recorded its rise towards the bog surface. Fifteen years later, the groundwater, the soil and the vegetation have been sampled and analyzed for iodine. The results we will present give insight on the mobility of 'aged' iodine with time, the retention properties of the peat, and provide iodine transfer factors for native boreal plant species. The data show iodine: - continues to slowly spread from the spike after 15 years, - is more strongly retained on the solid phase at the surface than at depth, - the chemical structure of the peat may influence the retention of iodine as shown by NMR analysis, - iodine retention has become greater with time, and - herbaceous species are the greatest accumulators. This study demonstrates bogs present good sinks for iodine and limit the transfer of iodine to some of the 'wildlife' food-chains. (author)

  2. Global iodine nutrition: Where do we stand in 2013? (United States)

    Pearce, Elizabeth N; Andersson, Maria; Zimmermann, Michael B


    Dietary iodine intake is required for the production of thyroid hormone. Consequences of iodine deficiency include goiter, intellectual impairments, growth retardation, neonatal hypothyroidism, and increased pregnancy loss and infant mortality. In 1990, the United Nations World Summit for Children established the goal of eliminating iodine deficiency worldwide. Considerable progress has since been achieved, largely through programs of universal salt iodization. Approximately 70% of all households worldwide currently have access to adequately iodized salt. In 2013, as defined by a national or subnational median urinary iodine concentration of 100-299 μg/L in school-aged children, 111 countries have sufficient iodine intake. Thirty countries remain iodine-deficient; 9 are moderately deficient, 21 are mildly deficient, and none are currently considered severely iodine-deficient. Ten countries have excessive iodine intake. In North America, both the United States and Canada are generally iodine-sufficient, although recent data suggest pregnant U.S. women are mildly iodine-deficient. Emerging issues include discrepancies between urinary iodine status in pregnant women compared to school-aged children in some populations, the problem of re-emerging iodine deficiency in parts of the developed world, the importance of food industry use of iodized salt, regions of iodine excess, and the potential effects of initiatives to lower population sodium consumption on iodine intake. Although substantial progress has been made over the last several decades, iodine deficiency remains a significant health problem worldwide and affects both industrialized and developing nations. The ongoing monitoring of population iodine status remains crucially important, and particular attention may need to be paid to monitoring the status of vulnerable populations, such as pregnant women and infants. There is also need for ongoing monitoring of iodized salt and other dietary iodine sources in

  3. Iodine uptake and distribution in horticultural and fruit tree species

    Directory of Open Access Journals (Sweden)

    Alessandra Caffagni


    Full Text Available Iodine is an essential microelement for humans and iodine deficiency disorder (IDD is one of the most widespread nutrient-deficiency diseases in the world. Iodine biofortification of plants provides an attractive opportunity to increase iodine intake in humans and to prevent and control IDD. This study was conducted to investigate the iodine uptake and accumulation in edible portion of two fruit trees: plum and nectarine, and two horticultural crops: tomato and potato. Two type of iodine treatments (soil and foliar spray application, and, for fresh market tomato, two production systems (open field and greenhouse hydroponic culture were tested. The distribution of iodine in potato stem and leaves, and in plum tree fruits, leaves, and branches was investigated. Iodine content of potato tubers after postharvest storage and processing (cooking, and iodine content of nectarine fruits after postharvest storage and processing (peeling were also determined. Differences in iodine accumulation were observed among the four crops, between applications, and between production systems. In open field, the maximum iodine content ranged from 9.5 and 14.3 μg 100 g−1 for plum and nectarine fruit, to 89.4 and 144.0 μg 100 g−1 for potato tuber and tomato fruit, respectively. These results showed that nectarine and plum tree accumulated significantly lower amounts of iodine in their edible tissues, in comparison with potato and tomato. The experiments also indicated hydroponic culture as the most efficient system for iodine uptake in tomato, since its fresh fruits accumulated up to 2423 μg 100 g−1 of iodine. Iodine was stored mainly in the leaves, in all species investigated. Only a small portion of iodine was moved to plum tree branches and fruits, and to potato stems and tubers. No differences in iodine content after fruit peeling was observed. A significant increase in iodine content of potato was observed after baking, whereas a significant decrease was

  4. Assessing iodine intake, iodine status, and the effects of maternal iodine supplementation: introduction to articles arising from 3 workshops held by the NIH Office of Dietary Supplements12 (United States)

    Ershow, Abby G; Coates, Paul M; Swanson, Christine A


    The NIH Office of Dietary Supplements (ODS) convened 3 workshops on iodine nutrition in 2014, each held in Rockville, Maryland. These workshops were part of the ongoing ODS Iodine Initiative, begun in 2011 in response to concerns that US pregnant women may be at risk of iodine deficiency and that a high fraction of prenatal dietary supplements do not contain the recommended amounts of iodine. The primary purpose of the workshops was to consider the data and resources necessary to evaluate the clinical and public health benefits and risks of maternal iodine supplementation in the United States. The first workshop focused on the assessment of iodine intake, the second focused on the assessment of iodine status, and the third focused on the design and interpretation of clinical trials of maternal iodine supplementation. Here we provide the background of the ODS Iodine Initiative, summarize the 3 workshops held in 2014, and introduce the articles that arose from the workshops and are published in this supplement issue. PMID:27534646

  5. Values of iodine metabolism biomarkers in assessing the iodine nutrition status in surgically treated patients with thyroid disease. (United States)

    Han, Jian-hua; Wu, Lian; Yu, Song-lin; Fang, Hui-ling; Kamg, Wei-ming; Cheng, Xin-qi; Lu, Jie; Yu, Jian-chun; Qiu, Ling


    To assess the clinical application value of iodine metabolism biomarkers in assessing iodine nutrition status in surgically treated patients with thyroid disease. Blood,morning urine and 24-hour urine samples were collected in 31 healthy volunteers and in 30 surgically treated patients with thyroid disease before and after surgery. Iodine concentration was analyzed by inductively coupled plasma mass spectrometry. The iodine metabolism biomarkers including serum iodine (SI), morning urine iodine(UI), morning urine iodine/urine creatinine ratio (UI/UCr), 24-hour urine iodine (24 h UI), and 24-hour urine iodine excretion (24 h UIE) were evaluated in these two groups. In addition, the validation coincidence rate of iodine metabolism biomarkers in healthy volunteers to different reference ranges including World Health Organization, Mayo Clinic, and Quest Diagnostics were calculated. The UI/UCr ratio of pre-operative thyroid disease patients was significantly lower than that of healthy volunteers (P0.05) between these two groups. The SI, UI ,and 24 h UI in postoperative thyroid disease patients were significantly higher than those of the pre-operative patients (all Piodine metabolism biomarkers. The UI/UCr ratio may be used for iodine nutrition evaluation in surgically treated patients with thyroid disease.

  6. Direct evidence for coastal iodine particles from Laminaria macroalgae – linkage to emissions of molecular iodine

    Directory of Open Access Journals (Sweden)

    G. McFiggans


    Full Text Available Renewal of ultrafine aerosols in the marine boundary layer may lead to repopulation of the marine distribution and ultimately determine the concentration of cloud condensation nuclei (CCN. Thus the formation of nanometre-scale particles can lead to enhanced scattering of incoming radiation and a net cooling of the atmosphere. The recent demonstration of the chamber formation of new particles from the photolytic production of condensable iodine-containing compounds from diiodomethane (CH2I2, (O'Dowd et al., 2002; Kolb, 2002; Jimenez et al., 2003a; Burkholder and Ravishankara, 2003, provides an additional mechanism to the gas-to-particle conversion of sulphuric acid formed in the photo-oxidation of dimethylsulphide for marine aerosol repopulation. CH2I2 is emitted from seaweeds (Carpenter et al., 1999, 2000 and has been suggested as an initiator of particle formation. We demonstrate here for the first time that ultrafine iodine-containing particles are produced by intertidal macroalgae exposed to ambient levels of ozone. The particle composition is very similar both to those formed in the chamber photo-oxidation of diiodomethane and in the oxidation of molecular iodine by ozone. The particles formed in all three systems are similarly aspherical. When small, those formed in the molecular iodine system swell only moderately when exposed to increased humidity environments, and swell progressively less with increasing size; this behaviour occurs whether they are formed in dry or humid environments, in contrast to those in the CH2I2 system. Direct coastal boundary layer observations of molecular iodine, ultrafine particle production and iodocarbons are reported. Using a newly measured molecular iodine photolysis rate, it is shown that, if atomic iodine is involved in the observed particle bursts, it is of the order of at least 1000 times more likely to result from molecular iodine photolysis than diiodomethane photolysis. A hypothesis for molecular

  7. 40 CFR 80.141 - Interim detergent gasoline program. (United States)


    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Interim detergent gasoline program. 80... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Detergent Gasoline § 80.141 Interim detergent gasoline... apply to: (i) All gasoline sold or transferred to a party who sells or transfers gasoline to the...

  8. 40 CFR 141.75 - Reporting and recordkeeping requirements. (United States)


    ... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.75... reporting requirements, as appropriate, until filtration is in place. A public water system that uses a ground water source under the direct influence of surface water and does not provide filtration treatment...

  9. 40 CFR 141.174 - Filtration sampling requirements. (United States)


    ... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and Disinfection... water system subject to the requirements of this subpart that provides conventional filtration treatment... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Filtration sampling requirements. 141...

  10. 40 CFR 141.175 - Reporting and recordkeeping requirements. (United States)


    ...) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Enhanced Filtration and... representative samples of filtered water in a system using conventional filtration treatment or direct filtration... addition to the reporting and recordkeeping requirements in § 141.75, a public water system subject to the...

  11. 40 CFR 141.71 - Criteria for avoiding filtration. (United States)


    ... PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Filtration and Disinfection § 141.71 Criteria for avoiding filtration. A public water system that uses a surface water source must meet all of...)(C)(iii), that filtration is required. A public water system that uses a ground water source under...

  12. 14 CFR 141.55 - Training course: Contents. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Training course: Contents. 141.55 Section... Training course: Contents. (a) Each training course for which approval is requested must meet the minimum... trained in the room at one time; (2) A description of each type of audiovisual aid, projector, tape...

  13. 14 CFR 141.25 - Business office and operations base. (United States)


    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Business office and operations base. 141.25... operations base. (a) Each holder of a pilot school or a provisional pilot school certificate must maintain a... or the operations base, each certificate holder must notify the FAA Flight Standards District Office...

  14. 40 CFR 141.22 - Turbidity sampling and analytical requirements. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Turbidity sampling and analytical... § 141.22 Turbidity sampling and analytical requirements. The requirements in this section apply to... the water distribution system at least once per day, for the purposes of making turbidity measurements...

  15. 40 CFR 141.701 - Source water monitoring. (United States)


    ... (a)(4) of this section based on the E. coli level that applies to the nearest surface water body. If no surface water body is nearby, the system must comply based on the requirements that apply to... Monitoring Requirements § 141.701 Source water monitoring. (a) Initial round of source water monitoring...

  16. 27 CFR 70.141 - Lien for taxes. (United States)


    ... intangible, belonging to such person. The lien attaches to all property and rights to property belonging to such person at any time during the period of the lien, including any property or rights to property... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Lien for taxes. 70.141...

  17. 9 CFR 319.141 - Fresh pork sausage. (United States)



  18. 26 CFR 1.141-5 - Private loan financing test. (United States)


    ... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Private loan financing test. 1.141-5 Section 1... loan financing test. (a) In general. Bonds of an issue are private activity bonds if more than the... determining whether the private loan financing test is met. In determining whether the proceeds of an issue...

  19. 27 CFR 25.141 - Barrels and kegs. (United States)


    ... OF THE TREASURY LIQUORS BEER Marks, Brands, and Labels § 25.141 Barrels and kegs. (a) General... shown on the bung or on the tap cover, or on a label securely affixed to each barrel or keg, the place... production: (i) May be shown as the only location on the bung, or on the tap cover, or on a separate label...

  20. 25 CFR 141.23 - Posted statement of ownership. (United States)


    ... legible to customers stating the form of the business entity, the names and addresses of all other... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.23 Posted statement of...

  1. 25 CFR 141.17 - Health and sanitation requirements. (United States)


    ... handling any food sold by a reservation business. (d) Any person whom the Service Unit Director of the... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.17 Health and sanitation...

  2. 7 CFR 1703.141 - Approved purposes for loans. (United States)


    ..., DEPARTMENT OF AGRICULTURE RURAL DEVELOPMENT Distance Learning and Telemedicine Loan Program § 1703.141... the project, including vehicles utilizing distance learning and telemedicine technology to deliver...) Providing links between teachers and students or medical professionals who are located at the same facility...

  3. 40 CFR 141.802 - Coliform sampling plan. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Coliform sampling plan. 141.802... sampling plan. (a) Each air carrier under this subpart must develop a coliform sampling plan covering each... required actions, including repeat and follow-up sampling, corrective action, and notification of...

  4. 41 CFR 105-53.141 - Office of Policy Analysis. (United States)


    ... Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 53-STATEMENT OF ORGANIZATION AND FUNCTIONS Central Offices § 105-53.141 Office of Policy Analysis. The Office of Policy Analysis, headed by..., independent, objective information concerning management policies and programs, and technical and analytical...

  5. Ugilec 141, PCB's en dioxinen in paling uit de Roer

    NARCIS (Netherlands)

    Wammes JIJ; Linders SHMA; Liem AKD; Velde EG van der; LOC


    Questions about the health risk of consumption of eel from the river Rur for anglers, were the reason for an investigation into the occurrence of PCBs, dioxins and Ugilec 141 in this eel. Methods developed at the Laboratory of Organic-analytical Chemistry have been used for the analysis of Ugilec

  6. 19 CFR 141.18 - Entry by nonresident corporation. (United States)


    ... 19 Customs Duties 2 2010-04-01 2010-04-01 false Entry by nonresident corporation. 141.18 Section....18 Entry by nonresident corporation. A nonresident corporation (i.e., one which is not incorporated... entry is located who is authorized to accept service of process against that corporation or, in the case...

  7. 41 CFR 105-71.141 - Financial reporting. (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Financial reporting. 105... GOVERNMENTS 71.14-Post-Award Requirements/Reports, Records, Retention, and Enforcement § 105-71.141 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this section, grantees will...

  8. 27 CFR 24.141 - Bonded wine warehouse. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Bonded wine warehouse. 24..., DEPARTMENT OF THE TREASURY LIQUORS WINE Establishment and Operations Permanent Discontinuance of Operations § 24.141 Bonded wine warehouse. Where all operations at a bonded wine warehouse are to be permanently...

  9. Long-term migration of iodine in sedimentary rocks based on iodine speciation and 129I/127I ratio (United States)

    Togo, Y.; Takahashi, Y.; Amano, Y.; Matsuzaki, H.; Suzuki, Y.; Muramatsu, Y.; Iwatsuki, T.


