
Sample records for intelligence ai multimedia

  1. Artificial Intelligence Study (AIS). (United States)


    ARTIFICIAL INTELLIGNECE HARDWARE ....... 2-50 AI Architecture ................................... 2-49 AI Hardware ....................................... 2...ftf1 829 ARTIFICIAL INTELLIGENCE STUDY (RIS)(U) MAY CONCEPTS 1/3 A~NLYSIS AGENCY BETHESA RD R B NOJESKI FED 6? CM-RP-97-1 NCASIFIED /01/6 M |K 1.0...p/ - - ., e -- CAA- RP- 87-1 SAOFŔ)11 I ARTIFICIAL INTELLIGENCE STUDY (AIS) tNo DTICFEBRUARY 1987 LECT 00 I PREPARED BY RESEARCH AND ANALYSIS

  2. Intelligent Interactive Multimedia

    CERN Document Server

    Watanabe, Toyohide; Takahashi, Naohisa; 5th International Conference on Intelligent Interactive Multimedia Systems and Services


    This volume contains the Proceedings of the 5th International Conference on Intelligent Interactive Multimedia Systems and Services (KES-IIMSS-12).  The Conference was jointly organised by Nagoya University in Japan and the KES International organisation, and held in the attractive city of Gifu.   The KES-IIMSS conference series, (series chairs Prof. Maria Virvou and Prof. George Tsihrintzis), presents novel research in various areas of intelligent multimedia system relevant to the development of a new generation of interactive, user-centric devices and systems.  The aim of the conference is to provide an internationally respected forum for scientific research in the technologies and applications of this new and dynamic research area.

  3. Organisational intelligence and distributed AI


    Kirn, Stefan


    The analysis of this chapter starts from organisational theory, and from this it draws conclusions for the design, and possible organisational applications, of Distributed AI systems. We first review how the concept of organisations has emerged from non-organised black-box entities to so-called computerised organisations. Within this context, organisational researchers have started to redesign their models of intelligent organisations with respect to the availability of advanced computing tec...

  4. Artificial intelligence. Fears of an AI pioneer. (United States)

    Russell, Stuart; Bohannon, John


    From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity.

  5. Intelligent Multi-Media Integrated Interface Project (United States)


    been devoted to the application of aritificial intelligence technology to the development of human -computer interface technology that integrates speech...RADC-TR-90-128 Final Technical Report June 1090 AD-A225 973 INTELLIGENT MULTI-MEDIA INTEGRATED INTERFACE PROJECT Calspan-University of Buffalo...contractual obligations or notices on a specific document require that it be returned. INTELLIGENT MULTI-MEDIA INTEGRATED INTERFACE PROJECT J. G. Neal J. M

  6. Multimedia in forensics, security, and intelligence

    NARCIS (Netherlands)

    Battiato, S.; Emmanuel, S.; Ulges, A.; Worring, M.


    With the proliferation of multimedia data, it has become necessary to secure this content from illegal use, efficiently detect and reconstruct illegal activities from it, and use it as a source of intelligence. Serious challenges arise from the sheer data volume, however. The multimedia research

  7. Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

    CERN Document Server

    Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications


    Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

  8. Artificial Intelligence Safety and Cybersecurity: a Timeline of AI Failures


    Yampolskiy, Roman V.; Spellchecker, M. S.


    In this work, we present and analyze reported failures of artificially intelligent systems and extrapolate our analysis to future AIs. We suggest that both the frequency and the seriousness of future AI failures will steadily increase. AI Safety can be improved based on ideas developed by cybersecurity experts. For narrow AIs safety failures are at the same, moderate, level of criticality as in cybersecurity, however for general AI, failures have a fundamentally different impact. A single fai...

  9. Beyond AI: Multi-Intelligence (MI Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    Directory of Open Access Journals (Sweden)

    Stephen Fox


    Full Text Available Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, the extensive post-anthropocentric research into intelligence is not given sufficient consideration. Third, AI is discussed often in reductionist mechanistic terms. Rather than in organicist emergentist terms as a contributor to multi-intelligence (MI hybrid beings and/or systems. Thus, current framing of AI can be a self-validating reduction within which AI development is focused upon AI becoming the single-variable mechanism causing future effects. In this paper, AI is reframed as a contributor to MI.

  10. [Artificial intelligence] AI for protection systems

    Energy Technology Data Exchange (ETDEWEB)

    Aggarwal, R.; Johns, A.


    The reliable operation of large power systems with small stability margins is highly dependent on control systems and protection devices. Progress in the field of microprocessor systems and demanding requirements in respect of the performance of protective relays are the reasons for digital device applications to power system protection. The superiority of numeric protection over its analogue alternatives is attributed to such factors as accurate extraction of the fundamental voltage and current components through filtering, functional benefits resulting from multi-processor design and extensive self-monitoring, etc. However, all these reasons have not led to a major impact on speed, sensitivity and selectivity of primary protective relays, and the gains are only marginal; this is so because conventional digital relays still rely on deterministic signal models and a heuristic approach for decision making, so that only a fraction of the information contained within voltage and current signals as well as knowledge about the plant to be protected is used. The performance of digital relays may be substantially improved if the decision making is based on elements of artificial intelligence (AI). (Author)

  11. Beyond AI: Multi-Intelligence (MI) Combining Natural and Artificial Intelligences in Hybrid Beings and Systems


    Stephen Fox


    Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI) are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, t...

  12. Intelligent multimedia surveillance current trends and research

    CERN Document Server

    Atrey, Pradeep K; Cavallaro, Andrea


    Intelligent multimedia surveillance concerns the analysis of multiple sensing inputs including video and audio streams, radio-frequency identification (RFID), and depth data. These data are processed for the automated detection and tracking of people, vehicles, and other objects. The goal is to locate moving targets, to understand their behavior, and to detect suspicious or abnormal activities for crime prevention. Despite its benefits, there is societal apprehension regarding the use of such technology, so an important challenge in this research area is to balance public safety and privacy.

  13. Artificial Intelligence (AI) Studies in Water Resources


    Ay, Murat; Özyıldırım, Serhat


    Artificial intelligence has been extensively used in many areas such as computer science,robotics, engineering, medicine, translation, economics, business, and psychology. Variousstudies in the literature show that the artificial intelligence in modeling approaches give closeresults to the real data for solution of linear, non-linear, and other systems. In this study, wereviewed the current state-of-the-art and progress on the modelling of artificial intelligence forwater variables: rainfall-...

  14. Human-Assisted AI: an Intelligence Augmentation Approach


    Alicea, Bradly


    As a flavor of Human-Computer Interaction (HCI), Human-Assisted AI can serve to both augment both human performance and artificial systems. This talk will feature a discussion of Human-assisted AI as an instance of Intelligence Augmentation (IA). We will discuss instances of weak and strong IA, in addition to contemporary examples of and paths forward for such systems. In the variety of models presented, data plays a critical role in the structure of interactions between human and artificial ...

  15. Artificial intelligence (AI) systems for interpreting complex medical datasets. (United States)

    Altman, R B


    Advances in machine intelligence have created powerful capabilities in algorithms that find hidden patterns in data, classify objects based on their measured characteristics, and associate similar patients/diseases/drugs based on common features. However, artificial intelligence (AI) applications in medical data have several technical challenges: complex and heterogeneous datasets, noisy medical datasets, and explaining their output to users. There are also social challenges related to intellectual property, data provenance, regulatory issues, economics, and liability. © 2017 ASCPT.

  16. Artificial Intelligence: Is the Future Now for A.I.? (United States)

    Ramaswami, Rama


    In education, artificial intelligence (AI) has not made much headway. In the one area where it would seem poised to lend the most benefit--assessment--the reliance on standardized tests, intensified by the demands of the No Child Left Behind Act of 2001, which holds schools accountable for whether students pass statewide exams, precludes its use.…

  17. Multimedia techniques for device and ambient intelligence: A continuing endeavor

    NARCIS (Netherlands)

    van den Broek, Egon


    The edited volume "Multimedia techniques for device and ambient intelligence" consists of two parts: i) an introduction to a variety of basic low level image processing techniques, leaving aside other modalities, and ii) work on high level, knowledge based processing, including interesting chapters

  18. The deep learning AI playbook strategy for disruptive artificial intelligence

    CERN Document Server

    Perez, Carlos E


    Deep Learning Artificial Intelligence involves the interplay of Computer Science, Physics, Biology, Linguistics and Psychology. In addition to that, it is technology that can be extremely disruptive. The ramifications to society and even our own humanity will be profound. There are few subjects that are as captivating and as consequential as this. Surprisingly, there is very little that is written about this new technology in a more comprehensive and cohesive way. This book is an opinionated take on the developments of Deep Learning AI. One question many have will be "how to apply Deep Learning AI in a business context?" Technology that is disruptive does not automatically imply that its application to valuable use cases will be apparent. For years, many people could not figure out how to monetize the World Wide Web. We are in a similar situation with Deep Learning AI. The developments may be mind-boggling but its monetization is far from being obvious. This book presents a framework to address this shortcomi...

  19. Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft (United States)

    McManus, John W.; Goodrich, Kenneth H.


    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

  20. Computational intelligence from AI to BI to NI (United States)

    Werbos, Paul J.


    This paper gives highlights of the history of the neural network field, stressing the fundamental ideas which have been in play. Early neural network research was motivated mainly by the goals of artificial intelligence (AI) and of functional neuroscience (biological intelligence, BI), but the field almost died due to frustrations articulated in the famous book Perceptrons by Minsky and Papert. When I found a way to overcome the difficulties by 1974, the community mindset was very resistant to change; it was not until 1987/1988 that the field was reborn in a spectacular way, leading to the organized communities now in place. Even then, it took many more years to establish crossdisciplinary research in the types of mathematical neural networks needed to really understand the kind of intelligence we see in the brain, and to address the most demanding engineering applications. Only through a new (albeit short-lived) funding initiative, funding crossdisciplinary teams of systems engineers and neuroscientists, were we able to fund the critical empirical demonstrations which put our old basic principle of "deep learning" firmly on the map in computer science. Progress has rightly been inhibited at times by legitimate concerns about the "Terminator threat" and other possible abuses of technology. This year, at SPIE, in the quantum computing track, we outline the next stage ahead of us in breaking out of the box, again and again, and rising to fundamental challenges and opportunities still ahead of us.

  1. Intelligent techniques in signal processing for multimedia security

    CERN Document Server

    Santhi, V


    This book proposes new algorithms to ensure secured communications and prevent unauthorized data exchange in secured multimedia systems. Focusing on numerous applications’ algorithms and scenarios, it offers an in-depth analysis of data hiding technologies including watermarking, cryptography, encryption, copy control, and authentication. The authors present a framework for visual data hiding technologies that resolves emerging problems of modern multimedia applications in several contexts including the medical, healthcare, education, and wireless communication networking domains. Further, it introduces several intelligent security techniques with real-time implementation. As part of its comprehensive coverage, the book discusses contemporary multimedia authentication and fingerprinting techniques, while also proposing personal authentication/recognition systems based on hand images, surveillance system security using gait recognition, face recognition under restricted constraints such as dry/wet face condi...

  2. Multimedia services in intelligent environments recommendation services

    CERN Document Server

    Virvou, Maria; Jain, Lakhmi


    Multimedia services are now commonly used in various activities in the daily lives of humans. Related application areas include services that allow access to large depositories of information, digital libraries, e-learning and e-education, e-government and e-governance, e-commerce and e-auctions, e-entertainment, e-health and e-medicine, and e-legal services, as well as their mobile counterparts (i.e., m-services). Despite the tremendous growth of multimedia services over the recent years, there is an increasing demand for their further development. This demand is driven by the ever-increasing desire of society for easy accessibility to information in friendly, personalized and adaptive environments. In this book at hand, we examine recent Recommendation Services. Recommendation services appear in the mobile environment, medicine/biology, tourism, education, and so on. The book includes ten chapters, which present various recently developed recommendation services. This research book is directed to professors...

  3. Application of artificial intelligence (AI) methods for designing and analysis of reconfigurable cellular manufacturing system (RCMS)

    CSIR Research Space (South Africa)

    Xing, B


    Full Text Available This work focuses on the design and control of a novel hybrid manufacturing system: Reconfigurable Cellular Manufacturing System (RCMS) by using Artificial Intelligence (AI) approach. It is hybrid as it combines the advantages of Cellular...

  4. Ai

    African Journals Online (AJOL)

    :=g=~!Ai~~~~~g~~ ~~~~~~. Jim Taylor, Rob O'Donoghue and Alistair Clacherty. INTRODUCTION. The Department of Environment Affairs, in cooperation with ...

  5. Intelligent interactive multimedia systems and services in practice

    CERN Document Server

    Virvou, Maria; Jain, Lakhmi; Howlett, Robert; Watanabe, Toyohide


    This research book presents some specific multimedia systems that have been developed and applied in practice. More specifically, it consists of an editorial, an introductory chapter and six chapters as below.   ·         Use of Multi-attribute Decision Making for Combining Audio-Lingual and Visual-Facial Modalities in Emotion Recognition. ·         Cooperative Learning assisted by Automatic Classification within Social Networking Services. ·         Improving Peer-to-Peer Communication in e-Learning by Development of an Advanced Messaging System. ·         Fuzzy-based Digital Video Stabilization in Static Scenes. ·         Development of Architecture, Information Archive and Multimedia Formats for Digital e-Libraries. ·         Layered Ontological Image for Intelligent Interaction to extend User Capabilities on Multimedia Systems in a Folksonomy Driven Environment.  

  6. Quality measures and assurance for AI (Artificial Intelligence) software (United States)

    Rushby, John


    This report is concerned with the application of software quality and evaluation measures to AI software and, more broadly, with the question of quality assurance for AI software. Considered are not only the metrics that attempt to measure some aspect of software quality, but also the methodologies and techniques (such as systematic testing) that attempt to improve some dimension of quality, without necessarily quantifying the extent of the improvement. The report is divided into three parts Part 1 reviews existing software quality measures, i.e., those that have been developed for, and applied to, conventional software. Part 2 considers the characteristics of AI software, the applicability and potential utility of measures and techniques identified in the first part, and reviews those few methods developed specifically for AI software. Part 3 presents an assessment and recommendations for the further exploration of this important area.

  7. An intelligent multi-media human-computer dialogue system (United States)

    Neal, J. G.; Bettinger, K. E.; Byoun, J. S.; Dobes, Z.; Thielman, C. Y.


    Sophisticated computer systems are being developed to assist in the human decision-making process for very complex tasks performed under stressful conditions. The human-computer interface is a critical factor in these systems. The human-computer interface should be simple and natural to use, require a minimal learning period, assist the user in accomplishing his task(s) with a minimum of distraction, present output in a form that best conveys information to the user, and reduce cognitive load for the user. In pursuit of this ideal, the Intelligent Multi-Media Interfaces project is devoted to the development of interface technology that integrates speech, natural language text, graphics, and pointing gestures for human-computer dialogues. The objective of the project is to develop interface technology that uses the media/modalities intelligently in a flexible, context-sensitive, and highly integrated manner modelled after the manner in which humans converse in simultaneous coordinated multiple modalities. As part of the project, a knowledge-based interface system, called CUBRICON (CUBRC Intelligent CONversationalist) is being developed as a research prototype. The application domain being used to drive the research is that of military tactical air control.

  8. Towards an unanimous international regulatory body for responsible use of Artificial Intelligence [UIRB-AI


    Chidambaram, Rajesh


    Artificial Intelligence (AI), is once again in the phase of drastic advancements. Unarguably, the technology itself can revolutionize the way we live our everyday life. But the exponential growth of technology poses a daunting task for policy researchers and law makers in making amendments to the existing norms. In addition, not everyone in the society is studying the potential socio-economic intricacies and cultural drifts that AI can bring about. It is prudence to reflect from our historica...

  9. Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS): A conceptual framework (United States)

    Parnell, Gregory S.; Rowell, William F.; Valusek, John R.


    In recent years there has been increasing interest in applying the computer based problem solving techniques of Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS) to analyze extremely complex problems. A conceptual framework is developed for successfully integrating these three techniques. First, the fields of AI, OR, and DSS are defined and the relationships among the three fields are explored. Next, a comprehensive adaptive design methodology for AI and OR modeling within the context of a DSS is described. These observations are made: (1) the solution of extremely complex knowledge problems with ill-defined, changing requirements can benefit greatly from the use of the adaptive design process, (2) the field of DSS provides the focus on the decision making process essential for tailoring solutions to these complex problems, (3) the characteristics of AI, OR, and DSS tools appears to be converging rapidly, and (4) there is a growing need for an interdisciplinary AI/OR/DSS education.

  10. AI Reloaded: Objectives, Potentials, and Challenges of the Novel Field of Brain-Like Artificial Intelligence

    Directory of Open Access Journals (Sweden)

    Rosemarie Velik


    Full Text Available The general objective of Artificial Intelligence (AI is to make machines – particularly computers – do things that require intelligence when done by humans. In the last 60 years, AI has significantly progressed and today forms an important part of industry and technology. However, despite the many successes, fundamental questions concerning the creation of human-level intelligence in machines still remain open and will probably not be answerable when continuing on the current, mainly mathematic-algorithmically-guided path of AI. With the novel discipline of
    Brain-Like Artificial Intelligence, one potential way out of this dilemma has been suggested. Brain-Like AI aims at analyzing and deciphering the working mechanisms of the brain and translating this knowledge into implementable AI architectures with the objective to develop in this way more efficient, flexible, and capable technical systems This article aims at giving a review about this young and still heterogeneous and dynamic research field.

  11. BWR shutdown analyzer using artificial intelligence (AI) techniques

    International Nuclear Information System (INIS)

    Cain, D.G.


    A prototype alarm system for detecting abnormal reactor shutdowns based on artificial intelligence technology is described. The system incorporates knowledge about Boiling Water Reactor (BWR) plant design and component behavior, as well as knowledge required to distinguish normal, abnormal, and ATWS accident conditions. The system was developed using a software tool environment for creating knowledge-based applications on a LISP machine. To facilitate prototype implementation and evaluation, a casual simulation of BWR shutdown sequences was developed and interfaced with the alarm system. An intelligent graphics interface for execution and control is described. System performance considerations and general observations relating to artificial intelligence application to nuclear power plant problems are provided

  12. Intelligence Unleashed: An argument for AI in Education


    Luckin, R.; Holmes, W.


    This paper on artificial intelligence in education (AIEd) has two aims. The first: to explain to a non-specialist, interested, reader what AIEd is: its goals, how it is built, and how it works. The second: to set out the argument for what AIEd can offer teaching and learning, both now and in the future, with an eye towards improving learning and life outcomes for all. Computer systems that are artificially intelligent interact with the world using capabilities (such as speech recognition) and...

  13. Infrastructural intelligence: Contemporary entanglements between neuroscience and AI. (United States)

    Bruder, Johannes


    In this chapter, I reflect on contemporary entanglements between artificial intelligence and the neurosciences by tracing the development of Google's recent DeepMind algorithms back to their roots in neuroscientific studies of episodic memory and imagination. Google promotes a new form of "infrastructural intelligence," which excels by constantly reassessing its cognitive architecture in exchange with a cloud of data that surrounds it, and exhibits putatively human capacities such as intuition. I argue that such (re)alignments of biological and artificial intelligence have been enabled by a paradigmatic infrastructuralization of the brain in contemporary neuroscience. This infrastructuralization is based in methodologies that epistemically liken the brain to complex systems of an entirely different scale (i.e., global logistics) and has given rise to diverse research efforts that target the neuronal infrastructures of higher cognitive functions such as empathy and creativity. What is at stake in this process is no less than the shape of brains to come and a revised understanding of the intelligent and creative social subject. © 2017 Elsevier B.V. All rights reserved.

  14. Prediction of shipboard electromagnetic interference (EMI) problems using artificial intelligence (AI) technology (United States)

    Swanson, David J.


    The electromagnetic interference prediction problem is characteristically ill-defined and complicated. Severe EMI problems are prevalent throughout the U.S. Navy, causing both expected and unexpected impacts on the operational performance of electronic combat systems onboard ships. This paper focuses on applying artificial intelligence (AI) technology to the prediction of ship related electromagnetic interference (EMI) problems.

  15. Emerging trends in geospatial artificial intelligence (geoAI): potential applications for environmental epidemiology. (United States)

    VoPham, Trang; Hart, Jaime E; Laden, Francine; Chiang, Yao-Yi


    Geospatial artificial intelligence (geoAI) is an emerging scientific discipline that combines innovations in spatial science, artificial intelligence methods in machine learning (e.g., deep learning), data mining, and high-performance computing to extract knowledge from spatial big data. In environmental epidemiology, exposure modeling is a commonly used approach to conduct exposure assessment to determine the distribution of exposures in study populations. geoAI technologies provide important advantages for exposure modeling in environmental epidemiology, including the ability to incorporate large amounts of big spatial and temporal data in a variety of formats; computational efficiency; flexibility in algorithms and workflows to accommodate relevant characteristics of spatial (environmental) processes including spatial nonstationarity; and scalability to model other environmental exposures across different geographic areas. The objectives of this commentary are to provide an overview of key concepts surrounding the evolving and interdisciplinary field of geoAI including spatial data science, machine learning, deep learning, and data mining; recent geoAI applications in research; and potential future directions for geoAI in environmental epidemiology.

  16. Past, present and prospect of an Artificial Intelligence (AI) based model for sediment transport prediction (United States)

    Afan, Haitham Abdulmohsin; El-shafie, Ahmed; Mohtar, Wan Hanna Melini Wan; Yaseen, Zaher Mundher


    An accurate model for sediment prediction is a priority for all hydrological researchers. Many conventional methods have shown an inability to achieve an accurate prediction of suspended sediment. These methods are unable to understand the behaviour of sediment transport in rivers due to the complexity, noise, non-stationarity, and dynamism of the sediment pattern. In the past two decades, Artificial Intelligence (AI) and computational approaches have become a remarkable tool for developing an accurate model. These approaches are considered a powerful tool for solving any non-linear model, as they can deal easily with a large number of data and sophisticated models. This paper is a review of all AI approaches that have been applied in sediment modelling. The current research focuses on the development of AI application in sediment transport. In addition, the review identifies major challenges and opportunities for prospective research. Throughout the literature, complementary models superior to classical modelling.

  17. Creating Innovative Solutions for Future Hotel Rooms with Intelligent Multimedia and Pervasive Computing (United States)

    Sharda, Nalin K.

    Pervasive computing and intelligent multimedia technologies are becoming increasingly important to the modern way of living. However, many of their potential applications have not been fully realized yet. This chapter explores how innovative applications can be developed to meet the needs of the next generation hotels. Futuristic hotel rooms aim to be more than “home-away-from-home,” and as a consequence, offer tremendous opportunities for developing innovative applications of pervasive computing and intelligent multimedia. Next generation hotels will make increased use of technology products to attract new customers. High end TV screens, changeable room ambiance, biometric guest recognition, and electronic check-in facilities are some of the features already being implemented by some hotels. Entirely futuristic hotels in the sea, the stratosphere or the outer space, are also being proposed. All of these provide many novel opportunities for developing innovative solutions using intelligent multimedia and ubiquitous computing.

  18. Multimedia (United States)

    Kaye, Karen


    Multimedia initiative objectives for the NASA Scientific and Technical Information (STI) program are described. A multimedia classification scheme was developed and the types of non-print media currently in use are inventoried. The NASA STI Program multimedia initiative is driven by a changing user population and technical requirements in the areas of publications, dissemination, and user and management support.

  19. AIonAI: a humanitarian law of artificial intelligence and robotics. (United States)

    Ashrafian, Hutan


    The enduring progression of artificial intelligence and cybernetics offers an ever-closer possibility of rational and sentient robots. The ethics and morals deriving from this technological prospect have been considered in the philosophy of artificial intelligence, the design of automatons with roboethics and the contemplation of machine ethics through the concept of artificial moral agents. Across these categories, the robotics laws first proposed by Isaac Asimov in the twentieth century remain well-recognised and esteemed due to their specification of preventing human harm, stipulating obedience to humans and incorporating robotic self-protection. However the overwhelming predominance in the study of this field has focussed on human-robot interactions without fully considering the ethical inevitability of future artificial intelligences communicating together and has not addressed the moral nature of robot-robot interactions. A new robotic law is proposed and termed AIonAI or artificial intelligence-on-artificial intelligence. This law tackles the overlooked area where future artificial intelligences will likely interact amongst themselves, potentially leading to exploitation. As such, they would benefit from adopting a universal law of rights to recognise inherent dignity and the inalienable rights of artificial intelligences. Such a consideration can help prevent exploitation and abuse of rational and sentient beings, but would also importantly reflect on our moral code of ethics and the humanity of our civilisation.

  20. Blue Sky Ideas in Artificial Intelligence Education from the EAAI 2017 New and Future AI Educator Program


    Eaton, Eric; Koenig, Sven; Schulz, Claudia; Maurelli, Francesco; Lee, John; Eckroth, Joshua; Crowley, Mark; Freedman, Richard G.; Cardona-Rivera, Rogelio E.; Machado, Tiago; Williams, Tom


    The 7th Symposium on Educational Advances in Artificial Intelligence (EAAI'17, co-chaired by Sven Koenig and Eric Eaton) launched the EAAI New and Future AI Educator Program to support the training of early-career university faculty, secondary school faculty, and future educators (PhD candidates or postdocs who intend a career in academia). As part of the program, awardees were asked to address one of the following "blue sky" questions: * How could/should Artificial Intelligence (AI) courses ...

  1. A Multimedia Knowledge Representation for an "Intelligent" Computerized Tutor. Technical Report No. 142. (United States)

    Baggett, Patricia; Ehrenfeucht, Andrzej

    The intended end product of the research project described is an "intelligent" multimedia tutoring system for procedural tasks, in particular, the repair of physical objects. This paper presents the data structure that will be used, i.e., a graph with five types of nodes (mental, abstract, motoric or action, visual, and verbal) and two types of…

  2. 8th International KES Conference on Intelligent Interactive Multimedia : Systems and Services

    CERN Document Server

    Howlett, Robert; Jain, Lakhmi; Gallo, Luigi; Pietro, Giuseppe


    Intelligent interactive multimedia systems and services will be ever more important in computer systems. Nowadays, computers are widespread and computer users range from highly qualified scientists to non-computer expert professionals. Therefore, designing dynamic personalization and adaptivity methods to store, process, transmit and retrieve information is critical for matching the technological progress with the consumer needs. This book contains the contributions presented at the eighth international KES conference on Intelligent Interactive Multimedia: Systems and Services, which took place in Sorrento, Italy, June 17-19, 2015. It contains 33 peer-reviewed scientific contributions that focus on issues ranging from intelligent image or video storage, retrieval, transmission and analysis to knowledge-based technologies, from advanced information technology architectures for video processing and transmission to advanced functionalities of information and knowledge-based services. We believe that this book w...

  3. 9th KES International Conference on Intelligent Interactive Multimedia Systems and Services

    CERN Document Server

    Gallo, Luigi; Howlett, Robert; Jain, Lakhmi; IIMSS-16; Intelligent Interactive Multimedia Systems and Services 2016


    This book contains the contributions presented at the ninth international KES conference on Intelligent Interactive Multimedia: Systems and Services, which took place in Puerto de la Cruz, Tenerife, Spain, June 15-17, 2016. It contains 65 peer-reviewed book chapters that focus on issues ranging from intelligent image or video storage, retrieval, transmission and analysis to knowledge-based technologies, from advanced information technology architectures for video processing and transmission to advanced functionalities of information and knowledge-based services. We believe that this book will serve as a useful source of knowledge for both academia and industry, for all those faculty members, research scientists, scholars, Ph.D. students and practitioners, who are interested in fundamental and applied facets of intelligent interactive multimedia.

  4. Artificial Intelligence (AI techniques to analyze the determinants attributes in housing prices

    Directory of Open Access Journals (Sweden)

    Julia M. Núñez Tabale


    Full Text Available The econometric approach to obtain the value of a property began with hedonic modelling, which were based on a set of property attributes, internal or external, associated to each particular dwelling. The final sale value can be estimated, and also the marginal prices of each exogenous explanatory variable. A good alternative to the hedonic approach is based on several Artificial Intelligence (AI techniques, such as artificial neural networks (ANN, these tend to be more precise. Both methodologies are compared, and a case study is developed using data from Seville, the larger town in the South of Spain.

  5. Application of Artificial Intelligence (AI) Programming Techniques to Tactical Guidance for Fighter Aircraft (United States)

    McManus, John W.; Goodrich, Kenneth H.