    [Introduction] 129I is one of the available indexes of long-term migration of groundwater solutes, because of its long half-life (15.7 million years) and low sorption characteristics. The Horonobe underground research center (Japan Atomic Energy Agency), at which are conducted research and development of fundamental techniques on geological disposal of high-level radioactive waste, is an appropriate site for natural analogue studies, because iodine concentration in groundwater is high in this area. To predict iodine behavior in natural systems, speciation of iodine is essential because of different mobility among each species. In this study, we determined iodine speciation and129I/127I isotope ratios of rock and groundwater samples to investigate long term migration of iodine. [Methods] All rock and groundwater samples were collected at Horonobe underground research center. The region is underlain mainly by Neogene to Quaternary marine sedimentary rocks, the Wakkanai Formation (Wk Fm, siliceous mudstones), and the overlying Koetoi Formation (Kt Fm, diatomaceous mudstones). Iodine species in rock samples were determined by iodine K-edge X-ray absorption near edge structure (SPring-8 BL01B1). Thin sections of rock samples were prepared, and iodine mapping were obtained by micro-XRF analysis (SPring-8 BL37XU). Iodine species (IO3-, I-, and organic I) in groundwater were separately detected by high performance liquid chromatography connected to ICP-MS. The 129I/127I ratios in groundwater and rock samples were measured by accelerator mass spectrometry (MALT, Univ. of Tokyo). Iodine in rock samples were separated by pyrohydrolysis and water extraction. [Results and discussion] Concentration of iodine in groundwater varied widely and was much higher than that of seawater showing a high correlation with that of chlorine (R2 = 0.90). Species of iodine in groundwater was mainly I-. Iodine in rock samples decreased near the boundary between Wk and Kt Fms. Iodine K-edge XANES

  10. Iodine excretion has decreased in Denmark between 2004 and 2010 - the importance of iodine content in milk

    DEFF Research Database (Denmark)

    Rasmussen, Lone Banke; Carlé, Allan; Jørgensen, Torben


    Fortification with the essential trace element iodine is widespread worldwide. In the present study, results on iodine excretion and intake of iodine-rich foods from a cross-sectional study carried out in 2004-5, 4 to 5 years after the implementation of mandatory iodine fortification, were compared...... with data in a study carried out in 2008-10. The 2008-10 study was a follow-up of a cross-sectional study carried out before iodine fortification was implemented. Participants in the cross-sectional studies were randomly selected. Both studies were carried out in the cities of Aalborg and Copenhagen...... in Denmark. The median urinary iodine concentration decreased in women from 97 μg/l (n 2862) to 78 μg/l (n 2041) (Piodine excretion. The prevalence of users of iodine containing dietary...

  11. Leak test method and test device for iodine filter

    International Nuclear Information System (INIS)

    Fukasawa, Tetsuo; Funabashi, Kiyomi; Miura, Noboru; Miura, Eiichi.


    An air introduction device which can change a humidity is disposed upstream of an iodine filter to be tested, and a humidity measuring device is disposed downstream of the iodine filter respectively. At first, dried air reduced with humidity is flown from the air introduction device to the iodine filter, to remove moisture content from an iodine adsorber in the iodine filter. Next, air at an increased humidity is supplied to the iodine filter. The difference between the time starting the supply of the highly humid air and the time detecting the high humidity at the humidity measuring device is measured. When the time difference is smaller than the time difference measured previously in a normal iodine filter, it shows the presence of leak in the iodine filter to be tested. With such procedures, leakage in the iodine filter which removes radioactive iodine from off-gases discharged from the radioactive material handling facilities can be detected easily by using water (steams), namely, a naturally present material. (I.N.)

  12. Stabilisation of microalgae: Iodine mobilisation under aerobic and anaerobic conditions. (United States)

    Han, Wei; Clarke, William; Pratt, Steven


    Mobilisation of iodine during microalgae stabilisation was investigated, with the view of assessing the potential of stabilised microalgae as an iodine-rich fertiliser. An iodine-rich waste microalgae (0.35 ± 0.05 mg I g(-1) VS(added)) was stabilised under aerobic and anaerobic conditions. Iodine mobilisation was linearly correlated with carbon emission, indicating iodine was in the form of organoiodine. Comparison between iodine and nitrogen mobilisation relative to carbon emission indicated that these elements were, at least in part, housed separately within the cells. After stabilisation, there were 0.22 ± 0.05 and 0.19 ± 0.01 mg g(-1) VS(added) iodine remaining in the solid in the aerobic and anaerobic processed material respectively, meaning 38 ± 5.0% (aerobic) and 50 ± 8.6% (anaerobic) of the iodine were mobilised, and consequently lost from the material. The iodine content of the stabilised material is comparable to the iodine content of some seaweed fertilisers, and potentially satisfies an efficient I-fertilisation dose. Copyright © 2015 Elsevier Ltd. All rights reserved.

  13. The kinetic study of oxidation of iodine by hydrogen peroxide

    Energy Technology Data Exchange (ETDEWEB)

    Cantrel, L [Institut de Protection et de Surete Nucleaire, IPNS, CEN Cadarache, Saint Paul lez Durance (France); Chopin, J [Laboratoire d` Electrochimie Inorganique, ENSSPICAM, Marseille (France)


    Iodine chemistry is one of the most important subjects of research in the field of reactor safety because this element can form volatile species which represent a biological hazard for environment. As the iodine and the peroxide are both present in the sump of the containment in the event of a severe accident on a light water nuclear reactor, it can be important to improve the knowledge on the reaction of oxidation of iodine by hydrogen peroxide. The kinetics of iodine by hydrogen peroxide has been studied in acid solution using two different analytical methods. The first is a UV/Vis spectrophotometer which records the transmitted intensity at 460 nm as a function of time to follow the decrease of iodine concentration, the second is an amperometric method which permits to record the increase of iodine+1 with time thanks to the current of reduction of iodine+1 to molecular iodine. The iodine was generated by Dushman reaction and the series of investigations were made at 40{sup o}C in a continuous stirring tank reactor. The influence of the initial concentrations of iodine, iodate, hydrogen peroxide, H{sup +} ions has been determined. The kinetics curves comprise two distinct chemical phases both for molecular iodine and for iodine+1. The relative importance of the two processes is connected to the initial concentrations of [I{sub 2}], [IO{sub 3}{sup -}], [H{sub 2}O{sub 2}] and [H{sup +}]. A rate law has been determined for the two steps for molecular iodine. (author) figs., tabs., 22 refs.

  14. Iodine status in the Nordic countries – past and present

    Directory of Open Access Journals (Sweden)

    Helena Filipsson Nyström


    Full Text Available Background: Adequate iodine nutrition is dependent on ground water content, seafood, and, as many countries use iodized cow fodder, dairy products. In most countries, salt fortification programs are needed to assure adequate iodine intake. Objectives: The objectives are threefold: 1 to describe the past and present iodine situation in the Nordic countries, 2 to identify important gaps of knowledge, and 3 to highlight differences among the Nordic countries’ iodine biomonitoring and fortification policies. Design: Historical data are compared with the current situation. The Nordic countries’ strategies to achieve recommended intake and urine iodine levels and their respective success rates are evaluated. Results: In the past, the iodine situation ranged from excellent in Iceland to widespread goiter and cretinism in large areas of Sweden. The situation was less severe in Norway and Finland. According to a 1960 World Health Organization (WHO report, there were then no observations of iodine deficiency in Denmark. In Sweden and Finland, the fortification of table salt was introduced 50–75 years ago, and in Norway and Finland, the fortification of cow fodder starting in the 1950s helped improve the population's iodine status due to the high intake of milk. In Denmark, iodine has been added to household salt and salt in bread for the past 15 years. The Nordic countries differ with regard to regulations and degree of governmental involvement. There are indications that pregnant and lactating women, the two most vulnerable groups, are mildly deficient in iodine in several of the Nordic countries. Conclusion: The Nordic countries employ different strategies to attain adequate iodine nutrition. The situation is not optimal and is in need of re-evaluation. Iodine researchers, Nordic national food administrations, and Nordic governmental institutions would benefit from collaboration to attain a broader approach and guarantee good iodine health for all.

  15. Iodine status in the Nordic countries – past and present (United States)

    Nyström, Helena Filipsson; Brantsæter, Anne Lise; Erlund, Iris; Gunnarsdottir, Ingibjörg; Hulthén, Lena; Laurberg, Peter; Mattisson, Irene; Rasmussen, Lone Banke; Virtanen, Suvi; Meltzer, Helle Margrete


    Background Adequate iodine nutrition is dependent on ground water content, seafood, and, as many countries use iodized cow fodder, dairy products. In most countries, salt fortification programs are needed to assure adequate iodine intake. Objectives The objectives are threefold: 1) to describe the past and present iodine situation in the Nordic countries, 2) to identify important gaps of knowledge, and 3) to highlight differences among the Nordic countries’ iodine biomonitoring and fortification policies. Design Historical data are compared with the current situation. The Nordic countries’ strategies to achieve recommended intake and urine iodine levels and their respective success rates are evaluated. Results In the past, the iodine situation ranged from excellent in Iceland to widespread goiter and cretinism in large areas of Sweden. The situation was less severe in Norway and Finland. According to a 1960 World Health Organization (WHO) report, there were then no observations of iodine deficiency in Denmark. In Sweden and Finland, the fortification of table salt was introduced 50–75 years ago, and in Norway and Finland, the fortification of cow fodder starting in the 1950s helped improve the population's iodine status due to the high intake of milk. In Denmark, iodine has been added to household salt and salt in bread for the past 15 years. The Nordic countries differ with regard to regulations and degree of governmental involvement. There are indications that pregnant and lactating women, the two most vulnerable groups, are mildly deficient in iodine in several of the Nordic countries. Conclusion The Nordic countries employ different strategies to attain adequate iodine nutrition. The situation is not optimal and is in need of re-evaluation. Iodine researchers, Nordic national food administrations, and Nordic governmental institutions would benefit from collaboration to attain a broader approach and guarantee good iodine health for all. PMID:27283870

  16. Iodine status in the Nordic countries - past and present. (United States)

    Nyström, Helena Filipsson; Brantsæter, Anne Lise; Erlund, Iris; Gunnarsdottir, Ingibjörg; Hulthén, Lena; Laurberg, Peter; Mattisson, Irene; Rasmussen, Lone Banke; Virtanen, Suvi; Meltzer, Helle Margrete


    Adequate iodine nutrition is dependent on ground water content, seafood, and, as many countries use iodized cow fodder, dairy products. In most countries, salt fortification programs are needed to assure adequate iodine intake. The objectives are threefold: 1) to describe the past and present iodine situation in the Nordic countries, 2) to identify important gaps of knowledge, and 3) to highlight differences among the Nordic countries' iodine biomonitoring and fortification policies. Historical data are compared with the current situation. The Nordic countries' strategies to achieve recommended intake and urine iodine levels and their respective success rates are evaluated. In the past, the iodine situation ranged from excellent in Iceland to widespread goiter and cretinism in large areas of Sweden. The situation was less severe in Norway and Finland. According to a 1960 World Health Organization (WHO) report, there were then no observations of iodine deficiency in Denmark. In Sweden and Finland, the fortification of table salt was introduced 50-75 years ago, and in Norway and Finland, the fortification of cow fodder starting in the 1950s helped improve the population's iodine status due to the high intake of milk. In Denmark, iodine has been added to household salt and salt in bread for the past 15 years. The Nordic countries differ with regard to regulations and degree of governmental involvement. There are indications that pregnant and lactating women, the two most vulnerable groups, are mildly deficient in iodine in several of the Nordic countries. The Nordic countries employ different strategies to attain adequate iodine nutrition. The situation is not optimal and is in need of re-evaluation. Iodine researchers, Nordic national food administrations, and Nordic governmental institutions would benefit from collaboration to attain a broader approach and guarantee good iodine health for all.


    Willard, Devina L; Young, Lorraine S; He, Xuemei; Braverman, Lewis E; Pearce, Elizabeth N


    Iodine is essential for thyroid hormone synthesis, and iodine deficiency may result in thyroid disorders including goiter and hypothyroidism. Patients on long-term enteral nutrition (EN) or parenteral nutrition (PN) may be at risk for micronutrient deficiencies. The recommended daily allowance for iodine intake is 150 μg for nonpregnant adults. However, there is no current consensus among scientific societies regarding the quantity of iodine to be added in adult EN and PN formulations. The objective of this study was to determine the iodine content of U.S. adult enteral and parenteral nutrition solutions. This study also aimed to determine whether adult patients in the United States who are receiving long-term artificial nutrition may be at risk for iodine deficiency. Ten enteral nutrition solutions and 4 parenteral nutrition solutions were evaluated. The iodine contents of these solutions were measured spectrophotometrically and compared to the labeled contents. Measured and labeled EN iodine contents were similar (range 131-176 μg/L and 106-160 μg/L, respectively). In contrast, PN formulas were found to contain small, unlabeled amounts of iodine, averaging 27 μg/L. Typical fluid requirements are 30 to 40 mL/kg/day for adults receiving either total EN (TEN) or total PN (TPN). Adults on long-term TEN likely consume enough servings to meet their daily iodine requirements. However, patients on long-term TPN would require on average 5.6 L PN/day to meet the recommended daily allowance of iodine. This volume of PN is far in excess of typical consumption. Thus, U.S. patients requiring long-term TPN may be at risk for iodine deficiency. EN = enteral nutrition; PN = parenteral nutrition; TEN = total enteral nutrition; TPN = total parenteral nutrition; UIC = urinary iodine concentration.

  18. Activation energies for iodine-exchange systems containing organic iodine compounds

    Energy Technology Data Exchange (ETDEWEB)

    Ikeda, N. (Takyo Univ. of Education (Japan). Faculty of Science) Takahashi, Yasuko


    In studies on the nonequilibrium isotopic exchange method for determining iodine in organic iodine compounds, activation energies have been measured to find systems having appropriate rate of exchange reactions. Activation energies are discussed by considering the effect of the structure of organic iodine compounds, the concentrations of reactants and solvent, etc. In homogeneous systems, activation energy is found to become larger in the order of CH/sub 3/Iiodine ratio between I/sub 2/ and organic iodine is a predominant factor in determining the rate of the exchange reaction.

  19. Generation of atomic iodine via fluorine for chemical oxygen-iodine laser

    International Nuclear Information System (INIS)

    Jirasek, Vit; Spalek, Otomar; Censky, Miroslav; Pickova, Irena; Kodymova, Jarmila; Jakubec, Ivo


    A method of the chemical generation of atomic iodine for a chemical oxygen-iodine laser (COIL) using atomic fluorine as a reaction intermediate was studied experimentally. This method is based on the reaction between F 2 and NO providing F atoms, and the reaction of F with HI resulting in iodine atoms generation. Atomic iodine was produced with efficiency exceeding 40% relative to initial F 2 flow rate. This efficiency was nearly independent on pressure and total gas flow rate. The F atoms were stable in the reactor up to 2 ms. An optimum ratio of the reactants flow rates was F 2 :NO:HI = 1:1:1. A rate constant of the reaction of F 2 with HI was determined. The numerical modelling showed that remaining HI and IF were probably consumed in their mutual reaction. The reaction system was found suitable for employing in a generator of atomic iodine with its subsequent injection into a supersonic nozzle of a COIL

  20. Iodine supply in diet in various european regions and risks of iodine prophylaxis

    International Nuclear Information System (INIS)

    Dumont, J.E.


    The main risk of low level irradiation of the thyroid is the induction of thyroid neoplasia. In the case of nuclear accidents this risk depends on the level of radioiodine uptake and half life in the thyroid, on the size of the gland and on the relative biological efficiency of the emitted radiation especially at low doses. The level of radioiodine uptake is inversely related to stable iodine supply in the diet. In this study it was proposed to: 1. systematically survey iodine supply in the diet, radioiodine uptake and thyroid kinetics in various European regions. Most of these data are readily available. Taken together with presently accepted estimates of relative biological efficiency, the radiation doses at various contamination levels and risks could be computed and tabulated as an easy-to-use basis for decision guidelines. 2. to obtain in vitro from human autopsy material, radioiodine kinetics data in fetal thyroid to complement data in vivo in a model animal close to man (the chimpanzee) at various dietary iodine levels. Urinary iodine excretions vary in Europe from one region to another from 16 to 250 ug/day. The full spectrum from severe iodine deficiency to normal dietary intake exists in Europe. It is therefore quite to be expected that 24h thyroid radioiodine uptakes vary from 19 to 83%. Therefore for a similar radioiodide contamination the thyroid exposure will vary from one region to another by a factor of 4

  1. The Swiss lodized Salt Program Provides Adequate Iodine for School Children and Pregnant Women, but Weaning Infants Not Receiving Iodine-Containing Complementary Foods as well as Their Mothers Are Iodine Deficient

    NARCIS (Netherlands)

    Andersson, M.; Aeberli, I.; Wüst, N.; Piacenza, A.M.; Bucher, T.; Henschen, I.; Haldimann, M.; Zimmermann, M.B.