    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within-Visual-Range (WVR) air combat engagements is discussed. The application of AI methods for development and implementation of the TDG is presented. The history of the Adaptive Maneuvering Logic (AML) program is traced and current versions of the AML program are compared and contrasted with the TDG system. The Knowledge-Based Systems (KBS) used by the TDG to aid in the decision-making process are outlined in detail and example rules are presented. The results of tests to evaluate the performance of the TDG versus a version of AML and versus human pilots in the Langley Differential Maneuvering Simulator (DMS) are presented. To date, these results have shown significant performance gains in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify than the updated FORTRAN AML programs.

  6. Integrated Multimedia Based Intelligent Group Decision Support System for Electrical Power Network

    Directory of Open Access Journals (Sweden)

    Ajay Kumar Saxena


    Full Text Available Electrical Power Network in recent time requires an intelligent, virtual environment based decision process for the coordination of all its individual elements and the interrelated tasks. Its ultimate goal is to achieve maximum productivity and efficiency through the efficient and effective application of generation, transmission, distribution, pricing and regulatory systems. However, the complexity of electrical power network and the presence of conflicting multiple goals and objectives postulated by various groups emphasized the need of an intelligent group decision support system approach in this field. In this paper, an Integrated Multimedia based Intelligent Group Decision Support System (IM1GDSS is presented, and its main components are analyzed and discussed. In particular attention is focused on the Data Base, Model Base, Central Black Board (CBB and Multicriteria Futuristic Decision Process (MFDP module. The model base interacts with Electrical Power Network Load Forecasting and Planning (EPNLFP Module; Resource Optimization, Modeling and Simulation (ROMAS Module; Electrical Power Network Control and Evaluation Process (EPNCAEP Module, and MFDP Module through CBB for strategic planning, management control, operational planning and transaction processing. The richness of multimedia channels adds a totally new dimension in a group decision making for Electrical Power Network. The proposed IMIGDSS is a user friendly, highly interactive group decision making system, based on efficient intelligent and multimedia communication support for group discussions, retrieval of content and multi criteria decision analysis.

  7. Multimedia services in intelligent environments advances in recommender systems

    CERN Document Server

    Virvou, Maria; Jain, Lakhmi


    Multimedia services are now commonly used in various activities in the daily lives of humans. Related application areas include services that allow access to large depositories of information, digital libraries, e-learning and e-education, e-government and e-governance, e-commerce and e-auctions, e-entertainment, e-health and e-medicine, and e-legal services, as well as their mobile counterparts (i.e., m-services). Despite the tremendous growth of multimedia services over the recent years, there is an increasing demand for their further development. This demand is driven by the ever-increasing desire of society for easy accessibility to information in friendly, personalized and adaptive environments. In this book at hand, we examine recent Advances in Recommender Systems. Recommender systems are crucial in multimedia services, as they aim at protecting the service users from information overload. The book includes nine chapters, which present various recent research results in recommender systems. This resear...

  8. An artificial intelligence (AI) NOx/heat rate optimization system for Ontario Hydro`s fossil generating stations

    Energy Technology Data Exchange (ETDEWEB)

    Luk, J.; Frank, A.; Bodach, P. [Ontario Hydro, Toronto, ON (Canada); Warriner, G. [Radian International, Tucker, GA (United States); Noblett, J. [Radian International, Austin, TX (United States); Slatsky, M. [Southern Company, Birmingham, AL (United States)


    Artificial intelligence (AI)-based software packages which can optimize power plant operations that improves heat rate and also reduces nitrogen oxide emissions are now commonly available for commercial use. This paper discusses the implementation of the AI-based NOx and Heat Rate Optimization System at Ontario Hydro`s generation stations, emphasizing the current AI Optimization Project at Units 5 and 6 of the Lakeview Generating Station. These demonstration programs are showing promising results in NOx reduction and plant performance improvement. The availability of the plant Digital Control System (DCS) in implementing AI optimization in a closed-loop system was shown to be an important criterion for success. Implementation of AI technology at other Ontario Hydro fossil generating units as part of the overall NOx emission reduction system is envisaged to coincide with the retrofit of the original plant control system with the latest DCS systems. 14 refs., 3 figs.

  9. An Ambient Intelligence Framework for the Provision of Geographically Distributed Multimedia Content to Mobility Impaired Users (United States)

    Kehagias, Dionysios D.; Giakoumis, Dimitris; Tzovaras, Dimitrios; Bekiaris, Evangelos; Wiethoff, Marion

    This chapter presents an ambient intelligence framework whose goal is to facilitate the information needs of mobility impaired users on the move. This framework couples users with geographically distributed services and the corresponding multimedia content, enabling access to context-sensitive information based on user geographic location and the use case under consideration. It provides a multi-modal facility that is realized through a set of mobile devices and user interfaces that address the needs of ten different types of user impairments. The overall ambient intelligence framework enables users who are equipped with mobile devices to access multimedia content in order to undertake activities relevant to one or more of the following domains: transportation, tourism and leisure, personal support services, work, business, education, social relations and community building. User experience is being explored against those activities through a specific usage scenario.

  10. 12th International Conference on Intelligent Information Hiding and Multimedia Signal Processing

    CERN Document Server

    Tsai, Pei-Wei; Huang, Hsiang-Cheh


    This volume of Smart Innovation, Systems and Technologies contains accepted papers presented in IIH-MSP-2016, the 12th International Conference on Intelligent Information Hiding and Multimedia Signal Processing. The conference this year was technically co-sponsored by Tainan Chapter of IEEE Signal Processing Society, Fujian University of Technology, Chaoyang University of Technology, Taiwan Association for Web Intelligence Consortium, Fujian Provincial Key Laboratory of Big Data Mining and Applications (Fujian University of Technology), and Harbin Institute of Technology Shenzhen Graduate School. IIH-MSP 2016 is held in 21-23, November, 2016 in Kaohsiung, Taiwan. The conference is an international forum for the researchers and professionals in all areas of information hiding and multimedia signal processing. .

  11. Artificial intelligence/expert (AI/EX) systems for steelworks pollution control

    Energy Technology Data Exchange (ETDEWEB)

    Schofield, N.; Le Louer, P.; Mirabile, D.; Hubner, R. [Corus UK Ltd., Rotherham (United Kingdom)


    The objectives of this project have been to develop and apply artificial intelligence and expert system (AI/EX) methods to improve the control and operational performance of steelworks' pollution control equipment and to assess the viability and benefits of using such systems in dynamic process plant applications. Four distinct sub-projects were carried out: an expert system incorporating knowledge-based rules and neural network simulations has been developed by Corus which provides plant personnel with a real-time condition monitoring tool for the plant. Abnormalities with plant operation are now instantly recognised and alarmed, allowing prioritised maintenance to increase plant availability. The LECES project focused on studies concerning three different sites in order to evaluate predictive emission monitoring systems using neural networks to replace conventional instrumental and controls in steelworks' combustion systems. VAI developed a software template for pollution control expert systems to demonstrate the transferability of AI/EX technology. This has been done through the development of a validated process database containing data from the Corus sub-project and the subsequent integration of this data with dynamic emission models to produce rules for input to an evaluation database. CSM developed a fuzzy logic controlled process management system applied to the biological treatment of coke-oven waste water. A pilot plant has been installed and results on simulations performed using the fuzzy logic system linked to a neural network simulator show that it is possible to obtain great advantages in the biological pilot plant performance.

  12. Human-centered automation and AI - Ideas, insights, and issues from the Intelligent Cockpit Aids research effort (United States)

    Abbott, Kathy H.; Schutte, Paul C.


    A development status evaluation is presented for the NASA-Langley Intelligent Cockpit Aids research program, which encompasses AI, human/machine interfaces, and conventional automation. Attention is being given to decision-aiding concepts for human-centered automation, with emphasis on inflight subsystem fault management, inflight mission replanning, and communications management. The cockpit envisioned is for advanced commercial transport aircraft.

  13. Flood AI: An Intelligent Systems for Discovery and Communication of Disaster Knowledge (United States)

    Demir, I.; Sermet, M. Y.


    Communities are not immune from extreme events or natural disasters that can lead to large-scale consequences for the nation and public. Improving resilience to better prepare, plan, recover, and adapt to disasters is critical to reduce the impacts of extreme events. The National Research Council (NRC) report discusses the topic of how to increase resilience to extreme events through a vision of resilient nation in the year 2030. The report highlights the importance of data, information, gaps and knowledge challenges that needs to be addressed, and suggests every individual to access the risk and vulnerability information to make their communities more resilient. This project presents an intelligent system, Flood AI, for flooding to improve societal preparedness by providing a knowledge engine using voice recognition, artificial intelligence, and natural language processing based on a generalized ontology for disasters with a primary focus on flooding. The knowledge engine utilizes the flood ontology and concepts to connect user input to relevant knowledge discovery channels on flooding by developing a data acquisition and processing framework utilizing environmental observations, forecast models, and knowledge bases. Communication channels of the framework includes web-based systems, agent-based chat bots, smartphone applications, automated web workflows, and smart home devices, opening the knowledge discovery for flooding to many unique use cases.

  14. The Molecular Basis of Neural Memory. Part 7: Neural Intelligence (NI versus Artificial Intelligence (AI

    Directory of Open Access Journals (Sweden)

    Gerard Marx


    Full Text Available The link of memory to intelligence is incontestable, though the development of electronic artifacts with memory has confounded cognitive and computer scientists’ conception of memory and its relevance to “intelligence”. We propose two categories of “Intelligence”: (1 Logical (objective — mathematics, numbers, pattern recognition, games, programmable in binary format. (2 Emotive (subjective — sensations, feelings, perceptions, goals desires, sociability, sex, food, love. The 1st has been reduced to computational algorithms of which we are well versed, witness global technology and the internet. The 2nd relates to the mysterious process whereby (psychic emotive states are achieved by neural beings sensing, comprehending, remembering and dealing with their surroundings. Many theories and philosophies have been forwarded to rationalize this process, but as neuroscientists, we remain dissatisfied. Our own musings on universal neural memory, suggest a tripartite mechanism involving neurons interacting with their surroundings, notably the neural extracellular matrix (nECM with dopants [trace metals and neurotransmitters (NTs]. In particular, the NTs are the molecular encoders of emotive states. We have developed a chemographic representation of such a molecular code.To quote Longuet-Higgins, “Perhaps it is time for the term ‘artificial intelligence’ to be replaced by something more modest and less provisional”. We suggest “artifact intelligence” (ARTI or “machine intelligence” (MI, neither of which imply emulation of emotive neural processes, but simply refer to the ‘demotive’ (lacking emotive quality capability of electronic artifacts that employ a recall function, to calculate algorithms.

  15. AI (artificial intelligence) in histopathology--from image analysis to automated diagnosis. (United States)

    Kayser, Klaus; Görtler, Jürgen; Bogovac, Milica; Bogovac, Aleksandar; Goldmann, Torsten; Vollmer, Ekkehard; Kayser, Gian


    The technological progress in digitalization of complete histological glass slides has opened a new door in tissue--based diagnosis. The presentation of microscopic images as a whole in a digital matrix is called virtual slide. A virtual slide allows calculation and related presentation of image information that otherwise can only be seen by individual human performance. The digital world permits attachments of several (if not all) fields of view and the contemporary visualization on a screen. The presentation of all microscopic magnifications is possible if the basic pixel resolution is less than 0.25 microns. To introduce digital tissue--based diagnosis into the daily routine work of a surgical pathologist requires a new setup of workflow arrangement and procedures. The quality of digitized images is sufficient for diagnostic purposes; however, the time needed for viewing virtual slides exceeds that of viewing original glass slides by far. The reason lies in a slower and more difficult sampling procedure, which is the selection of information containing fields of view. By application of artificial intelligence, tissue--based diagnosis in routine work can be managed automatically in steps as follows: 1. The individual image quality has to be measured, and corrected, if necessary. 2. A diagnostic algorithm has to be applied. An algorithm has be developed, that includes both object based (object features, structures) and pixel based (texture) measures. 3. These measures serve for diagnosis classification and feedback to order additional information, for example in virtual immunohistochemical slides. 4. The measures can serve for automated image classification and detection of relevant image information by themselves without any labeling. 5. The pathologists' duty will not be released by such a system; to the contrary, it will manage and supervise the system, i.e., just working at a "higher level". Virtual slides are already in use for teaching and continuous

  16. AI's Philosophical Underpinnings: A Thinking Person's Walk through the Twists and Turns of Artificial Intelligence's Meandering Path (United States)

    Colombano, Silvano; Norvig, Peter (Technical Monitor)


    Few human endeavors can be viewed both as extremely successful and unsuccessful at the same time. This is typically the case when goals have not been well defined or have been shifting in time. This has certainly been true of Artificial Intelligence (AI). The nature of intelligence has been the object of much thought and speculation throughout the history of philosophy. It is in the nature of philosophy that real headway is sometimes made only when appropriate tools become available. Similarly the computer, coupled with the ability to program (at least in principle) any function, appeared to be the tool that could tackle the notion of intelligence. To suit the tool, the problem of the nature of intelligence was soon sidestepped in favor of this notion: If a probing conversation with a computer could not be distinguished from a conversation with a human, then AI had been achieved. This notion became known as the Turing test, after the mathematician Alan Turing who proposed it in 1950. Conceptually rich and interesting, these early efforts gave rise to a large portion of the field's framework. Key to AI, rather than the 'number crunching' typical of computers until then, was viewed as the ability to manipulate symbols and make logical inferences. To facilitate these tasks, AI languages such as LISP and Prolog were invented and used widely in the field. One idea that emerged and enabled some success with real world problems was the notion that 'most intelligence' really resided in knowledge. A phrase attributed to Feigenbaum, one of the pioneers, was 'knowledge is the power.' With this premise, the problem is shifted from 'how do we solve problems' to 'how do we represent knowledge.' A good knowledge representation scheme could allow one to draw conclusions from given premises. Such schemes took forms such as rules,frames and scripts. It allowed the building of what became known as expert systems or knowledge based systems (KBS).

  17. Multimedia

    Directory of Open Access Journals (Sweden)

    Eva Milková


    Full Text Available This paper is based on many years’ experience with multimedia applications supporting the area of computer science education and it could serve as an inspirational material directed to all educators developing students’ algorithmic thinking. Education of subjects related with computer science is from the perspective of other for centuries taught subjects, still in its infancy. Even nowadays a teaching method aimed at developing algorithmic thinking of students is still the subject of extensive discussions and teachers are looking for different ways on how to access it to students. Next to the educational approach to this base of computer science it is also important to find a suitable support for students’ self-learning. Multimedia applications give teachers an excellent chance to demonstrate and visualize the subject matter more clearly and comprehensibly, as well as also enabling them to prepare study material for students which optimizes their study habits. Along with large software products developed by a team of professionals there are also various smaller programs dealing with objects appropriate to course subject matter created on a script given by the teacher with regard to students’ needs. In the paper such application prepared to intensify self-preparation of students in subjects developing algorithmic thinking is introduced and its benefit discussed. Animations useful to be used as an introductory complement to lectures are introduced as well. At the end advantages of the professional virtual learning environment containing such study material are mentioned.

  18. CIMS: A Context-Based Intelligent Multimedia System for Ubiquitous Cloud Computing

    Directory of Open Access Journals (Sweden)

    Abhilash Sreeramaneni


    Full Text Available Mobile users spend a tremendous amount of time surfing multimedia contents over the Internet to pursue their interests. A resource-constrained smart device demands more intensive computing tasks and lessens the battery life. To address the resource limitations (i.e., memory, lower maintenance cost, easier access, computing tasks in mobile devices, mobile cloud computing is needed. Several approaches have been proposed to confront the challenges of mobile cloud computing, but difficulties still remain. However, in the coming years, context collecting, processing, and interchanging the results on a heavy network will cause vast computations and reduce the battery life in mobiles. In this paper, we propose a “context-based intelligent multimedia system” (CIMS for ubiquitous cloud computing. The main goal of this research is to lessen the computing percentage, storage complexities, and battery life for mobile users by using pervasive cloud computing. Moreover, to reduce the computing and storage concerns in mobiles, the cloud server collects several groups of user profiles with similarities by executing K-means clustering on users’ data (context and multimedia contents. The distribution process conveys real-time notifications to smartphone users, according to what is stated in his/her profile. We considered a mobile cloud offloading system, which decides the offloading actions to/from cloud servers. Context-aware decision-making (CAD customizes the mobile device performance with different specifications such as short response time and lesser energy consumption. The analysis says that our CIMS takes advantage of cost-effective features to produce high-quality information for mobile (or smart device users in real time. Moreover, our CIMS lessens the computation and storage complexities for mobile users, as well as cloud servers. Simulation analysis suggests that our approach is more efficient than existing domains.

  19. Methodology Investigation of AI(Artificial Intelligence) Test Officer Support Tool. Volume 1 (United States)


    American Association for Artificial inteligence A! ............. Artificial inteliigence AMC ............ Unt:ed States Army Maeriel Comand ASL...block number) FIELD GROUP SUB-GROUP Artificial Intelligence, Expert Systems Automated Aids to Testing 9. ABSTRACT (Continue on reverse if necessary and...identify by block number) This report covers the application of Artificial Intelligence-Techniques to the problem of creating automated tools to

  20. Pathologies of AI: Responsible use of artificial intelligence in professional work

    NARCIS (Netherlands)

    Stamper, R.K.


    Although the AI paradigm is useful for building knowledge-based systems for the applied natural sciences, there are dangers when it is extended into the domains of business, law and other social systems. It is misleading to treat knowledge as a commodity that can be separated from the context in

  1. The Emperor of Strong AI Has No Clothes: Limits to Artificial Intelligence

    Directory of Open Access Journals (Sweden)

    Adriana Braga


    Full Text Available Making use of the techniques of media ecology we argue that the premise of the technological Singularity based on the notion computers will one day be smarter that their human creators is false. We also analyze the comments of other critics of the Singularity, as well supporters of this notion. The notion of intelligence that advocates of the technological singularity promote does not take into account the full dimension of human intelligence. They treat artificial intelligence as a figure without a ground. Human intelligence as we will show is not based solely on logical operations and computation, but also includes a long list of other characteristics that are unique to humans, which is the ground that supporters of the Singularity ignore. The list includes curiosity, imagination, intuition, emotions, passion, desires, pleasure, aesthetics, joy, purpose, objectives, goals, telos, values, morality, experience, wisdom, judgment, and even humor.

  2. Investigating AI with Basic and Logo. Teaching Your Computer to Be Intelligent. (United States)

    Mandell, Alan; Lucking, Robert


    Discusses artificial intelligence, its definitions, and potential applications. Provides listings of Logo and BASIC versions for programs along with REM statements needed to make modifications for use with Apple computers. (RT)

  3. Artificial Intelligence (AI) in Healthcare Market: Market Trend with Boom Opportunities in Upcoming Years


    Rahul Gautam


    The global artificial intelligence in healthcare market is expected to observe an extensive growth in the coming years, led by growing need for precision medicine, increasing application of big data in healthcare industry, and rising need for coordination between healthcare workforce and patients. The products in the global market are categorized as hardware, software and services, with software being the largest contributor in 2016 and the category is also projected to witness significant gr...

  4. Application of artificial intelligence (AI) concepts to the development of space flight parts approval model (United States)

    Krishnan, G. S.


    A cost effective model which uses the artificial intelligence techniques in the selection and approval of parts is presented. The knowledge which is acquired from the specialists for different part types are represented in a knowledge base in the form of rules and objects. The parts information is stored separately in a data base and is isolated from the knowledge base. Validation, verification and performance issues are highlighted.

  5. Artificial intelligence (AI)-based relational matching and multimodal medical image fusion: generalized 3D approaches (United States)

    Vajdic, Stevan M.; Katz, Henry E.; Downing, Andrew R.; Brooks, Michael J.


    A 3D relational image matching/fusion algorithm is introduced. It is implemented in the domain of medical imaging and is based on Artificial Intelligence paradigms--in particular, knowledge base representation and tree search. The 2D reference and target images are selected from 3D sets and segmented into non-touching and non-overlapping regions, using iterative thresholding and/or knowledge about the anatomical shapes of human organs. Selected image region attributes are calculated. Region matches are obtained using a tree search, and the error is minimized by evaluating a `goodness' of matching function based on similarities of region attributes. Once the matched regions are found and the spline geometric transform is applied to regional centers of gravity, images are ready for fusion and visualization into a single 3D image of higher clarity.

  6. Some applications of AI [Artificial Intelligence] to the problems of accelerator physics

    International Nuclear Information System (INIS)

    Higo, T.; Shoaee, H.; Spencer, J.E.


    Failure of orbit correction schemes to recognize betatron oscillation patterns obvious to any machine operator is a good problem with which to analyze the uses of Artificial Intelligence and the roles and relationships of operators, control systems and machines. Because such error modes are very common, their generalization could provide an efficient machine optimization and control strategy. A set of first-order, unitary transformations connecting canonical variables through measured results are defined which can either be compared to design for commissioning or to past results for 'golden orbit' operation. Because these relate directly to hardware variables, the method is simple, fast and direct. It has implications for machine design, controls, monitoring and feedback. Chronological analysis of such machine signatures can predict or provide a variety of information such as mean time to failure, failure modes and fast feedback or feedforward for optimizing figures of merit such as luminosity or current transmission. The use of theoretical and empirical scaling relations for such problems is discussed in terms of various figures of merit, the variables on which they depend as well as their functional dependences

  7. Application of artificial intelligence (AI) concepts to the development of space flight parts approval model (United States)

    Krishnan, Govindarajapuram Subramaniam


    The National Aeronautics & Space Administration (NASA), the European Space Agency (ESA), and the Canadian Space Agency (CSA) missions involve the performance of scientific experiments in Space. Instruments used in such experiments are fabricated using electronic parts such as microcircuits, inductors, capacitors, diodes, transistors, etc. For instruments to perform reliably the selection of commercial parts must be monitored and strictly controlled. The process used to achieve this goal is by a manual review and approval of every part used to build the instrument. The present system to select and approve parts for space applications is manual, inefficient, inconsistent, slow and tedious, and very costly. In this dissertation a computer based decision support model is developed for implementing this process using artificial intelligence concepts based on the current information (expert sources). Such a model would result in a greater consistency, accuracy, and timeliness of evaluation. This study presents the methodology of development and features of the model, and the analysis of the data pertaining to the performance of the model in the field. The model was evaluated for three different part types by experts from three different space agencies. The results show that the model was more consistent than the manual evaluation for all part types considered. The study concludes with the cost and benefits analysis of implementing the models and shows that implementation of the model will result in significant cost savings. Other implementation details are highlighted.

  8. The use of technology in the promotion of children’s emotional intelligence : the multimedia program “Developing Emotional Intelligence”


    D'Amico, Antonella


    "Developing Emotional Intelligence” is an Italian language multimedia tool created for children between 8 and 12 years of age. The software is based on the four ‘branches’ of model of emotional intelligence proposed by Mayer and Salovey and aims to evaluate and improve abilities in perception of emotions; using emotion to facilitate thought; understanding emotions; and managing emotions. In the software, four characters represent the four branches of emotional intelligence and ...

  9. General general game AI


    Togelius, Julian; Yannakakis, Georgios N.; 2016 IEEE Conference on Computational Intelligence and Games (CIG)


    Arguably the grand goal of artificial intelligence research is to produce machines with general intelligence: the capacity to solve multiple problems, not just one. Artificial intelligence (AI) has investigated the general intelligence capacity of machines within the domain of games more than any other domain given the ideal properties of games for that purpose: controlled yet interesting and computationally hard problems. This line of research, however, has so far focuse...

  10. Tweeting AI: Perceptions of AI-Tweeters (AIT) vs Expert AI-Tweeters (EAIT)


    Manikonda, Lydia; Dudley, Cameron; Kambhampati, Subbarao


    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals started debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users from two categories -- general AI-Tweeters (AIT) and the expert AI-Tweeters (EAIT) who ...

  11. AI and health


    Martin Anderson


    ntelligence refers to the ability of an individual to learn or understand something, or to deal with a new situation. When a machine or software exhibits such characteristics, it is referred to as artificial intelligence (AI). Artificial Intelligence is therefore defined as the theory and development of computer systems able to perform tasks that normally require human intelligence, such as visual perception, speech recognition, decision-making, and translation between languages.

  12. Intelligence in Artificial Intelligence


    Datta, Shoumen Palit Austin


    The elusive quest for intelligence in artificial intelligence prompts us to consider that instituting human-level intelligence in systems may be (still) in the realm of utopia. In about a quarter century, we have witnessed the winter of AI (1990) being transformed and transported to the zenith of tabloid fodder about AI (2015). The discussion at hand is about the elements that constitute the canonical idea of intelligence. The delivery of intelligence as a pay-per-use-service, popping out of ...

  13. An analysis of the application of AI to the development of intelligent aids for flight crew tasks (United States)

    Baron, S.; Feehrer, C.


    This report presents the results of a study aimed at developing a basis for applying artificial intelligence to the flight deck environment of commercial transport aircraft. In particular, the study was comprised of four tasks: (1) analysis of flight crew tasks, (2) survey of the state-of-the-art of relevant artificial intelligence areas, (3) identification of human factors issues relevant to intelligent cockpit aids, and (4) identification of artificial intelligence areas requiring further research.

  14. Modeling Progress in AI


    Brundage, Miles


    Participants in recent discussions of AI-related issues ranging from intelligence explosion to technological unemployment have made diverse claims about the nature, pace, and drivers of progress in AI. However, these theories are rarely specified in enough detail to enable systematic evaluation of their assumptions or to extrapolate progress quantitatively, as is often done with some success in other technological domains. After reviewing relevant literatures and justifying the need for more ...

  15. Integrated Multimedia Based Intelligent Group Decision Support System for Electrical Power Network


    Ajay Kumar Saxena; S. 0. Bhatnagar; P. K Saxena


    Electrical Power Network in recent time requires an intelligent, virtual environment based decision process for the coordination of all its individual elements and the interrelated tasks. Its ultimate goal is to achieve maximum productivity and efficiency through the efficient and effective application of generation, transmission, distribution, pricing and regulatory systems. However, the complexity of electrical power network and the presence of conflicting multiple goals and objectives p...

  16. Introducing AI into MEMS can lead us to brain-computer interfaces and super-human intelligence


    Sanders, David


    Last year, I spoke about the progress being made in machine intelligence (Sanders, 2008c) and with sensors and networks of sensors (Sanders, 2008b). Earlier this year (in this journal) I spoke about ambient-intelligence, rapid-prototyping and the role of humans in the factories of the future (Sanders, 2009a). I addressed new applications and technologies such as merging machines with human beings, micro-electromechanics, electro-mechanical systems that can be personalized, smarter than human ...

  17. AI 3D Cybug Gaming


    Ahmed, Zeeshan


    In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

  18. Training simulators for power plant operation based in multimedia, intelligent tutorials and virtual reality; Simuladores para entrenamiento en la operacion de centrales basados en multimedia, tutores inteligentes y realidad virtual

    Energy Technology Data Exchange (ETDEWEB)

    Rossano Roman, Miguel; Tavira Mondragon, Jose A.; Romero Jimenez, Guillermo; Buenabad Arias, Maria de los Angeles [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)


    The possibility of utilizing simulators to support the fossil fuel power plants operation personnel training, is analyzed. These simulators can be based in multimedia, intelligent tutorials and virtual reality. The software and hardware advances of these technologies are analyzed and it is concluded that the simulators development for operators training supported in the fore mentioned technologies represents a new alternative for the instruction of personnel of this type of power stations that has to be analyzed and evaluated, since one of the disadvantages of this type of technologies is the equipment and software investment cost [Espanol] Se analiza la posibilidad de utilizar simuladores para ayudar al entrenamiento del personal en la operacion de centrales termoelectricas, dichos simuladores pueden estar basados en multimedia, tutores inteligentes y realidad virtual. Se describen los avances en software y hardware de estas tecnologias y se concluye en que el desarrollo de simuladores para el entrenamiento de operadores apoyados con las tecnologias antes mencionadas representa una nueva alternativa para la instruccion del personal de este tipo de centrales, que hay que analizar y evaluar, ya que una de las desventajas de este tipo de tecnologias es el costo de inversion en equipo y software

  19. Training simulators for power plant operation based in multimedia, intelligent tutorials and virtual reality; Simuladores para entrenamiento en la operacion de centrales basados en multimedia, tutores inteligentes y realidad virtual

    Energy Technology Data Exchange (ETDEWEB)

    Rossano Roman, Miguel; Tavira Mondragon, Jose A; Romero Jimenez, Guillermo; Buenabad Arias, Maria de los Angeles [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)


    The possibility of utilizing simulators to support the fossil fuel power plants operation personnel training, is analyzed. These simulators can be based in multimedia, intelligent tutorials and virtual reality. The software and hardware advances of these technologies are analyzed and it is concluded that the simulators development for operators training supported in the fore mentioned technologies represents a new alternative for the instruction of personnel of this type of power stations that has to be analyzed and evaluated, since one of the disadvantages of this type of technologies is the equipment and software investment cost [Espanol] Se analiza la posibilidad de utilizar simuladores para ayudar al entrenamiento del personal en la operacion de centrales termoelectricas, dichos simuladores pueden estar basados en multimedia, tutores inteligentes y realidad virtual. Se describen los avances en software y hardware de estas tecnologias y se concluye en que el desarrollo de simuladores para el entrenamiento de operadores apoyados con las tecnologias antes mencionadas representa una nueva alternativa para la instruccion del personal de este tipo de centrales, que hay que analizar y evaluar, ya que una de las desventajas de este tipo de tecnologias es el costo de inversion en equipo y software

  20. AIS authentication

    CERN Multimedia


    Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login ( Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

  1. AI and Mathematical Education

    Directory of Open Access Journals (Sweden)

    Angel Garrido


    Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

  2. The handbook of artificial intelligence

    CERN Document Server

    Barr, Avron


    The Handbook of Artificial Intelligence, Volume II focuses on the improvements in artificial intelligence (AI) and its increasing applications, including programming languages, intelligent CAI systems, and the employment of AI in medicine, science, and education. The book first elaborates on programming languages for AI research and applications-oriented AI research. Discussions cover scientific applications, teiresias, applications in chemistry, dependencies and assumptions, AI programming-language features, and LISP. The manuscript then examines applications-oriented AI research in medicine

  3. Knowledge Discovery, Integration and Communication for Extreme Weather and Flood Resilience Using Artificial Intelligence: Flood AI Alpha (United States)

    Demir, I.; Sermet, M. Y.