    Background: If children and pregnant women in the population are iodine sufficient, it is generally assumed infants are also sufficient. But weaning infants may be at risk of iodine deficiency because iodized salt contributes little dietary iodine during this period. To fill this gap, iodine

  2. Neurotoxicity of iodinated radiological contrast media

    International Nuclear Information System (INIS)

    Araujo Pinheiro, R.S. de


    We studied during the last ten years the neurotoxicity of artificial iodinated contrast media, with prospective clinical and experimental protocols. The experimental investigation in animals aimed to understand the relationship between the intracarotid injection, the subarachnoid application and the integrity of the blood-brain barrier function. The electro physiologic disturbances and the morphologic observation of pial circulation support the evidence that iodinated artificial contrast media induces significant alterations in brain metabolism and in the autoregulation of the blood flow of the encephalon. Even if many of such phenomena may not be apparent at the clinical level, we supposed that they are always present and that their clinical exteriorization is prevented by the immediate and effective action of homeostatic mechanisms. (author)

  3. Separation of iodine species by adsorption chromatography

    International Nuclear Information System (INIS)

    Machado, E.C.; Bellido Jr, A.V.


    Based on the different properties of iodide and iodate species in some sorption materials a new chromatographic method was developed to study the speciation of iodine in a mangrove system. Two sorption materials, alumina and silica, were investigated and several distribution coefficients for iodide and iodate were determined at different concentrations of NaOH, NaNO 3 and NaHCO 3 solutions. The best separation results were obtained percolating sea water samples, containing iodide species, through a glass column filled with alumina. The iodine passed through the column after washing the column with 0.1M sodium nitrate solution, and the iodate was eluted with a 0.5M sodium bicarbonate solution. (author)

  4. The 2016 iodine pill distribution campaign

    International Nuclear Information System (INIS)

    Delmestre, A.; Le Guen, B.


    The last iodine pills were distributed in february 2009, they are now outdated and a new campaign has been launched. Each family will receive a voucher to recover iodine pills from the nearby pharmacy. The aim of this new campaign is of course to protect people in case of severe nuclear accident but also to develop a radiation protection culture among the population. During the previous campaign only 51% of the concerned people went to the pharmacy to get the pills. The 2016 campaign will involve the public and all the establishments open to the public in a range of 10 km around each of the 19 nuclear power plants. It concerns 500 municipalities, 375.000 households, 55.000 enterprises and public utilities and 275 pharmacies are involved in the campaign. (A.C.)

  5. Models of iodine behavior in reactor containments

    Energy Technology Data Exchange (ETDEWEB)

    Weber, C.F.; Beahm, E.C.; Kress, T.S.


    Models are developed for many phenomena of interest concerning iodine behavior in reactor containments during severe accidents. Processes include speciation in both gas and liquid phases, reactions with surfaces, airborne aerosols, and other materials, and gas-liquid interface behavior. Although some models are largely empirical formulations, every effort has been made to construct mechanistic and rigorous descriptions of relevant chemical processes. All are based on actual experimental data generated at the Oak Ridge National Laboratory (ORNL) or elsewhere, and, hence, considerable data evaluation and parameter estimation are contained in this study. No application or encoding is attempted, but each model is stated in terms of rate processes, with the intention of allowing mechanistic simulation. Taken together, this collection of models represents a best estimate iodine behavior and transport in reactor accidents.

  6. Iodine-125 radiation of posterior uveal melanoma

    International Nuclear Information System (INIS)

    Packer, S.


    Twenty-eight cases of posterior choroidal melanoma were treated with iodine-125 in gold eye plaques. Eleven cases were located within 3.0 mm of the optic nerve (group A), nine were within 3.0 mm of the fovea (group B), and eight were within 3.0 mm of the optic nerve and fovea (group C). The mean follow-up of group A was 46.3 months; group B, 25.5 months; and group C, 42.7 months. Complications included macular edema, cataract and tumor growth. Visual acuity remained within two lines of that tested preoperatively for 4 of 11 patients in group A, 4 of 9 in group B, and 5 of 8 in group C. These results with iodine-125 suggest it as an appropriate treatment for patients with choroidal melanoma located near optic nerve and/or macula

  7. Iodine-125 radiation of posterior uveal melanoma

    Energy Technology Data Exchange (ETDEWEB)

    Packer, S.


    Twenty-eight cases of posterior choroidal melanoma were treated with iodine-125 in gold eye plaques. Eleven cases were located within 3.0 mm of the optic nerve (group A), nine were within 3.0 mm of the fovea (group B), and eight were within 3.0 mm of the optic nerve and fovea (group C). The mean follow-up of group A was 46.3 months; group B, 25.5 months; and group C, 42.7 months. Complications included macular edema, cataract and tumor growth. Visual acuity remained within two lines of that tested preoperatively for 4 of 11 patients in group A, 4 of 9 in group B, and 5 of 8 in group C. These results with iodine-125 suggest it as an appropriate treatment for patients with choroidal melanoma located near optic nerve and/or macula.

  8. Radiosensitizers action on Iodine 131 therapeutical effect

    International Nuclear Information System (INIS)

    Agote, Marcos; Kreimann, Erica L.; Bocanera, Laura V.; Dagrosa, Maria A.; Juvenal, Guillermo J.; Pisarev, Mario A.


    Present studies were aimed to research the possible application of a radiosensitizer, nicotinamide, to increase the therapeutical effect of radioiodine. There were used goitrous and normal rats with growing dose of Iodine 131, with and without simultaneous treatment with nicotinamide. The obtained results show that the nicotinamide treatment importantly increases the thyroid radio destructive effect induced by radioiodine. Under these experimental conditions, nicotinamide induces to a significant increase of thyroid vascularisation, without changes in the proteins ADP-ribosylation activity. These results show, for the first time, the radiosensitizer effect of nicotinamide in front of Iodine 131 and give the possibility of using it in the treatment of hyperthyroid or thyroid difference cancer patients. (author)

  9. Investigation of the radioecology of iodine 129

    International Nuclear Information System (INIS)

    Schuettelkopf, H.


    Very sensitive analytical methods for I-129 were developed for different sample materials. - The behaviour of I-129 in the Karlsruhe reprocessing plant and its release was completely investigated. - A longterm risk for the population caused by I-129 is not excpected. An existing environmental contamination with I-129 is reduced by a half-life of 0,3 y. The exposure of the population via the pasture-cow-milk path until now was overstimated at least by a factor 45. - In the environmental air of Kiel, Stade, Karlsruhe, Gundremmingen and Munich elemental iodine and iodine aerosols were measured. In the environmental air of Karlsruhe CH 3 127 I was determined. (orig./RW) [de

  10. Models of iodine behavior in reactor containments

    International Nuclear Information System (INIS)

    Weber, C.F.; Beahm, E.C.; Kress, T.S.


    Models are developed for many phenomena of interest concerning iodine behavior in reactor containments during severe accidents. Processes include speciation in both gas and liquid phases, reactions with surfaces, airborne aerosols, and other materials, and gas-liquid interface behavior. Although some models are largely empirical formulations, every effort has been made to construct mechanistic and rigorous descriptions of relevant chemical processes. All are based on actual experimental data generated at the Oak Ridge National Laboratory (ORNL) or elsewhere, and, hence, considerable data evaluation and parameter estimation are contained in this study. No application or encoding is attempted, but each model is stated in terms of rate processes, with the intention of allowing mechanistic simulation. Taken together, this collection of models represents a best estimate iodine behavior and transport in reactor accidents

  11. The Impact of Carrot Enriched in Iodine through Soil Fertilization on Iodine Concentration and Selected Biochemical Parameters in Wistar Rats (United States)

    Piątkowska, Ewa; Kopeć, Aneta; Bieżanowska-Kopeć, Renata; Pysz, Mirosław; Kapusta-Duch, Joanna; Koronowicz, Aneta Agnieszka; Smoleń, Sylwester; Skoczylas, Łukasz; Ledwożyw-Smoleń, Iwona; Rakoczy, Roksana; Maślak, Edyta


    Iodine is one of the trace elements which are essential for mammalian life. The major objective of iodine biofortification of plants is to obtain food rich in this trace element, which may increase its consumption by various populations. Additionally, it may reduce the risk of iodine deficiency diseases. In this research for the first time we have assessed the bioavailability of iodine from raw or cooked carrot biofortified with this trace element on iodine concentration in selected tissues and various biochemical parameters as well as mRNA expression of some genes involved in iodine metabolism in Wistar rats. Statistically, a significantly higher iodine level was determined in urine, faeces and selected tissues of rats fed a diet containing biofortified raw carrot as compared to a diet without iodine and a diet containing control cooked carrot. Biofortified raw carrot significantly increased triiodothyronine concentration as compared to animals from other experimental groups. The highest thyroid stimulating hormone level was determined in rats fed control cooked carrots. mRNA expression of selected genes was affected by different dietary treatment in rats’ hearts. Biofortified raw and cooked carrot could be taken into account as a potential source of iodine in daily diets to prevent iodine deficiency in various populations. PMID:27043135

  12. European commission research activities on iodine

    International Nuclear Information System (INIS)

    Loggia, E. della


    The research on iodine, as on other important fission products which would be released during a severe accident, carried out directly or organized by the European Commission stems from the Euratom Treaty, namely from Chapter III of the treaty which deals with the protection of the health of the population against radiations and from Chapter I which deals with research. In this paper we do not consider the Commission radiological protection programme: we limit ourselves to the presentation of the research carried out on Iodine as part of the most recent source term studies within the framework Programmes as are called the research programme of the European Commission, usually valid for a 4 year periods. The research activities are carried out by the European Commission either directly through the Joint Research Centres (JRC) or indirectly through collaboration with research organizations of Member States. Concerning the iodine research carried out as Direct Action in the Joint Research Centres, are mentioned here the most relevant activities carried out in this field at the JRC of Ispra and Karlsruhe (TUI). As Indirect Action, we present here the results of some studies allocated by the European Commission to experts of research organizations of Member Countries, followed by a short description of the main results achieved by the Reinforced Concerted Action, within the III Framework Programme (1992-1995). At the end of the paper are described the research on iodine being carried out or proposed within the IV Framework Programme (1995-1998). Mention is also done of the Commission participation, relevant in terms of financial and human efforts, to the PHEBUS FP Project. (author) refs

  13. European commission research activities on iodine

    Energy Technology Data Exchange (ETDEWEB)

    Loggia, E della [European Commission, Brussels (Belgium)


    The research on iodine, as on other important fission products which would be released during a severe accident, carried out directly or organized by the European Commission stems from the Euratom Treaty, namely from Chapter III of the treaty which deals with the protection of the health of the population against radiations and from Chapter I which deals with research. In this paper we do not consider the Commission radiological protection programme: we limit ourselves to the presentation of the research carried out on Iodine as part of the most recent source term studies within the framework Programmes as are called the research programme of the European Commission, usually valid for a 4 year periods. The research activities are carried out by the European Commission either directly through the Joint Research Centres (JRC) or indirectly through collaboration with research organizations of Member States. Concerning the iodine research carried out as Direct Action in the Joint Research Centres, are mentioned here the most relevant activities carried out in this field at the JRC of Ispra and Karlsruhe (TUI). As Indirect Action, we present here the results of some studies allocated by the European Commission to experts of research organizations of Member Countries, followed by a short description of the main results achieved by the Reinforced Concerted Action, within the III Framework Programme (1992-1995). At the end of the paper are described the research on iodine being carried out or proposed within the IV Framework Programme (1995-1998). Mention is also done of the Commission participation, relevant in terms of financial and human efforts, to the PHEBUS FP Project. (author) refs.

  14. Novel method of producing radioactive iodine

    International Nuclear Information System (INIS)

    Shikata, E.; Amano, H.


    Radioactive iodine(I-131) is easily obtained by heating, at a temperature ranging from 600 0 C to 650 0 C, a tellurium oxide intermediate which was obtained by heating telluric acid or tellurium trioxide at a temperature from about 400 0 C to 560 0 C and was irradited with a neutron flux. Thus, pure I-131 is obtained without the complicated operations required in a conventional process for separation and/or purification of the product. 4 claims

  15. The reaction of polyaniline with iodine

    Czech Academy of Sciences Publication Activity Database

    Stejskal, Jaroslav; Trchová, Miroslava; Blinova, Natalia V.; Konyushenko, Elena; Reynaud, S.; Prokeš, J.


    Roč. 49, č. 1 (2008), s. 180-185 ISSN 0032-3861 R&D Projects: GA MŠk ME 847; GA AV ČR IAA4050313; GA AV ČR IAA400500504 Grant - others:Eco-net project(FR) 16256SA Institutional research plan: CEZ:AV0Z40500505 Keywords : conducting polymer * polyaniline * iodine Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.331, year: 2008

  16. Dither Cavity Length Controller with Iodine Locking

    Directory of Open Access Journals (Sweden)

    Lawson Marty


    Full Text Available A cavity length controller for a seeded Q-switched frequency doubled Nd:YAG laser is constructed. The cavity length controller uses a piezo-mirror dither voltage to find the optimum length for the seeded cavity. The piezo-mirror dither also dithers the optical frequency of the output pulse. [1]. This dither in optical frequency is then used to lock to an Iodine absorption line.

  17. Fuel performance evaluation through iodine activity monitoring

    International Nuclear Information System (INIS)

    Anantharaman, K.; Chandra, R.


    The objective of the failed fuel detection system is to keep a watch on fuel behaviour during operation. This paper describes the evaluation of fuel behaviour by monitoring the activities of various isotopes of iodine both during steady state and during a reactor shutdown. The limitations of this approach also has been explained. The monitoring of tramp uranium for different types of release, namely fixed contamination and continuous release from fuel, is also presented. (author)

  18. Direct solar-pumped iodine laser amplifier (United States)

    Han, Kwang S.


    This semiannual progress report covers the period from March 1, 1987 to September 30, 1987 under NASA grant NAG1-441 entitled 'Direct solar-pumped iodine laser amplifier'. During this period Nd:YAG and Nd:Cr:GSGG crystals have been tested for the solar-simulator pumped cw laser, and loss mechanisms of the laser output power in a flashlamp-pumped iodine laser also have been identified theoretically. It was observed that the threshold pump-beam intensities for both Nd:YAG and Nd:Cr:GSGG crystals were about 1000 solar constants, and the cw laser operation of the Nd:Cr:GSGG crystal was more difficult than that of the Nd:YAG crystal under the solar-simulator pumping. The possibility of the Nd:Cr:GSGG laser operation with a fast continuously chopped pumping was also observed. In addition, good agreement between the theoretical calculations and the experimental data on the loss mechanisms of a flashlamp-pumped iodine laser at various fill pressures and various lasants was achieved.