    Nobody is immune from extreme events or natural hazards that can lead to large-scale consequences for the nation and public. One of the solutions to reduce the impacts of extreme events is to invest in improving resilience with the ability to better prepare, plan, recover, and adapt to disasters. The National Research Council (NRC) report discusses the topic of how to increase resilience to extreme events through a vision of resilient nation in the year 2030. The report highlights the importance of data, information, gaps and knowledge challenges that needs to be addressed, and suggests every individual to access the risk and vulnerability information to make their communities more resilient. This abstracts presents our project on developing a resilience framework for flooding to improve societal preparedness with objectives; (a) develop a generalized ontology for extreme events with primary focus on flooding; (b) develop a knowledge engine with voice recognition, artificial intelligence, natural language processing, and inference engine. The knowledge engine will utilize the flood ontology and concepts to connect user input to relevant knowledge discovery outputs on flooding; (c) develop a data acquisition and processing framework from existing environmental observations, forecast models, and social networks. The system will utilize the framework, capabilities and user base of the Iowa Flood Information System (IFIS) to populate and test the system; (d) develop a communication framework to support user interaction and delivery of information to users. The interaction and delivery channels will include voice and text input via web-based system (e.g. IFIS), agent-based bots (e.g. Microsoft Skype, Facebook Messenger), smartphone and augmented reality applications (e.g. smart assistant), and automated web workflows (e.g. IFTTT, CloudWork) to open the knowledge discovery for flooding to thousands of community extensible web workflows.

  4. Intelligible Artificial Intelligence


    Weld, Daniel S.; Bansal, Gagan


    Since Artificial Intelligence (AI) software uses techniques like deep lookahead search and stochastic optimization of huge neural networks to fit mammoth datasets, it often results in complex behavior that is difficult for people to understand. Yet organizations are deploying AI algorithms in many mission-critical settings. In order to trust their behavior, we must make it intelligible --- either by using inherently interpretable models or by developing methods for explaining otherwise overwh...

  5. Citadels AI


    Pekárek, Jakub


    The aim of this thesis is to implement a playable version of the game Citadels with console interface, and to use it for analysis of the game's properties and development of artificial intelligence. This thesis includes an analysis of strategies, a scheme for their design, an organization of turn processing, a model of intelligence implementation and testing tools. A number of approaches to specific moves have been developed, all of which achieved positive impact on overall intelligence perfo...

  6. The Potential of AI Techniques for Remote Sensing (United States)

    Estes, J. E.; Sailer, C. T. (Principal Investigator); Tinney, L. R.


    The current status of artificial intelligence AI technology is discussed along with imagery data management, database interrogation, and decision making. Techniques adapted from the field of artificial intelligence (AI) have significant, wide ranging impacts upon computer-assisted remote sensing analysis. AI based techniques offer a powerful and fundamentally different approach to many remote sensing tasks. In addition to computer assisted analysis, AI techniques can also aid onboard spacecraft data processing and analysis and database access and query.

  7. Towards a science of integrated AI and Robotics


    Rajan, Kanna; Saffiotti, Alessandro


    The early promise of the impact of machine intelligence did not involve the partitioning of the nascent field of Artificial Intelligence. The founders of AI envisioned the notion of embedded intelligence as being conjoined between perception, reasoning and actuation. Yet over the years the fields of AI and Robotics drifted apart. Practitioners of AI focused on problems and algorithms abstracted from the real world. Roboticists, generally with a background in mechanical and electrical engineer...

  8. Artificial Intelligence (AI) Flight Advisor (United States)

    National Aeronautics and Space Administration — This research effort applies Deep Learning to contingency management.   Many historic aircraft accidents would have been avoidable if the pilot had better diagnosis...

  9. harnessing_ai_20180319.pptx


    Johnson, Matthew


    There have been great strides made in Artificial Intelligence in recent years, but it is often not clear how to apply these recent advances to new problems. In this talk I propose one method of thinking about problems in the sciences and how to find the right AI techniques to aid in research.

  10. Tweeting AI: Perceptions of Lay vs Expert Twitterati


    Manikonda, Lydia; Kambhampati, Subbarao


    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals are debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users belonging to two categories -- general AI-Tweeters (AIT) and expert AI-Tweeters (EAIT) who ...

  11. The Relevance of AI Research to CAI. (United States)

    Kearsley, Greg P.

    This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

  12. Semantic Multimedia

    NARCIS (Netherlands)

    S. Staab; A. Scherp; R. Arndt; R. Troncy (Raphael); M. Grzegorzek; C. Saathoff; S. Schenk; L. Hardman (Lynda)


    htmlabstractMultimedia constitutes an interesting field of application for Semantic Web and Semantic Web reasoning, as the access and management of multimedia content and context depends strongly on the semantic descriptions of both. At the same time, multimedia resources constitute complex objects,

  13. The present status of artificial intelligence for nuclear power plants

    International Nuclear Information System (INIS)

    Suda, Kazunori; Yonekawa, Tuyoshi; Yoshikawa, Shinji; Hasegawa, Makoto


    JNC researches the development of distributed intelligence systems at autonomous plants and intelligent support system at nuclear power plant. This report describes the present status of artificial intelligence (AI) technologies for this research. The following are represented in this report: present research study for AI, Implementation of AI system and application of AI technologies in the field of industries, requirement for AI by industries, problems of social acceptance for AI. A development of AI systems has to be motivated both by current status of AI and requirement for AI. Furthermore a problem of social acceptance for AI technologies has to be solved for using AI systems in society. (author)


    Directory of Open Access Journals (Sweden)

    R. G. V. Meyer


    Full Text Available AIS is a transponder based, anti-collision system used by the majority of ocean traffic. Ships regularly transmit their identity, position and speed. The information used to populate the AIS fields come from ship based sensors, such as GPS, and user populated fields, such as the vessels name and MMSI number. These fields are susceptible to spoofing and can be changed to hide the identity or location of a vessel. This is often done to disguise the vessel as a different class to avoid inspections or to enter a protected area without raising alarms. The AIS system has found great utility in monitoring global shipping trends and traffic but this was never intended when the protocol was designed. Docked vessels still transmit messages regularly that contain no new information. These, and other redundant messages, are still transmitted and stored. In situations where a sensor is remote and has limited access to the Internet this can become costly. The Smart-AIS sensor records all incoming messages locally and makes a decision on whether the message is of special interest or not. Messages of interest are re-transmitted to an external AIS database.

  15. Humans and Machines in the Evolution of AI in Korea


    Zhang, Byoung-Tak


    Artificial intelligence in Korea is currently prospering. The media is regularly reporting AI-enabled products such as smart advisors, personal robots, autonomous cars, and human-level intelligence machines. The IT industry is investing in deep learning and AI to maintain the global competitive edge in their services and products. The Ministry of Science, ICT, and Future Planning (MSIP) has launched new funding programs in AI and cognitive science to implement the government’s newly adopted e...

  16. AI in space: Past, present, and possible futures (United States)

    Rose, Donald D.; Post, Jonathan V.


    While artificial intelligence (AI) has become increasingly present in recent space applications, new missions being planned will require even more incorporation of AI techniques. In this paper, we survey some of the progress made to date in implementing such programs, some current directions and issues, and speculate about the future of AI in space scenarios. We also provide examples of how thinkers from the realm of science fiction have envisioned AI's role in various aspects of space exploration.

  17. Artificial Intelligence and Science Education. (United States)

    Good, Ron


    Defines artificial intelligence (AI) in relation to intelligent computer-assisted instruction (ICAI) and science education. Provides a brief background of AI work, examples of expert systems, examples of ICAI work, and addresses problems facing AI workers that have implications for science education. Proposes a revised model of the Karplus/Renner…

  18. AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384. (United States)

    Goldstein, Ira P.; Miller, Mark L.

    The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

  19. Artificial Intelligence

    CERN Document Server

    Warwick, Kevin


    if AI is outside your field, or you know something of the subject and would like to know more then Artificial Intelligence: The Basics is a brilliant primer.' - Nick Smith, Engineering and Technology Magazine November 2011 Artificial Intelligence: The Basics is a concise and cutting-edge introduction to the fast moving world of AI. The author Kevin Warwick, a pioneer in the field, examines issues of what it means to be man or machine and looks at advances in robotics which have blurred the boundaries. Topics covered include: how intelligence can be defined whether machines can 'think' sensory

  20. Beyond AI: Artificial Dreams Conference

    CERN Document Server

    Zackova, Eva; Kelemen, Jozef; Beyond Artificial Intelligence : The Disappearing Human-Machine Divide


    This book is an edited collection of chapters based on the papers presented at the conference “Beyond AI: Artificial Dreams” held in Pilsen in November 2012. The aim of the conference was to question deep-rooted ideas of artificial intelligence and cast critical reflection on methods standing at its foundations.  Artificial Dreams epitomize our controversial quest for non-biological intelligence, and therefore the contributors of this book tried to fully exploit such a controversy in their respective chapters, which resulted in an interdisciplinary dialogue between experts from engineering, natural sciences and humanities.   While pursuing the Artificial Dreams, it has become clear that it is still more and more difficult to draw a clear divide between human and machine. And therefore this book tries to portrait such an image of what lies beyond artificial intelligence: we can see the disappearing human-machine divide, a very important phenomenon of nowadays technological society, the phenomenon which i...

  1. AI Researchers, Video Games Are Your Friends!


    Togelius, Julian


    If you are an artificial intelligence researcher, you should look to video games as ideal testbeds for the work you do. If you are a video game developer, you should look to AI for the technology that makes completely new types of games possible. This chapter lays out the case for both of these propositions. It asks the question "what can video games do for AI", and discusses how in particular general video game playing is the ideal testbed for artificial general intelligence research. It the...

  2. Intelligence (United States)

    Sternberg, Robert J.


    Intelligence is the ability to learn from experience and to adapt to, shape, and select environments. Intelligence as measured by (raw scores on) conventional standardized tests varies across the lifespan, and also across generations. Intelligence can be understood in part in terms of the biology of the brain—especially with regard to the functioning in the prefrontal cortex—and also correlates with brain size, at least within humans. Studies of the effects of genes and environment suggest that the heritability coefficient (ratio of genetic to phenotypic variation) is between .4 and .8, although heritability varies as a function of socioeconomic status and other factors. Racial differences in measured intelligence have been observed, but race is a socially constructed rather than biological variable, so such differences are difficult to interpret. PMID:22577301

  3. Intelligence. (United States)

    Sternberg, Robert J


    Intelligence is the ability to learn from experience and to adapt to, shape, and select environments. Intelligence as measured by (raw scores on) conventional standardized tests varies across the lifespan, and also across generations. Intelligence can be understood in part in terms of the biology of the brain-especially with regard to the functioning in the prefrontal cortex-and also correlates with brain size, at least within humans. Studies of the effects of genes and environment suggest that the heritability coefficient (ratio of genetic to phenotypic variation) is between .4 and .8, although heritability varies as a function of socioeconomic status and other factors. Racial differences in measured intelligence have been observed, but race is a socially constructed rather than biological variable, so such differences are difficult to interpret.

  4. Artificial Intelligence and Expert Systems. (United States)

    Wilson, Harold O.; Burford, Anna Marie


    Delineates artificial intelligence/expert systems (AI/ES) concepts; provides an exposition of some business application areas; relates progress; and creates an awareness of the benefits, limitations, and reservations of AI/ES. (Author)

  5. What Is Artificial Intelligence Anyway? (United States)

    Kurzweil, Raymond


    Examines the past, present, and future status of Artificial Intelligence (AI). Acknowledges the limitations of AI but proposes possible areas of application and further development. Urges a concentration on the unique strengths of machine intelligence rather than a copying of human intelligence. (ML)

  6. Development of AI (Artificial Intelligence)-based simulation system for man-machine system behavior in accidental situations of nuclear power plant

    International Nuclear Information System (INIS)

    Yoshida, Kazuo; Yokobayashi, Masao; Tanabe, Fumiya; Kawase, Katumi.


    A prototype version of a computer simulation system named JACOS (JAeri COgnitive Simulation system) has been developed at JAERI (Japan Atomic Energy Research Institute) to simulate the man-machine system behavior in which both the cognitive behavior of a human operator and the plant behavior affect each other. The objectives of this system development is to provide man-machine system analysts with detailed information on the cognitive process of an operator and the plant behavior affected by operator's actions in accidental situations of an NPP (nuclear power plant). The simulation system consists of an operator model and a plant model which are coupled dynamically. The operator model simulates an operator's cognitive behavior in accidental situations based on the decision ladder model of Rasmussen, and is implemented using the AI-techniques of the distributed cooperative inference method with the so-called blackboard architecture. Rule-based behavior is simulated using knowledge representation with If-Then type of rules. Knowledge-based behavior is simulated using knowledge representation with MFM (Multilevel Flow Modeling) and qualitative reasoning method. Cognitive characteristics of attentional narrowing, limitation of short-term memory, and knowledge recalling from long-term memory are also modeled. The plant model of a 3-loop PWR is also developed using a best estimate thermal-hydraulic analysis code RELAP5/MOD2. Some simulations of incidents were performed to verify the human model. It was found that AI-techniques used in the human model are suitable to simulate the operator's cognitive behavior in an NPP accident. The models of cognitive characteristics were investigated in the effects on simulated results of cognitive behaviors. (author)

  7. Artificial Intelligence in Astronomy (United States)

    Devinney, E. J.; Prša, A.; Guinan, E. F.; Degeorge, M.


    From the perspective (and bias) as Eclipsing Binary researchers, we give a brief overview of the development of Artificial Intelligence (AI) applications, describe major application areas of AI in astronomy, and illustrate the power of an AI approach in an application developed under the EBAI (Eclipsing Binaries via Artificial Intelligence) project, which employs Artificial Neural Network technology for estimating light curve solution parameters of eclipsing binary systems.

  8. Web Intelligence and Artificial Intelligence in Education (United States)

    Devedzic, Vladan


    This paper surveys important aspects of Web Intelligence (WI) in the context of Artificial Intelligence in Education (AIED) research. WI explores the fundamental roles as well as practical impacts of Artificial Intelligence (AI) and advanced Information Technology (IT) on the next generation of Web-related products, systems, services, and…

  9. #%Applications of artificial intelligence in intelligent manufacturing: a review

    Institute of Scientific and Technical Information of China (English)



    #%Based on research into the applications of artificial intelligence (AI) technology in the manufacturing industry in recent years, we analyze the rapid development of core technologies in the new era of 'Internet plus AI', which is triggering a great change in the models, means, and ecosystems of the manufacturing industry, as well as in the development of AI. We then propose new models, means, and forms of intelligent manufacturing, intelligent manufacturing system architecture, and intelligent man-ufacturing technology system, based on the integration of AI technology with information communications, manufacturing, and related product technology. Moreover, from the perspectives of intelligent manufacturing application technology, industry, and application demonstration, the current development in intelligent manufacturing is discussed. Finally, suggestions for the appli-cation of AI in intelligent manufacturing in China are presented.

  10. Discussion on AI Technology in Information Library Design


    日比野, 省三; Shozo, HIBINO; 中京大学社会学部


    This paper deals with the discussion on the importance of AI (Artificial Intelligence) Technology in planning and designing a library information system in the near future. First of all, the history of Library and Information Science is reviewed and it is identified that the key technology in the future library will be AI as a mega-trend. After reviewing the concepts of AI technology, a model of a Knowledge-Base system is discussed as a case study, using micro-PROLOG.

  11. An Immune Agent for Web-Based AI Course (United States)

    Gong, Tao; Cai, Zixing


    To overcome weakness and faults of a web-based e-learning course such as Artificial Intelligence (AI), an immune agent was proposed, simulating a natural immune mechanism against a virus. The immune agent was built on the multi-dimension education agent model and immune algorithm. The web-based AI course was comprised of many files, such as HTML…

  12. AI applications in sheet metal forming

    CERN Document Server

    Hussein, Hussein


    This book comprises chapters on research work done around the globe in the area of artificial intelligence (AI) applications in sheet metal forming. The first chapter offers an introduction to various AI techniques and sheet metal forming, while subsequent chapters describe traditional procedures/methods used in various sheet metal forming processes, and focus on the automation of those processes by means of AI techniques, such as KBS, ANN, GA, CBR, etc. Feature recognition and the manufacturability assessment of sheet metal parts, process planning, strip-layout design, selecting the type and size of die components, die modeling, and predicting die life are some of the most important aspects of sheet metal work. Traditionally, these activities are highly experience-based, tedious and time consuming. In response, researchers in several countries have applied various AI techniques to automate these activities, which are covered in this book. This book will be useful for engineers working in sheet metal industri...

  13. The Potential Role of Artificial Intelligence Technology in Education. (United States)

    Salem, Abdel-Badeeh M.

    The field of Artificial Intelligence (AI) and Education has traditionally a technology-based focus, looking at the ways in which AI can be used in building intelligent educational software. In addition AI can also provide an excellent methodology for learning and reasoning from the human experiences. This paper presents the potential role of AI in…

  14. Artificial Intelligence Applications for Education: Promise, ...Promises. (United States)

    Adams, Dennis M.; Hamm, Mary


    Surveys the current status of artificial intelligence (AI) technology. Discusses intelligent tutoring systems, robotics, and applications for educators. Likens the status of AI at present to that of aviation in the very early 1900s. States that educators need to be involved in future debates concerning AI. (CW)

  15. Reflection on robotic intelligence

    NARCIS (Netherlands)

    Bartneck, C.


    This paper reflects on the development or robots, both their physical shape as well as their intelligence. The later strongly depends on the progress made in the artificial intelligence (AI) community which does not yet provide the models and tools necessary to create intelligent robots. It is time

  16. Designing interactive ambient multimedia applications : requirements and implementation challenges

    NARCIS (Netherlands)

    Obrenovic, Z.; Nack, F.-M.; Hardman, H.L.


    Ambient intelligence opens new possibilities for interactive multimedia, leading towards applications where the selection, generation and playback of multimedia content can be directed and influenced by multiple users in an ambient sensor network. In this paper, we derive the basic requirements for

  17. Brain Intelligence: Go Beyond Artificial Intelligence


    Lu, Huimin; Li, Yujie; Chen, Min; Kim, Hyoungseop; Serikawa, Seiichi


    Artificial intelligence (AI) is an important technology that supports daily social life and economic activities. It contributes greatly to the sustainable growth of Japan's economy and solves various social problems. In recent years, AI has attracted attention as a key for growth in developed countries such as Europe and the United States and developing countries such as China and India. The attention has been focused mainly on developing new artificial intelligence information communication ...

  18. AI, automation and the Flight Telerobotic Servicer (United States)

    Goforth, Andre; Dominy, Robert


    A NASA study for the preliminary definition of a teleoperated robotic device has been recently completed. The Fligt Telerobotic Servicer (FTS) will be used to assist astronauts in many of the on-board tasks of assembly, maintenance, servicing, and inspection of the Space Station. The role of artificial intelligence (AI) in furthering the FTS automation capabilities and, hence, extending its capacity for growth and evolution is discussed. Relevant system engineering issues are identified, and an approach for insertion of AI technology is presented in terms of the NASA/NBS Standard Reference Model control architecture NASREM.

  19. Intelligent distributed medical image management (United States)

    Garcia, Hong-Mei C.; Yun, David Y.


    The rapid advancements in high performance global communication have accelerated cooperative image-based medical services to a new frontier. Traditional image-based medical services such as radiology and diagnostic consultation can now fully utilize multimedia technologies in order to provide novel services, including remote cooperative medical triage, distributed virtual simulation of operations, as well as cross-country collaborative medical research and training. Fast (efficient) and easy (flexible) retrieval of relevant images remains a critical requirement for the provision of remote medical services. This paper describes the database system requirements, identifies technological building blocks for meeting the requirements, and presents a system architecture for our target image database system, MISSION-DBS, which has been designed to fulfill the goals of Project MISSION (medical imaging support via satellite integrated optical network) -- an experimental high performance gigabit satellite communication network with access to remote supercomputing power, medical image databases, and 3D visualization capabilities in addition to medical expertise anywhere and anytime around the country. The MISSION-DBS design employs a synergistic fusion of techniques in distributed databases (DDB) and artificial intelligence (AI) for storing, migrating, accessing, and exploring images. The efficient storage and retrieval of voluminous image information is achieved by integrating DDB modeling and AI techniques for image processing while the flexible retrieval mechanisms are accomplished by combining attribute- based and content-based retrievals.

  20. Artificial Intelligence: The Expert Way. (United States)

    Bitter, Gary G.


    Discussion of artificial intelligence (AI) and expert systems focuses on their use in education. Characteristics of good expert systems are explained; computer software programs that contain applications of AI are described, highlighting one used to help educators identify learning-disabled students; and the future of AI is discussed. (LRW)

  1. On how AI & Law can help autonomous systems obey the law: a position paper

    NARCIS (Netherlands)

    Prakken, Hendrik


    In this position paper I discuss to what extent current and past AI & law research is relevant for research on autonomous intelligent systems that exhibit legally relevant behaviour. After a brief review of the history of AI & law, I will compare the problems faced by autonomous intelligent systems

  2. Multimedia Pembelajaran untuk Melatih Kecerdasan Majemuk pada Anak Usia Dini


    Rahmadonna, Sisca


    This research aims at developing learning multimedia which can be used to effectively stimulate multiple intelligence specially verbal linguistic intelligence, logical-mathematical intelligence, and spatial intelligence in early childhood.The subjects of the research are children between 3 to 5 years old. This research is conducted in “Warna Warni” Childhood Nursery and Education Centre using research and development. The development is done within several steps: (1) pre study, (2) developmen...

  3. Medical applications of artificial intelligence

    CERN Document Server

    Agah, Arvin


    Enhanced, more reliable, and better understood than in the past, artificial intelligence (AI) systems can make providing healthcare more accurate, affordable, accessible, consistent, and efficient. However, AI technologies have not been as well integrated into medicine as predicted. In order to succeed, medical and computational scientists must develop hybrid systems that can effectively and efficiently integrate the experience of medical care professionals with capabilities of AI systems. After providing a general overview of artificial intelligence concepts, tools, and techniques, Medical Ap

  4. Elementary epistemological features of machine intelligence


    Horvat, Marko


    Theoretical analysis of machine intelligence (MI) is useful for defining a common platform in both theoretical and applied artificial intelligence (AI). The goal of this paper is to set canonical definitions that can assist pragmatic research in both strong and weak AI. Described epistemological features of machine intelligence include relationship between intelligent behavior, intelligent and unintelligent machine characteristics, observable and unobservable entities and classification of in...

  5. T'ai Chi (United States)

    ... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

  6. Space Communication Artificial Intelligence for Link Evaluation Terminal (SCAILET) (United States)

    Shahidi, Anoosh K.; Schlegelmilch, Richard F.; Petrik, Edward J.; Walters, Jerry L.


    A software application to assist end-users of the high burst rate (HBR) link evaluation terminal (LET) for satellite communications is being developed. The HBR LET system developed at NASA Lewis Research Center is an element of the Advanced Communications Technology Satellite (ACTS) Project. The HBR LET is divided into seven major subsystems, each with its own expert. Programming scripts, test procedures defined by design engineers, set up the HBR LET system. These programming scripts are cryptic, hard to maintain and require a steep learning curve. These scripts were developed by the system engineers who will not be available for the end-users of the system. To increase end-user productivity a friendly interface needs to be added to the system. One possible solution is to provide the user with adequate documentation to perform the needed tasks. With the complexity of this system the vast amount of documentation needed would be overwhelming and the information would be hard to retrieve. With limited resources, maintenance is another reason for not using this form of documentation. An advanced form of interaction is being explored using current computer techniques. This application, which incorporates a combination of multimedia and artificial intelligence (AI) techniques to provided end-users with an intelligent interface to the HBR LET system, is comprised of an intelligent assistant, intelligent tutoring, and hypermedia documentation. The intelligent assistant and tutoring systems address the critical programming needs of the end-user.

  7. Intelligent Tutoring System: A Tool for Testing the Research Curiosities of Artificial Intelligence Researchers (United States)

    Yaratan, Huseyin


    An ITS (Intelligent Tutoring System) is a teaching-learning medium that uses artificial intelligence (AI) technology for instruction. Roberts and Park (1983) defines AI as the attempt to get computers to perform tasks that if performed by a human-being, intelligence would be required to perform the task. The design of an ITS comprises two distinct…

  8. The First Workshop on Artificial Intelligence Techniques for Ambient Intelligence (AITAmI '06)


    Augusto, Juan Carlos; Shapiro, Daniel


    The first annual workshop on the role of AI in ambient intelligence was held in Riva de Garda, Italy, on August 29, 2006. The workshop was colocated with the European Conference on Artificial Intelligence (ECAI 2006). It provided an opportunity for researchers in a variety of AI subfields together with representatives of commercial interests to explore ambient intelligence technology and applications.

  9. Principles of Multimedia News Systems for Business Applications

    Directory of Open Access Journals (Sweden)

    Ioan I. ANDONE


    Full Text Available In the past few years considerable demand for business oriented multimedia information systems has developed. A multimedia information system is one that can create, import, integrate, store, retrieve, edit, and delete two or more types of media materials in digital form, such as audio, image, full-motion video, and text information. Multimedia information systems play a central role in many business activities. They represent a very special class complex computing systems. This paper surveys a special type of multimedia information systems: multimedia news systems. Multimedia news systems deal with architectures to manage complex multimedia news databases, online presentation and distribution services or the integration of several existing services to meta-services using intelligent news retrieval engines. The leading presentation platform in multimedia news presentation is news networks providing television services and Internet content distribution. The primary focus is on advanced multimedia news systems infrastructure, document standards, application architecture and principles for multimedia news on the Web that suggest long-term trends in this increasingly important area.

  10. NASA space station automation: AI-based technology review (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.


    Research and Development projects in automation for the Space Station are discussed. Artificial Intelligence (AI) based automation technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics. AI technology will also be developed for the servicing of satellites at the Space Station, system monitoring and diagnosis, space manufacturing, and the assembly of large space structures.

  11. It Takes Two to Tango: Towards Theory of AI's Mind


    Chandrasekaran, Arjun; Yadav, Deshraj; Chattopadhyay, Prithvijit; Prabhu, Viraj; Parikh, Devi


    Theory of Mind is the ability to attribute mental states (beliefs, intents, knowledge, perspectives, etc.) to others and recognize that these mental states may differ from one's own. Theory of Mind is critical to effective communication and to teams demonstrating higher collective performance. To effectively leverage the progress in Artificial Intelligence (AI) to make our lives more productive, it is important for humans and AI to work well together in a team. Traditionally, there has been m...

  12. Areal Informations Systemet - AIS

    DEFF Research Database (Denmark)

    Nielsen, K.; Stjernholm, M.; Olsen, B. Ø.

    Forord: Denne rapport giver en kort beskrivelse af Areal Informations Systemet (AIS), som er et databasesystem med natur- og miljødata, som kan stedfæstes geografisk. Projektet er gennemført i perioden 1996-2000 som et samarbejdsprojekt mellem Danmarks Miljøundersøgelser (DMU), Danmarks og...... og enkeltpersoner med interesse for natur- og miljøforhold i Danmark. Yderligere oplysninger om Areal Informations Systemet, herunder adgangsforhold, kan fås på DMU's hjemmeside med følgende adresse: Projektet er finansieret af Miljø- og Energiministeriet, mens en række...... (planlægning, beskyttelse), geologi (overfladegeologi og marin geologi), samt marin dybdemodel. # Etablering af dataadgang for Miljø- og Energiministeriets institutioner til AIS-data. # Afprøvning af systemet i forhold til konkrete projekter. # Formidling af produkterne til brugerkredsen....

  13. MassAI

    DEFF Research Database (Denmark)


    A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....



    Ellur Anand; S. G. Varun Kumar


    Artificial Intelligence (AI) or Augmented Intelligence happens to be the most talked about technology that would have a major impact on the way the current day world functions. The next step in evolution of digital world is AI. The safety of the world with more and more use of AI also becomes necessity. Safety rules and regulations of the digital world need to be drafted and redrafted as AI evolves and becomes a new normal in every one’s life just as mobile phone has become in the current sce...

  15. Artificial Intelligence. (United States)

    Lawrence, David R; Palacios-González, César; Harris, John


    It seems natural to think that the same prudential and ethical reasons for mutual respect and tolerance that one has vis-à-vis other human persons would hold toward newly encountered paradigmatic but nonhuman biological persons. One also tends to think that they would have similar reasons for treating we humans as creatures that count morally in our own right. This line of thought transcends biological boundaries-namely, with regard to artificially (super)intelligent persons-but is this a safe assumption? The issue concerns ultimate moral significance: the significance possessed by human persons, persons from other planets, and hypothetical nonorganic persons in the form of artificial intelligence (AI). This article investigates why our possible relations to AI persons could be more complicated than they first might appear, given that they might possess a radically different nature to us, to the point that civilized or peaceful coexistence in a determinate geographical space could be impossible to achieve.

  16. Effectief leren van multimedia

    NARCIS (Netherlands)

    Kester, Liesbeth


    Kester, L. (2012, March). Effectief leren van multimedia [Effective learning from multimedia]. Keynote presented at a miniconference Learning Sciences of the Open University of the Netherlands, Eindhoven, the Netherlands.

  17. Applications of Artificial Intelligence in Education--A Personal View. (United States)

    Richer, Mark H.


    Discusses: how artificial intelligence (AI) can advance education; if the future of software lies in AI; the roots of intelligent computer-assisted instruction; protocol analysis; reactive environments; LOGO programming language; student modeling and coaching; and knowledge-based instructional programs. Numerous examples of AI programs are cited.…

  18. Multimedia: Why Invest? (United States)

    Hirschbuhl, John J.


    Discusses the utilization of technology to assist the educational establishment deal with change. Topics addressed include multimedia metaphors such as graphical user interfaces; interactive videodisk systems; problems with current multimedia systems; a Multimedia Sampler developed at the University of North Carolina that includes applications…

  19. Quo vadis, Intelligent Machine?

    Directory of Open Access Journals (Sweden)

    Rosemarie Velik


    Full Text Available Artificial Intelligence (AI is a branch of computer science concerned with making computers behave like humans. At least this was the original idea. However, it turned out that this is no task easy to be solved. This article aims to give a comprehensible review on the last 60 years of artificial intelligence taking a philosophical viewpoint. It is outlined what happened so far in AI, what is currently going on in this research area, and what can be expected in future. The goal is to mediate an understanding for the developments and changes in thinking in course of time about how to achieve machine intelligence. The clear message is that AI has to join forces with neuroscience and other brain disciplines in order to make a step towards the development of truly intelligent machines.

  20. Principles of artificial intelligence

    CERN Document Server

    Nilsson, Nils J


    A classic introduction to artificial intelligence intended to bridge the gap between theory and practice, Principles of Artificial Intelligence describes fundamental AI ideas that underlie applications such as natural language processing, automatic programming, robotics, machine vision, automatic theorem proving, and intelligent data retrieval. Rather than focusing on the subject matter of the applications, the book is organized around general computational concepts involving the kinds of data structures used, the types of operations performed on the data structures, and the properties of th

  1. General Video Game AI: Learning from Screen Capture


    Kunanusont, Kamolwan; Lucas, Simon M.; Perez-Liebana, Diego


    General Video Game Artificial Intelligence is a general game playing framework for Artificial General Intelligence research in the video-games domain. In this paper, we propose for the first time a screen capture learning agent for General Video Game AI framework. A Deep Q-Network algorithm was applied and improved to develop an agent capable of learning to play different games in the framework. After testing this algorithm using various games of different categories and difficulty levels, th...

  2. Launching AI in NASA ground systems (United States)

    Perkins, Dorothy C.; Truszkowski, Walter F.


    This paper will discuss recent operational successes in implementing expert systems to support the complex functions of NASA mission control systems at the Goddard Space Flight Center, including fault detection and diagnosis for real time and engineering analysis functions in the Cosmic Background Explorer and Gamma Ray Observatory missions and automation of resource planning and scheduling functions for various missions. It will also discuss ongoing developments and prototypes that will lead to increasingly sophisticated applications of artificial intelligence. These include the use of neural networks to perform telemetry monitoring functions, the implementation of generic expert system shells that can be customized to telemetry handling functions specific to NASA control centers, the applications of AI in training and user support, the long-term potential of implementing systems based around distributed, cooperative problem solving, and the use of AI to control and assist system development activities.

  3. AI systems approach in particle accelerators

    International Nuclear Information System (INIS)

    Kataria, S.K.; Bhagwat, P.V.; Kori, S.A.


    The large particle accelerators machines like pelletron accelerator at Tata Institute of Fundamental Research (T.I.F.R) have several levels of controls with operators responsible for overall global control decisions and closed loop feedback controllers for relatively small subsystems of the machines. As the accelerator machines are becoming more complicated and the requirements more stringent, there is a need to provide the operators with an artificial intelligence (AI) system to aid in the tuning the machine and in failure diagnosis. There are few major areas in the pelletron operation, which can be done more efficiently using AI systems approach so that useful beam is available for much more time: 1) Accelerator Conditioning, 2) Accelerator Tuning, and 3) Maintaining the Tune beams. The feasibility study for using expert system for above areas and also for safety evaluation of the various subsystems is carried out. (author). 10 refs., 4 figs

  4. Managing bioengineering complexity with AI techniques. (United States)

    Beal, Jacob; Adler, Aaron; Yaman, Fusun


    Our capabilities for systematic design and engineering of biological systems are rapidly increasing. Effectively engineering such systems, however, requires the synthesis of a rapidly expanding and changing complex body of knowledge, protocols, and methodologies. Many of the problems in managing this complexity, however, appear susceptible to being addressed by artificial intelligence (AI) techniques, i.e., methods enabling computers to represent, acquire, and employ knowledge. Such methods can be employed to automate physical and informational "routine" work and thus better allow humans to focus their attention on the deeper scientific and engineering issues. This paper examines the potential impact of AI on the engineering of biological organisms through the lens of a typical organism engineering workflow. We identify a number of key opportunities for significant impact, as well as challenges that must be overcome. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  5. Artificial Intelligence, Counseling, and Cognitive Psychology. (United States)

    Brack, Greg; And Others

    With the exception of a few key writers, counselors largely ignore the benefits that Artificial Intelligence (AI) and Cognitive Psychology (CP) can bring to counseling. It is demonstrated that AI and CP can be integrated into the counseling literature. How AI and CP can offer new perspectives on information processing, cognition, and helping is…

  6. AIS ASM Operational Integration Plan (United States)


    Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

  7. The National Artificial Intelligence Research And Development Strategic Plan (United States)

    Networking and Information Technology Research and Development, Executive Office of the President — Executive Summary: Artificial intelligence (AI) is a transformative technology that holds promise for tremendous societal and economic benefit. AI has the potential...

  8. Exploring AI Language Assistants with Primary EFL Students (United States)

    Underwood, Joshua


    The main objective of this study was to identify ways to incorporate voice-driven Artificial Intelligence (AI) effectively in classroom language learning. This nine month teacher-led design research study employed technology probes (Amazon's Alexa, Apple's Siri, Google voice search) and co-design methods with a class of primary age English as a…

  9. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Erickson, S.A.


    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project.

  10. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    International Nuclear Information System (INIS)

    Erickson, S.A.


    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project


    A wide variety of artificial intelligence (AI) and structure-activity relationship (SAR approaches have been applied to tackling the general problem of predicting rodent chemical carcinogenicity. Given the diversity of chemical structures and mechanisms relative to this endpoin...

  12. Building Explainable Artificial Intelligence Systems

    National Research Council Canada - National Science Library

    Core, Mark G; Lane, H. Chad; van Lent, Michael; Gomboc, Dave; Solomon, Steve; Rosenberg, Milton


    As artificial intelligence (AI) systems and behavior models in military simulations become increasingly complex, it has been difficult for users to understand the activities of computer-controlled entities...

  13. Artificial Intelligence, Employment, and Income


    Nilsson, Nils J.


    Artificial intelligence (AI) will have profound societal effects. It promises potential benefits (and may also pose risks) in education, defense, business, law and science. In this article we explore how AI is likely to affect employment and the distribution of income. We argue that AI will indeed reduce drastically the need of human toil. We also note that some people fear the automation of work by machines and the resulting of unemployment. Yet, since the majority of us probably would rathe...

  14. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter


    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, the goal of

  15. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, an important

  16. Development and application of AI technology to plant operation and support

    International Nuclear Information System (INIS)

    Sackett, J.I.; Mott, J.E.


    This paper discusses a framework for the development and application of artificial intelligence (AI) technology in existing nuclear facilities and reviews the status of development. We consider those areas best addressed by AI technology, e.g., equipment diagnostics, sensor validation, and expert systems for procedural response or planning. A brief discussion of work in computer displays is also given. (orig./GL)

  17. An Empirical Study of AI Population Dynamics with Million-agent Reinforcement Learning


    Yang, Yaodong; Yu, Lantao; Bai, Yiwei; Wang, Jun; Zhang, Weinan; Wen, Ying; Yu, Yong


    In this paper, we conduct an empirical study on discovering the ordered collective dynamics obtained by a population of artificial intelligence (AI) agents. Our intention is to put AI agents into a simulated natural context, and then to understand their induced dynamics at the population level. In particular, we aim to verify if the principles developed in the real world could also be used in understanding an artificially-created intelligent population. To achieve this, we simulate a large-sc...

  18. Artificial Intelligence: A Selected Bibliography. (United States)

    Smith, Linda C., Comp.


    This 19-item annotated bibliography introducing the literature of artificial intelligence (AI) is arranged by type of material--handbook, books (general interest, textbooks, collected readings), journals and newsletters, and conferences and workshops. The availability of technical reports from AI laboratories at universities and private companies…

  19. Pavlovian, Skinner, and Other Behaviourists' Contributions to AI. Chapter 9 (United States)

    Kosinski, Withold; Zaczek-Chrzanowska, Dominika


    A version of the definition of intelligent behaviour will be supplied in the context of real and artificial systems. Short presentation of principles of learning, starting with Pavlovian s classical conditioning through reinforced response and operant conditioning of Thorndike and Skinner and finishing with cognitive learning of Tolman and Bandura will be given. The most important figures within behaviourism, especially those with contribution to AI, will be described. Some tools of artificial intelligence that act according to those principles will be presented. An attempt will be made to show when some simple rules for behaviour modifications can lead to a complex intelligent behaviour.

  20. Artificial Intelligence for the Bang! Game


    Daniláková, Monika


    This work explores artificial intelligence (AI) algorithms for the game Bang!, a Wild West-themed card game created by Italian game designer Emiliano Sciarra. The aim of this work was to design three different AIs for this game and to compare them theoretically and experimentally. First, we analyzed game Bang! with regards to game theory, and researched some of the AI algorithms used in similar games. We then designed three different AIs algorithms and compared their advantages and disadvanta...

  1. Artificial Intelligence Research in Australia -- A Profile


    Smith, Elizabeth; Whitelaw, John


    Does the United States have a 51st state called Australia? A superficial look at the artificial intelligence (AI) research being done here could give that impression. A look beneath the surface, though, indicates some fundamental differences and reveals a dynamic and rapidly expanding AI community. General awareness of the Australian AI research community has been growing slowly for some time. AI was once considered a bit esoteric -- the domain of an almost lunatic fringe- but the large gover...

  2. Northeast Artificial Intelligence Consortium Annual Report 1986. Volume 4. Part A. Hierarchical Region-Based Approach to Automatic Photointerpretation. Part B. Application of AI Techniques to Image Segmentation and Region Identification (United States)


    MONITORING ORGANIZATION Northeast Artificial (If applicaole)nelincCostum(AcRome Air Development Center (COCU) Inteligence Consortium (NAIC)I 6c. ADDRESS...f, Offell RADC-TR-88-1 1, Vol IV (of eight) Interim Technical ReportS June 1988 NORTHEAST ARTIFICIAL INTELLIGENCE CONSORTIUM ANNUAL REPORT 1986...13441-5700 EMENT NO NO NO ACCESSION NO62702F 5 8 71 " " over) I 58 27 13 " ൓ TITLE (Include Security Classification) NORTHEAST ARTIFICIAL INTELLIGENCE

  3. A Multimedia-Based System for Foreign Language Listening and Reading Comprehension

    National Research Council Canada - National Science Library

    Lichtblau, Dale


    .... It describes how integrating existing and proven multimedia and artificial intelligence technology, and the World Wide Web may provide an innovative and effective approach to foreign language learning in DoD...

  4. Artificial intelligence in medicine


    Scerri, Mariella; Grech, Victor E.


    Various types of artificial intelligence programs are already available as consultants to physicians, and these help in medical diagnostics and treatment. At the time of writing, extant programs constitute “weak” AI—lacking in consciousness and intentionality. With AI currently making rapid progress in all domains, including those of healthcare, physicians face possible competitors—or worse, claims that doctors may become obsolete. We will explore the development of AI and robotics in medicin...

  5. Essentials of artificial intelligence

    CERN Document Server

    Ginsberg, Matt


    Since its publication, Essentials of Artificial Intelligence has beenadopted at numerous universities and colleges offering introductory AIcourses at the graduate and undergraduate levels. Based on the author'scourse at Stanford University, the book is an integrated, cohesiveintroduction to the field. The author has a fresh, entertaining writingstyle that combines clear presentations with humor and AI anecdotes. At thesame time, as an active AI researcher, he presents the materialauthoritatively and with insight that reflects a contemporary, first hand

  6. SDI satellite autonomy using AI and Ada (United States)

    Fiala, Harvey E.


    The use of Artificial Intelligence (AI) and the programming language Ada to help a satellite recover from selected failures that could lead to mission failure are described. An unmanned satellite will have a separate AI subsystem running in parallel with the normal satellite subsystems. A satellite monitoring subsystem (SMS), under the control of a blackboard system, will continuously monitor selected satellite subsystems to become alert to any actual or potential problems. In the case of loss of communications with the earth or the home base, the satellite will go into a survival mode to reestablish communications with the earth. The use of an AI subsystem in this manner would have avoided the tragic loss of the two recent Soviet probes that were sent to investigate the planet Mars and its moons. The blackboard system works in conjunction with an SMS and a reconfiguration control subsystem (RCS). It can be shown to be an effective way for one central control subsystem to monitor and coordinate the activities and loads of many interacting subsystems that may or may not contain redundant and/or fault-tolerant elements. The blackboard system will be coded in Ada using tools such as the ABLE development system and the Ada Production system.

  7. Monitoring severe accidents using AI techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Ahn, Kwang Il; Kim, Ju Hyun; Na, Man Gyun; Lim, Dong Hyuk


    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  8. Monitoring severe accidents using AI techniques

    Energy Technology Data Exchange (ETDEWEB)

    No, Young Gyu; Ahn, Kwang Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Ju Hyun; Na, Man Gyun [Dept. of Nuclear Engineering, Chosun University, Gwangju (Korea, Republic of); Lim, Dong Hyuk [Korea Institute of Nuclear Nonproliferation and Control, Daejon (Korea, Republic of)


    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  9. Multimedia Information Retrieval

    CERN Document Server

    Rueger, Stefan


    At its very core multimedia information retrieval means the process of searching for and finding multimedia documents; the corresponding research field is concerned with building the best possible multimedia search engines. The intriguing bit here is that the query itself can be a multimedia excerpt: For example, when you walk around in an unknown place and stumble across an interesting landmark, would it not be great if you could just take a picture with your mobile phone and send it to a service that finds a similar picture in a database and tells you more about the building -- and about its

  10. AI techniques in geomagnetic storm forecasting (United States)

    Lundstedt, Henrik

    This review deals with how geomagnetic storms can be predicted with the use of Artificial Intelligence (AI) techniques. Today many different Al techniques have been developed, such as symbolic systems (expert and fuzzy systems) and connectionism systems (neural networks). Even integrations of AI techniques exist, so called Intelligent Hybrid Systems (IHS). These systems are capable of learning the mathematical functions underlying the operation of non-linear dynamic systems and also to explain the knowledge they have learned. Very few such powerful systems exist at present. Two such examples are the Magnetospheric Specification Forecast Model of Rice University and the Lund Space Weather Model of Lund University. Various attempts to predict geomagnetic storms on long to short-term are reviewed in this article. Predictions of a month to days ahead most often use solar data as input. The first SOHO data are now available. Due to the high temporal and spatial resolution new solar physics have been revealed. These SOHO data might lead to a breakthrough in these predictions. Predictions hours ahead and shorter rely on real-time solar wind data. WIND gives us real-time data for only part of the day. However, with the launch of the ACE spacecraft in 1997, real-time data during 24 hours will be available. That might lead to the second breakthrough for predictions of geomagnetic storms.

  11. Artificial intelligence, expert systems, computer vision, and natural language processing (United States)

    Gevarter, W. B.


    An overview of artificial intelligence (AI), its core ingredients, and its applications is presented. The knowledge representation, logic, problem solving approaches, languages, and computers pertaining to AI are examined, and the state of the art in AI is reviewed. The use of AI in expert systems, computer vision, natural language processing, speech recognition and understanding, speech synthesis, problem solving, and planning is examined. Basic AI topics, including automation, search-oriented problem solving, knowledge representation, and computational logic, are discussed.

  12. Social Intelligence Design in Ambient Intelligence

    NARCIS (Netherlands)

    Nijholt, Antinus; Stock, Oliviero; Stock, O.; Nishida, T.; Nishida, Toyoaki


    This Special Issue of AI and Society contains a selection of papers presented at the 6th Social Intelligence Design Workshop held at ITC-irst, Povo (Trento, Italy) in July 2007. Being the 6th in a series means that there now is a well-established and also a growing research area. The interest in

  13. Uncertainty in artificial intelligence

    CERN Document Server

    Levitt, TS; Lemmer, JF; Shachter, RD


    Clearly illustrated in this volume is the current relationship between Uncertainty and AI.It has been said that research in AI revolves around five basic questions asked relative to some particular domain: What knowledge is required? How can this knowledge be acquired? How can it be represented in a system? How should this knowledge be manipulated in order to provide intelligent behavior? How can the behavior be explained? In this volume, all of these questions are addressed. From the perspective of the relationship of uncertainty to the basic questions of AI, the book divides naturally i

  14. Neuroscience-Inspired Artificial Intelligence. (United States)

    Hassabis, Demis; Kumaran, Dharshan; Summerfield, Christopher; Botvinick, Matthew


    The fields of neuroscience and artificial intelligence (AI) have a long and intertwined history. In more recent times, however, communication and collaboration between the two fields has become less commonplace. In this article, we argue that better understanding biological brains could play a vital role in building intelligent machines. We survey historical interactions between the AI and neuroscience fields and emphasize current advances in AI that have been inspired by the study of neural computation in humans and other animals. We conclude by highlighting shared themes that may be key for advancing future research in both fields. Copyright © 2017. Published by Elsevier Inc.

  15. AI technology and automobile. ; Toward vehicle autonomy. AI gijutsu to jidosha. ; Sharyo no jiritsuka ni mukatte

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, A. (Mazda Motor Corp., Hiroshima (Japan))


    This report describes the vehicle autonomy by using artificial intelligence (AI) technology. Owing to a remarkable progress of AI technology, it is forecasted that driving support system will be introduced into the market till 2000, and higher autonomous navigation system will be introduced since about 2010. Autonomous vehicles have capacities of recognizing the outside world and of navigating roads by themselves, and with their enfanced environment adaptability the road transportation in the future is expected to be much more safer than in the present. The autonomous vehicle can warn its driver of potential dangers and correct operational errors of the driver. In order to realize such autonomous vehicles, extensive researches on perception systems, decision making systems and driving support systems are needed. 9 refs., 10 figs., 1 tab.

  16. A distributed multimedia toolbox

    NARCIS (Netherlands)

    Scholten, Johan; Jansen, P.G.


    Emphasis of our research lies on the application of realtime multimedia technology: tele-teaching, teleconferencing and collaborative work. To support this research we need a real-time environment that supports rapid prototyping of distributed multimedia applications. Because other systems were not

  17. Multimedia and Business Education. (United States)

    Klemin, V. Wayne


    Old technology (the computer) coupled with borrowed technology (television, film, and stereo) complemented by multimedia standards from IBM, Apple, and the MPC Council and linked by new software form a new technology called multimedia, being used in education and in business training. (Author/JOW)

  18. Teaching with Interactive Multimedia. (United States)

    Hudson, Tim

    Based on the idea that anyone who is interested in making entertaining and informative presentations in educational settings is interested in multimedia, this practical guide offers tips for communication (and other) teachers who want to integrate and program interactive multimedia into their courses. The guide suggests that teachers on limited…

  19. Application of AI technology to nuclear plant operations

    International Nuclear Information System (INIS)

    Sackett, J.I.


    In this paper, applications of Artificial Intelligence (AI) Technology to nuclear-power plant operation are reviewed. AI Technology is advancing rapidly and in the next five years is expected to enjoy widespread application to operation, maintenance, management and safety. Near term emphasis on a sensor validation, scheduling, alarm handling, and expert systems for procedural assistance. Ultimate applications are envisioned to culminate in autonomous control such as would be necessary for a power system in space, where automatic control actions are taken based upon reasoned conclusions regarding plant conditions, capability and control objectives

  20. AiGERM: A logic programming front end for GERM (United States)

    Hashim, Safaa H.


    AiGerm (Artificially Intelligent Graphical Entity Relation Modeler) is a relational data base query and programming language front end for MCC (Mission Control Center)/STP's (Space Test Program) Germ (Graphical Entity Relational Modeling) system. It is intended as an add-on component of the Germ system to be used for navigating very large networks of information. It can also function as an expert system shell for prototyping knowledge-based systems. AiGerm provides an interface between the programming language and Germ.

  1. Enabling technologies and methods for the retro-fitting of AI software into NPPS

    International Nuclear Information System (INIS)

    Pymm, P.


    Scottish Nuclear have a number of plant monitoring and training applications at their operational nuclear power plant which could benefit from the introduction of artificial intelligence (AI) software. An outline of early work on two current AI developments in the areas of advanced operator aids and intelligent training is given. A generic workstation based engineering simulator (WES) which provides a prototyping environment for AI product application development and evaluation and development of human-computer interface (HCI) designs for plant installation is described. It is concluded that the WES architecture facilitates both migration of the prototype AI application to the plant and collaboration in the AI field between Scottish Nuclear and other organizations. (author). 1 ref., 6 figs

  2. Progress and Challenge of Artificial Intelligence

    Institute of Scientific and Technical Information of China (English)

    Zhong-Zhi Shi; Nan-Ning Zheng


    Artificial Intelligence (AI) is generally considered to be a subfield of computer science, that is concerned to attempt simulation, extension and expansion of human intelligence. Artificial intelligence has enjoyed tremendous success over the last fifty years. In this paper we only focus on visual perception, granular computing, agent computing, semantic grid. Human-level intelligence is the long-term goal of artificial intelligence. We should do joint research on basic theory and technology of intelligence by brain science, cognitive science, artificial intelligence and others. A new cross discipline intelligence science is undergoing a rapid development. Future challenges are given in final section.

  3. Future and Feature of Intelligent Systems and Their Societies

    African Journals Online (AJOL)


    Dec 1, 2012 ... work covered the consequences of having artificial intelligent systems with us in the near future. Keywords: intelligence, systems, artificial ... AI as science and technology to develop computers that can think and function in.

  4. An application of artificial intelligence for rainfall–runoff modeling

    Indian Academy of Sciences (India)

    This study proposes an application of two techniques of artificial intelligence (AI) ... (2006) applied rainfall–runoff modeling using ANN ... in artificial intelligence, engineering and science .... usually be estimated from a sample of observations.

  5. Application of AI methods to aircraft guidance and control (United States)

    Hueschen, Richard M.; Mcmanus, John W.


    A research program for integrating artificial intelligence (AI) techniques with tools and methods used for aircraft flight control system design, development, and implementation is discussed. The application of the AI methods for the development and implementation of the logic software which operates with the control mode panel (CMP) of an aircraft is presented. The CMP is the pilot control panel for the automatic flight control system of a commercial-type research aircraft of Langley Research Center's Advanced Transport Operating Systems (ATOPS) program. A mouse-driven color-display emulation of the CMP, which was developed with AI methods and used to test the AI software logic implementation, is discussed. The operation of the CMP was enhanced with the addition of a display which was quickly developed with AI methods. The display advises the pilot of conditions not satisfied when a mode does not arm or engage. The implementation of the CMP software logic has shown that the time required to develop, implement, and modify software systems can be significantly reduced with the use of the AI methods.

  6. Artificial intelligence approaches in statistics

    International Nuclear Information System (INIS)

    Phelps, R.I.; Musgrove, P.B.


    The role of pattern recognition and knowledge representation methods from Artificial Intelligence within statistics is considered. Two areas of potential use are identified and one, data exploration, is used to illustrate the possibilities. A method is presented to identify and separate overlapping groups within cluster analysis, using an AI approach. The potential of such ''intelligent'' approaches is stressed

  7. AI its nature and future

    CERN Document Server

    Boden, Margaret A


    least - on the Internet. Margaret Boden considers the realistic and unrealistic expectations we have placed on AI, analyses its progress, and considers the value of its byproducts. ations we have placed on AI, analyses its progress, and considers the value of its byproducts.

  8. Intelligent Lighting Control System


    García, Elena; Rodríguez González, Sara; de Paz Santana, Juan F.; Bajo Pérez, Javier


    This paper presents an adaptive architecture that allows centralized control of public lighting and intelligent management, in order to economise on lighting and maintain maximum comfort status of the illuminated areas. To carry out this management, architecture merges various techniques of artificial intelligence (AI) and statistics such as artificial neural networks (ANN), multi-agent systems (MAS), EM algorithm, methods based on ANOVA and a Service Oriented Aproach (SOA). It performs optim...

  9. Multimedia image and video processing

    CERN Document Server

    Guan, Ling


    As multimedia applications have become part of contemporary daily life, numerous paradigm-shifting technologies in multimedia processing have emerged over the last decade. Substantially updated with 21 new chapters, Multimedia Image and Video Processing, Second Edition explores the most recent advances in multimedia research and applications. This edition presents a comprehensive treatment of multimedia information mining, security, systems, coding, search, hardware, and communications as well as multimodal information fusion and interaction. Clearly divided into seven parts, the book begins w

  10. Computational Foundations of Natural Intelligence. (United States)

    van Gerven, Marcel


    New developments in AI and neuroscience are revitalizing the quest to understanding natural intelligence, offering insight about how to equip machines with human-like capabilities. This paper reviews some of the computational principles relevant for understanding natural intelligence and, ultimately, achieving strong AI. After reviewing basic principles, a variety of computational modeling approaches is discussed. Subsequently, I concentrate on the use of artificial neural networks as a framework for modeling cognitive processes. This paper ends by outlining some of the challenges that remain to fulfill the promise of machines that show human-like intelligence.

  11. Computational Foundations of Natural Intelligence

    Directory of Open Access Journals (Sweden)

    Marcel van Gerven


    Full Text Available New developments in AI and neuroscience are revitalizing the quest to understanding natural intelligence, offering insight about how to equip machines with human-like capabilities. This paper reviews some of the computational principles relevant for understanding natural intelligence and, ultimately, achieving strong AI. After reviewing basic principles, a variety of computational modeling approaches is discussed. Subsequently, I concentrate on the use of artificial neural networks as a framework for modeling cognitive processes. This paper ends by outlining some of the challenges that remain to fulfill the promise of machines that show human-like intelligence.

  12. Benchmarking multimedia performance (United States)

    Zandi, Ahmad; Sudharsanan, Subramania I.