  19. Nonimmediate hypersensitivity reactions to iodinated contrast media. (United States)

    Gómez, Enrique; Ariza, Adriana; Blanca-López, Natalia; Torres, Maria J


    To provide a detailed analysis of the latest findings on the mechanisms underlying the nonimmediate reactions to iodinated contrast media and comment on the recent advances in diagnosis, focusing on the roles of the skin test, drug provocation test (DPT), and lymphocyte transformation test (LTT). Several studies have reported new findings supporting an important role for T-lymphocytes in the nonimmediate reactions to iodinated contrast media. The LTT has been used as an in-vitro tool for diagnosis, but with variable results. However, the inclusion of autologous monocyte-derived dendritic cells as professional antigen-presenting cells has improved the sensitivity of this test. Regarding in-vivo diagnosis, although skin testing has been routine, it has now been shown that its sensitivity and negative predictive value are low. Recent studies have demonstrated that the DPT is a well tolerated and useful procedure that is necessary to confirm the diagnosis of nonimmediate hypersensitivity reactions to iodinated contrast media. Nonimmediate reactions to contrast media are usually T-cell mediated. Diagnosis is based on skin testing, although its sensitivity and negative predictive value are not optimal. Consequently, drug provocation testing is often needed to confirm the diagnosis and also to seek alternative contrast media that can be tolerated.

  20. Special syntheses of certain organic iodine compounds

    International Nuclear Information System (INIS)

    Henry, R.; Debuchy, D.; Junod, E.


    The technical difficulties encountered in working on radioactive products force us to choose the simplest methods of chemical synthesis possible. For iodine compounds, two special methods have been chosen: - by using fission recoil, we can prepare simple iodine compounds such as iodobenzene or methyl iodide in high yields and having a good degree of purity. The method consists in the irradiation of mixtures of uranium oxide and benzoic acid or ammonium acetate. The iodised product is separated by distillation, after dissolving the recoil medium in a solvent. - by isotopic exchange between the inorganic iodine of different valencies and complex molecules such as Bengal pink, and diodone, it is also possible to obtain satisfactory labelling yields. These reactions have been adapted so as to give a minimum time for isotopic exchange. In the case of Bengal pink, we have found a yield of 90 per cent after 60 minutes by exchange between Nal and the organic molecule in aqueous solution in presence of hydrogen peroxide. For diodone the method proposed by Liebster has been modified so as to reduce losses during purification. The analytical methods adopted for these different compounds are described. (author) [fr

  1. Prediction of iodine activity peak during refuelling

    International Nuclear Information System (INIS)

    Hozer, Z.; Vajda, N.


    The increase of fission product activities in the primary circuit of a nuclear power plant indicates the existence of defects in some fuel rods. The power change leads to the cooling down of the fuel and results in the fragmentation of the UO 2 pellets, which facilitates the release of fission products from the intergranular regions. Furthermore the injection of boric acid after shutdown will increase the primary activity, due to the solution of deposited fission products from the surface of the core components. The calculation of these phenomena usually is based on the evaluation of activity measurements and power plant data. The estimation of iodine spiking peak during reactor transients is based on correlation with operating parameters, such as reactor power and primary pressure. The approach used in the present method was applied for CANDU reactors. The VVER-440 specific correlations were determined using the activity measurements of the Paks NPP and the data provided by the Russian fuel supplier. The present method is used for the evaluation of the iodine isotopes, as well as the noble gases. A numerical model has been developed for iodine spiking simulation and has been validated against several shutdown transients, measured at Paks NPP. (R.P.)

  2. Iodine deficiency disorders (IDD control in India

    Directory of Open Access Journals (Sweden)

    Chandrakant S Pandav


    Full Text Available Iodine deficiency disorders (IDD constitute the single largest cause of preventable brain damage worldwide. Majority of consequences of IDD are invisible and irreversible but at the same time these are preventable. In India, the entire population is prone to IDD due to deficiency of iodine in the soil of the subcontinent and consequently the food derived from it. To combat the risk of IDD, salt is fortified with iodine. However, an estimated 350 million people do not consume adequately iodized salt and, therefore, are at risk for IDD. Of the 325 districts surveyed in India so far, 263 are IDD-endemic. The current household level iodized salt coverage in India is 91 per cent with 71 per cent households consuming adequately iodized salt. The IDD control goal in India was to reduce the prevalence of IDD below 10 per cent in the entire country by 2012. What is required is a "mission approach" with greater coordination amongst all stakeholders of IDD control efforts in India. Mainstreaming of IDD control in policy making, devising State specific action plans to control IDD, strict implementation of Food Safety and Standards (FSS Act, 2006, addressing inequities in iodized salt coverage (rural-urban, socio-economic, providing iodized salt in Public Distribution System, strengthening monitoring and evaluation of IDD programme and ensuring sustainability of IDD control activities are essential to achieve sustainable elimination of IDD in India.

  3. Outcome of hyperthyroidism treated by radioactive iodine

    International Nuclear Information System (INIS)

    Al-Shaikh, A.A.


    To study the outcome of Radioactive Iodine (RAI) in treatment of hyperthyroidism. It is a retrospective study of all patients of hyperthyroidism treated by Radioactive Iodine (RAI) seen in endocrinology clinic at King Abdulaziz University Hospital and Dr. Soliman Fageeh Hospital in Jeddah, Saudia Arabia. Two hundred and sixteen (216) patients were treated by RAI. They proved to have hyperthyroidism by thyroid function test (TSH, FT4 and T3) and isotopes scanning of the thyroid gland. All received 10 mci of RAI and were then followed up after one month and every two months thereafter for at least one year. The efficacy of the therapy was assessed by the improvement of the clinical features and by the thyroid function tests. A total of 216 patients were seen, the mean age was 36.5+- 10.64 years. One hundred fifty three were female and sixty three were male. Graves disease was the underlying cause in 163 patients [65.55%], toxic multi nodular goiter in 37 patients [25.1%] and toxic adenoma in 16 patients [9.3%]. The symptoms improved after one month only in 11 patients but others required antithyroid treatment for two months. Only 17 patients remained hyperthyroid after six months of treatment. Radioactive iodine is very effective in treatment of hyperthyroidism with minor side effects such as weight gain, fatigability and hypothyroidism. (author)

  4. Radioactive iodine therapy in cats with hyperthyroidism

    International Nuclear Information System (INIS)

    Turrel, J.M.; Feldman, E.C.; Hays, M.; Hornof, W.J.


    Eleven cats with hyperthyroidism were treated with radioactive iodine ( 131 I). Previous unsuccessful treatments for hyperthyroidism included hemithyroidectomy (2 cats) and an antithyroid drug (7 cats). Two cats had no prior treatment. Thyroid scans, using technetium 99m, showed enlargement and increased radionuclide accumulation in 1 thyroid lobe in 5 cats and in both lobes in 6 cats. Serum thyroxine concentrations were high and ranged from 4.7 to 18 micrograms/dl. Radioactive iodine tracer studies were used to determine peak radioactive iodine uptake (RAIU) and effective and biological half-lives. Activity of 131 I administered was calculated from peak RAIU, effective half-life, and estimated thyroid gland weight. Activity of 131 I administered ranged from 1.0 to 5.9 mCi. The treatment goal was to deliver 20,000 rad to hyperactive thyroid tissue. However, retrospective calculations based on peak RAIU and effective half-life obtained during the treatment period showed that radiation doses actually ranged from 7,100 to 64,900 rad. Complete ablation of the hyperfunctioning thyroid tissue and a return to euthyroidism were seen in 7 cats. Partial responses were seen in 2 cats, and 2 cats became hypothyroid. It was concluded that 131 I ablation of thyroid tumors was a reasonable alternative in the treatment of hyperthyroidism in cats. The optimal method of dosimetry remains to be determined

  5. Generalised derived limits for radioisotopes of iodine

    International Nuclear Information System (INIS)

    Hughes, J.S.; Haywood, S.M.; Simmonds, J.R.


    Generalised Derived Limits (GDLs) are evaluated for iodine-125,129,131,132,133,134,135 in selected materials from the terrestrial and aquatic environments and for discharge to atmosphere. They are intended for use as convenient reference levels against which the results of environmental monitoring can be compared and atmospheric discharges assessed. GDLs are intended for use when the environmental contamination or discharge to atmosphere is less than about 5% of the GDL. If the level of environmental contamination or discharge to the atmosphere exceeds this percentage of the GDL it does not necessarily mean that the dose equivalents to members of the public are approaching the dose equivalent limit. It is rather an indication that it may be appropriate to obtain a more specific derived limit for the particular situation by reviewing the values of the parameters involved in the calculation. GDL values are specified for iodine radionuclides in water, soil, grass, sediments and various foodstuffs derived from the terrestrial and aquatic environments. GDLs are also given for iodine radionuclides on terrestrial surfaces and for their discharge to atmosphere. (author)

  6. Thyroid measurements of Iodine-125 workers

    International Nuclear Information System (INIS)

    Burns, P.A.; Peggie, J.R.


    The accumulation of 125 I in the thyroid presents real hazards to workers who use this radionuclide. Recent assessments of the maximum permissible thyroid burden for 125 I have tended to be lower than those previously adopted. Workers using 125 I may receive small doses to a film badge monitor from external radiation while accumulating significant doses to the thyroid from internal contamination. It is therefore necessary to perform some form of thyroid monitoring on such workers. In the past two years the Australian Radiation Laboratory has monitored 125 I workers from six different institutations in the Melbourne area to determine the activity of 125 I in their thyroids. Most of the levels monitored were less than one tenth of the most recently recommended thyroid burden of 400 nanocurie. The highest levels were measured in workers who actually perform iodinations. Workers who handle the iodinate generally had lower levels than those performing the iodinations. Only a very small number of the workers measured were below the detectable limit of the system indicating that even when low activities of 125 I are handled in relatively stable forms it is still possible to accumulate 125 I in the thyroid

  7. Experience of iodine removal in Tokai reprocessing plant

    International Nuclear Information System (INIS)

    Kikuchi, K.; Komori, Y.; Takeda, K.


    In the Tokai reprocessing plant about 170 ton of irradiated fuels have been processed since the beginning of hot operations in 1977. There was no effective equipment for iodine removal from the off-gas except for alkaline scrubbers when the plant construction was completed. In order to reduce the iodine discharge to the atmosphere, silver-exchanged zeolite (AgX) filters were installed additionally in 1979 and 1980, and they have been effective. However, those decontamination factors (DFs) were not as high as expected, and increasing the reprocessing amount of spent fuels it became necessary to lower the iodine discharge to the atmosphere. Therefore, other iodine removal equipment is planned to be installed in the plant. Concerning these investigations and development of iodine removal techniques, the iodine concentration of actual off-gases was measured and useful data were obtained

  8. Iodine behavior in containment under LWR accident conditions

    International Nuclear Information System (INIS)

    Wisbey, S.J.; Beahm, E.C.; Shockley, W.E.; Wang, Y.M.


    The description of containment iodine behavior in reactor accident sequences requires an understanding of iodine volatility effects, deposition and revaporization/resuspension (from surfaces and aerosols), chemical changes between species, and mass transport. The experimental work in this program has largely centered on the interactions of iodine in or with water pools. The formation of volatile iodine, as I 2 or organic iodides, is primarily dependent on radiation and solution pH. Lower pH results in increased formation of volatile iodine species; thus, for example, a pH of 3.05 resulted in a conversion of I - to I 2 that was more than two orders of magnitude greater than tests run at pH 6.1 or 6.8. The formation or organic iodides involving water pools has been linked to the presence of iodine as I 2 , the solution/gas contact, and to the type of organic material

  9. Iodine intake as a determinant of thyroid disorders in populations

    DEFF Research Database (Denmark)

    Laurberg, Peter; Cerqueira, Charlotte; Ovesen, Lars


    Depending on the availability of iodine, the thyroid gland is able to enhance or limit the use of iodine for thyroid hormone production. When compensation fails, as in severely iodine-deficient populations, hypothyroidism and developmental brain damage will be the dominating disorders. This is, out...... of all comparison, the most serious association between disease and the level of iodine intake in a population. In less severe iodine deficiency, the normal thyroid gland is able to adapt and keep thyroid hormone production within the normal range. However, the prolonged thyroid hyperactivity associated...... with such adaptation leads to thyroid growth, and during follicular cell proliferation there is a tendency to mutations leading to multifocal autonomous growth and function. In populations with mild and moderate iodine deficiency, such multifocal autonomous thyroid function is a common cause of hyperthyroidism...

  10. 40 CFR 141.571 - What records does subpart T require my system to keep? (United States)


    ... records does subpart T require my system to keep? Your system must keep several types of records based on... Benchmarking(§§ 141.540-141.544) Benchmark (including raw data and analysis) Indefinitely. ...

  11. Method and composition for removing iodine from gases

    International Nuclear Information System (INIS)

    French, J.A.; O'Hara, D.K.; Pasha, M.


    A method and composition for removing iodine and organic iodides from an iodine-containing off-gas stream is provided. The composition for the removal is a ceramic material impregnated with a mixture of a metallic salt with a water-soluble secondary amine. The method for removing the iodine and iodide is accomplished by passing the off-gas stream over the ceramic impregnated with the metallic salt-amine mixture

  12. Preventive distribution and plans of iodine tablets stocks management

    International Nuclear Information System (INIS)


    This official note includes two parts: one concerns the new preventive distribution of iodine tablets on the areas defined by the Particular Intervention Plans (P.P.I.) around nuclear facilities and the other one the setting up of iodine tablets stocks beyond the P.P.I. areas. In annexe is a guide for the elaboration of stocks management plans for steady iodine tablets. (N.C.)

  13. A point on the 2016 iodine pill distribution campaign

    International Nuclear Information System (INIS)

    Alfonsi, S.; Catelinois, J.M.; Bouet, P.; Ferlet, O.; Riviere, E.


    The 2016 Iodine distribution campaign involves various actors: state representatives (regional prefect) whose dedication creates a climate of trust for the population, local elected officials (in particular the mayors of the municipalities concerned who can play an important role to motivate the population), health professionals like doctors and nurses who can bring information on radiation hazards and explain the preventive role of iodine and local pharmacists who are in charge of delivering iodine pills. (A.C.)

  14. Role of iodine in pathogenesis of thyroid disease - is induction of apoptosis consequence of iodine cytotoxicity?

    Directory of Open Access Journals (Sweden)

    Marković Ljiljana


    Full Text Available Iodine is one of the best-characterized environmental factors associated with autoimmune thyroid disease (ATD. Epidemiological studies have shown that ATD incidence has increased following the introduction of salt iodination in the 1920s; in addition, ATD patients can improve upon iodine restriction. In animal models such as BioBreeding/Worcester and Buffalo rats, obese chicken strain, and non-obese diabetic H-2h4 mice, excess iodine is associated with autoimmunity. Analyses of Hashimoto thyroiditis (HT have shown enlarged number of apoptotic follicular cells, and the destruction is an effect of death receptormediated apoptosis. Excess of iodine induces rapid apoptosis of goitrogen Wistar pretreated rats, possibly connected with inhibition of polyamine synthesis, inhibitors of DNA fragmentation. Percentage of apoptotic cells was statistically higher in patients with HT than in those with euthyroid goiter, with significant increase of caspase 32. Genes for Bcl-2 and Bax proteins are under the transcriptional control of p53. In TAD-2 cell cultures, apoptosis is p53-independed, suggesting that DNA damage is not primarily evoked by potassium iodide (KI. High concentrations of NaI increase the proportion of apoptotic cells in FTRL5 thyroid cell line. Iodide cytotoxicity is inhibited by a TPO inhibitor and is relieved with an anti-oxidant agent. Chronic iodine excess induces apoptosis and necrosis of thyroid follicular and endothelial cells, leading to thyroglobulin accumulation in connective tissue. Iodide excess requires peroxidase enzymatic activity to induce apoptosis. Ionic iodide is not directly toxic, whereas its molecular form I2 mediates the apoptotic effect of KI. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. OI-175059

  15. Efforts to Consolidate Chalcogels with Adsorbed Iodine

    Energy Technology Data Exchange (ETDEWEB)

    Riley, Brian J.; Pierce, David A.; Chun, Jaehun


    This document discusses ongoing work with non-oxide aerogels, called chalcogels, that are under development at the Pacific Northwest National Laboratory as sorbents for gaseous iodine. Work was conducted in fiscal year 2012 to demonstrate the feasibility of converting Sn2S3 chalcogel without iodine into a glass. This current document summarizes the work conducted in fiscal year 2013 to assess the consolidation potential of non-oxide aerogels with adsorbed iodine. The Sn2S3 and Sb13.5Sn5S20 chalcogels were selected for study. The first step in the process for these experiments was to load them with iodine (I2). The I2 uptake was ~68 mass% for Sn2S3 and ~50 mass% for Sb13.5Sn5S20 chalcogels. X-ray diffraction (XRD) of both sets of sorbents showed that metal-iodide complexes were formed during adsorption, i.e., SnI4 for Sn2S3 and SbI3 for Sb13.5Sn5S20. Additionally, metal-sulfide-iodide complexes were formed, i.e., SnSI for Sn2S3 and SbSI for Sb13.5Sn5S20. No XRD evidence for unreacted iodine was found in any of these samples. Once the chalcogels had reached maximum adsorption, the consolidation potential was assessed. Here, the sorbents were heated for consolidation in vacuum-sealed quartz vessels. The Sb13.5Sn5S20 chalcogel was heated both (1) in a glassy carbon crucible within a fused quartz tube and (2) in a single-containment fused quartz tube. The Sn2S3 chalcogel was only heated in a single-containment fused quartz tube. In both cases with the single-containment fused quartz experiments, the material consolidated nicely. However, in both cases, there were small fractions of metal iodides not incorporated into the final product as well as fused quartz particles within the melt due to the sample attacking the quartz wall during the heat treatment. The Sb13.5Sn5S20 did not appear to attack the glassy carbon crucible so, for future experiments, it would be ideal to apply a coating, such as pyrolytic graphite, to the inner walls of the fused quartz vessel to prevent

  16. Two-layer type filter for removal of radioactive iodine

    Energy Technology Data Exchange (ETDEWEB)

    Taoki, M


    The object is to provide a filter for removing radioactive iodine, which is used for disposal of gaseous waste in an atomic power plant, to particularly hold a pressure loss lower. The filter according to the present invention comprises two layers, which are filled at a front stage with active carbon, which is small in pressure loss and has a good collective efficiency relative to iodine, and at a rear stage with silver zeolite, which has a good collective efficiency relative to both iodine and methyl iodine, whereby respective adsorbent are effectively utilized to minimize pressure loss even if a large quantity of air.

  17. Iodine Contents in Baby Food Consumed in Japan

    Directory of Open Access Journals (Sweden)

    Yoshida M.


    Full Text Available To evaluate iodine intake in Japanese infants, iodine contents were determined in both commercial and homemade baby food samples consumed in Japan. Fifty-three samples of commercial bottled or retort baby food and 25 samples of homemade baby food for one day were collected and their iodine contents were determined by inductively coupled plasma mass spectrometry after an extraction with 0.5% tetramethylammonium hydroxide. Among the commercial baby food samples, 35 samples showed low iodine values ( 1000 ng/g wet weight. Significantly higher iodine values were observed in 15 samples composed of dishes cooked using kombu (a kind of kelp than other samples. Among the homemade baby food samples, 12 samples brought very low iodine intake (< 1- 24 μg/d, while 5 samples brought very high iodine intake (283-978 μg/d. These results indicate that intermittent high iodine baby food including dishes cooked using kombu contributes to sufficient iodine intake in Japanese infants.

  18. Fatty acids labelled in the. omega. -position with iodine isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Mathieu, J.P.; Busquet, G.; Comet, M. (Universite Scientifique et Medicale de Grenoble, 38 - La Tronche (France)); Riche, F.; Vidal, M. (Laboratoire d' Etudes Dynamiques et Structurales de la Selectivite, 38 - Grenoble (France)); Coornaert, S.; Bardy, A. (CEA, Centre de Saclay, 91 - Gif-sur-Yvette (France)); Godart, J. (Institut des Sciences Nucleaires, 38 - Grenoble (France))


    The synthesis of saturated acetylenic and olefinic (Z or E) fatty acids has been carried out and their labelling with iodine-131 or 123 by exchange I/sup -/, *I/sup -/ has been studied. The influence of several parameters -water and fatty acid concentrations, specific activity, labelling solution acidity, iodine carrier presence- on this exchange reaction has been noted, enabling experimental conditions to be defined that produce labelling yields of greater than 95%. These results should lead to widespread clinical use of iodine labelled fatty acids.

  19. Thyroid iodine uptake and serum triiodothyronine level in eldery subjects

    International Nuclear Information System (INIS)

    Paradowski, L.; Dolinska, G.; Knapik, Z.; Rynowiecka, M.


    Iodine uptake by the thyroid and serum triiodothyronine (T 3 ) level in subjects aged from 65 to 93 years were determined. Low T 3 level and normal uptake of inorganic iodine by the thyroid were found. In the light of these results it is suggested that normal accumulation of inorganic iodine and low production of T 3 are characteristic features of euthyroidism in elderly subjects. It is believed that the function of the thyroid is expressed better by determination of the serum levels of thyroid hormones than determination of the uptake of radioactive iodine. Elaboration of standard normal values which would take into account abnormalities encountered in old age is postulated. (author)

  20. Gravimetric determination of the iodine number of carbon black

    International Nuclear Information System (INIS)

    Murphy, L.J. Jr.


    This paper discusses a gravimetric method for the determination of the iodine adsorption number of carbon black. It comprises determining the concentration of an accurately weighed iodine blank solution by adding a standardized titrant to the iodine solution until a titration endpoint is reached and determining the concentration of the iodine solution by accurately weighing the amount of the standardized titrant necessary to reach the endpoint, accurately weighing an amount of carbon black and adding an appropriate amount of an accurately weighed portion of the iodine solution, equilibrating the carbon black-iodine solution mixture, adding the standardized titrant to an accurately weighed portion of the supernatant from the carbon black-iodine mixture until a titration endpoint is reached and determining the concentration of the supernatant by accurately weighing the amount of the standardized titrant necessary to reach the endpoint, wherein the titration endpoint of the supernatant is obtained using an indicating and a reference electrode, and calculating the iodine adsorption number of the carbon black based on the gravimetrically determined concentration of the titrant, the iodine solution, and the supernatant

  1. The method of quantitative determination of iodine in acetic acid

    International Nuclear Information System (INIS)

    Sukhomlinov, A.B.; Kalinchenko, N.B.


    Method for separate determination of J 2 and J - concentrations in acetic acid is suggested. Iodine concentration in acetic acid is determined by measuring potential of iodine-selective electrode first in the initial solution of acetic acid, where molecular iodine dissociation equals 0.5, and then in acetic acid, with alkali (NaOH) addition up to pH > 3, where molecular iodine dissociation equals 1. Determination is conducted in 5x10 -7 -5x10 -6 mol/l concentration range with relative standard deviation not more than 0.1. 1 fig

  2. Two-layer type filter for removal of radioactive iodine

    International Nuclear Information System (INIS)

    Taoki, Masafumi.


    Object: To provide a filter for removing radioactive iodine, which is used for disposal of gaseous waste in an atomic power plant, to particularly hold a pressure loss lower. Structure: The filter according to the present invention comprises two layers, which are filled at a front stage with active carbon, which is small in pressure loss and has a good collective efficiency relative to iodine, and at a rear stage with silver zeolite, which has a good collective efficiency relative to both iodine and methyl iodine, whereby respective adsorbent are effectively utilized to minimize pressure loss even if a large quantity of air. (Kamimura, M.)

  3. Mission and System Advantages of Iodine Hall Thrusters (United States)

    Dankanich, John W.; Szabo, James; Pote, Bruce; Oleson, Steve; Kamhawi, Hani


    The exploration of alternative propellants for Hall thrusters continues to be of interest to the community. Investments have been made and continue for the maturation of iodine based Hall thrusters. Iodine testing has shown comparable performance to xenon. However, iodine has a higher storage density and resulting higher ?V capability for volume constrained systems. Iodine's vapor pressure is low enough to permit low-pressure storage, but high enough to minimize potential adverse spacecraft-thruster interactions. The low vapor pressure also means that iodine does not condense inside the thruster at ordinary operating temperatures. Iodine is safe, it stores at sub-atmospheric pressure, and can be stored unregulated for years on end; whether on the ground or on orbit. Iodine fills a niche for both low power (10kW) electric propulsion regimes. A range of missions have been evaluated for direct comparison of Iodine and Xenon options. The results show advantages of iodine Hall systems for both small and microsatellite application and for very large exploration class missions.

  4. Maternal urinary iodine concentration in pregnancy and children's cognition: results from a population-based birth cohort in an iodine-sufficient area

    NARCIS (Netherlands)

    Ghassabian, A.; Steenweg- de Graaff, J.; Peeters, R.P.; Ross, H.A.; Jaddoe, V.W.; Hofman, A.; Verhulst, F.C.; White, T.; Tiemeier, H.


    OBJECTIVE: Reports from populations with an insufficient iodine intake suggest that children of mothers with mild iodine deficiency during pregnancy are at risk for cognitive impairments. However, it is unknown whether, even in iodine-sufficient areas, low levels of iodine intake occur that

  5. 40 CFR 141.551 - What strengthened combined filter effluent turbidity limits must my system meet? (United States)


    ... effluent turbidity limits must my system meet? 141.551 Section 141.551 Protection of Environment... Effluent Requirements § 141.551 What strengthened combined filter effluent turbidity limits must my system meet? Your system must meet two strengthened combined filter effluent turbidity limits. (a) The first...

  6. 40 CFR 141.560 - Is my system subject to individual filter turbidity requirements? (United States)


    ... filter turbidity requirements? 141.560 Section 141.560 Protection of Environment ENVIRONMENTAL PROTECTION... Filtration and Disinfection-Systems Serving Fewer Than 10,000 People Individual Filter Turbidity Requirements § 141.560 Is my system subject to individual filter turbidity requirements? If your system is a subpart...

  7. 40 CFR 141.86 - Monitoring requirements for lead and copper in tap water. (United States)


    ... copper in tap water. 141.86 Section 141.86 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... § 141.86 Monitoring requirements for lead and copper in tap water. (a) Sample site location. (1) By the... the water system can collect the number of lead and copper tap samples required in paragraph (c) of...

  8. 25 CFR 141.27 - Trade in imitation Indian crafts prohibited. (United States)


    ... 25 Indians 1 2010-04-01 2010-04-01 false Trade in imitation Indian crafts prohibited. 141.27 Section 141.27 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FINANCIAL ACTIVITIES BUSINESS PRACTICES ON THE NAVAJO, HOPI AND ZUNI RESERVATIONS General Business Practices § 141.27 Trade in imitation...

  9. 40 CFR 141.403 - Treatment technique requirements for ground water systems. (United States)


    ... ground water systems. 141.403 Section 141.403 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS (CONTINUED) NATIONAL PRIMARY DRINKING WATER REGULATIONS Ground Water Rule § 141... customer as follows: (i) Chemical disinfection—(A) Ground water systems serving greater than 3,300 people...

  10. 40 CFR 141.62 - Maximum contaminant levels for inorganic contaminants. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for inorganic contaminants. 141.62 Section 141.62 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Water Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.62 Maximum...

  11. 40 CFR 141.63 - Maximum contaminant levels (MCLs) for microbiological contaminants. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels (MCLs) for microbiological contaminants. 141.63 Section 141.63 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Water Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.63 Maximum...

  12. 40 CFR 141.61 - Maximum contaminant levels for organic contaminants. (United States)


    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Maximum contaminant levels for organic contaminants. 141.61 Section 141.61 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER... Regulations: Maximum Contaminant Levels and Maximum Residual Disinfectant Levels § 141.61 Maximum contaminant...

  13. 26 CFR 1.381(c)(14)-1 - Dividend carryover to personal holding company. (United States)


    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Dividend carryover to personal holding company. 1.381(c)(14)-1 Section 1.381(c)(14)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(14)-1...

  14. Biofortification of lettuce (Lactuca sativa L.) with iodine: the effect of iodine form and concentration in the nutrient solution on growth, development and iodine uptake of lettuce grown in water culture. (United States)

    Voogt, Wim; Holwerda, Harmen T; Khodabaks, Rashied


    Iodine is an essential trace element for humans. Two billion individuals have insufficient iodine intake. Biofortification of vegetables with iodine offers an excellent opportunity to increase iodine intake by humans. The main aim was to study the effect of iodine form and concentration in the nutrient solution on growth, development and iodine uptake of lettuce, grown in water culture. In both a winter and summer trial, dose rates of 0, 13, 39, 65, and 90 or 129 microg iodine L(-1), applied as iodate (IO(3)(-)) or iodide (I(-)), did not affect plant biomass, produce quality or water uptake. Increases in iodine concentration significantly enhanced iodine content in the plant. Iodine contents in plant tissue were up to five times higher with I(-) than with IO(3)(-). Iodine was mainly distributed to the outer leaves. The highest iodide dose rates in both trials resulted in 653 and 764 microg iodine kg(-1) total leaf fresh weight. Biofortification of lettuce with iodine is easily applicable in a hydroponic growing system, both with I(-) and IO(3)(-). I(-) was more effective than IO(3)(-). Fifty grams of iodine-biofortified lettuce would provide, respectively, 22% and 25% of the recommended daily allowance of iodine for adolescents and adults. (c) 2010 Society of Chemical Industry.

  15. An Assessment of the Selenium Status of Iodine-Deficient and Non-Iodine Deficient Filipino Children

    Directory of Open Access Journals (Sweden)

    Ma. Sofia Amarra


    Full Text Available The aim of this study is to examine and compare blood selenium levels in iodine-deficient and non-iodine deficient children. Two groups of children were examined: one group with iodine deficiency (n=31 and the other group with normal iodine status (n=32. Blood was extracted by venipuncture from children aged 6-10 years attending first grade in Commonwealth Elementary School in Quezon City. Whole blood selenium was examined by electrothermal atomic absorption spectrophotometry (AAS. Iodine status was determined by goiter palpation and urinary iodine excretion. Mean selenium levels of deficient and non-deficient children were compared using T-test. Using a cut-off value of 60 mg Se/L whole blood, the proportion of children with normal and deficient iodine status who fell below this cut-off was compared using chi-square test. Whole blood selenium values ranged from 17.6 to 133.6 mg/L. There were no significant differences in mean selenium levels between children with normal and deficient iodine status. Children with normal iodine status had a mean blood selenium level of 55.87 ± 26.3 mg/L while children with deficient iodine status had a mean level of 58.76 ± 26.4 mg/L. Sixty percent of children had blood selenium levels below the arbitrary cut-off of 60 mg/L with no significant difference between groups (p = 0.165, indicating that selenium deficiency is prevalent in this group of children regardless of iodine status. Since selenium deficiency limits the response to iodine supplementation, further investigation is needed to determine whether the same situation exists in children from other areas.

  16. Fine Structure in Proton Emission from the Deformed 141g.sHo and 141mHo

    International Nuclear Information System (INIS)

    Karny, M.; Rykaczewski, Krzysztof Piotr; Grzywacz, R.; Batchelder, J.C.; Bingham, C.R.; Goodin, C. T.; Gross, Carl J.; Hamilton, J.H.; Korgul, A.; Krolas, W.; Liddick, S. N.; Li, K.; Maier, Karl; Mazzocchi, C.; Piechaczek, A.; Shapira, Dan; Simpson, D.; Tantawy, M.N.; Winger, J.A.; Yu, Chang-Hong; Zganjar, E. F.