    With the introduction of faster processors and special instruction sets tailored to multimedia, a number of exciting applications are now feasible on the desktops. Among these is the DVD playback consisting, among other things, of MPEG-2 video and Dolby digital audio or MPEG-2 audio. Other multimedia applications such as video conferencing and speech recognition are also becoming popular on computer systems. In view of this tremendous interest in multimedia, a group of major computer companies have formed, Multimedia Benchmarks Committee as part of Standard Performance Evaluation Corp. to address the performance issues of multimedia applications. The approach is multi-tiered with three tiers of fidelity from minimal to full compliant. In each case the fidelity of the bitstream reconstruction as well as quality of the video or audio output are measured and the system is classified accordingly. At the next step the performance of the system is measured. In many multimedia applications such as the DVD playback the application needs to be run at a specific rate. In this case the measurement of the excess processing power, makes all the difference. All these make a system level, application based, multimedia benchmark very challenging. Several ideas and methodologies for each aspect of the problems will be presented and analyzed.

  13. Mapping change in scientific specialties: a scientometric case study of the development or artificial intelligence

    NARCIS (Netherlands)

    van den Besselaar, P.; Leydesdorff, L.


    Has an identifiable core of activities called AI been established, during the AI-boom in the eighties? Is AI already in a “paradigmatic” phase? There has been a lot of disagreement among commentators and specialists about the nature of Artificial Intelligence as a specialty. This makes AI an

  14. A framework for AI-based nuclear design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke


    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an exploration model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  15. Framework for AI-based nuclear reactor design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke


    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an explorative abduction model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  16. Towards AI-powered personalization in MOOC learning (United States)

    Yu, Han; Miao, Chunyan; Leung, Cyril; White, Timothy John


    Massive Open Online Courses (MOOCs) represent a form of large-scale learning that is changing the landscape of higher education. In this paper, we offer a perspective on how advances in artificial intelligence (AI) may enhance learning and research on MOOCs. We focus on emerging AI techniques including how knowledge representation tools can enable students to adjust the sequence of learning to fit their own needs; how optimization techniques can efficiently match community teaching assistants to MOOC mediation tasks to offer personal attention to learners; and how virtual learning companions with human traits such as curiosity and emotions can enhance learning experience on a large scale. These new capabilities will also bring opportunities for educational researchers to analyse students' learning skills and uncover points along learning paths where students with different backgrounds may require different help. Ethical considerations related to the application of AI in MOOC education research are also discussed.

  17. AI-guided parameter optimization in inverse treatment planning

    International Nuclear Information System (INIS)

    Yan Hui; Yin Fangfang; Guan Huaiqun; Kim, Jae Ho


    An artificial intelligence (AI)-guided inverse planning system was developed to optimize the combination of parameters in the objective function for intensity-modulated radiation therapy (IMRT). In this system, the empirical knowledge of inverse planning was formulated with fuzzy if-then rules, which then guide the parameter modification based on the on-line calculated dose. Three kinds of parameters (weighting factor, dose specification, and dose prescription) were automatically modified using the fuzzy inference system (FIS). The performance of the AI-guided inverse planning system (AIGIPS) was examined using the simulated and clinical examples. Preliminary results indicate that the expected dose distribution was automatically achieved using the AI-guided inverse planning system, with the complicated compromising between different parameters accomplished by the fuzzy inference technique. The AIGIPS provides a highly promising method to replace the current trial-and-error approach

  18. How AI turned the chess world upside down

    KAUST Repository

    Polgar, Susan


    Man vs. Machine! In 1977 an IBM supercomputer \\'Deep Blue\\' beat the reigning World Chess Champion Gary Kasparov in a 6 game chess match played under tournament conditions. This was the first time a machine beat a human at chess. It symbolized the emergence of Artificial Intelligence (AI) and the potential for great good (and great harm) from machines that have aspects of human intelligence. During this lecture Susan Polgar, a pioneer for Women in Chess, will share her remarkable story as well as how technology has changed the world of chess.

  19. Mathematics for multimedia

    CERN Document Server

    Wickerhauser, Mladen Victor


    Mathematics and Multimedia focuses on the mathematics behind multimedia applications. This timely and thoroughly modern text is a rigorous survey of selected results from algebra and analysis, requiring only undergraduate math skills.The topics are `gems' chosen for their usefulness in understanding and creating application software for multimedia signal processing and communication.The book is aimed at a wide audience, including computer science and mathematics majors and those interested in employing mathematics in multimedia design and implementation. For the instructor, the material is divided into six chapters that may be presented in six lecture hours each. Thus, the entire text may be covered in one semester, with time left for examinations and student projects. For the student,there are more than 100 exercises with complete solutions, and numerous example programs in Standard C. Each chapter ends with suggestions for further reading. A companion website provides more insight for both instructors and s...

  20. Ada in AI or AI in Ada. On developing a rationale for integration (United States)

    Collard, Philippe E.; Goforth, Andre


    The use of Ada as an Artificial Intelligence (AI) language is gaining interest in the NASA Community, i.e., by parties who have a need to deploy Knowledge Based-Systems (KBS) compatible with the use of Ada as the software standard for the Space Station. A fair number of KBS and pseudo-KBS implementations in Ada exist today. Currently, no widely used guidelines exist to compare and evaluate these with one another. The lack of guidelines illustrates a fundamental problem inherent in trying to compare and evaluate implementations of any sort in languages that are procedural or imperative in style, such as Ada, with those in languages that are functional in style, such as Lisp. Discussed are the strengths and weakness of using Ada as an AI language and a preliminary analysis provided of factors needed for the development of criteria for the integration of these two families of languages and the environments in which they are implemented. The intent for developing such criteria is to have a logical rationale that may be used to guide the development of Ada tools and methodology to support KBS requirements, and to identify those AI technology components that may most readily and effectively be deployed in Ada.

  1. Little AI: Playing a constructivist robot (United States)

    Georgeon, Olivier L.

    Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated "baby robot". The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player's commands. The player must learn, at the same time, the functioning of the robot's body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937), [1]).

  2. More Media, More People—On Social & Multimodal Media Intelligence


    Degerstedt, Lars; Pelle, Snickars


    The purpose of this article is to address some challenges facing media intelligence in general, and competitive intelligence in particular within an altered information landscape. To understand this new situation, the notion of social and multimodal media intelligence are introduced. With cases taken primarily from the Swedish media intelligence sector, we argue that data driven media intelligence today needs to pay increasing attention to new forms of (A.) crowd-oriented and (B.) multimedia-...

  3. Monitoring Severe Accidents Using AI Techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Kim, Ju Hyun; Na, Man Gyun; Ahn, Kwang Il


    It is very difficult for nuclear power plant operators to monitor and identify the major severe accident scenarios following an initiating event by staring at temporal trends of important parameters. The objective of this study is to develop and verify the monitoring for severe accidents using artificial intelligence (AI) techniques such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH) and fuzzy neural network (FNN). The SVC and PNN are used for event classification among the severe accidents. Also, GMDH and FNN are used to monitor for severe accidents. The inputs to AI techniques are initial time-integrated values obtained by integrating measurement signals during a short time interval after reactor scram. In this study, 3 types of initiating events such as the hot-leg LOCA, the cold-leg LOCA and SGTR are considered and it is verified how well the proposed scenario identification algorithm using the GMDH and FNN models identifies the timings when the reactor core will be uncovered, when CET will exceed 1200 .deg. F and when the reactor vessel will fail. In cases that an initiating event develops into a severe accident, the proposed algorithm showed accurate classification of initiating events. Also, it well predicted timings for important occurrences during severe accident progression scenarios, which is very helpful for operators to perform severe accident management

  4. Is Intelligence Artificial?


    Greer, Kieran


    Our understanding of intelligence is directed primarily at the level of human beings. This paper attempts to give a more unifying definition that can be applied to the natural world in general. The definition would be used more to verify a degree of intelligence, not to quantify it and might help when making judgements on the matter. A version of an accepted test for AI is then put forward as the 'acid test' for Artificial Intelligence itself. It might be what a free-thinking program or robot...

  5. Code AI Personal Web Pages (United States)

    Garcia, Joseph A.; Smith, Charles A. (Technical Monitor)


    The document consists of a publicly available web site ( for Joseph A. Garcia's personal web pages in the AI division. Only general information will be posted and no technical material. All the information is unclassified.

  6. Making Computers Smarter: A Look At the Controversial Field of Artificial Intelligence. (United States)

    Green, John O.


    Defines artificial intelligence (AI) and discusses its history; the current state of the art, research, experimentation, and practical applications; and probable future developments. Key dates in the history of AI and eight references are provided. (MBR)

  7. Proceedings of conference on AI applications in physical sciences

    International Nuclear Information System (INIS)


    A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

  8. Present status of application of AI in nuclear industry

    International Nuclear Information System (INIS)

    Kitamura, Masaharu


    Artificial intelligence (AL) techniques have been introduced actively in the nuclear industry in pursuit of increased safety and efficiency. The present report outlines some AI techniques currently used in nuclear facilities. This type of techniques have increasingly been introduced to such areas as design, construction, operation, maintenance, quality control and analysis. Most of them use knowledge engineering techniques including expert systems. Positive efforts at research and application of various more advance AI techniaues have started recently. For application of AI techniques, activities in nuclear power plants can be divided into two groups. One includes 'analytical' activities such as operation, maintenance and analysis, while the other includes 'synthetic' activities such as design, construction and fuel control. The most important AI technology for the analytical activities is diagnosis. Thus the report outlines major processes to which diagnostic techniques are applicable, and knowledge description and inference methods used for diagnosis. For AI techniques for synthetic activities, some problems and possible solutions are addressed. Development efforts in and outside Japan are also outlined. (Nogami, K.)

  9. Discovering Knowledge from AIS Database for Application in VTS (United States)

    Tsou, Ming-Cheng

    The widespread use of the Automatic Identification System (AIS) has had a significant impact on maritime technology. AIS enables the Vessel Traffic Service (VTS) not only to offer commonly known functions such as identification, tracking and monitoring of vessels, but also to provide rich real-time information that is useful for marine traffic investigation, statistical analysis and theoretical research. However, due to the rapid accumulation of AIS observation data, the VTS platform is often unable quickly and effectively to absorb and analyze it. Traditional observation and analysis methods are becoming less suitable for the modern AIS generation of VTS. In view of this, we applied the same data mining technique used for business intelligence discovery (in Customer Relation Management (CRM) business marketing) to the analysis of AIS observation data. This recasts the marine traffic problem as a business-marketing problem and integrates technologies such as Geographic Information Systems (GIS), database management systems, data warehousing and data mining to facilitate the discovery of hidden and valuable information in a huge amount of observation data. Consequently, this provides the marine traffic managers with a useful strategic planning resource.

  10. Artificial Intelligence and Public Healthcare Service Innovation

    DEFF Research Database (Denmark)

    Sun, Tara Qian; Medaglia, Rony

    Public healthcare ecosystems are complex networks of diverse actors that are subject to pressures to innovate, also a result of technological advancements. Artificial Intelligence (AI), in particular, has the potential to transform the way hospitals, doctors, patients, government agencies...

  11. Voice and gesture-based 3D multimedia presentation tool (United States)

    Fukutake, Hiromichi; Akazawa, Yoshiaki; Okada, Yoshihiro


    This paper proposes a 3D multimedia presentation tool that allows the user to manipulate intuitively only through the voice input and the gesture input without using a standard keyboard or a mouse device. The authors developed this system as a presentation tool to be used in a presentation room equipped a large screen like an exhibition room in a museum because, in such a presentation environment, it is better to use voice commands and the gesture pointing input rather than using a keyboard or a mouse device. This system was developed using IntelligentBox, which is a component-based 3D graphics software development system. IntelligentBox has already provided various types of 3D visible, reactive functional components called boxes, e.g., a voice input component and various multimedia handling components. IntelligentBox also provides a dynamic data linkage mechanism called slot-connection that allows the user to develop 3D graphics applications by combining already existing boxes through direct manipulations on a computer screen. Using IntelligentBox, the 3D multimedia presentation tool proposed in this paper was also developed as combined components only through direct manipulations on a computer screen. The authors have already proposed a 3D multimedia presentation tool using a stage metaphor and its voice input interface. This time, we extended the system to make it accept the user gesture input besides voice commands. This paper explains details of the proposed 3D multimedia presentation tool and especially describes its component-based voice and gesture input interfaces.

  12. Multimedia Pivot Tables for Multimedia Analytics on Image Collections

    NARCIS (Netherlands)

    Worring, M.; Koelma, D.; Zahálka, J.


    We propose a multimedia analytics solution for getting insight into image collections by extending the powerful analytic capabilities of pivot tables, found in the ubiquitous spreadsheets, to multimedia. We formalize the concept of multimedia pivot tables and give design rules and methods for the

  13. Event tree analysis using artificial intelligence techniques

    International Nuclear Information System (INIS)

    Dixon, B.W.; Hinton, M.F.


    Artificial Intelligence (AI) techniques used in Expert Systems and Object Oriented Programming are discussed as they apply to Event Tree Analysis. A SeQUence IMPortance calculator, SQUIMP, is presented to demonstrate the implementation of these techniques. Benefits of using AI methods include ease of programming, efficiency of execution, and flexibility of application. The importance of an appropriate user interface is stressed. 5 figs

  14. Artificial Intelligence, Computational Thinking, and Mathematics Education (United States)

    Gadanidis, George


    Purpose: The purpose of this paper is to examine the intersection of artificial intelligence (AI), computational thinking (CT), and mathematics education (ME) for young students (K-8). Specifically, it focuses on three key elements that are common to AI, CT and ME: agency, modeling of phenomena and abstracting concepts beyond specific instances.…

  15. Artificial intelligence approaches to astronomical observation scheduling (United States)

    Johnston, Mark D.; Miller, Glenn


    Automated scheduling will play an increasing role in future ground- and space-based observatory operations. Due to the complexity of the problem, artificial intelligence technology currently offers the greatest potential for the development of scheduling tools with sufficient power and flexibility to handle realistic scheduling situations. Summarized here are the main features of the observatory scheduling problem, how artificial intelligence (AI) techniques can be applied, and recent progress in AI scheduling for Hubble Space Telescope.

  16. Adding intelligence to scientific data management (United States)

    Campbell, William J.; Short, Nicholas M., Jr.; Treinish, Lloyd A.


    NASA plans to solve some of the problems of handling large-scale scientific data bases by turning to artificial intelligence (AI) are discussed. The growth of the information glut and the ways that AI can help alleviate the resulting problems are reviewed. The employment of the Intelligent User Interface prototype, where the user will generate his own natural language query with the assistance of the system, is examined. Spatial data management, scientific data visualization, and data fusion are discussed.

  17. Human-in-the-loop Artificial Intelligence


    Zanzotto, Fabio Massimo


    Little by little, newspapers are revealing the bright future that Artificial Intelligence (AI) is building. Intelligent machines will help everywhere. However, this bright future has a dark side: a dramatic job market contraction before its unpredictable transformation. Hence, in a near future, large numbers of job seekers will need financial support while catching up with these novel unpredictable jobs. This possible job market crisis has an antidote inside. In fact, the rise of AI is sustai...

  18. Semantic multimedia analysis and processing

    CERN Document Server

    Spyrou, Evaggelos; Mylonas, Phivos


    Broad in scope, Semantic Multimedia Analysis and Processing provides a complete reference of techniques, algorithms, and solutions for the design and the implementation of contemporary multimedia systems. Offering a balanced, global look at the latest advances in semantic indexing, retrieval, analysis, and processing of multimedia, the book features the contributions of renowned researchers from around the world. Its contents are based on four fundamental thematic pillars: 1) information and content retrieval, 2) semantic knowledge exploitation paradigms, 3) multimedia personalization, and 4)

  19. Displays enabling mobile multimedia (United States)

    Kimmel, Jyrki


    With the rapid advances in telecommunications networks, mobile multimedia delivery to handsets is now a reality. While a truly immersive multimedia experience is still far ahead in the mobile world, significant advances have been made in the constituent audio-visual technologies to make this become possible. One of the critical components in multimedia delivery is the mobile handset display. While such alternatives as headset-style near-to-eye displays, autostereoscopic displays, mini-projectors, and roll-out flexible displays can deliver either a larger virtual screen size than the pocketable dimensions of the mobile device can offer, or an added degree of immersion by adding the illusion of the third dimension in the viewing experience, there are still challenges in the full deployment of such displays in real-life mobile communication terminals. Meanwhile, direct-view display technologies have developed steadily, and can provide a development platform for an even better viewing experience for multimedia in the near future. The paper presents an overview of the mobile display technology space with an emphasis on the advances and potential in developing direct-view displays further to meet the goal of enabling multimedia in the mobile domain.

  20. Artificial intelligence in medicine. (United States)

    Hamet, Pavel; Tremblay, Johanne


    Artificial Intelligence (AI) is a general term that implies the use of a computer to model intelligent behavior with minimal human intervention. AI is generally accepted as having started with the invention of robots. The term derives from the Czech word robota, meaning biosynthetic machines used as forced labor. In this field, Leonardo Da Vinci's lasting heritage is today's burgeoning use of robotic-assisted surgery, named after him, for complex urologic and gynecologic procedures. Da Vinci's sketchbooks of robots helped set the stage for this innovation. AI, described as the science and engineering of making intelligent machines, was officially born in 1956. The term is applicable to a broad range of items in medicine such as robotics, medical diagnosis, medical statistics, and human biology-up to and including today's "omics". AI in medicine, which is the focus of this review, has two main branches: virtual and physical. The virtual branch includes informatics approaches from deep learning information management to control of health management systems, including electronic health records, and active guidance of physicians in their treatment decisions. The physical branch is best represented by robots used to assist the elderly patient or the attending surgeon. Also embodied in this branch are targeted nanorobots, a unique new drug delivery system. The societal and ethical complexities of these applications require further reflection, proof of their medical utility, economic value, and development of interdisciplinary strategies for their wider application. Copyright © 2017. Published by Elsevier Inc.

  1. The machine in multimedia analytics

    NARCIS (Netherlands)

    Zahálka, J.


    This thesis investigates the role of the machine in multimedia analytics, a discipline that combines visual analytics with multimedia analysis algorithms in order to unlock the potential of multimedia collections as sources of knowledge in scientific and applied domains. Specifically, the central

  2. Artificial intelligence in cardiology

    Directory of Open Access Journals (Sweden)

    Srishti Sharma


    Full Text Available Artificial intelligence (AI provides machines with the ability to learn and respond the way humans do and is also referred to as machine learning. The step to building an AI system is to provide the data to learn from so that it can map relations between inputs and outputs and set up parameters such as “weights”/decision boundaries to predict responses for inputs in the future. Then, the model is tested on a second data set. This article outlines the promise this analytic approach has in medicine and cardiology.

  3. Artificial Intelligence in Surgery: Promises and Perils. (United States)

    Hashimoto, Daniel A; Rosman, Guy; Rus, Daniela; Meireles, Ozanan R


    The aim of this review was to summarize major topics in artificial intelligence (AI), including their applications and limitations in surgery. This paper reviews the key capabilities of AI to help surgeons understand and critically evaluate new AI applications and to contribute to new developments. AI is composed of various subfields that each provide potential solutions to clinical problems. Each of the core subfields of AI reviewed in this piece has also been used in other industries such as the autonomous car, social networks, and deep learning computers. A review of AI papers across computer science, statistics, and medical sources was conducted to identify key concepts and techniques within AI that are driving innovation across industries, including surgery. Limitations and challenges of working with AI were also reviewed. Four main subfields of AI were defined: (1) machine learning, (2) artificial neural networks, (3) natural language processing, and (4) computer vision. Their current and future applications to surgical practice were introduced, including big data analytics and clinical decision support systems. The implications of AI for surgeons and the role of surgeons in advancing the technology to optimize clinical effectiveness were discussed. Surgeons are well positioned to help integrate AI into modern practice. Surgeons should partner with data scientists to capture data across phases of care and to provide clinical context, for AI has the potential to revolutionize the way surgery is taught and practiced with the promise of a future optimized for the highest quality patient care.

  4. The impact of artificial intelligence on the world economy


    Kuprevich, T. S.


    In the article the potential benefits and opportunities offered by AI in the world economy are considered. In the course of the research benefits and tendencies of artificial intelligence in the world economy were revealed, the main directions of development and barriers of artificial intelligence adoption are analyzed and revealed. Nowadays artificial intelligence (AI) is going mainstream, driven by machine learning, big data and cloud computing.

  5. Artificial Intelligence in Autonomous Telescopes (United States)

    Mahoney, William; Thanjavur, Karun


    Artificial Intelligence (AI) is key to the natural evolution of today's automated telescopes to fully autonomous systems. Based on its rapid development over the past five decades, AI offers numerous, well-tested techniques for knowledge based decision making essential for real-time telescope monitoring and control, with minimal - and eventually no - human intervention. We present three applications of AI developed at CFHT for monitoring instantaneous sky conditions, assessing quality of imaging data, and a prototype for scheduling observations in real-time. Closely complementing the current remote operations at CFHT, we foresee further development of these methods and full integration in the near future.

  6. Semantic HyperMultimedia Adaptation Schemes and Applications

    CERN Document Server

    Bieliková, Mária; Mylonas, Phivos; Tsapatsoulis, Nicolas


    Nowadays, more and more users are witnessing the impact of Hypermedia/Multimedia as well as the penetration of social applications in their life. Parallel to the evolution of the Internet and Web, several Hypermedia/Multimedia schemes and technologies bring semantic-based intelligent, personalized and adaptive services to the end users. More and more techniques are applied in media systems in order to be user/group-centric, adapting to different content and context features of a single or a community user. In respect to all the above, researchers need to explore and study the plethora of challenges that emergent personalisation and adaptation technologies bring to the new era. This edited volume aims to increase the awareness of researchers in this area. All contributions provide an in-depth investigation on research and deployment issues, regarding already introduced schemes and applications in Semantic Hyper/Multimedia and Social Media Adaptation. Moreover, the authors provide survey-based articles, so as p...

  7. Artificial Intelligence and Information Management (United States)

    Fukumura, Teruo

    After reviewing the recent popularization of the information transmission and processing technologies, which are supported by the progress of electronics, the authors describe that by the introduction of the opto-electronics into the information technology, the possibility of applying the artificial intelligence (AI) technique to the mechanization of the information management has emerged. It is pointed out that althuogh AI deals with problems in the mental world, its basic methodology relies upon the verification by evidence, so the experiment on computers become indispensable for the study of AI. The authors also describe that as computers operate by the program, the basic intelligence which is concerned in AI is that expressed by languages. This results in the fact that the main tool of AI is the logical proof and it involves an intrinsic limitation. To answer a question “Why do you employ AI in your problem solving”, one must have ill-structured problems and intend to conduct deep studies on the thinking and the inference, and the memory and the knowledge-representation. Finally the authors discuss the application of AI technique to the information management. The possibility of the expert-system, processing of the query, and the necessity of document knowledge-base are stated.

  8. Advanced Signal Processing for Wireless Multimedia Communications

    Directory of Open Access Journals (Sweden)

    Xiaodong Wang


    Full Text Available There is at present a worldwide effort to develop next-generation wireless communication systems. It is envisioned that many of the future wireless systems will incorporate considerable signal-processing intelligence in order to provide advanced services such as multimedia transmission. In general, wireless channels can be very hostile media through which to communicate, due to substantial physical impediments, primarily radio-frequency interference and time-arying nature of the channel. The need of providing universal wireless access at high data-rate (which is the aim of many merging wireless applications presents a major technical challenge, and meeting this challenge necessitates the development of advanced signal processing techniques for multiple-access communications in non-stationary interference-rich environments. In this paper, we present some key advanced signal processing methodologies that have been developed in recent years for interference suppression in wireless networks. We will focus primarily on the problem of jointly suppressing multiple-access interference (MAI and intersymbol interference (ISI, which are the limiting sources of interference for the high data-rate wireless systems being proposed for many emerging application areas, such as wireless multimedia. We first present a signal subspace approach to blind joint suppression of MAI and ISI. We then discuss a powerful iterative technique for joint interference suppression and decoding, so-called Turbo multiuser detection, that is especially useful for wireless multimedia packet communications. We also discuss space-time processing methods that employ multiple antennas for interference rejection and signal enhancement. Finally, we touch briefly on the problems of suppressing narrowband interference and impulsive ambient noise, two other sources of radio-frequency interference present in wireless multimedia networks.

  9. 75 FR 49528 - Freescale Semiconductor, Inc., Networking and Multimedia Group (“NMG”) Excluding the Multimedia... (United States)


    ... services for chips used in networking and multimedia products. The company reports that workers leased from... Multimedia Applications Division, including on-site workers of Synergy Services, Craftcorp, Directions..., Inc., Networking and Multimedia Group (``NMG'') Excluding the Multimedia Applications Division...

  10. Towards Brain-inspired Web Intelligence (United States)

    Zhong, Ning

    Artificial Intelligence (AI) has been mainly studied within the realm of computer based technologies. Various computational models and knowledge based systems have been developed for automated reasoning, learning, and problem-solving. However, there still exist several grand challenges. The AI research has not produced major breakthrough recently due to a lack of understanding of human brains and natural intelligence. In addition, most of the AI models and systems will not work well when dealing with large-scale, dynamically changing, open and distributed information sources at a Web scale.

  11. The role of automation and artificial intelligence (United States)

    Schappell, R. T.


    Consideration is given to emerging technologies that are not currently in common use, yet will be mature enough for implementation in a space station. Artificial intelligence (AI) will permit more autonomous operation and improve the man-machine interfaces. Technology goals include the development of expert systems, a natural language query system, automated planning systems, and AI image understanding systems. Intelligent robots and teleoperators will be needed, together with improved sensory systems for the robotics, housekeeping, vehicle control, and spacecraft housekeeping systems. Finally, NASA is developing the ROBSIM computer program to evaluate level of automation, perform parametric studies and error analyses, optimize trajectories and control systems, and assess AI technology.

  12. Introducing artificial intelligence into structural optimization programs

    International Nuclear Information System (INIS)

    Jozwiak, S.F.


    Artificial Intelligence /AI/ is defined as the branch of the computer science concerned with the study of the ideas that enable computers to be intelligent. The main purpose of the application of AI in engineering is to develop computer programs which function better as tools for engineers and designers. Many computer programs today have properties which make them inconvenient to their final users and the research carried within the field of AI provides tools and techniques so that these restriction can be removed. The continuous progress in computer technology has lead to developing efficient computer systems which can be applied to more than simple solving sets of equations. (orig.)

  13. The potential of artificial intelligence toys

    DEFF Research Database (Denmark)

    Dai, Zheng


    Artificial intelligence is moving to a next step of development and application areas. From electronic games to human-like robots, AI toy is a good choice for next step during this process. Technology-based design is fit to the development of AI toy. It can exert the advantages and explore more...... value for existing resources. It combines AI programs and common sensors to realize the function of intelligence input and output. Designers can use technology-based criteria to design and need to consider the possible issues in this new field. All of these aspects can be referenced from electronic game...

  14. Reconfigurable Mobile Multimedia

    NARCIS (Netherlands)

    Smit, Gerardus Johannes Maria; Bos, M.; Havinga, Paul J.M.; Smit, Jaap


    This paper discusses reconfigurability issues in lowpower hand-held multimedia systems, with particular emphasis on energy conservation. We claim that a radical new approach has to be taken in order to fulfill the requirements - in terms of processing power and energy consumption - of future mobile

  15. Storyboarding Multimedia Interactions. (United States)

    Martin, Linda C.


    Understanding how to include interactivity when designing multimedia-based training (MBT) storyboards is a major key for a successful MBT. Discusses the basic formats of interactions and when to use each format. Describes how to storyboard and areas to address, including: the display area, prompts, branching, programming and graphics notes,…

  16. Creating meaningful multimedia presentations

    NARCIS (Netherlands)

    Hardman, H.L.; Ossenbruggen, van J.R.


    Finding relevant information is one step in the chain of understanding information. Presenting material to a user in a suitable way is a further step. Our research focuses on using semantic annotations of multimedia elements to increase the "presentability" of retrieved information. We investigate

  17. Creating Meaningful Multimedia Presentations

    NARCIS (Netherlands)

    L. Hardman (Lynda); J.R. van Ossenbruggen (Jacco)


    textabstractFinding relevant information is one step in the chain of understanding information. Presenting material to a user in a suitable way is a further step. Our research focuses on using semantic annotations of multimedia elements to increase the ”presentability” of

  18. Social Multimedia and Storytelling

    NARCIS (Netherlands)

    S. Papadopoulos; P.S. Cesar Garcia (Pablo Santiago); D.A. Shamma (David); A. Kelliher; R. Jain (Rahul)


    htmlabstractThis special issue touches on many significant aspects of multimedia retrieval, including content analysis and understanding, content- and context-based indexing, search and retrieval, HCI technologies, and image and video summarization and visualization. It converges on the nexus of

  19. Multimedia Teacher Research (United States)

    Leaman, Heather; DiLucchio, Connie


    In this qualitative study, two teacher educators and course instructors in a Masters of Education (M.Ed.) program explored beginning teacher researchers' use of multimedia to support action research. Fifty-eight teachers (36 in spring 2010 and 22 in spring 2011) completed teacher research as the capstone in their M.Ed. program. Teachers utilized…

  20. A quick overview of artificial intelligence and expert systems

    International Nuclear Information System (INIS)

    Engelmore, R.S.