    Fine structure in proton emission from the deformed states 141g.s Ho (T 1/2 = 4.1 ms) and 141 mHo (T 1/2 = 7.4 (micro)s) has been discovered at Oak Ridge by detecting fusion evaporation residues with the Recoil Mass Spectrometer, Si-detectors and digital signal processing electronics. The branching ratios to the first 2 + excited state in 140 Dy were measured to be I p g.s. (2 + ) = 0.9±0.1% and I p m (2 + ) = 1.7±0.5%. A comparison of the available calculations to the experimental values calls for further development of the theoretical models

  17. The retention of iodine by iodine filters in nuclear power plants in the case of fire (a literature review)

    International Nuclear Information System (INIS)

    Giraud, V.


    Due to the liberation of considerable amounts of gaseous combustion products, fires in nuclear power plants may lead to a deterioration in the retention of radioiodine by iodine filters. The combustion products of the burnable materials, i.e., insulations, lubricants and paints, vary considerably with the development of the fire. Combustion product analyses of these materials have been performed only to a limited extent. The reaction of iodine with combustion products as well as the retention of the resulting iodine reaction products by sorbents have not yet been investigated. The reduction in the removal efficiencies of iodine sorbents due to the presence of combustion products is unknown. (orig.) [de

  18. Bacterial contribution to iodine volatilization in the environment

    Energy Technology Data Exchange (ETDEWEB)

    Amachi, S; Kasahara, M; Fujii, T [Chiba Univ., Dept. of Bioresources Chemistry, Matsudo, Chiba (Japan); Muramatsu, Y [National Inst. of Radiological Sciences, Chiba (Japan)


    The roles of microorganisms in iodine volatilization from the environment were studied. More than 100 bacterial strains were isolated from various environments such as soils, seawater and marine sediments, and were examined their capacities for volatilizing iodine. Approximately 40% of these bacteria showed significant capacities for volatilizing iodine. Gas chromatographic determinations revealed that the chemical species of gaseous iodine is methyl iodide (CH{sub 3}I). Phylogenetic analysis based on 16S ribosomal DNA showed that these 'iodine-volatilizing bacteria' are widely distributed through the bacterial domain. The iodide-methylating reaction was mediated by an enzyme protein with S-adenosyl-L-methionine (SAM) as the methyl donor. We then estimated bacterial contribution to iodine volatilization from soils. Iodine in soils was volatilized mainly as CH{sub 3}I. CH{sub 3}I emission was enhanced in the presence of glucose or yeast extract, but was inhibited by autoclaving of soils. Little CH{sub 3}I was produced under anaerobic conditions. Furthermore, the addition of streptomycin and tetracycline, antibiotics which inhibit bacterial growth, strongly inhibited CH{sub 3}I emission, while a fungal inhibitor cycloheximide caused little effect. These results suggest that iodine in soils is volatilized as CH{sub 3}I mainly by the action of aerobic soil bacteria. Similar experiment was carried out by using sea water samples. The emission of iodine from sea waters occurred biologically, and bacterial (and also other microbial) contribution was confirmed. Our results suggest that iodine is methylated and volatilized into the atmosphere as a result of bacterial activities. Since bacteria are so abundant and widespread in the environments, they may significantly contribute to global iodine volatilization. This indicates that if {sup 129}I would be released from nuclear facilities, weapons testing or ground storage of nuclear wastes, the pathway of volatilization by

  19. 8401 lack of dietary sources of iodine and the prevalence of iodine ...

    African Journals Online (AJOL)

    1Institute of Nutrition, Food Science and Technology, Hawassa University, ... to supply iodized salt in order to achieve the goal of elimination of iodine .... Of the participants, 26% owned mature enset (local indicator of wealth) and 85% .... was higher among subjects whose major drinking water source was ... Education level.

  20. Pool scrubbing models for iodine components

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, K [Battelle Ingenieurtechnik GmbH, Eschborn (Germany)


    Pool scrubbing is an important mechanism to retain radioactive fission products from being carried into the containment atmosphere or into the secondary piping system. A number of models and computer codes has been developed to predict the retention of aerosols and fission product vapours that are released from the core and injected into water pools of BWR and PWR type reactors during severe accidents. Important codes in this field are BUSCA, SPARC and SUPRA. The present paper summarizes the models for scrubbing of gaseous Iodine components in these codes, discusses the experimental validation, and gives an assessment of the state of knowledge reached and the open questions which persist. The retention of gaseous Iodine components is modelled by the various codes in a very heterogeneous manner. Differences show up in the chemical species considered, the treatment of mass transfer boundary layers on the gaseous and liquid sides, the gas-liquid interface geometry, calculation of equilibrium concentrations and numerical procedures. Especially important is the determination of the pool water pH value. This value is affected by basic aerosols deposited in the water, e.g. Cesium and Rubidium compounds. A consistent model requires a mass balance of these compounds in the pool, thus effectively coupling the pool scrubbing phenomena of aerosols and gaseous Iodine species. Since the water pool conditions are also affected by drainage flow of condensate water from different regions in the containment, and desorption of dissolved gases on the pool surface is determined by the gas concentrations above the pool, some basic limitations of specialized pool scrubbing codes are given. The paper draws conclusions about the necessity of coupling between containment thermal-hydraulics and pool scrubbing models, and proposes ways of further simulation model development in order to improve source term predictions. (author) 2 tabs., refs.

  1. Pool scrubbing models for iodine components

    International Nuclear Information System (INIS)

    Fischer, K.


    Pool scrubbing is an important mechanism to retain radioactive fission products from being carried into the containment atmosphere or into the secondary piping system. A number of models and computer codes has been developed to predict the retention of aerosols and fission product vapours that are released from the core and injected into water pools of BWR and PWR type reactors during severe accidents. Important codes in this field are BUSCA, SPARC and SUPRA. The present paper summarizes the models for scrubbing of gaseous Iodine components in these codes, discusses the experimental validation, and gives an assessment of the state of knowledge reached and the open questions which persist. The retention of gaseous Iodine components is modelled by the various codes in a very heterogeneous manner. Differences show up in the chemical species considered, the treatment of mass transfer boundary layers on the gaseous and liquid sides, the gas-liquid interface geometry, calculation of equilibrium concentrations and numerical procedures. Especially important is the determination of the pool water pH value. This value is affected by basic aerosols deposited in the water, e.g. Cesium and Rubidium compounds. A consistent model requires a mass balance of these compounds in the pool, thus effectively coupling the pool scrubbing phenomena of aerosols and gaseous Iodine species. Since the water pool conditions are also affected by drainage flow of condensate water from different regions in the containment, and desorption of dissolved gases on the pool surface is determined by the gas concentrations above the pool, some basic limitations of specialized pool scrubbing codes are given. The paper draws conclusions about the necessity of coupling between containment thermal-hydraulics and pool scrubbing models, and proposes ways of further simulation model development in order to improve source term predictions. (author) 2 tabs., refs

  2. Effects of diuretics on iodine uptake in non-toxic goitre: comparison with low-iodine diet

    Energy Technology Data Exchange (ETDEWEB)

    Kapucu, L.Ozlem; Azizoglu, Firat [Department of Nuclear Medicine, Gazi University, Ankara (Turkey); Ayvaz, Goksun; Karakoc, Ayhan [Department of Endocrinology, Gazi University, Ankara (Turkey)


    Low-iodine diet has been employed to achieve iodine depletion prior to radioiodine (RI) therapy. However, treatment with diuretics may be more effective than low-iodine diet in causing iodine depletion and subsequent increase in RI uptake by the thyroid. Fifty-five patients with non-toxic goitre were given 0.20 MBq RI p.o. on the first day of the study and thyroid uptake was measured. In 15 patients, a low-iodine diet was started and continued for 14 days. The remaining 40 patients received furosemide 40 mg/day orally for 5 days with an unrestricted diet. On the 15th day of the study, all patients were given 0.20 MBq RI p.o. and thyroid RI uptake was measured again. Additionally, 24-h urinary iodine excretion and RI clearance were measured on the 1st and 6th days in 21 patients from the furosemide group and on the 1st and 15th days in eight patients from the diet group. Furosemide administration led to a 58.40% increase in iodine uptake over the baseline value, which was significantly higher than the increase caused by low-iodine diet (17.22%) (P<0.0001). Urinary excretion of RI decreased in both groups similarly (furosemide, 29.45%; low-iodine diet, 21.06%; P=0.33). Iodine clearance also decreased in each group similarly (10.61% vs 7.53%, P=0.53). Treatment with furosemide prior to administration of RI increases the uptake of RI by the thyroid more effectively than does low-iodine diet. (orig.)

  3. Iodine-131 monitoring in sewage plant outflow

    International Nuclear Information System (INIS)

    McGowan, D R; Crawley, M T; Pratt, B E; Hinton, P J; Peet, D J


    Three different hospital sites (Oxford, Sutton and Guildford) have performed sampling of their local sewage plant outflow to determine levels of radioactivity resulting from iodine-131 patients undergoing radionuclide therapies. It was found that a maximum of 20% of activity discharged from the hospitals was present in the sewage plant final effluent channel. This is significantly below the level predicted by mathematical models in current use. The results further show that abatement systems to reduce public exposure are unlikely to be warranted at hospital sites. (paper)

  4. Captor of Iodine coupled to PC

    International Nuclear Information System (INIS)

    Arista Romeu, Eduardo; Alonso Abad Dolores; Arteche Diaz, Raul


    A measurement - detection system (DETEC -PC) is presented to be used in Iodine Thyroid Uptake Studies. It consists of three elements: the detector with its collimator, a blind measurement module and the application software. The measurement module communicates trough a RS-232 serial interface to the Personal Computer where the application software (DETEC ) resides. The software was designed according to the principles of Object oriented programming using C++ language. It automatically fixes spectrometric measurement parameters and besides patient measurement also performs statistical analysis of a batch of samples. It possesses a PARADOX database with all information of measured patients and an 'on line' help with the system options

  5. Evaluation of Iodine Bioavailability in Seaweed Using in Vitro Methods. (United States)

    Domínguez-González, M Raquel; Chiocchetti, Gabriela M; Herbello-Hermelo, Paloma; Vélez, Dinoraz; Devesa, Vicenta; Bermejo-Barrera, Pilar


    Due to the high levels of iodine present in seaweed, the ingestion of a large amount of this type of food can produce excessive intake of iodine. However, the food after ingestion undergoes different chemistry and physical processes that can modify the amount of iodine that reaches the systemic circulation (bioavailability). Studies on the bioavailability of iodine from food are scarce and indicate that the bioavailable amount is generally lower than ingested. Iodine in vitro bioavailability estimation from different commercialized seaweed has been studied using different in vitro approaches (solubility, dialyzability, and transport and uptake by intestinal cells). Results indicate that iodine is available after gastrointestinal digestion for absorption (bioaccessibility: 49-82%), kombu being the seaweed with the highest bioaccessibility. The incorporation of dialysis cell cultures to elucidate bioavailability modifies the estimation of the amount of iodine that may reach the systemic circulation (dialysis, 5-28%; cell culture, ≤3%). The paper discusses advantages and drawbacks of these methodologies for iodine bioavailability in seaweed.

  6. Prevalence of iodine deficiency among school children and access ...

    African Journals Online (AJOL)

    Prevalence of iodine deficiency among school children and access to iodized salt in Zambia. ... African Journal of Food, Agriculture, Nutrition and Development ... It was carried out in 2011 and entailed determining the urinary iodine concentration (UIC) among 1, 283 school children from 30 selected schools and the amount ...

  7. Determination of iodine to compliment mass spectrometric measurements

    International Nuclear Information System (INIS)

    Hohorst, F.A.


    The dose of iodine-129 to facility personnel and the general public as a result of past, present, and future activities at DOE sites is of continuing interest, WINCO received about 160 samples annually in a variety of natural matrices, including snow, milk, thyroid tissue, and sagebrush, in which iodine-129 is determined in order to evaluate this dose, Currently, total iodine and the isotopic ratio of iodine-127 to iodine-129 are determined by mass spectrometry. These two measurements determine the concentration of iodine-129 in each sample, These measurements require at least 16 h of mass spectrometer operator time for each sample. A variety of methods are available which concentrate and determine small quantities of iodine. Although useful, these approaches would increase both time and cost. The objective of this effort was to determine total iodine by an alternative method in order to decrease the load on mass spectrometry by 25 to 50%. The preparation of each sample for mass spectrometric analysis involves a common step--collection of iodide on an ion exchange bed. This was the focal point of the effort since the results would be applicable to all samples

  8. Reaction of iodine oxidation by potassium permanganate in tributyl phosphate

    International Nuclear Information System (INIS)

    Khokhlov, M.L.; Legin, E.K.


    Stoichiometry was determined and kinetics of iodine oxidation by potassium permanganate in tributylphosphate was studied. Kinetic scheme, which agrees with stoichiometry and experimental kinetic equation of the reaction, is suggested. A mixture is the reaction product. It is ascertained that when the mixture is heated, thermal decomposition of iodate to iodide occurs without elementary iodine separation, which is catalyzed by polymanganate

  9. [Electrochemical methods of control of iodine contents in drinks]. (United States)

    Zakharova, E A; Slepchenko, G B; Kolpakova, E Iu


    The simple and express methods of determination of iodide ions (0.01-0.20 mg/decimeter3) in iodine-enriched drinks by potentiometry and inversion voltamperometry were developed. The studies on influencing a storage time hermetically packaged carbonated beverages, a storage time of the depressurized drinks, stuff of ware on the contents of iodine in drinks are held.

  10. Co-60 gamma radiation assisted diffusion of iodine in polypropylene

    Energy Technology Data Exchange (ETDEWEB)

    Mathakari, N.L.; Bhoraskar, V.N. [Microtron Accelerator Laboratory, Department of Physics, University of Pune, Pune, Maharashtra 411007 (India); Dhole, S.D., E-mail: sanjay@physics.unipune.ernet.i [Microtron Accelerator Laboratory, Department of Physics, University of Pune, Pune, Maharashtra 411007 (India)


    Thin films of polypropylene having dimensions 50 mm x 15 mm x 350 {mu}m were immersed in 1 N iodine solution and then irradiated with Co-60 gamma radiation for the periods of 48, 96 and 144 h at the doses varying from 14.4 to 43.2 kGy. The films were also kept immersed in iodine solution for similar periods but without irradiation. Furthermore, the films were also directly-irradiated with Co-60 gamma radiation for similar periods and doses. The radiation-iodinated, plain-iodinated and directly-irradiated samples were characterized by using various techniques such as weight gain EDS, SEM, FTIR, UV-visible spectroscopy, contact angle and XRD. Weight gain, EDS and SEM collectively reveal that gamma irradiation enhances iodine intake in polypropylene. FTIR, EDS and contact angle measurements indicate that presence of iodine during irradiation resists radiation induced carbonylation of polypropylene. FTIR also shows presence of HOI (Hypoiodous acid) species instead of expected C-I bonds. UV-visible analysis unambiguously shows that presence of iodine enhances radiation induced band gap reduction process of polypropylene. XRD indicates that iodine decreases the crystallinity of polypropylene.