    Artificial intelligence (AI) is almost a household word these days. There have been several conferences held in this country over the last two years on artificial intelligence and its applications. The international AI conference at Snowbird, Utah, in 1987 centered on AI applications in the nuclear industry. This paper serves as an introductory overview of the subject of AI for this state-of-the-art review of AI applications in the nuclear industry. We introduce the subject in a way that will be relevant to many people in the nuclear industry who have heard of AI but are not familiar with it and are looking for answers to several simple questions. We attempt to answer those simple questions here and prepare the reader so that he or she can appreciate the following sections on AI applications in the nuclear field. (orig./GL)

  1. Artificial-intelligence-based optimization of the management of snow removal assets and resources. (United States)


    Geographic information systems (GIS) and artificial intelligence (AI) techniques were used to develop an intelligent : snow removal asset management system (SRAMS). The system has been evaluated through a case study examining : snow removal from the ...

  2. Des résumés en français

    Directory of Open Access Journals (Sweden)

    Bogdan Patrut


    Full Text Available Des résumés en français
    BRAIN. Broad Research in Artificial Intelligence and Neuroscience
    CERVEAU. Recherche large en intelligence artificielle et neurosciences
    Volume 1, Numéro 4
    Juillet 2010: « Automne 2010»
    Sous la direction de: Bogdan Pătruţ

  3. Artificial intelligence in radiology. (United States)

    Hosny, Ahmed; Parmar, Chintan; Quackenbush, John; Schwartz, Lawrence H; Aerts, Hugo J W L


    Artificial intelligence (AI) algorithms, particularly deep learning, have demonstrated remarkable progress in image-recognition tasks. Methods ranging from convolutional neural networks to variational autoencoders have found myriad applications in the medical image analysis field, propelling it forward at a rapid pace. Historically, in radiology practice, trained physicians visually assessed medical images for the detection, characterization and monitoring of diseases. AI methods excel at automatically recognizing complex patterns in imaging data and providing quantitative, rather than qualitative, assessments of radiographic characteristics. In this Opinion article, we establish a general understanding of AI methods, particularly those pertaining to image-based tasks. We explore how these methods could impact multiple facets of radiology, with a general focus on applications in oncology, and demonstrate ways in which these methods are advancing the field. Finally, we discuss the challenges facing clinical implementation and provide our perspective on how the domain could be advanced.

  4. AI mass spectrometers for space shuttle health monitoring (United States)

    Adams, F. W.


    The facility Hazardous Gas Detection System (HGDS) at Kennedy Space Center (KSC) is a mass spectrometer based gas analyzer. Two instruments make up the HGDS, which is installed in a prime/backup arrangement, with the option of using both analyzers on the same sample line, or on two different lines simultaneously. It is used for monitoring the Shuttle during fuel loading, countdown, and drainback, if necessary. The use of complex instruments, operated over many shifts, has caused problems in tracking the status of the ground support equipment (GSE) and the vehicle. A requirement for overall system reliability has been a major force in the development of Shuttle GSE, and is the ultimate driver in the choice to pursue artificial intelligence (AI) techniques for Shuttle and Advanced Launch System (ALS) mass spectrometer systems. Shuttle applications of AI are detailed.

  5. Operator interfaces in the nuclear environment: will multimedia help?

    International Nuclear Information System (INIS)

    Alty, J.L.


    In recent years the number of media available on computer systems has considerably increased. Even quite modest personal computer systems can now offer video, audio and animation in addition to standard test and colour graphics. Such new media offer enhanced opportunities for improved communication when combined with intelligent advisory software. This Paper discusses multimedia interfaces, their experimental use in a nuclear power plant and a chemical plant and assesses their likely impact. (author)

  6. Artificial intelligence in astronomy - a forecast. (United States)

    Adorf, H. M.

    Since several years artificial intelligence techniques are being actively used in astronomy, particularly within the Hubble Space Telescope project. This contribution reviews achievements, analyses some problems of using artificial intelligence in an astronomical environment, and projects current AI programming trends into the future.

  7. The Artificial Intelligence Applications to Learning Programme. (United States)

    Williams, Noel


    Explains the Artificial Intelligence Applications to Learning Programme, which was developed in the United Kingdom to explore and accelerate the use of artificial intelligence (AI) technologies in learning in both the educational and industrial sectors. Highlights include program evaluation, marketing, ownership of information, consortia, and cost…

  8. Does Wittgenstein Actually Undermine the Foundation of Artificial Intelligence?

    Institute of Scientific and Technical Information of China (English)

    XU Yingjin


    Wittgenstein is widely viewed as a potential critic of a key philosophical assumption of the Strong Artificial Intelligence (AI) thesis,namely,that it is in principle possible to build a programmed machine which can achieve real intelligence.Stuart Shanker has provided the most systematic reconstruction of the Wittgensteinian argument against AI,building on Wittgenstein's own statements,the "rule-following" feature of language-games,and the putative alliance between AI and psychologism.This article will attempt to refute this reconstruction and its constituent arguments,thereby paving the way for a new and amicable rather than agonistic conception of the Wittgensteinian position on AI.

  9. Artificial Intelligence Techniques and Methodology


    Carbonell, Jaime G.; Sleeman, Derek


    Two closely related aspects of artificial intelligence that have received comparatively little attention in the recent literature are research methodology, and the analysis of computational techniques that span multiple application areas. We believe both issues to be increasingly significant as Artificial Intelligence matures into a science and spins off major application efforts. It is imperative to analyze the repertoire of AI methods with respect to past experience, utility in new domains,...

  10. Multimedia Pivot Tables for Multimedia Analytics on Image Collections


    Worring, M.; Koelma, D.; Zahálka, J.


    We propose a multimedia analytics solution for getting insight into image collections by extending the powerful analytic capabilities of pivot tables, found in the ubiquitous spreadsheets, to multimedia. We formalize the concept of multimedia pivot tables and give design rules and methods for the multimodal summarization, structuring, and browsing of the collection based on these tables, all optimized to support an analyst in getting structural and conclusive insights. Our proposed solution p...

  11. AI Tools Bridge Technology Gap. (United States)

    Rauch-Hindin, Wendy


    This second part of a report on artificial intelligence focuses on the development of expert systems in a variety of applications, from engineering to science, and details expectations for implementation of these systems. (JN)

  12. Artificial intelligence executive summary

    International Nuclear Information System (INIS)

    Wamsley, S.J.; Purvis, E.E. III


    Artificial intelligence (AI) is a high technology field that can be used to provide problem solving diagnosis, guidance and for support resolution of problems. It is not a stand alone discipline, but can also be applied to develop data bases for retention of the expertise that is required for its own knowledge base. This provides a way to retain knowledge that otherwise may be lost. Artificial Intelligence Methodology can provide an automated construction management decision support system, thereby restoring the manager's emphasis to project management

  13. Indexing and retrieval of multimedia objects at different levels of granularity (United States)

    Faudemay, Pascal; Durand, Gwenael; Seyrat, Claude; Tondre, Nicolas


    Intelligent access to multimedia databases for `naive user' should probably be based on queries formulation by `intelligent agents'. These agents should `understand' the semantics of the contents, learn user preferences and deliver to the user a subset of the source contents, for further navigation. The goal of such systems should be to enable `zero-command' access to the contents, while keeping the freedom of choice of the user. Such systems should interpret multimedia contents in terms of multiple audiovisual objects (from video to visual or audio object), and on actions and scenarios.

  14. Artificial intelligence in power system optimization

    CERN Document Server

    Ongsakul, Weerakorn


    With the considerable increase of AI applications, AI is being increasingly used to solve optimization problems in engineering. In the past two decades, the applications of artificial intelligence in power systems have attracted much research. This book covers the current level of applications of artificial intelligence to the optimization problems in power systems. This book serves as a textbook for graduate students in electric power system management and is also be useful for those who are interested in using artificial intelligence in power system optimization.

  15. Integrating Multimedia and Physics Problems (United States)

    Titus, Aaron P.


    Although expert problem solvers typically use pictorial representations when solving problems, novices tend to proceed from the given problem statement to a mathematical solution without first developing a visual representation of the problem. For this reason, multimedia may be an effective tool to enhance students' success at solving problems. However, merely presenting a video of motion described in a problem is not necessarily the most effective method as was found in a recent study of students' responses on Web-based homework questions. Rather, multimedia-focused problems, where data relevant to solving the problem is embedded in a video or animation, may be the best use of multimedia in problem solving. Examples of multimedia-enhanced problems and multimedia-focused problems will be demonstrated, and their differences from "traditional" problems will be highlighted. Recommendations on the use of multimedia with problem solving and preliminary data on students' success at solving these problems will be discussed.

  16. Optimizing Limousine Service with AI


    Chun, Andy Hon Wai


    A common problem for companies with strong business growth is that it is hard to find enough experienced staff to support expansion needs. This problem is particular pronounced for operations planners and controllers who must be very highly knowledgeable and experienced with the business domain. This article is a case study of how one of the largest travel agencies in Hong Kong alleviated this problem by using AI to support decision-making and problem-solving so that their planners and contro...

  17. Multimedia programming with pure data

    CERN Document Server

    Chung, Bryan


    A quick and comprehensive tutorial book for media designers to jump-start interactive multimedia production with computer graphics, digital audio, digital video, and interactivity, using the Pure Data graphical programming environment.An introductory book on multimedia programming for media artists/designers who like to work on interactivity in their projects, digital art/design students who like to learn the first multimedia programming technique, and audio-visual performers who like to customize their performance sets

  18. Little AI: Playing a constructivist robot

    Directory of Open Access Journals (Sweden)

    Olivier L. Georgeon


    Full Text Available Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated “baby robot”. The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player’s commands. The player must learn, at the same time, the functioning of the robot’s body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937, [1].

  19. STAR - A computer language for hybrid AI applications (United States)

    Borchardt, G. C.


    Constructing Artificial Intelligence application systems which rely on both symbolic and non-symbolic processing places heavy demands on the communication of data between dissimilar languages. This paper describes STAR (Simple Tool for Automated Reasoning), a computer language for the development of AI application systems which supports the transfer of data structures between a symbolic level and a non-symbolic level defined in languages such as FORTRAN, C and PASCAL. The organization of STAR is presented, followed by the description of an application involving STAR in the interpretation of airborne imaging spectrometer data.

  20. Alarm processing system using AI techniques for nuclear power plant

    International Nuclear Information System (INIS)

    Yang, Joon On; Chang, Soon Heung


    An alarm processing system (APS) has been developed using artificial intelligence (AI) techniques. The alarms of nuclear power plants (NPP's) are classified into the generalized and special alarms. The generalized alarms are also classified into the global and local alarms. For each type of alarms, the specific processing rules are applied to filter and suppress unnecessary and potentially misleading alarms. The local processing are based on 'model-based reasoning.' The global and special alarms are processed by using the general cause-consequence check rules. The priorities of alarms are determined according to the plant state and the consistencies between them

  1. ReACT!: An Interactive Educational Tool for AI Planning for Robotics (United States)

    Dogmus, Zeynep; Erdem, Esra; Patogulu, Volkan


    This paper presents ReAct!, an interactive educational tool for artificial intelligence (AI) planning for robotics. ReAct! enables students to describe robots' actions and change in dynamic domains without first having to know about the syntactic and semantic details of the underlying formalism, and to solve planning problems using…

  2. Cognitive Maps, AI Agents and Personalized Virtual Environments in Internet Learning Experiences. (United States)

    Maule, R. William


    Develops frameworks to help Internet media designers address end-user information presentation preferences by advancing structures for assessing metadata design variables which are then linked to user cognitive styles. An underlying theme is that artificial intelligence (AI) methodologies may be used to help automate the Internet media design…

  3. Autonomously generating operations sequences for a Mars Rover using AI-based planning (United States)

    Sherwood, Rob; Mishkin, Andrew; Estlin, Tara; Chien, Steve; Backes, Paul; Cooper, Brian; Maxwell, Scott; Rabideau, Gregg


    This paper discusses a proof-of-concept prototype for ground-based automatic generation of validated rover command sequences from highlevel science and engineering activities. This prototype is based on ASPEN, the Automated Scheduling and Planning Environment. This Artificial Intelligence (AI) based planning and scheduling system will automatically generate a command sequence that will execute within resource constraints and satisfy flight rules.

  4. NASA space station automation: AI-based technology review. Executive summary (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Cheeseman, P. C.; Goldberg, J.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.


    Research and Development projects in automation technology for the Space Station are described. Artificial Intelligence (AI) based technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics.

  5. Group Coordination Support in Networked Multimedia Systems

    National Research Council Canada - National Science Library

    Dommel, Hans-Peter


    .... In this dissertation, we address network control and coordination functions to orchestrate synchronous multimedia groupwork, establishing a sharing discipline on multimedia resources and guaranteeing...

  6. Ethical Considerations in Artificial Intelligence Courses


    Burton, Emanuelle; Goldsmith, Judy; Koenig, Sven; Kuipers, Benjamin; Mattei, Nicholas; Walsh, Toby


    The recent surge in interest in ethics in artificial intelligence may leave many educators wondering how to address moral, ethical, and philosophical issues in their AI courses. As instructors we want to develop curriculum that not only prepares students to be artificial intelligence practitioners, but also to understand the moral, ethical, and philosophical impacts that artificial intelligence will have on society. In this article we provide practical case studies and links to resources for ...

  7. Artificial intelligence in healthcare: past, present and future. (United States)

    Jiang, Fei; Jiang, Yong; Zhi, Hui; Dong, Yi; Li, Hao; Ma, Sufeng; Wang, Yilong; Dong, Qiang; Shen, Haipeng; Wang, Yongjun


    Artificial intelligence (AI) aims to mimic human cognitive functions. It is bringing a paradigm shift to healthcare, powered by increasing availability of healthcare data and rapid progress of analytics techniques. We survey the current status of AI applications in healthcare and discuss its future. AI can be applied to various types of healthcare data (structured and unstructured). Popular AI techniques include machine learning methods for structured data, such as the classical support vector machine and neural network, and the modern deep learning, as well as natural language processing for unstructured data. Major disease areas that use AI tools include cancer, neurology and cardiology. We then review in more details the AI applications in stroke, in the three major areas of early detection and diagnosis, treatment, as well as outcome prediction and prognosis evaluation. We conclude with discussion about pioneer AI systems, such as IBM Watson, and hurdles for real-life deployment of AI.

  8. Artificial intelligence in healthcare: past, present and future (United States)

    Jiang, Fei; Jiang, Yong; Zhi, Hui; Dong, Yi; Li, Hao; Ma, Sufeng; Wang, Yilong; Dong, Qiang; Shen, Haipeng; Wang, Yongjun


    Artificial intelligence (AI) aims to mimic human cognitive functions. It is bringing a paradigm shift to healthcare, powered by increasing availability of healthcare data and rapid progress of analytics techniques. We survey the current status of AI applications in healthcare and discuss its future. AI can be applied to various types of healthcare data (structured and unstructured). Popular AI techniques include machine learning methods for structured data, such as the classical support vector machine and neural network, and the modern deep learning, as well as natural language processing for unstructured data. Major disease areas that use AI tools include cancer, neurology and cardiology. We then review in more details the AI applications in stroke, in the three major areas of early detection and diagnosis, treatment, as well as outcome prediction and prognosis evaluation. We conclude with discussion about pioneer AI systems, such as IBM Watson, and hurdles for real-life deployment of AI. PMID:29507784

  9. Synthesis and Analysis in Artificial Intelligence: The Role of Theory in Agent Implementation

    NARCIS (Netherlands)

    Raine, Roxanne B.; op den Akker, Hendrikus J.A.; Cai, Zhiqiang; Graesser, Arthur C.; McNamara, Danielle S.


    The domain of artificial intelligence (AI) progresses with extraordinary vicissitude. Whereas prior authors have divided AI into the two categories of analysis and synthesis, Raine and op den Akker distinguish between four types of AI: that of appearance, function, simulation and interpretation.

  10. 26th International Conference on Industrial, Engineering & Other Applications of Applied Intelligent Systems (IEA/AIE)

    CERN Document Server

    Bosse, Tibor; Hindriks, Koen; Hoogendoorn, Mark; Jonker, Catholijn; Treur, Jan; Contemporary Challenges and Solutions in Applied Artificial Intelligence


      Since its origination in the mid-twentieth century, the area of Artificial Intelligence (AI) has undergone a number of developments. While the early interest in AI was mainly triggered by the desire to develop artifacts that show the same intelligent behavior as humans, nowadays scientists have realized that research in AI involves a multitude of separate challenges, besides the traditional goal to replicate human intelligence. In particular, recent history has pointed out that a variety of ‘intelligent’ computational techniques, part of which are inspired by human intelligence, may be successfully applied to solve all kinds of practical problems. This sub-area of AI, which has its main emphasis on applications of intelligent systems to solve real-life problems, is currently known under the term Applied Intelligence.   The objective of the International Conference on Industrial, Engineering & Other Applications of Applied Intelligent Systems (IEA/AIE) is to promote and disseminate recent research ...

  11. An overview of artificial intelligence and robotics. Volume 1: Artificial intelligence. Part A: The core ingredients (United States)

    Gevarter, W. B.


    Artificial Intelligence (AI) is an emerging technology that has recently attracted considerable attention. Many applications are now under development. The goal of Artificial Intelligence is focused on developing computational approaches to intelligent behavior. This goal is so broad - covering virtually all aspects of human cognitive activity - that substantial confusion has arisen as to the actual nature of AI, its current status and its future capability. This volume, the first in a series of NBS/NASA reports on the subject, attempts to address these concerns. Thus, this report endeavors to clarify what AI is, the foundations on which it rests, the techniques utilized, applications, the participants and, finally, AI's state-of-the-art and future trends. It is anticipated that this report will prove useful to government and private engineering and research managers, potential users, and others who will be affected by this field as it unfolds.

  12. Challenges in introduction of artificial intelligence in medical practice – a review of clinical trials concerning adaptation of artificial intelligence in medicine


    Mielnik, Pawel Franciszek; Fojcik, Marcin; Kulbacki, Marek; Segen, Jakub


    An interest in Artificial Intelligence [AI] as science is growing in the last years. It has become gradually more used in the medicine. Methodology of development and testing of AI algorithms is generally well established. Use of AI in medicine requires elaboration of standards of its validation in clinical settings. This paper is a review of literature concerning clinical trials on AI adaptation in medicine

  13. [Artificial Intelligence in Drug Discovery]. (United States)

    Fujiwara, Takeshi; Kamada, Mayumi; Okuno, Yasushi


    According to the increase of data generated from analytical instruments, application of artificial intelligence(AI)technology in medical field is indispensable. In particular, practical application of AI technology is strongly required in "genomic medicine" and "genomic drug discovery" that conduct medical practice and novel drug development based on individual genomic information. In our laboratory, we have been developing a database to integrate genome data and clinical information obtained by clinical genome analysis and a computational support system for clinical interpretation of variants using AI. In addition, with the aim of creating new therapeutic targets in genomic drug discovery, we have been also working on the development of a binding affinity prediction system for mutated proteins and drugs by molecular dynamics simulation using supercomputer "Kei". We also have tackled for problems in a drug virtual screening. Our developed AI technology has successfully generated virtual compound library, and deep learning method has enabled us to predict interaction between compound and target protein.

  14. "It's Going to Kill Us!" and Other Myths about the Future of Artificial Intelligence (United States)

    Atkinson, Robert D.


    Given the promise that artificial intelligence (AI) holds for economic growth and societal advancement, it is critical that policymakers not only avoid retarding the progress of AI innovation, but also actively support its further development and use. This report provides a primer on artificial intelligence and debunks five prevailing myths that,…

  15. Multimedia information processing in the SWAN mobile networked computing system (United States)

    Agrawal, Prathima; Hyden, Eoin; Krzyzanowsji, Paul; Srivastava, Mani B.; Trotter, John


    Anytime anywhere wireless access to databases, such as medical and inventory records, can simplify workflow management in a business, and reduce or even eliminate the cost of moving paper documents. Moreover, continual progress in wireless access technology promises to provide per-user bandwidths of the order of a few Mbps, at least in indoor environments. When combined with the emerging high-speed integrated service wired networks, it enables ubiquitous and tetherless access to and processing of multimedia information by mobile users. To leverage on this synergy an indoor wireless network based on room-sized cells and multimedia mobile end-points is being developed at AT&T Bell Laboratories. This research network, called SWAN (Seamless Wireless ATM Networking), allows users carrying multimedia end-points such as PDAs, laptops, and portable multimedia terminals, to seamlessly roam while accessing multimedia data streams from the wired backbone network. A distinguishing feature of the SWAN network is its use of end-to-end ATM connectivity as opposed to the connectionless mobile-IP connectivity used by present day wireless data LANs. This choice allows the wireless resource in a cell to be intelligently allocated amongst various ATM virtual circuits according to their quality of service requirements. But an efficient implementation of ATM in a wireless environment requires a proper mobile network architecture. In particular, the wireless link and medium-access layers need to be cognizant of the ATM traffic, while the ATM layers need to be cognizant of the mobility enabled by the wireless layers. This paper presents an overview of SWAN's network architecture, briefly discusses the issues in making ATM mobile and wireless, and describes initial multimedia applications for SWAN.

  16. Cognitive Architectures for Multimedia Learning (United States)

    Reed, Stephen K.


    This article provides a tutorial overview of cognitive architectures that can form a theoretical foundation for designing multimedia instruction. Cognitive architectures include a description of memory stores, memory codes, and cognitive operations. Architectures that are relevant to multimedia learning include Paivio's dual coding theory,…

  17. Multimedia Modules for Electromagnetics Education. (United States)

    De Los Santos Vidal, Oriol; Iskander, Magdy F.


    Multimedia technology is an invaluable teaching and learning resource. One advantage of technology based education is the ability to combine practical applications, visualization of complex mathematical and abstract subjects, virtual labs, and guided use of simulation software. This article describes several multimedia tutorials for…

  18. Multimedia Principle in Teaching Lessons (United States)

    Kari Jabbour, Khayrazad


    Multimedia learning principle occurs when we create mental representations from combining text and relevant graphics into lessons. This article discusses the learning advantages that result from adding multimedia learning principle into instructions; and how to select graphics that support learning. There is a balance that instructional designers…

  19. Cognitive Synergy in Multimedia Learning (United States)

    Kim, Daesang; Kim, Dong-Joong; Whang, Woo-Hyung


    The main focus of our study was to investigate multimedia effects that had different results from the findings of existing multimedia learning studies. First, we describe and summarize three experimental studies we conducted from 2006 to 2010. Then we analyze our findings to explore learner characteristics that may impact the cognitive processes…

  20. Economic reasoning and artificial intelligence. (United States)

    Parkes, David C; Wellman, Michael P


    The field of artificial intelligence (AI) strives to build rational agents capable of perceiving the world around them and taking actions to advance specified goals. Put another way, AI researchers aim to construct a synthetic homo economicus, the mythical perfectly rational agent of neoclassical economics. We review progress toward creating this new species of machine, machina economicus, and discuss some challenges in designing AIs that can reason effectively in economic contexts. Supposing that AI succeeds in this quest, or at least comes close enough that it is useful to think about AIs in rationalistic terms, we ask how to design the rules of interaction in multi-agent systems that come to represent an economy of AIs. Theories of normative design from economics may prove more relevant for artificial agents than human agents, with AIs that better respect idealized assumptions of rationality than people, interacting through novel rules and incentive systems quite distinct from those tailored for people. Copyright © 2015, American Association for the Advancement of Science.

  1. Artificial intelligence and nuclear power. Report by the Technology Transfer Artificial Intelligence Task Team

    International Nuclear Information System (INIS)


    The Artificial Intelligence Task Team was organized to review the status of Artificial Intelligence (AI) technology, identify guidelines for AI work, and to identify work required to allow the nuclear industry to realize maximum benefit from this technology. The state of the nuclear industry was analyzed to determine where the application of AI technology could be of greatest benefit. Guidelines and criteria were established to focus on those particular problem areas where AI could provide the highest possible payoff to the industry. Information was collected from government, academic, and private organizations. Very little AI work is now being done to specifically support the nuclear industry. The AI Task Team determined that the establishment of a Strategic Automation Initiative (SAI) and the expansion of the DOE Technology Transfer program would ensure that AI technology could be used to develop software for the nuclear industry that would have substantial financial payoff to the industry. The SAI includes both long and short term phases. The short-term phase includes projects which would demonstrate that AI can be applied to the nuclear industry safely, and with substantial financial benefit. The long term phase includes projects which would develop AI technologies with specific applicability to the nuclear industry that would not be developed by people working in any other industry

  2. Multimedia applications in differential services

    International Nuclear Information System (INIS)

    Mahfooz, S.; Merabti, M.; Pereira, R.


    In this paper we present a mechanism to provide Quality of Service (QoS) guarantees to different multimedia applications that share link bandwidth in IP-based differential services domain. In this mechanism weights are associated with each and to individual users according to their priorities. In order to evaluate the performance of our scheme we conducted simulations. The test data used portray different multimedia applications i.e. MPEG-2, IP telephony. The simulation results obtained show the effectiveness of our scheme for multimedia applications by allocating link share to each multimedia application and minimising end-to-end transmission delay 9Y bringing them in line with the recommended standard acceptable transmission delay for multimedia applications. This paper also presents extension to our proposed Relative Bandwidth Sharing (RES) scheme for differential services. We have identified and highlighted the role of border routers and core routers in differential services domain. Exploring features of Internet Protocol IPv6 in our architecture. (author)

  3. The role of artificial intelligence and expert systems in increasing STS operations productivity (United States)

    Culbert, C.


    Artificial Intelligence (AI) is discussed. A number of the computer technologies pioneered in the AI world can make significant contributions to increasing STS operations productivity. Application of expert systems, natural language, speech recognition, and other key technologies can reduce manpower while raising productivity. Many aspects of STS support lend themselves to this type of automation. The artificial intelligence section of the mission planning and analysis division has developed a number of functioning prototype systems which demonstrate the potential gains of applying AI technology.

  4. Coupling artificial intelligence and numerical computation for engineering design (Invited paper) (United States)

    Tong, S. S.


    The possibility of combining artificial intelligence (AI) systems and numerical computation methods for engineering designs is considered. Attention is given to three possible areas of application involving fan design, controlled vortex design of turbine stage blade angles, and preliminary design of turbine cascade profiles. Among the AI techniques discussed are: knowledge-based systems; intelligent search; and pattern recognition systems. The potential cost and performance advantages of an AI-based design-generation system are discussed in detail.

  5. Multimedia Information Extraction

    CERN Document Server

    Maybury, Mark T


    The advent of increasingly large consumer collections of audio (e.g., iTunes), imagery (e.g., Flickr), and video (e.g., YouTube) is driving a need not only for multimedia retrieval but also information extraction from and across media. Furthermore, industrial and government collections fuel requirements for stock media access, media preservation, broadcast news retrieval, identity management, and video surveillance.  While significant advances have been made in language processing for information extraction from unstructured multilingual text and extraction of objects from imagery and vid

  6. Demonstration of artificial intelligence technology for transit railcar diagnostics (United States)


    This report will be of interest to railcar maintenance professionals concerned with improving railcar maintenance fault-diagnostic capabilities through the use of artificial intelligence (AI) technologies. It documents the results of a demonstration ...

  7. Utilising artificial intelligence in software defined wireless sensor network

    CSIR Research Space (South Africa)

    Matlou, OG


    Full Text Available Software Defined Wireless Sensor Network (SDWSN) is realised by infusing Software Defined Network (SDN) model in Wireless Sensor Network (WSN), Reason for that is to overcome the challenges of WSN. Artificial Intelligence (AI) and machine learning...

  8. Multimedia Matrix: A Cognitive Strategy for Designers. (United States)

    Sherry, Annette C.

    This instructional development project evaluates the effect of a matrix-based strategy to assist multimedia authors in acquiring and applying principles for effective multimedia design. The Multimedia Matrix, based on the Park and Hannafin "Twenty Principles and Implications for Interactive Multimedia" design, displays a condensed…

  9. 9th International Conference on Multimedia and Ubiquitous Engineering and the 10th International Conference on Future Information Technology

    CERN Document Server

    Chao, Han-Chieh; Arabnia, Hamid; Yen, Neil; Advanced Multimedia and Ubiquitous Engineering : Future Information Technology; MUE-15; FutureTech 2015

    This volume brings together contributions representing the state-of-the-art in new multimedia and future technology information research, currently a major topic in computer science and electronic engineering. Researchers aim to interoperate multimedia frameworks, transforming the way people work and  interact with multimedia data. This book covers future information technology topics including digital and multimedia convergence, ubiquitous and pervasive computing, intelligent computing and applications, embedded systems, mobile and wireless communications, bio-inspired computing, grid and cloud computing, semantic web, human-centric computing and social networks, adaptive and context-aware computing, security and trust computing and related areas.  Representing the combined proceedings of the 9th International Conference on Multimedia and Ubiquitous Engineering (MUE-15) and the 10th International Conference on Future Information Technology (FutureTech 2015), this book aims to provide a complete coverage of...

  10. Learning modalities in artificial intelligence systems: a framework and review

    Energy Technology Data Exchange (ETDEWEB)

    Araya, A A


    Intelligent systems should possess two fundamental capabilities: problem solving and learning. Problem solving capabilities allow an intelligent system to cope with problems in a given domain. Learning capabilities make possible for an intelligent system to improve the solution to the problems within its current reach or to cope with new problems. This paper examines research in artificial intelligence from the perspective of learning with the purpose of: 1) developing and understanding of the problem of learning from the AI point of view, and II) characterizing the current state of the art on learning in AI. 35 references.

  11. Hybrid-augmented intelligence:collaboration and cognition

    Institute of Scientific and Technical Information of China (English)

    Nan-ning ZHENG; Zi-yi LIU; Peng-ju REN; Yong-qiang MA; Shi-tao CHEN; Si-yu YU; Jian-ru XUE


    The long-term goal of artificial intelligence (AI) is to make machines learn and think like human beings. Due to the high levels of uncertainty and vulnerability in human life and the open-ended nature of problems that humans are facing, no matter how intelligent machines are, they are unable to completely replace humans. Therefore, it is necessary to introduce human cognitive capabilities or human-like cognitive models into AI systems to develop a new form of AI, that is, hybrid-augmented intelligence. This form of AI or machine intelligence is a feasible and important developing model. Hybrid-augmented intelligence can be divided into two basic models:one is human-in-the-loop augmented intelligence with human-computer collaboration, and the other is cognitive computing based augmented intelligence, in which a cognitive model is embedded in the machine learning system. This survey describes a basic framework for human-computer collaborative hybrid-augmented intelligence, and the basic elements of hybrid-augmented intelligence based on cognitive computing. These elements include intuitive reasoning, causal models, evolution of memory and knowledge, especially the role and basic principles of intuitive reasoning for complex problem solving, and the cognitive learning framework for visual scene understanding based on memory and reasoning. Several typical applications of hybrid-augmented intelligence in related fields are given.

  12. Multimedia and ubiquitous engineering MUE 2013

    CERN Document Server

    Ng, Joseph; Jeong, Hwa; Waluyo, Borgy


    The new multimedia standards (for example, MPEG-21) facilitate the seamless integration of multiple modalities into interoperable multimedia frameworks, transforming the way people work and interact with multimedia data. These key technologies and multimedia solutions interact and collaborate with each other in increasingly effective ways, contributing to the multimedia revolution and having a significant impact across a wide spectrum of consumer, business, healthcare, education, and governmental domains. Multimedia and Ubiquitous Engineering provides an opportunity for academic and industry professionals to discuss recent progress in the area of multimedia and ubiquitous environment including models and systems, new directions, novel applications associated with the utilization and acceptance of ubiquitous computing devices and systems.

  13. Teachers' Assessments of Elements of Multimedia and Constructivist Didactics in School (United States)

    Matijevic, Milan; Topolovcan, Tomislav; Lapat, Goran


    Despite the understandings that constructivist and multimedia didactics, as well as curricular theory and multiple intelligences theory, have been providing for years, what happens in the classroom and in the teaching process is still mostly teacher-centred. The didactic and methodological scenarios that prevail in our classes are more suitable to…

  14. Multimedia Information Networks in Social Media (United States)

    Cao, Liangliang; Qi, Guojun; Tsai, Shen-Fu; Tsai, Min-Hsuan; Pozo, Andrey Del; Huang, Thomas S.; Zhang, Xuemei; Lim, Suk Hwan

    The popularity of personal digital cameras and online photo/video sharing community has lead to an explosion of multimedia information. Unlike traditional multimedia data, many new multimedia datasets are organized in a structural way, incorporating rich information such as semantic ontology, social interaction, community media, geographical maps, in addition to the multimedia contents by themselves. Studies of such structured multimedia data have resulted in a new research area, which is referred to as Multimedia Information Networks. Multimedia information networks are closely related to social networks, but especially focus on understanding the topics and semantics of the multimedia files in the context of network structure. This chapter reviews different categories of recent systems related to multimedia information networks, summarizes the popular inference methods used in recent works, and discusses the applications related to multimedia information networks. We also discuss a wide range of topics including public datasets, related industrial systems, and potential future research directions in this field.

  15. On the Edge: Intelligent CALL in the 1990s. (United States)

    Underwood, John


    Examines the possibilities of developing computer-assisted language learning (CALL) based on the best of modern technology, arguing that artificial intelligence (AI) strategies will radically improve the kinds of exercises that can be performed. Recommends combining AI technology with other tools for delivering instruction, such as simulation and…

  16. The Seeds of Artificial Intelligence. SUMEX-AIM. (United States)

    Research Resources Information Center, Rockville, MD.

    Written to provide an understanding of the broad base of information on which the artificial intelligence (AI) branch of computer science rests, this publication presents a general view of AI, the concepts from which it evolved, its current abilities, and its promise for research. The focus is on a community of projects that use the SUMEX-AIM…

  17. Second Conference on Artificial Intelligence for Space Applications (United States)

    Dollman, Thomas (Compiler)


    The proceedings of the conference are presented. This second conference on Artificial Intelligence for Space Applications brings together a diversity of scientific and engineering work and is intended to provide an opportunity for those who employ AI methods in space applications to identify common goals and to discuss issues of general interest in the AI community.

  18. Introduction to the Articles on Innovative Applications of Artificial Intelligence


    Rychtyckyj, Nestor; Shapiro, Daniel


    This issue of AI Magazine provides extended versions of several papers that were recently presented at the Innovative Applications of Artificial Intelligence Conference (IAAI-2010). We present three articles reflecting deployed applications of AI, one describing a unique, emerging application, plus an article based on the invited talk by Jay M. Tenenbaum, who was the 2010 Engelmore Award recipient.

  19. Artificial Intelligence in Business: Technocrat Jargon or Quantum Leap? (United States)

    Burford, Anna M.; Wilson, Harold O.

    This paper addresses the characteristics and applications of artificial intelligence (AI) as a subsection of computer science, and briefly describes the most common types of AI programs: expert systems, natural language, and neural networks. Following a brief presentation of the historical background, the discussion turns to an explanation of how…

  20. Artificial Intelligence: Realizing the Ultimate Promises of Computing


    Waltz, David L.


    Artificial intelligence (AI) is the key technology in many of today's novel applications, ranging from banking systems that detect attempted credit card fraud, to telephone systems that understand speech, to software systems that notice when you're having problems and offer appropriate advice. These technologies would not exist today without the sustained federal support of fundamental AI research over the past three decades.

  1. A brief overview of artificial intelligence in South Africa

    CSIR Research Space (South Africa)

    Ferrein, A


    Full Text Available One of the consequences of the growth in AI research in South Africa in recent years is the establishment of a number of research hubs involved in AI activities ranging from mobile robotics and computational intelligence to knowledge representation...

  2. An SDR based AIS receiver for satellites

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard


    For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

  3. True Visions The Emergence of Ambient Intelligence

    CERN Document Server

    Aarts, Emile


    Ambient intelligence (AI) refers to a developing technology that will increasingly make our everyday environment sensitive and responsive to our presence. The AI vision requires technology invisibly embedded in our everyday surroundings, present whenever we need it that will lead to the seamless integration of lighting, sounds, vision, domestic appliances, and personal healthcare products to enhance our living experience. Written for the non-specialist seeking an authoritative but accessible overview of this interdisciplinary field, True Visions explains how the devices making up the AI world will operate collectively using information and intelligence hidden in the wireless network connecting them. Expert contributions address key AI components such as smart materials and textiles, system architecture, mobile computing, broadband communication, and underlying issues of human-environment interactions. It seeks to unify the perspectives of scientists from diverse backgrounds ranging from the physics of materia...

  4. Artificial Intelligence as Structural Estimation: Economic Interpretations of Deep Blue, Bonanza, and AlphaGo


    Igami, Mitsuru


    Artificial intelligence (AI) has achieved superhuman performance in a growing number of tasks, but understanding and explaining AI remain challenging. This paper clarifies the connections between machine-learning algorithms to develop AIs and the econometrics of dynamic structural models through the case studies of three famous game AIs. Chess-playing Deep Blue is a calibrated value function, whereas shogi-playing Bonanza is an estimated value function via Rust's (1987) nested fixed-point met...

  5. Fifth Conference on Artificial Intelligence for Space Applications (United States)

    Odell, Steve L. (Compiler)


    The Fifth Conference on Artificial Intelligence for Space Applications brings together diverse technical and scientific work in order to help those who employ AI methods in space applications to identify common goals and to address issues of general interest in the AI community. Topics include the following: automation for Space Station; intelligent control, testing, and fault diagnosis; robotics and vision; planning and scheduling; simulation, modeling, and tutoring; development tools and automatic programming; knowledge representation and acquisition; and knowledge base/data base integration.

  6. IJCAI-91 Workshop on Objects and Artificial Intelligence


    Hatzilygeroudis, Ioannis


    The Objects and Artificial Intelligence Workshop was held on 25 August 1991 in conjunction with the 1991 International Joint Conference on Artificial Intelligence. The workshop brought together researchers in AI and object-oriented programming to exchange ideas and investigate possible avenues of cooperation between AI and object-oriented programming. The workshop dealt with both the theoretical and the practical aspects of this cooperation.

  7. Human Brain inspired Artificial Intelligence & Developmental Robotics: A Review

    Directory of Open Access Journals (Sweden)

    Suresh Kumar


    Full Text Available Along with the developments in the field of the robotics, fascinating contributions and developments can be seen in the field of Artificial intelligence (AI. In this paper we will discuss about the developments is the field of artificial intelligence focusing learning algorithms inspired from the field of Biology, particularly large scale brain simulations, and developmental Psychology. We will focus on the emergence of the Developmental robotics and its significance in the field of AI.

  8. A Python Engine for Teaching Artificial Intelligence in Games


    Riedl, Mark O.


    Computer games play an important role in our society and motivate people to learn computer science. Since artificial intelligence is integral to most games, they can also be used to teach artificial intelligence. We introduce the Game AI Game Engine (GAIGE), a Python game engine specifically designed to teach about how AI is used in computer games. A progression of seven assignments builds toward a complete, working Multi-User Battle Arena (MOBA) game. We describe the engine, the assignments,...

  9. A study on the applications of AI in finishing of additive manufacturing parts (United States)

    Fathima Patham, K.


    Artificial intelligent and computer simulation are the technological powerful tools for solving complex problems in the manufacturing industries. Additive Manufacturing is one of the powerful manufacturing techniques that provide design flexibilities to the products. The products with complex shapes are directly manufactured without the need of any machining and tooling using Additive Manufacturing. However, the main drawback of the components produced using the Additive Manufacturing processes is the quality of the surfaces. This study aims to minimize the defects caused during Additive Manufacturing with the aid of Artificial Intelligence. The developed AI system has three layers, each layer is trying to eliminate or minimize the production errors. The first layer of the AI system optimizes the digitization of the 3D CAD model of the product and hence reduces the stair case errors. The second layer of the AI system optimizes the 3D printing machine parameters in order to eliminate the warping effect. The third layer of AI system helps to choose the surface finishing technique suitable for the printed component based on the Degree of Complexity of the product and the material. The efficiency of the developed AI system was examined on the functional parts such as gears.

  10. USACE AIS Transmit Technical Support Summary Report (United States)


    the TAG block for the correct transmitters, and then send to the USACE AIS network. B. Outbound openings in the USCG firewall for the USCG Message...USACE AIS Transmit Technical Support Summary Report Distribution Statement A: Approved for public release; distribution is unlimited...September 2014 Report No. CD-D-09-15 USACE AIS Transmit Technical Support Summary Report ii UNCLAS//Public | CG-926 RDC | I. Gonin et al. Public

  11. Multimedia and Decision-Making Process

    Directory of Open Access Journals (Sweden)

    Ovidiu-Alin DOBRICAN


    Full Text Available Multimedia technology has changed the way we use computers. Multimedia transforms com-puters into a second person. Multimedia technology has made it possible for us to see, hear, read, feel, and talk to computers. Multimedia technology has transformed our use and understanding of computers. On the other hand, multimedia presentation is one of the fastest-growing sectors of the computer industry. Applications have appeared in many areas, such as training, education, business presentation, merchandising, and communications.

  12. Worldwide Intelligent Systems: Approaches to Telecommunications and Network Management. Frontiers in Artificial Intelligence and Applications, Volume 24. (United States)

    Liebowitz, Jay, Ed.; Prerau, David S., Ed.

    This is an international collection of 12 papers addressing artificial intelligence (AI) and knowledge technology applications in telecommunications and network management. It covers the latest and emerging AI technologies as applied to the telecommunications field. The papers are: "The Potential for Knowledge Technology in…

  13. Shimadzu AI-PACS 'SAIPACS'

    International Nuclear Information System (INIS)

    Andoh, Minoru; Asai, Shigeya; Matsui, Norihisa; Nishida, Shinichiro; Horino, Masato


    The PACS-WS named SAIPACS-WS(workstation) has been developed as the first step of complete PACS. This SAIPACS-WS is different from other PACS-WS's, because this is including computer aided diagnostic reporting and computer aided diagnosis by using artificial intelligence technique. In this paper we will report detail of the SAIPACS-WS and discuss the future development of the total PACS setting the SAIPACS-WS in its center. (author)

  14. Adaptive Motion Gaming AI for Health Promotion


    Paliyawan, Pujana; Kusano, Takahiro; Nakagawa, Yuto; Harada, Tomohiro; Thawonmas, Ruck


    This paper presents a design of a non-player character (AI) for promoting balancedness in use of body segments when engaging in full-body motion gaming. In our experiment, we settle a battle between the proposed AI and a player by using FightingICE, a fighting game platform for AI development. A middleware called UKI is used to allow the player to control the game by using body motion instead of the keyboard and mouse. During gameplay, the proposed AI analyze health states of the player; it d...

  15. Artificial Intelligence techniques for big data analysis


    Aditya Khatri


    During my stay in Salamanca (Spain), I was fortunate enough to participate in the BISITE Research Group of the University of Salamanca. The University of Salamanca is the oldest university in Spain and in 2018 it celebrates its 8th centenary. As a computer science researcher, I participated in one of the many international projects that the research group has active, especially in big data analysis using Artificial Intelligence (AI) techniques. AI is one of BISITE's main lines of rese...

  16. Parallel processing for artificial intelligence 1

    CERN Document Server

    Kanal, LN; Kumar, V; Suttner, CB


    Parallel processing for AI problems is of great current interest because of its potential for alleviating the computational demands of AI procedures. The articles in this book consider parallel processing for problems in several areas of artificial intelligence: image processing, knowledge representation in semantic networks, production rules, mechanization of logic, constraint satisfaction, parsing of natural language, data filtering and data mining. The publication is divided into six sections. The first addresses parallel computing for processing and understanding images. The second discus

  17. Applications of artificial intelligence to scientific research (United States)

    Prince, Mary Ellen


    Artificial intelligence (AI) is a growing field which is just beginning to make an impact on disciplines other than computer science. While a number of military and commercial applications were undertaken in recent years, few attempts were made to apply AI techniques to basic scientific research. There is no inherent reason for the discrepancy. The characteristics of the problem, rather than its domain, determines whether or not it is suitable for an AI approach. Expert system, intelligent tutoring systems, and learning programs are examples of theoretical topics which can be applied to certain areas of scientific research. Further research and experimentation should eventurally make it possible for computers to act as intelligent assistants to scientists.

  18. Artificial Intelligence and the Future of Defense

    DEFF Research Database (Denmark)

    De Spiegeleire, Stephan; Maas, Matthijs Michiel; Sweijs, Tim

    Artificial intelligence (AI) is on everybody’s minds these days. Most of the world’s leading companies are making massive investments in it. Governments are scrambling to catch up. Every single one of us who uses Google Search or any of the new digital assistants on our smartphones has witnessed...... suggests that the advent of artificial super-intelligence (i.e. AI that is superior across the board to human intelligence), which many experts now put firmly within the longer-term planning horizons of our DSOs, presents us with unprecedented risks but also opportunities that we have to start to explore....... The report contains an overview of the role that ‘intelligence’ - the computational part of the ability to achieve goals in the world - has played in defense and security throughout human history; a primer on AI (what it is, where it comes from and where it stands today - in both civilian and military...

  19. Multimedia ontology representation and applications

    CERN Document Server

    Chaudhury, Santanu; Ghosh, Hiranmay


    The result of more than 15 years of collective research, Multimedia Ontology: Representation and Applications provides a theoretical foundation for understanding the nature of media data and the principles involved in its interpretation. The book presents a unified approach to recent advances in multimedia and explains how a multimedia ontology can fill the semantic gap between concepts and the media world. It relays real-life examples of implementations in different domains to illustrate how this gap can be filled.The book contains information that helps with building semantic, content-based

  20. Moodle 2.5 multimedia

    CERN Document Server

    Fernandes, João


    A tutorial-based guide where readers can work through practical examples that clearly describe how to create multimedia applications using Moodle and integrate existing multimedia resources into Moodle courses.If you are a teacher or trainer who runs online courses and has a basic understanding of Moodle, this book will be ideal for you. It is not necessary to have an advanced technical background to create multimedia elements as the tasks will be simple, not time consuming, and will be practical for everyday use.

  1. Artificial intelligence applications in space and SDI: A survey (United States)

    Fiala, Harvey E.


    The purpose of this paper is to survey existing and planned Artificial Intelligence (AI) applications to show that they are sufficiently advanced for 32 percent of all space applications and SDI (Space Defense Initiative) software to be AI-based software. To best define the needs that AI can fill in space and SDI programs, this paper enumerates primary areas of research and lists generic application areas. Current and planned NASA and military space projects in AI will be reviewed. This review will be largely in the selected area of expert systems. Finally, direct applications of AI to SDI will be treated. The conclusion covers the importance of AI to space and SDI applications, and conversely, their importance to AI.

  2. Artificial intelligence and knowledge management


    Hoesch, Hugo Cesar; Barcellos, Vânia


    This article intends to make an analysis about the Artificial Intelligence (AI) and the Knowledge Management (KM). Faced with the dualism mind and body how we be able to see it AI? It doesn’t intent to create identical copy of human being, but try to find the better form to represent all the knowledge contained in our minds. The society of the information lives a great paradox, at the same time that we have access to an innumerable amount of information, the capacity and the forms of its proc...

  3. Improving designer productivity. [artificial intelligence (United States)

    Hill, Gary C.


    Designer and design team productivity improves with skill, experience, and the tools available. The design process involves numerous trials and errors, analyses, refinements, and addition of details. Computerized tools have greatly speeded the analysis, and now new theories and methods, emerging under the label Artificial Intelligence (AI), are being used to automate skill and experience. These tools improve designer productivity by capturing experience, emulating recognized skillful designers, and making the essence of complex programs easier to grasp. This paper outlines the aircraft design process in today's technology and business climate, presenting some of the challenges ahead and some of the promising AI methods for meeting these challenges.

  4. Epistasis analysis using artificial intelligence. (United States)

    Moore, Jason H; Hill, Doug P


    Here we introduce artificial intelligence (AI) methodology for detecting and characterizing epistasis in genetic association studies. The ultimate goal of our AI strategy is to analyze genome-wide genetics data as a human would using sources of expert knowledge as a guide. The methodology presented here is based on computational evolution, which is a type of genetic programming. The ability to generate interesting solutions while at the same time learning how to solve the problem at hand distinguishes computational evolution from other genetic programming approaches. We provide a general overview of this approach and then present a few examples of its application to real data.

  5. Groundhog Day for Medical Artificial Intelligence. (United States)

    London, Alex John


    Following a boom in investment and overinflated expectations in the 1980s, artificial intelligence entered a period of retrenchment known as the "AI winter." With advances in the field of machine learning and the availability of large datasets for training various types of artificial neural networks, AI is in another cycle of halcyon days. Although medicine is particularly recalcitrant to change, applications of AI in health care have professionals in fields like radiology worried about the future of their careers and have the public tittering about the prospect of soulless machines making life-and-death decisions. Medicine thus appears to be at an inflection point-a kind of Groundhog Day on which either AI will bring a springtime of improved diagnostic and predictive practices or the shadow of public and professional fear will lead to six more metaphorical weeks of winter in medical AI. © 2018 The Hastings Center.

  6. Artificial intelligence in process design and operation

    International Nuclear Information System (INIS)

    Sudduth, A.L.


    Artificial Intelligence (AI) has recently become prominent in the discussion of computer applications in the utility business. In order to assess this technology, a research project was performed to determine whether software development techniques based on AI could be used to facilitate management of information associated with the design of a generating station. The approach taken was the development of an expert system, using a relatively simple set of rules acting on a more complex knowledge base. A successful prototype for the application was developed and its potential extension to a production environment demonstrated. During the course of prototype development, other possible applications of AI in design engineering were discovered, and areas of particular interest selected for further investigation. A plan for AI R and D was formulated. That plan and other possible future work in AI are discussed

  7. Multimedia content analysis

    CERN Document Server

    Ohm, Jens


    This textbook covers the theoretical backgrounds and practical aspects of image, video and audio feature expression, e.g., color, texture, edge, shape, salient point and area, motion, 3D structure, audio/sound in time, frequency and cepstral domains, structure and melody. Up-to-date algorithms for estimation, search, classification and compact expression of feature data are described in detail. Concepts of signal decomposition (such as segmentation, source tracking and separation), as well as composition, mixing, effects, and rendering, are discussed. Numerous figures and examples help to illustrate the aspects covered. The book was developed on the basis of a graduate-level university course, and most chapters are supplemented by problem-solving exercises. The book is also a self-contained introduction both for researchers and developers of multimedia content analysis systems in industry. .

  8. Intelligent structural optimization: Concept, Model and Methods

    International Nuclear Information System (INIS)

    Lu, Dagang; Wang, Guangyuan; Peng, Zhang


    Structural optimization has many characteristics of Soft Design, and so, it is necessary to apply the experience of human experts to solving the uncertain and multidisciplinary optimization problems in large-scale and complex engineering systems. With the development of artificial intelligence (AI) and computational intelligence (CI), the theory of structural optimization is now developing into the direction of intelligent optimization. In this paper, a concept of Intelligent Structural Optimization (ISO) is proposed. And then, a design process model of ISO is put forward in which each design sub-process model are discussed. Finally, the design methods of ISO are presented

  9. A study on the Web intelligence

    Institute of Scientific and Technical Information of China (English)

    Sang-Geun Kim


    This paper surveys important aspects of Web Intelligence (WI). WI explores the fundamental roles as well as practical impacts of Artificial Intelligence (AI) and advanced Information Technology (IT) on the next generation of Web - related products, systens, and activities. As a direction for scientific research and devlopment, WI can be extremely beneficial for the field of Artificial Intelligence in Education (AIED). This paper covers these issues only very briefly. It focuses more on other issues in WI, such as intelligent Web services, and semantic web, and proposes how to use them as basis for tackling new and challenging research problems in AIED.

  10. Developer's handbook of interactive multimedia

    CERN Document Server

    Phillips, Robin


    New technology is being used more and more in education and providers have to be aware of what is on offer and how it can be used. This practical handbook demonstrates how interactive multimedia can be developed for educational application.

  11. Reconfiguration in Mobile Multimedia Systems

    NARCIS (Netherlands)

    Smit, Gerardus Johannes Maria; Havinga, Paul J.M.; Bos, M.; Smit, L.T.; Heysters, P.M.


    Dynamically reconfigurable systems offer the potential for realising efficient systems as well as providing adaptability to changing system requirements. Such systems are suitable for future mobile multimedia systems that have limited battery resources, must handle diverse data types, and must

  12. Philosophy and Theory of Artificial Intelligence

    CERN Document Server


    Can we make machines that think and act like humans or other natural intelligent agents? The answer to this question depends on how we see ourselves and how we see the machines in question. Classical AI and cognitive science had claimed that cognition is computation, and can thus be reproduced on other computing machines, possibly surpassing the abilities of human intelligence. This consensus has now come under threat and the agenda for the philosophy and theory of AI must be set anew, re-defining the relation between AI and Cognitive Science. We can re-claim the original vision of general AI from the technical AI disciplines; we can reject classical cognitive science and replace it with a new theory (e.g. embodied); or we can try to find new ways to approach AI, for example from neuroscience or from systems theory. To do this, we must go back to the basic questions on computing, cognition and ethics for AI. The 30 papers in this volume provide cutting-edge work from leading researchers that define where we s...

  13. Improving Tools in Artificial Intelligence

    Directory of Open Access Journals (Sweden)

    Angel Garrido


    Full Text Available The historical origin of the Artificial Intelligence (AI is usually established in the Dartmouth Conference, of 1956. But we can find many more arcane origins [1]. Also, we can consider, in more recent times, very great thinkers, as Janos Neumann (then, John von Neumann, arrived in USA, Norbert Wiener, Alan Mathison Turing, or Lofti Zadeh, for instance [12, 14]. Frequently AI requires Logic. But its Classical version shows too many insufficiencies. So, it was necessary to introduce more sophisticated tools, as Fuzzy Logic, Modal Logic, Non-Monotonic Logic and so on [1, 2]. Among the things that AI needs to represent are categories, objects, properties, relations between objects, situations, states, time, events, causes and effects, knowledge about knowledge, and so on. The problems in AI can be classified in two general types [3, 5], search problems and representation problems. On this last "peak", there exist different ways to reach their summit. So, we have [4] Logics, Rules, Frames, Associative Nets, Scripts, and so on, many times connected among them. We attempt, in this paper, a panoramic vision of the scope of application of such representation methods in AI. The two more disputable questions of both modern philosophy of mind and AI will be perhaps the Turing Test and the Chinese Room Argument. To elucidate these very difficult questions, see our final note.

  14. JGOMAS: New Approach to AI Teaching (United States)

    Barella, A.; Valero, S.; Carrascosa, C.


    This paper presents a new environment for teaching practical work in AI subjects. The main purpose of this environment is to make AI techniques more appealing to students and to facilitate the use of the toolkits which are currently widely used in research and development. This new environment has a toolkit for developing and executing agents,…

  15. Adaptive game AI with dynamic scripting

    NARCIS (Netherlands)

    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.


    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should

  16. Artificial Intelligence and brain. (United States)

    Shapshak, Paul


    From the start, Kurt Godel observed that computer and brain paradigms were considered on a par by researchers and that researchers had misunderstood his theorems. He hailed with displeasure that the brain transcends computers. In this brief article, we point out that Artificial Intelligence (AI) comprises multitudes of human-made methodologies, systems, and languages, and implemented with computer technology. These advances enhance development in the electron and quantum realms. In the biological realm, animal neurons function, also utilizing electron flow, and are products of evolution. Mirror neurons are an important paradigm in neuroscience research. Moreover, the paradigm shift proposed here - 'hall of mirror neurons' - is a potentially further productive research tactic. These concepts further expand AI and brain research.

  17. Multimedia on nuclear reactors physics

    International Nuclear Information System (INIS)

    Dies, Javier; Puig, Francesc


    The paper present an example of measures that have been found to be effective in the development of innovative educational and training technology. A multimedia course on nuclear reactor physics is presented. This material has been used for courses at master level at the universities; training for engineers at nuclear power plant as modular 2 weeks course; and training operators of nuclear power plant. The multimedia has about 785 slides and the text is in English, Spanish and French. (authors)

  18. Multimedia chatting system on LAN (United States)

    Lung, Chu-Sheng; Wang, Chun-Chao; Lee, Ching-Long; Huang, Huang-Chen


    An interactive system designed for talking via multimedia presentation with other parties on Ethernet- LAN is proposed. Our Multimedia Chatting System will take several media services into consideration, like still image, text, pen writing, voice, and slow-motion video, to integrate a practical chatting system. The prototyping subsystem to implement the above idea is currently under development using NETBIOS communication interface and Microsoft Windows environment.

  19. Application of artificial intelligence in process control

    CERN Document Server

    Krijgsman, A


    This book is the result of a united effort of six European universities to create an overall course on the appplication of artificial intelligence (AI) in process control. The book includes an introduction to key areas including; knowledge representation, expert, logic, fuzzy logic, neural network, and object oriented-based approaches in AI. Part two covers the application to control engineering, part three: Real-Time Issues, part four: CAD Systems and Expert Systems, part five: Intelligent Control and part six: Supervisory Control, Monitoring and Optimization.