  11. Iodine Status and Goiter Prevalence in Nizhegorodsky Region

    Directory of Open Access Journals (Sweden)

    Yu I Tarasov


    Full Text Available The undertaken study was to evaluate the severity of iodine deficiency and to establish the prevalence of goiter in the city of Nizhny Novgorod and in 35 districts of Nizhegorodsky region. 1868 children aged 8—11 years were examined. The median of urinary iodine concentration was measured, and the size of the thyroid was determined by palpation and by ultrasound study. Among all the examinees, the detection rate of the goiter was 19.4% (as evidenced by palpation and the median of urinary iodine concentration was 45.05 μg/l. The findings indicate natural iodine deficiency on the whole territory studied with severity variations from mild to moderate, and the disparity in goiter rate and iodine excretion level in some districts of Nizhegorodsky region. Cluster analysis and automatic classification of the districts based on goiter prevalence and urinary iodine parameters may be useful for a comprehensive assessment of iodine status in the whole region. Analyzing the pattern of the spread of goiter has demonstrated the role of geochemical, social and medical factors existing in the region. Key words: iodine deficiency, goiter, population based stady, thyroid.

  12. Iodine deficiency, thyroid function and hearing deficit: a review

    NARCIS (Netherlands)

    Boonstra, A.; MacKenzie, I.


    Iodine deficiency affects an estimated 241 million school-aged children in the world. Little is known about iodine deficiency in relation to auditory function, except for the fact that deaf-mutism is one of the features of cretinism. In the present review, we documented the scientific knowledge on

  13. Thyroid Function among Breastfed Children with Chronically Excessive Iodine Intakes

    Directory of Open Access Journals (Sweden)

    Inger Aakre


    Full Text Available Iodine excess may impair thyroid function and trigger adverse health consequences for children. This study aims to describe iodine status among breastfed infants with high iodine exposure in the Saharawi refugee camps Algeria, and further assess thyroid function and iodine status among the children three years later. In 2010, a cross-sectional study among 111 breastfed children aged 0–6 months was performed (baseline study. In 2013, a second cross-sectional study (follow-up study was conducted among 289 children; 213 newly selected and 76 children retrieved from baseline. Urinary iodine concentration (UIC and breast milk iodine concentration (BMIC were measured at baseline. UIC, thyroid hormones and serum thyroglobulin (Tg were measured at follow-up. At baseline and follow-up, 88% and 72% had excessive iodine intakes (UIC ≥ 300 µg/L, respectively. At follow-up, 24% had a thyroid hormone disturbance and/or elevated serum Tg, including 9% with subclinical hypothyroidism (SCH, 4% with elevated fT3 and 14% with elevated Tg. Children with SCH had poorer linear growth and were more likely to be underweight than the children without SCH. Excessive iodine intakes and thyroid disturbances were common among children below four years of age in our study. Further, SCH seemed to be associated with poor growth and weight.

  14. Assessment of Dietary Supplement from Iodine by Milk Intake

    International Nuclear Information System (INIS)

    Labib, A.A.; Labib, A.A.; Challan, B.M.; Challan, B.M.


    Low level concentration of iodine was determined in various milk products for adult and baby milk powders by Inductively Coupled Plasma Mass Spectrometry (ICP-MS) method. It is a reliable method for the determination of iodine in milk samples, using alkaline digestion with potassium hydroxide KOH solution in an oven. After digestion, a stabilizer is added and the solution is taken to volume , then filtered and analysed by ICP-MS either directly or after dilution. Samples for investigation were collected from domestic market of Egypt. The detection limits of current Iodine are not affected by interfering from milk gradient. The minimum detection limit (MDL) of about 10 ppb Iodine was achieved. This method showed excellent results for aqueous iodide solutions, although the complex milk digest matrix made the method unsuitable for such samples. So, investigation of the iodine species is achieved through the oxidation and extraction of iodine milk sample s, the digest ion was carried out to control the iodine chemistry. Iodine concentrations ranged from 0.1 7 to 5 .1 mg / kg for various samples , The accuracy of the method ranged from 95 to 100%

  15. The iodine reactivity; La reactivite de l'iode

    Energy Technology Data Exchange (ETDEWEB)



    The iodine is an important element because it has long life isotopes (such as iodine 129) and a great mobility in natural media. Iodine presents a complex chemistry because of its volatility and its strong redox reactivity. The S.E.C.R. works to better understand the reactivity of this element in different natural, industrial or biological environments. It plays a part in thermochemical sites as a possible way of hydrogen formation. This seminar gives some aspects relative to the chemical reactivity of iodine, since its thermochemistry in the I/S cycles to produce hydrogen to its reactivity in the natural medium and its potential radiological impact. This document includes 4 presentations transparencies dealing with: the {sup 129}I cycle rejected in the low radioactive gaseous and liquid effluents of the La Hague reprocessing plant (C. Frechou); a bibliographic review of iodine retention in soils (F. Bazer-Bachi); the hydrogen production and the iodine/sulfur thermochemical cycle (role of iodine in the process); and the direct characterization by electro-spray ionization mass spectroscopy of iodine fixation by fulvic acids (P. Reiller, B. Amekraz, C. Moulin, V. Moulin)

  16. Iodine, a Mild Reagent for the Aromatization of Terpenoids. (United States)

    Domingo, Victoriano; Prieto, Consuelo; Silva, Lucia; Rodilla, Jesús M L; Quílez del Moral, José F; Barrero, Alejandro F


    Efficient procedures based on the use of iodine for the aromatization of a series of terpenoids possessing diene and homoallylic or allylic alcohol functionalities are described. Different examples are reported as a proof-of-concept study. Furthermore, iodine also proved to mediate the dehydrogenation of testosterone.

  17. Treatment of hyperthyroidism: who's afraid of radioactive iodine?

    International Nuclear Information System (INIS)

    Doorenbos, H.


    Discussed is the fact that treatment of hyperthyroidism with radioactive iodine is not often used although comparative studies show that radioactive iodine gives the best results compared with drugs or surgery. Argued is that the government besides legal radiation safety regulations, hospital planning and cost control, should reconsider the interest of the individual patient. (Auth.)

  18. [Study on the iodine nutrition and iodine deficiency disorders status in pasturing areas of Tibet-a non-epidemic area of iodine deficiency disorders in serious iodine deficiency district]. (United States)

    DU, Dan; Li, Su-Mei; Li, Xiu-Wei; Wang, Hai-Yan; Li, Shu-Hua; Nima, Cangjue; Danzeng, Sangbu; Zhuang, Guang-Xiu


    To explore the status of iodine nutrition and iodine deficiency disorders in the pasturing areas and agricultural regions in Tibet. 30 families were selected respectively in pastoral Dangxiong county and agricultural Qushui county of Lasa. Drinking water and edible salt were collected for testing the iodine contents. In each type of the following populations including children aged 8 - 10, women of child-bearing age and male adults, 50 subjects were randomly sampled to examine their urinary iodine contents. Among them, 50 children and 50 women were randomly selected for goiter examination by palpation. Water iodine content was less than 2 µg/L, both in pasturing area and in agricultural areas. There was no iodized salt used in the families of pasturing areas, while 90% people consumed iodized salt in agricultural areas. The median of urinary iodine in pasturing area was 50.2 µg/L, significantly lower than that of agricultural area (193.2 µg/L). However, the goiter rate of children and women in pasturing area was significantly lower than that in agricultural area. Although iodine intake of populations in pasturing area of Tibet was severely deficient, there was no epidemic of Iodine Deficiency Disorders. This phenomenon noticed by the researchers deserved further investigation.

  19. Iodine-129 separation and determination by neutron activation analysis

    International Nuclear Information System (INIS)

    Bate, L.C.; Stokely, J.R.


    This paper describes a method for analysis of iodine-129 in fission product mixtures originating from fuel reprocessing studies and low-level wastes. The method utilizes conventional iodine valence adjustment and solvent extraction techniques to chemically separate iodine-129 from most fission products. The iodine-129 is determined by neutron irradiation and measurement of the 12.4 hour iodine-130 produced by the neutron capture reaction. Special techniques were devised for neutron irradiation of iodine-129 samples in the pneumatic tube irradiation facilities at the High Flux Isotope (HFIR) and Oak Ridge Research (ORR) Reactors. Chemically separated iodine-129 is adsorbed on an anion exchange resin column made from an irradiation container. The loaded resin is then irradiated in either of the pneumatic facilities to produce iodine-130. Sensitivity of the analysis with the HFIR facility (flux: 5x10 14 n/cm 2 /s) and a 100 second irradiation time is approximately 0.03 nanograms. Samples up to 250 ml in volume can be easily processed. (author)

  20. Radiolytical oxidation of gaseous iodine by beta radiation

    International Nuclear Information System (INIS)

    Kaerkelae, Teemu; Auvinen, Ari; Kekki, Tommi; Kotiluoto, Petri; Lyyraenen, Jussi; Jokiniemi, Jorma


    Iodine is one of the most radiotoxic fission product released from fuel during a severe nuclear power plant accident. Within the containment building, iodine compounds can react e.g. on the painted surfaces and form gaseous organic iodides. In this study, it was found out that gaseous methyl iodide (CH 3 I) is oxidised when exposed to beta radiation in an oxygen containing atmosphere. As a result, nucleation of aerosol particles takes place and the formation of iodine oxide particles is suggested. These particles are highly hygroscopic. They take up water from the air humidity and iodine oxides dissolve within the droplets. In order to mitigate the possible source term, it is of interest to understand the effect of beta radiation on the speciation of iodine.

  1. Radiolytical oxidation of gaseous iodine by beta radiation

    Energy Technology Data Exchange (ETDEWEB)

    Kaerkelae, Teemu; Auvinen, Ari; Kekki, Tommi; Kotiluoto, Petri; Lyyraenen, Jussi [VTT Technical Research Centre of Finland, Espoo (Finland); Jokiniemi, Jorma [VTT Technical Research Centre of Finland, Espoo (Finland); Eastern Finland Univ., Kuopio (Finland)


    Iodine is one of the most radiotoxic fission product released from fuel during a severe nuclear power plant accident. Within the containment building, iodine compounds can react e.g. on the painted surfaces and form gaseous organic iodides. In this study, it was found out that gaseous methyl iodide (CH{sub 3}I) is oxidised when exposed to beta radiation in an oxygen containing atmosphere. As a result, nucleation of aerosol particles takes place and the formation of iodine oxide particles is suggested. These particles are highly hygroscopic. They take up water from the air humidity and iodine oxides dissolve within the droplets. In order to mitigate the possible source term, it is of interest to understand the effect of beta radiation on the speciation of iodine.

  2. Iodine behaviour in PWR accidents leading to severe core damage

    International Nuclear Information System (INIS)

    Lucas, M.; Devillers, C.; Fermandjian, J.; Manesse, D.


    This paper deals with the iodine partition coefficient between the water at the bottom of the reactor building and the atmosphere above it. Molecular iodine is considered as a potential contributor to the airborne activity inside the reactor building. The concentration of molecular iodine in the containment atmosphere will depend, on one hand, upon mechanisms which generate that species and, on the other hand, upon the kinetics of chemical reactions which consume that species. Experiments have therefore been performed on the two following items: - molecular iodine formation through ν radiation from cesium iodide aerosols (droplets) in the reactor containment building, for doses ranging between 1.2 and 8 MRad (12 and 80 kSv), with solutions of various pH's and at different temperatures, - rate of hypoiodous acid disproportionation into iodate and iodide influencing further behavior of molecular iodine

  3. Iodine in different food articles and standard reference materials

    International Nuclear Information System (INIS)

    Dermelj, M.; Slejkovec, Z.; Byrne, A.R.; Stegnar, P.; Stibilj, V.; Rossbach, M.


    The greater part of essential iodine enters living organisms via the food chain. Nevertheless, quantitative data on its concentration in diets, food articles and also in available SRMs are very poor and scarce. This and WHO recommendations on daily allowances of iodine for man via food articles caused an added demand for accurate and reliable determination of iodine in these samples. From this point of view the purpose of the present was to analyse and to establish the concentration levels of total iodine in some food articles, diets, SRMs and candidate reference materials by the use of rapid radiochemical separation, developed in our laboratory. The results were checked by the analysis of SRMs with available certified values for iodine and good agreement is evident. (orig.)

  4. Solar-simulator-pumped atomic iodine laser kinetics (United States)

    Wilson, H. W.; Raju, S.; Shiu, Y. J.


    The literature contains broad ranges of disagreement in kinetic data for the atomic iodine laser. A kinetic model of a solar-simulator-pumped iodine laser is used to select those kinetic data consistent with recent laser experiments at the Langley Research Center. Analysis of the solar-simulator-pumped laser experiments resulted in the following estimates of rate coefficients: for alkyl radical (n-C3F7) and atomic iodine (I) recombination, 4.3 x 10 to the 11th power (1.9) + or - cu cm/s; for n-C3F7I stabilized atomic iodine recombination (I + I) 3.7 x 10 to the -32nd power (2.3) + or -1 cm to the 6th power/s; and for molecular iodine (I2) quenching, 3.1 x 10 to the -11th power (1.6) + or - 1 cu cm/s. These rates are consistent with the recent measurements.

  5. Pressurized water reactor iodine spiking behavior under power transient conditions

    International Nuclear Information System (INIS)

    Ho, J.C.


    The most accepted theory explaining the cause of pressurized water reactor iodine spiking is steam formation and condensation in damaged fuel rods. The phase transformation of the primary coolant from water to steam and back again is believed to cause the iodine spiking phenomenon. But due to the complex nature of the phenomenon, a comprehensive model of the behavior has not yet been successfully developed. This paper presents a new model based on an empirical approach, which gives a first-order estimation of the peak iodine spiking magnitude. Based on the proposed iodine spiking model, it is apparent that it is feasible to derive a correlation using the plant operating data base to monitor and control the peak iodine spiking magnitude

  6. Modelling iodine behaviour using LIRIC 3.0

    Energy Technology Data Exchange (ETDEWEB)

    Wren, J C; Glowa, G A; Ball, J M [Atomic Energy of Canada Ltd., Pinawa, MB (Canada). Whiteshell Labs.


    The overall objective of the iodine chemistry research program at the Whiteshell Laboratories of AECL is to develop and validate the LIRIC (Library of Iodine Reactions In Containment) model. The model, once validated, is intended as either a stand-alone analytical tool or for incorporation into a code for licensing analyses of fission-product behaviour in containment. LIRIC is currently being used to assess the role and importance of individual phenomena on iodine volatility under reactor accident conditions and, thus, help to establish priorities within the iodine research program. The LIRIC model has undergone significant alterations since it was last reported (LIRIC 2.0), mainly as a result of considerable development in understanding of iodine behaviour over the last few years. The new version, LIRIC 3.0, has been used to simulate various results from the Radioiodine Test Facility (RTF) with reasonable success, although under somewhat limited conditions.

  7. Radiation protection in nuclear emergencies, including thyroid blockage with iodine

    International Nuclear Information System (INIS)

    Niklas, K.


    The Government of the Federal Republic of Germany has set emergency reference levels of radiation doses at which countermeasures such as sheltering, evacuation, iodine prophylaxis and resettlement should be considered in case of severe accidents in nuclear installations. Emergency facilities are to be set up for a range of meausres to protect the public, such as assessment of contamination and subsequent decontamination. Recommendations as to further therapeutic measures will be made by medical personnel. The administration of stable iodine can block or reduce the accumulation of radioiodine in the thyroid gland. Stable potassium iodine tablets (100 mg each) will be distributed by the local authorities. Since iodine deficiency is still prevalent in large parts of the Federal Republic of Germany, iodine prophylaxis will be recommended only when relatively high radiation doses to the thyroid gland are to be expected. Resettlement of the population must be considered if an excessive dose is expected in the affected area over a long period. (orig.) [de

  8. Anaphylactic reaction to iodinated contrast media. Review the relevant loterature

    International Nuclear Information System (INIS)

    Kuwashima, Shigeko; Kitajima, Kazuhiro; Kohno, Tatsuo; Kaji, Yasushi; Takahashi, Tetuya; Seki, Masaya; Sakamoto, Tomoyuki


    Recently, iodinated contrast media are necessary for CT examinations and they occupy an important position in the radiological diagnosis. Nonionic contrast media significantly reduce the prevalence of all degree of adverse reaction to contrast media rather than ionic contrast media. So, generally, iodinated contrast media are safe and widely used, but adverse reaction after intravenous iodinated contrast media are not uncommon. Severe and potentially life-threatening reaction occur by using the iodinated contrast media practically. Patients at risk must be identified before the contrast media study, and all possible measures must be taken to deal effectively with spontaneous anaphylactic reactions. We report three cases of anaphylactic reactions by iodinated contrast media on CT. (author)

  9. The study of iodine in Chinese total diets

    International Nuclear Information System (INIS)

    Hou, Xiaolin; Chai, Chifang; Qian, Qinfang; Liu, Guodong; Zhang, Yongbao; Wang, Ke


    In this work, China was divided into four area groups according to their geographical positions and dietary habits. All foods were divided into 12 types and the iodine contents in various diets were determined using epithermal neutron activation analysis (NAA). The intakes for China were evaluated. The results indicate that the intakes of iodine in northern areas are slightly higher and in south areas lower than the lowest recommended intake, and the average intake in China is 166 μg/person per day, which is within the recommended range. In addition, one province was chosen from each area groups. The dietary intakes of iodine were investigated in different ages and sex using total mixed diet method. Our results indicate that the average iodine intake of four provinces was lower than the recommended value, which suggests that it is necessary to supplement iodine in foods in China

  10. Method for solidification of radioactive iodine-containing solid wastes

    International Nuclear Information System (INIS)

    Ozawa, Yoshihiro; Funabashi, Kiyomi; Uetake, Naoto.


    Purpose: To process radioactive iodine containing solid wastes as non-leaching solidified wastes with no risk of iodine release. Method: It has been known for the thermal stability of CuI, PbI 2 or adsorbents containing the same that they do not release iodine in an inert gas atmosphere or in a reducing atmosphere at a temperature lower than 480 deg C. In view of the above, adsorbents containing iodine in the chemical form of CuI or PbI 2 , or CuI or powdery PbI 2 per se are sealed and solidified into low melting glass at a temperature of lower than 480 deg C at which no iodine release occurs in a non-oxidative atmosphere. Since the products are vitrified wastes, they scarcely show leaching property and are excellent in durability and stability. (Takahashi, M.)

  11. Low Urinary Iodine Concentration among Mothers and Children in Cambodia. (United States)

    Laillou, Arnaud; Sophonneary, Prak; Kuong, Khov; Hong, Rathavuth; Un, Samoeurn; Chamnan, Chhoun; Poirot, Etienne; Berger, Jacques; Wieringa, Frank


    A 2014 national assessment of salt iodization coverage in Cambodia found that 62% of samples were non-iodized, suggesting a significant decline in daily iodine intakes. The Cambodian Micronutrient Survey conducted in 2014 (CMNS-2014) permitted obtaining national data on urinary iodine concentrations (UIC) to assess iodine status and whether iodized salt use had an impact. Urine samples were collected from mothers (n = 736) and children (n = 950). The median UIC was 63 µg/L and 72 µg/L in mothers and children respectively. More than 60% of mothers and their children had a UIC Cambodia. It is essential for the government to enhance enforcement of the iodized salt legislation, and implement short term strategies, such as iodine supplementation, to prevent an increase of severe complications due to iodine deficiency in the Cambodian population.

  12. Suboptimal Iodine Status among Pregnant Women in the Oslo Area, Norway. (United States)

    Henjum, Sigrun; Aakre, Inger; Lilleengen, Anne Marie; Garnweidner-Holme, Lisa; Borthne, Sandra; Pajalic, Zada; Blix, Ellen; Gjengedal, Elin Lovise Folven; Brantsæter, Anne Lise


    Norway has been considered iodine replete for decades; however, recent studies indicate reemergence of inadequate iodine status in different population groups. We assessed iodine status in pregnant women based on urinary iodine concentration (UIC), urinary iodine excretion (UIE), and iodine intake from food and supplements. In 804 pregnant women, 24-h iodine intakes from iodine-rich foods and iodine-containing supplements were calculated. In 777 women, iodine concentration was measured in spot urine samples by inductively coupled plasma/mass spectrometry (ICP-MS). In addition, 49 of the women collected a 24-h urine sample for assessment of UIE and iodine intake from food frequency questionnaire (FFQ). Median UIC was 92 µg/L. Fifty-five percent had a calculated iodine intake below estimated average requirement (EAR) (160 µg/day). Iodine intake from food alone did not provide the amount of iodine required to meet maternal and fetal needs during pregnancy. In multiple regression models, hypothyroidism, supplemental iodine and maternal age were positively associated with UIC, while gestational age and smoking were negatively associated, explaining 11% of the variance. This study clearly shows that pregnant women in the Oslo area are mild to moderate iodine deficient and public health strategies are needed to improve and secure adequate iodine status.

  13. Primary circuit iodine model addition to IMPAIR-3

    Energy Technology Data Exchange (ETDEWEB)

    Osetek, D J; Louie, D L.Y. [Los Alamos Technical Associates, Inc., Albuquerque, NM (United States); Guntay, S; Cripps, R [Paul Scherrer Inst. (PSI), Villigen (Switzerland)


    As part of a continuing effort to provide the U.S. Department of Energy (DOE) Advanced Reactor Severe Accident Program (ARSAP) with complete iodine analysis capability, a task was undertaken to expand the modeling of IMPAIR-3, an iodine chemistry code. The expanded code will enable the DOE to include detailed iodine behavior in the assessment of severe accident source terms used in the licensing of U.S. Advanced Light Water Reactors (ALWRs). IMPAIR-3 was developed at the Paul Scherrer Institute (PSI), Switzerland, and has been used by ARSAP for the past two years to analyze containment iodine chemistry for ALWR source term analyses. IMPAIR-3 is primarily a containment code but the iodine chemistry inside the primary circuit (the Reactor Coolant System or RCS) may influence the iodine species released into the the containment; therefore, a RCS iodine chemistry model must be implemented in IMPAIR-3 to ensure thorough source term analysis. The ARSAP source term team and the PSI IMPAIR-3 developers are working together to accomplish this task. This cooperation is divided into two phases. Phase I, taking place in 1996, involves developing a stand-alone RCS iodine chemistry program called IMPRCS (IMPAIR -Reactor Coolant System). This program models a number of the chemical and physical processes of iodine that are thought to be important at conditions of high temperature and pressure in the RCS. In Phase II, which is tentatively scheduled for 1997, IMPRCS will be implemented as a subroutine in IMPAIR-3. To ensure an efficient calculation, an interface/tracking system will be developed to control the use of the RCS model from the containment model. These two models will be interfaced in such a way that once the iodine is released from the RCS, it will no longer be tracked by the RCS model but will be tracked by the containment model. All RCS thermal-hydraulic parameters will be provided by other codes. (author) figs., tabs., refs.

  14. Iodine intake in human nutrition: a systematic literature review

    Directory of Open Access Journals (Sweden)

    Ingibjörg Gunnarsdottir


    Full Text Available The present literature review is a part of the NNR5 project with the aim of reviewing and updating the scientific basis of the 4th edition of the Nordic Nutrition Recommendations (NNR issued in 2004. The main objective of the review is to assess the influence of different intakes of iodine at different life stages (infants, children, adolescents, adults, elderly, and during pregnancy and lactation in order to estimate the requirement for adequate growth, development, and maintenance of health. The literature search resulted in 1,504 abstracts. Out of those, 168 papers were identified as potentially relevant. Full paper selection resulted in 40 papers that were quality assessed (A, B, or C. The grade of evidence was classified as convincing, probable, suggestive, and no conclusion. We found suggestive evidence for improved maternal iodine status and thyroid function by iodine supplementation during pregnancy. Suggestive evidence was found for the relationship between improved thyroid function (used as an indicator of iodine status during pregnancy and cognitive function in the offspring up to 18 months of age. Moderately to severely iodine-deficient children will probably benefit from iodine supplementation or improved iodine status in order to improve their cognitive function, while only one study showed improved cognitive function following iodine supplementation in children from a mildly iodine-deficient area (no conclusion. No conclusions can be drawn related to other outcomes included in our review. There are no new data supporting changes in dietary reference values for children or adults. The rationale for increasing the dietary reference values for pregnant and lactating women in the NNR5 needs to be discussed in a broader perspective, taking iodine status of pregnant women in the Nordic countries into account.

  15. Revisiting History: Encountering Iodine Then and Now--A General Chemistry Laboratory to Observe Iodine from Seaweed (United States)

    Wahab, M. Farooq


    The history of the discovery of iodine is retold using brown-colored seaweed found commonly along the ocean shore. The seaweed is ashed at a low temperature and the iodides are extracted into boiling water. The iodides are oxidized in acidic medium. Solvent extraction of iodine by oxidation of iodides as well as simple aqueous extraction of iodide…

  16. Source of Iodine-131 in Europe Identified

    International Nuclear Information System (INIS)


    Full text: The IAEA has received information from the Hungarian Atomic Energy Authority (HAEA) that the source of the iodine-131 (I-131) detected in Europe was most probably a release to the atmosphere from the Institute of Isotopes Ltd., Budapest. The Institute of Isotopes Ltd. produces radioisotopes for healthcare, research and industrial applications. According to the HAEA, the release occurred from September 8 to November 16, 2011. The cause of the release is under investigation. As previously mentioned, the levels of I-131 that have been detected in Europe are extremely low. There is no health concern to the population. If any member of the public were to breathe iodine for a whole year at the levels measured in European countries, then they would receive a dose in the range of 0.01 microsieverts for the year. To put this into perspective, the average annual background is 2 400 microsieverts per year. The IAEA was first notified of the presence of trace levels of I-131 by authorities from the Czech Republic on 11 November. Since this notification, the IAEA contacted several member states throughout the region to determine the cause and origin. The IAEA also worked with the World Meteorological Organization (WMO) to conduct air dispersion modelling, as part of efforts to determine the source. (IAEA)

  17. Tracing the Iodine-129 fallout in Argentina

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez Niello, Jorge; Negri, Agustin; Arazi, Andres [Comision Nacional de Energia Atomica (CNEA), Buenos Aires (Argentina). Lab. TANDAR; Wallner, Anton [The Australian National University, Canberra (Australia). Dept. of Nuclear Physics; Niello, Jorge Fernandez [Universidad Nacional de San Martin, Campus Miguelete, Buenos Aires (Argentina)


    Full text: Long-lived {sup 129}I (half-life=15.6 Ma) is produced naturally by irradiation of atmospheric xenon by cosmic neutrons and in the sub-surface by spontaneous fission of {sup 238}U, from which the natural inventory of {sup 129}I has been estimated to be around 50,000 kg, only 140 kg of them corresponds to the hydrospheric inventory. Nuclear tests and accidents have added between 45-130 kg. Apart from a global atmospheric fallout component, {sup 129}I has been released from several nuclear fuel reprocessing plants located in the Northern Hemisphere (ca. 6000 kg) which serve as localized sources in oceanographic-tracer experiments. In this presentation, we report results from a study exploring the presence of {sup 129}I in the Southern Hemisphere by determining {sup 129}I/{sup 127}I isotopic ratios in water samples (rivers, lakes and shallow sea-water) taken at different latitudes in Argentina including Antarctica. The iodine-127 and iodine-129 concentrations were measured via ICP-MS (Inductively Coupled Plasma Mass Spectrometry) and Accelerator Mass Spectrometry (AMS), respectively. Distribution of both isotopes can be understood considering tropospheric circulation patterns, possible sources and regional precipitation patterns. Natural and anthropogenic sources for the Southern Hemisphere and their inventories are discussed. Similar contribution came from natural sources and nuclear tests. Contribution from the nuclear fuel reprocessing plants placed in the Northern hemisphere can be neglected. (author)

  18. Iodine waste form summary report (FY 2007)

    International Nuclear Information System (INIS)

    Krumhansl, James Lee; Nenoff, Tina Maria; McMahon, Kevin A.; Gao, Huizhen; Rajan, Ashwath Natech


    This new program at Sandia is focused on Iodine waste form development for GNEP cycle needs. Our research has a general theme of 'Waste Forms by Design' in which we are focused on silver loaded zeolite waste forms and related metal loaded zeolites that can be validated for chosen GNEP cycle designs. With that theme, we are interested in materials flexibility for iodine feed stream and sequestration material (in a sense, the ability to develop a universal material independent on the waste stream composition). We also are designing the flexibility to work in a variety of repository or storage scenarios. This is possible by studying the structure/property relationship of existing waste forms and optimizing them to our current needs. Furthermore, by understanding the properties of the waste and the storage forms we may be able to predict their long-term behavior and stability. Finally, we are working collaboratively with the Waste Form Development Campaign to ensure materials durability and stability testing

  19. Heterogeneous equilibrium in mplybdenum-iodine system

    International Nuclear Information System (INIS)

    Klinkova, L.A.


    Heterogeneous equilibrium in the Mo-J system is studied to reveal regions of existence of molybdenum iodides, is studied. The investigation is performed for atomic ratio I/Mo=0.02-7.5 in the temperature range of 300-1370 K using methods of thermographic, X-ray phase, chemical and optical analyses of phases quenched after isothermal annealing. It is shown that higher molybdenum iodides (Mo1 4 , MoJ 5 , MoJ 6 ) are thermally unstable compounds and exist in the Mo-J system at low temperatures (360-490 K). Above 470 K higher iodides dissociate up to molybdenum triiodide. MoJ 3 under the pressure of iodine vapors is stable up to 970 K. Molybdenum diiodide is the product of triiodide decomposition and forms in the Mo-J system in the 700-1270 K range. At the J/Mo>>3 ratio the product of triiodide decomposition is MoJsub(2.87) which is thermally unstable up to 570 K, while in iodine atmosphere - up to 1170 K

  20. MDCT angiography of the pulmonary arteries: intravascular contrast enhancement does not depend on iodine concentration when injecting equal amounts of iodine at standardized iodine delivery rates

    International Nuclear Information System (INIS)

    Keil, S.; Plumhans, C.; Behrendt, F.F.; Das, M.; Muehlenbruch, G.; Mahnken, A.H.; Guenther, R.W.; Stanzel, S.; Seidensticker, P.; Knackstedt, C.; Wildberger, J.E.


    To compare the impact of iodine concentration using two different contrast materials (CM) at standardized iodine delivery rate (IDR) and overall iodine load in 16-multidetector-row-CT-angiography (MDCTA) of the pulmonary arteries of 192 patients with known or suspected pulmonary embolism. One hundred three patients (group A) received 148 ml of a CM containing 300 mg iodine/ml (Ultravist 300 trademark, BayerScheringPharma) at a flow rate of 4.9 ml/s. Eighty-nine patients (group B) received 120 ml of a CM with a concentration of 370 mg iodine/ml (Ultravist370 trademark) at a flow rate of 4.0 ml/s, resulting in a standardized IDR (∝1.5 gI/s) and the same overall amount of iodine (44.4 g). Both CM injections were followed by a saline chaser. Mean density values were determined in the pulmonary trunk, the ascending and the descending aorta, respectively. Applying repeated-measures ANOVA, no statistically significant differences between both MDCTA protocols were found (p=0.5790): the mean density in the pulmonary trunk was 355±116 Hounsfield Units (group A) and 358±115 (group B). The corresponding values for the ascending and descending aorta were 295±79 (group A) and 284±65 (group B) as well as 272±71 and 262±70. In conclusion, the use of standardized IDR and overall iodine load provides comparable intravascular CM density in pulmonary 16-MDCTA for delivering contrast materials with different iodine concentrations. (orig.)