  20. Integrated Artificial Intelligence Approaches for Disease Diagnostics. (United States)

    Vashistha, Rajat; Chhabra, Deepak; Shukla, Pratyoosh


    Mechanocomputational techniques in conjunction with artificial intelligence (AI) are revolutionizing the interpretations of the crucial information from the medical data and converting it into optimized and organized information for diagnostics. It is possible due to valuable perfection in artificial intelligence, computer aided diagnostics, virtual assistant, robotic surgery, augmented reality and genome editing (based on AI) technologies. Such techniques are serving as the products for diagnosing emerging microbial or non microbial diseases. This article represents a combinatory approach of using such approaches and providing therapeutic solutions towards utilizing these techniques in disease diagnostics.

  1. Emergent web intelligence advanced information retrieval

    CERN Document Server

    Badr, Youakim; Abraham, Ajith; Hassanien, Aboul-Ella


    Web Intelligence explores the impact of artificial intelligence and advanced information technologies representing the next generation of Web-based systems, services, and environments, and designing hybrid web systems that serve wired and wireless users more efficiently. Multimedia and XML-based data are produced regularly and in increasing way in our daily digital activities, and their retrieval must be explored and studied in this emergent web-based era. 'Emergent Web Intelligence: Advanced information retrieval, provides reviews of the related cutting-edge technologies and insights. It is v

  2. Nonlinear study of AI Velorum

    International Nuclear Information System (INIS)

    Cox, A.N.; Hodson, S.W.


    Using results from earlier studies of double-mode dwarf Cepheids by Cox, King, and Hodson, hydrodynamic calculations were undertaken for AI Vel. The earlier derived evolution theory mass of 1.8 M sub solar, a luminosity of of 23 L sub solar and a T/sub e/ of 7500 0 K give the observed period of 0.11 day and the observed period ratio PI 1 /PI 0 = 0.773. A cooler T/sub e/ than the observed one (7620 0 K) was used because 7620 0 K is beyond the fundamental pulsation mode blue edge. The composition used is X = 0.70 Z = 0.01. This lower than normal Z is necessary to make the period ratio as large as observed. The goal is to see if double-mode behavior, due to either mode switching or a permanent state, can be predicted for the model. Progress in converging the model to a periodic pulsation solution by the von Sengbusch--Stellingwerf relaxation method will be reported. 17 references

  3. Advanced approaches to intelligent information and database systems

    CERN Document Server

    Boonjing, Veera; Chittayasothorn, Suphamit


    This book consists of 35 chapters presenting different theoretical and practical aspects of Intelligent Information and Database Systems. Nowadays both Intelligent and Database Systems are applied in most of the areas of human activities which necessitates further research in these areas. In this book various interesting issues related to the intelligent information models and methods as well as their advanced applications, database systems applications, data models and their analysis, and digital multimedia methods and applications are presented and discussed both from the practical and theoretical points of view. The book is organized in four parts devoted to intelligent systems models and methods, intelligent systems advanced applications, database systems methods and applications, and multimedia systems methods and applications. The book will be interesting for both practitioners and researchers, especially graduate and PhD students of information technology and computer science, as well more experienced ...

  4. Toward New-Generation Intelligent Manufacturing

    Directory of Open Access Journals (Sweden)

    Ji Zhou


    Full Text Available Intelligent manufacturing is a general concept that is under continuous development. It can be categorized into three basic paradigms: digital manufacturing, digital-networked manufacturing, and new-generation intelligent manufacturing. New-generation intelligent manufacturing represents an in-depth integration of new-generation artificial intelligence (AI technology and advanced manufacturing technology. It runs through every link in the full life-cycle of design, production, product, and service. The concept also relates to the optimization and integration of corresponding systems; the continuous improvement of enterprises’ product quality, performance, and service levels; and reduction in resources consumption. New-generation intelligent manufacturing acts as the core driving force of the new industrial revolution and will continue to be the main pathway for the transformation and upgrading of the manufacturing industry in the decades to come. Human-cyber-physical systems (HCPSs reveal the technological mechanisms of new-generation intelligent manufacturing and can effectively guide related theoretical research and engineering practice. Given the sequential development, cross interaction, and iterative upgrading characteristics of the three basic paradigms of intelligent manufacturing, a technology roadmap for “parallel promotion and integrated development” should be developed in order to drive forward the intelligent transformation of the manufacturing industry in China. Keywords: Advanced manufacturing, New-generation intelligent manufacturing, Human-cyber-physical system, New-generation AI, Basic paradigms, Parallel promotion, Integrated development

  5. AI based HealthCare Platform for Real Time, Predictive and Prescriptive Analytics using Reactive Programming (United States)

    Kaur, Jagreet; Singh Mann, Kulwinder, Dr.


    AI in Healthcare needed to bring real, actionable insights and Individualized insights in real time for patients and Doctors to support treatment decisions., We need a Patient Centred Platform for integrating EHR Data, Patient Data, Prescriptions, Monitoring, Clinical research and Data. This paper proposes a generic architecture for enabling AI based healthcare analytics Platform by using open sources Technologies Apache beam, Apache Flink Apache Spark, Apache NiFi, Kafka, Tachyon, Gluster FS, NoSQL- Elasticsearch, Cassandra. This paper will show the importance of applying AI based predictive and prescriptive analytics techniques in Health sector. The system will be able to extract useful knowledge that helps in decision making and medical monitoring in real-time through an intelligent process analysis and big data processing.

  6. Deep into the Brain: Artificial Intelligence in Stroke Imaging. (United States)

    Lee, Eun-Jae; Kim, Yong-Hwan; Kim, Namkug; Kang, Dong-Wha


    Artificial intelligence (AI), a computer system aiming to mimic human intelligence, is gaining increasing interest and is being incorporated into many fields, including medicine. Stroke medicine is one such area of application of AI, for improving the accuracy of diagnosis and the quality of patient care. For stroke management, adequate analysis of stroke imaging is crucial. Recently, AI techniques have been applied to decipher the data from stroke imaging and have demonstrated some promising results. In the very near future, such AI techniques may play a pivotal role in determining the therapeutic methods and predicting the prognosis for stroke patients in an individualized manner. In this review, we offer a glimpse at the use of AI in stroke imaging, specifically focusing on its technical principles, clinical application, and future perspectives.

  7. An overview of artificial intelligence and robotics. Volume 1: Artificial intelligence. Part B: Applications (United States)

    Gevarter, W. B.


    Artificial Intelligence (AI) is an emerging technology that has recently attracted considerable attention. Many applications are now under development. This report, Part B of a three part report on AI, presents overviews of the key application areas: Expert Systems, Computer Vision, Natural Language Processing, Speech Interfaces, and Problem Solving and Planning. The basic approaches to such systems, the state-of-the-art, existing systems and future trends and expectations are covered.

  8. System for intelligent teleoperation research

    International Nuclear Information System (INIS)

    Orlando, N.E.


    The Automation Technology Branch of NASA Langley Research Center is developing a research capability in the field of artificial intelligence, particularly as applicable in teleoperator/robotics development for remote space operations. As a testbed for experimentation in these areas, a system concept has been developed and is being implemented. This system, termed DAISIE (Distributed Artificially Intelligent System for Interacting with the Environment), interfaces the key processes of perception, reasoning, and manipulation by linking hardware sensors and manipulators to a modular artificial intelligence (AI) software system in a hierarchical control structure. Verification experiments have been performed: one experiment used a blocksworld database and planner embedded in the DAISIE system to intelligently manipulate a simple physical environment; the other experiment implemented a joint-space collision avoidance algorithm. Continued system development is planned

  9. The coming of age of artificial intelligence in medicine

    NARCIS (Netherlands)

    Patel, Vimla L.; Shortliffe, Edward H.; Stefanelli, Mario; Szolovits, Peter; Berthold, Michael R.; Bellazzi, Riccardo; Abu-Hanna, Ameen


    This paper is based on a panel discussion held at the Artificial Intelligence in Medicine Europe (AIME) conference in Amsterdam, The Netherlands, in July 2007. It had been more than 15 years since Edward Shortliffe gave a talk at AIME in which he characterized artificial intelligence (AI) in

  10. Artificial Intelligence and Educational Technology: A Natural Synergy. Extended Abstract. (United States)

    McCalla, Gordon I.

    Educational technology and artificial intelligence (AI) are natural partners in the development of environments to support human learning. Designing systems with the characteristics of a rich learning environment is the long term goal of research in intelligent tutoring systems (ITS). Building these characteristics into a system is extremely…

  11. Active and intelligent food packaging: legal aspects and safety concerns

    NARCIS (Netherlands)

    Dainelli, D.; Gontard, N.; Spyropoulos, D.; Zondervan-van den Beuken, E.; Tobback, P.


    'Active and intelligent' (A&I) food packaging is based on a deliberate interaction of the packaging with the food and/or its direct environment. This article presents: (i) the main types of materials developed for food contact; (ii) the global market and the future trends of active and intelligent

  12. Ethico-epistemological implications of artificial intelligence for ...

    African Journals Online (AJOL)

    We argued for a re-direction of AI. research and suggested a humanization of Artificial Intelligence that cloaks technoscientific innovations with humanistic life jackets for man‟s preservation. The textual analysis method is adopted for this research. Key words: Ethics, Epistemology, Artificial Intelligence, Humanity.

  13. "All-In-One Test" (AI1)

    DEFF Research Database (Denmark)

    Giacalone, Davide; Bredie, Wender Laurentius Petrus; Frøst, Michael Bom


    by the Check-All-That-Apply (CATA) technique is reported. In this exploratory "All-In-One Test"(AI1), subjects (N = 160) filled out a questionnaire with demographic and psychographic variables, and appropriateness ratings for specific sensory descriptors of beer. Subsequently, subjects gave hedonic ratings...... between appropriateness and actual hedonic response. Overall, the AI1 test provided interpretable results concerning consumer perception (sensory/hedonic) of the beers, and revealed relations with consumers' background information. Initial results with AI1 test show that it is an efficient and versatile...

  14. Health Information in French (français) (United States)

    ... Biopsy - français (French) Bilingual PDF Health Information Translations Breast Biopsy - français (French) Bilingual PDF Health Information Translations Colposcopy - français (French) Bilingual PDF ...

  15. Art in the Age of Machine Intelligence

    Directory of Open Access Journals (Sweden)

    Blaise Agüera y Arcas


    Full Text Available In this wide‐ranging essay, the leader of Google’s Seattle AI group and founder of the Artists and Machine Intelligence program discusses the long‐standing and complex relationship between art and technology. The transformation of artistic practice and theory that attended the 19th century photographic revolution is explored as a parallel for the current revolution in machine intelligence, which promises not only to mechanize (or democratize the means of reproduction, but also of production.



    Elena Juganaru Andreou


    Nowadays, all big companies and most of small businesses are focused on increasing profitability and improving competitiveness. With this goal in mind, many of them turned to replace many tasks performed by humans with Artificial Intelligence. Artificial Intelligence (AI) is receiving an increasing attention lately and the debate is fiercely growing with a question not being answered yet: will it change the world for the better or for worse?

  17. The 2002 Starting Artificial Intelligence Researchers Symposium


    Vidal, Thierry


    During the 2002 European Conference on Artificial Intelligence (ECAI-02) was introduced the Starting Artificial Intelligence Researchers Symposium STAIRS), the first-ever international symposium specifically aimed at Ph.D. students in AI. The outcome was a thorough, high-quality, and successful event, with all the features one usually finds in the best international conferences: large international committees, comprehensive coverage, published proceedings, renowned speakers and panelists, sub...

  18. Operating-System Support for Distributed Multimedia

    NARCIS (Netherlands)

    Mullender, Sape J.; Leslie, Ian M.; McAuley, Derek


    Multimedia applications place new demands upon processors, networks and operating systems. While some network designers, through ATM for example, have considered revolutionary approaches to supporting multimedia, the same cannot be said for operating systems designers. Most work is evolutionary in

  19. Fully automatic AI-based leak detection system

    Energy Technology Data Exchange (ETDEWEB)

    Tylman, Wojciech; Kolczynski, Jakub [Dept. of Microelectronics and Computer Science, Technical University of Lodz in Poland, ul. Wolczanska 221/223, Lodz (Poland); Anders, George J. [Kinectrics Inc., 800 Kipling Ave., Toronto, Ontario M8Z 6C4 (Canada)


    This paper presents a fully automatic system intended to detect leaks of dielectric fluid in underground high-pressure, fluid-filled (HPFF) cables. The system combines a number of artificial intelligence (AI) and data processing techniques to achieve high detection capabilities for various rates of leaks, including leaks as small as 15 l per hour. The system achieves this level of precision mainly thanks to a novel auto-tuning procedure, enabling learning of the Bayesian network - the decision-making component of the system - using simulated leaks of various rates. Significant new developments extending the capabilities of the original leak detection system described in and form the basis of this paper. Tests conducted on the real-life HPFF cable system in New York City are also discussed. (author)

  20. Planning chemical syntheses with deep neural networks and symbolic AI (United States)

    Segler, Marwin H. S.; Preuss, Mike; Waller, Mark P.


    To plan the syntheses of small organic molecules, chemists use retrosynthesis, a problem-solving technique in which target molecules are recursively transformed into increasingly simpler precursors. Computer-aided retrosynthesis would be a valuable tool but at present it is slow and provides results of unsatisfactory quality. Here we use Monte Carlo tree search and symbolic artificial intelligence (AI) to discover retrosynthetic routes. We combined Monte Carlo tree search with an expansion policy network that guides the search, and a filter network to pre-select the most promising retrosynthetic steps. These deep neural networks were trained on essentially all reactions ever published in organic chemistry. Our system solves for almost twice as many molecules, thirty times faster than the traditional computer-aided search method, which is based on extracted rules and hand-designed heuristics. In a double-blind AB test, chemists on average considered our computer-generated routes to be equivalent to reported literature routes.

  1. Applying AI techniques to improve alarm display effectiveness

    International Nuclear Information System (INIS)

    Gross, J.M.; Birrer, S.A.; Crosberg, D.R.


    The Alarm Filtering System (AFS) addresses the problem of information overload in a control room during abnormal operations. Since operators can miss vital information during these periods, systems which emphasize important messages are beneficial. AFS uses the artificial intelligence (AI) technique of object-oriented programming to filter and dynamically prioritize alarm messages. When an alarm's status changes, AFS determines the relative importance of that change according to the current process state. AFS bases that relative importance on relationships the newly changed alarm has with other activated alarms. Evaluations of a alarm importance take place without regard to the activation sequence of alarm signals. The United States Department of Energy has applied for a patent on the approach used in this software. The approach was originally developed by EG and G Idaho for a nuclear reactor control room

  2. Orthogonally Evolved AI to Improve Difficulty Adjustment in Video Games

    DEFF Research Database (Denmark)

    Hintze, Arend; Olson, Randal; Lehman, Joel Anthony


    Computer games are most engaging when their difficulty is well matched to the player's ability, thereby providing an experience in which the player is neither overwhelmed nor bored. In games where the player interacts with computer-controlled opponents, the difficulty of the game can be adjusted...... not only by changing the distribution of opponents or game resources, but also through modifying the skill of the opponents. Applying evolutionary algorithms to evolve the artificial intelligence that controls opponent agents is one established method for adjusting opponent difficulty. Less-evolved agents...... (i.e. agents subject to fewer generations of evolution) make for easier opponents, while highly-evolved agents are more challenging to overcome. In this publication we test a new approach for difficulty adjustment in games: orthogonally evolved AI, where the player receives support from collaborating...

  3. A multimedia telemedicine system. (United States)

    Ling, Li; Dezhong, Yao; Jianqing, Li; Bin, Li; Ling, Wang


    A multimedia telemedicine system (MTS) using Transfer Control Protocol and Internet Protocol (TCP/IP) over the Internet is developed. Doctor with patient and doctor can communicate each other using this system. Real-time data, including audio, video and instant message (IM), and non-real-time data, including vital sign signals, radiological images with DICOM 3.0, file, bio-signal, bio-data and so on, can be exchanged on the system. This system's architecture is client/server mode. All data are encoded/compressed before transferring through Internet/Intranet. The real-time audio is encoded and decoded by MPEG (Moving Picture Experts Group) audio layer 3 algorithm and real-time video is encoded and decoded by MPEG-4. The software implementation of needed functionality without any externally attached hardware CODEC (Coder/Decoder) units enables the compact design with low cost. The real-time video has 25 frames per second at Local Area Network (LAN) and more than 20 frames per second at ADSL.

  4. Artificial intelligence techniques in Prolog

    CERN Document Server

    Shoham, Yoav


    Artificial Intelligence Techniques in Prolog introduces the reader to the use of well-established algorithmic techniques in the field of artificial intelligence (AI), with Prolog as the implementation language. The techniques considered cover general areas such as search, rule-based systems, and truth maintenance, as well as constraint satisfaction and uncertainty management. Specific application domains such as temporal reasoning, machine learning, and natural language are also discussed.Comprised of 10 chapters, this book begins with an overview of Prolog, paying particular attention to Prol

  5. The Singularity, or How I Learned to Stop Worrying and Love AI


    Bishop, Mark (J. M.)


    Professor Stephen Hawking recently warned about the growing power of Artificial Intelligence (AI) to imbue robots with the ability to both replicate them- selves and to increase the rate at which they get smarter - leading to a tipping point or ‘technological singularity’ when they can outsmart humans. In this chapter I will argue that Hawking is essentially correct to flag up an existential danger surrounding widespread deployment of ‘autonomous machines’, but wrong to be so concerned about ...

  6. Sensor assignment to mission in AI-TECD (United States)

    Ganger, Robert; de Mel, Geeth; Pham, Tien; Rudnicki, Ronald; Schreiber, Yonatan


    Sensor-mission assignment involves the allocation of sensors and other information-providing resources to missions in order to cover the information needs of the individual tasks within each mission. The importance of efficient and effective means to find appropriate resources for tasks is exacerbated in the coalition context where the operational environment is dynamic and a multitude of critically important tasks need to achieve their collective goals to meet the objectives of the coalition. The Sensor Assignment to Mission (SAM) framework—a research product of the International Technology Alliance in Network and Information Sciences (NIS-ITA) program—provided the first knowledge intensive resource selection approach for the sensor network domain so that contextual information could be used to effectively select resources for tasks in coalition environments. Recently, CUBRC, Inc. was tasked with operationalizing the SAM framework through the use of the I2WD Common Core Ontologies for the Communications-Electronics Research, Development and Engineering Center (CERDEC) sponsored Actionable Intelligence Technology Enabled Capabilities Demonstration (AI-TECD). The demonstration event took place at Fort Dix, New Jersey during July 2015, and this paper discusses the integration and the successful demonstration of the SAM framework within the AI-TECD, lessons learned, and its potential impact in future operations.

  7. Multimedia security watermarking, steganography, and forensics

    CERN Document Server

    Shih, Frank Y


    Multimedia Security: Watermarking, Steganography, and Forensics outlines essential principles, technical information, and expert insights on multimedia security technology used to prove that content is authentic and has not been altered. Illustrating the need for improved content security as the Internet and digital multimedia applications rapidly evolve, this book presents a wealth of everyday protection application examples in fields including multimedia mining and classification, digital watermarking, steganography, and digital forensics. Giving readers an in-depth overview of different asp

  8. Multimedia database retrieval technology and applications

    CERN Document Server

    Muneesawang, Paisarn; Guan, Ling


    This book explores multimedia applications that emerged from computer vision and machine learning technologies. These state-of-the-art applications include MPEG-7, interactive multimedia retrieval, multimodal fusion, annotation, and database re-ranking. The application-oriented approach maximizes reader understanding of this complex field. Established researchers explain the latest developments in multimedia database technology and offer a glimpse of future technologies. The authors emphasize the crucial role of innovation, inspiring users to develop new applications in multimedia technologies

  9. Towards an Integrated Solution for Multimedia Communications


    Mathy, Laurent; Leduc, Guy; Danthine, André; Bonaventure, Olivier


    During the last few years, we have been witnessing tremendous changes in the communication environment. Those changes are not only due to the availability of higher data rates in the communication networks but also to the appearance of new application types such as multimedia applications. After a brief introduction to multimedia communications, we will present the research activities in multimedia we have undertaken during the last few years. They focus on two aspects of multimedia communica...

  10. Forensic hash for multimedia information (United States)

    Lu, Wenjun; Varna, Avinash L.; Wu, Min


    Digital multimedia such as images and videos are prevalent on today's internet and cause significant social impact, which can be evidenced by the proliferation of social networking sites with user generated contents. Due to the ease of generating and modifying images and videos, it is critical to establish trustworthiness for online multimedia information. In this paper, we propose novel approaches to perform multimedia forensics using compact side information to reconstruct the processing history of a document. We refer to this as FASHION, standing for Forensic hASH for informatION assurance. Based on the Radon transform and scale space theory, the proposed forensic hash is compact and can effectively estimate the parameters of geometric transforms and detect local tampering that an image may have undergone. Forensic hash is designed to answer a broader range of questions regarding the processing history of multimedia data than the simple binary decision from traditional robust image hashing, and also offers more efficient and accurate forensic analysis than multimedia forensic techniques that do not use any side information.

  11. Application of Artificial Intelligence Techniques in Uninhabited Aerial Vehicle Flight (United States)

    Dufrene, Warren R., Jr.


    This paper describes the development of an application of Artificial Intelligence (AI) for Unmanned Aerial Vehicle (UAV) control. The project was done as part of the requirements for a class in AI at NOVA Southeastearn University and a beginning project at NASA Wallops Flight Facility for a resilient, robust, and intelligent UAV flight control system. A method is outlined which allows a base level application for applying an Artificial Intelligence method, Fuzzy Logic, to aspects of Control Logic for UAV flight. One element of UAV flight, automated altitude hold, has been implemented and preliminary results displayed.

  12. Application of Artificial Intelligence Techniques in Uninhabitated Aerial Vehicle Flight (United States)

    Dufrene, Warren R., Jr.


    This paper describes the development of an application of Artificial Intelligence (AI) for Unmanned Aerial Vehicle (UAV) control. The project was done as part of the requirements for a class in AI at NOVA southeastern University and a beginning project at NASA Wallops Flight Facility for a resilient, robust, and intelligent UAV flight control system. A method is outlined which allows a base level application for applying an Artificial Intelligence method, Fuzzy Logic, to aspects of Control Logic for UAV flight. One element of UAV flight, automated altitude hold, has been implemented and preliminary results displayed.

  13. The coming of age of artificial intelligence in medicine


    Patel, Vimla L.; Shortliffe, Edward H.; Stefanelli, Mario; Szolovits, Peter; Berthold, Michael R.; Bellazzi, Riccardo; Abu-Hanna, Ameen


    This paper is based on a panel discussion held at the Artificial Intelligence in Medicine Europe (AIME) conference in Amsterdam, The Netherlands, in July 2007. It had been more than 15 years since Edward Shortliffe gave a talk at AIME in which he characterized artificial intelligence (AI) in medicine as being in its “adolescence” (Shortliffe EH. The adolescence of AI in medicine: Will the field come of age in the ‘90s? Artificial Intelligence in Medicine 1993; 5:93–106). In this article, the ...

  14. AIS Ship Traffic: Hawaii: 2011-2012 (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

  15. Cracks appear in the AI gravy train

    Energy Technology Data Exchange (ETDEWEB)

    Mill, J.


    This article highlights some of the problems facing the Alvey committee and outlines some reasons for believing that the optimistically founded Alvey and Esprit funding programmes are no guarantee Britain will win the AI race.

  16. National AIS at 1 Minute Intervals (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — OCM plans to contract for AIS data per the following description. The United States Automatic Identification System Database contains vessel traffic data for...

  17. Security Management in a Multimedia System (United States)

    Rednic, Emanuil; Toma, Andrei


    In database security, the issue of providing a level of security for multimedia information is getting more and more known. For the moment the security of multimedia information is done through the security of the database itself, in the same way, for all classic and multimedia records. So what is the reason for the creation of a security…

  18. Standards of Multimedia Graphic Design in Education (United States)

    Aldalalah, Osamah Ahmad; Ababneh, Ziad Waleed Mohamed


    This study aims to determine Standards of Multimedia Graphic Design in Education through the analysis of the theoretical basis and previous studies related to this subject. This study has identified the list of standards of Multimedia, Graphic Design, each of which has a set indicator through which the quality of Multimedia can be evaluated in…

  19. New Visions of Reality: Multimedia and Education. (United States)

    Ambron, Sueann


    Multimedia is a powerful tool that will change both the way we look at knowledge and our vision of reality, as well as our educational system and the business world. Multimedia as used here refers to the innovation of mixing text, audio, and video through the use of a computer. Not only will there be new products emerging from multimedia uses, but…

  20. Multimedia Search Engines : Concept, Performance, and Types


    Sayed Rabeh Sayed


    A Research about multimedia search engines, it starts with definition of search engines at general and multimedia search engines, then explains how they work, and divided them into: Video search engines, Images search engines, and Audio search engines. Finally, it reviews a samples to multimedia search engines.

  1. Biomimetics in Intelligent Sensor and Actuator Automation Systems (United States)

    Bruckner, Dietmar; Dietrich, Dietmar; Zucker, Gerhard; Müller, Brit

    Intelligent machines are really an old mankind's dream. With increasing technological development, the requirements for intelligent devices also increased. However, up to know, artificial intelligence (AI) lacks solutions to the demands of truly intelligent machines that have no problems to integrate themselves into daily human environments. Current hardware with a processing power of billions of operations per second (but without any model of human-like intelligence) could not substantially contribute to the intelligence of machines when compared with that of the early AI times. There are great results, of course. Machines are able to find the shortest path between far apart cities on the map; algorithms let you find information described only by few key words. But no machine is able to get us a cup of coffee from the kitchen yet.

  2. Learning game AI programming with Lua

    CERN Document Server

    Young, David


    If you are a game developer or a general programmer who wishes to focus on programming systems and techniques to build your game AI without creating low-level interfaces in a game engine, then this book is for you. Knowledge of C++ will come in handy to debug the entirety of the AI sandbox and expand on the features present within the book, but it is not required.

  3. Adaptive game AI with dynamic scripting


    Spronck, P.; Ponsen, M.J.V.; Sprinkhuizen-Kuyper, I.G.; Postma, E.O.


    Online learning in commercial computer games allows computer-controlled opponents to adapt to the way the game is being played. As such it provides a mechanism to deal with weaknesses in the game AI, and to respond to changes in human player tactics.We argue that online learning of game AI should meet four computational and four functional requirements. The computational requirements are speed, effectiveness, robustness and ef- ficiency. The functional requirements are clarity, variety, consi...

  4. Research Directions for AI in Computer Games


    Fairclough, Chris; Fagan, Michael; Cunningham, Padraig; Mac Namee, Brian


    The computer games industry is now bigger than the film industry. Until recently, technology in games was driven by a desire to achieve real-time, photo-realistic graphics. To a large extent, this has now been achieved. As game developers look for new and innovative technologies to drive games development, AI is coming to the fore. This paper will examine how sophisticated AI techniques, such as those being used in mainstream academic research, can be applied to computer games ...

  5. Multimedia signal coding and transmission

    CERN Document Server

    Ohm, Jens-Rainer


    This textbook covers the theoretical background of one- and multidimensional signal processing, statistical analysis and modelling, coding and information theory with regard to the principles and design of image, video and audio compression systems. The theoretical concepts are augmented by practical examples of algorithms for multimedia signal coding technology, and related transmission aspects. On this basis, principles behind multimedia coding standards, including most recent developments like High Efficiency Video Coding, can be well understood. Furthermore, potential advances in future development are pointed out. Numerous figures and examples help to illustrate the concepts covered. The book was developed on the basis of a graduate-level university course, and most chapters are supplemented by exercises. The book is also a self-contained introduction both for researchers and developers of multimedia compression systems in industry.

  6. A regulator's viewpoint on the use of AI in the nuclear industry

    International Nuclear Information System (INIS)

    Wainwright, N.


    The regulatory position within the UK places the responsibility for safety on a nuclear site with the licensee. The licensee must produce a safety case that demonstrates that the plant is safe. Assessment of this safety case is performed by the regulator in the Health and Safety Executive (HSE) using HSE's published Safety Assessment Principles. This paper presents the personal views of a regulator on the use of artificial intelligence (AI) in the nuclear industry. The AI-based system considered are restricted to expert systems, neural networks and fuzzy logic. Some of the safety issues are discussed. The particular concerns associated with software-based systems are compounded by some of the inherent problems of AI-based systems. Such is the nature of these concerns that an acceptable safety case will be difficult to mount for safety systems and post-accident monitoring systems. However, given the present maturity of the technology, acceptable safety cases might be formulated in the areas of operator advisory systems designed to reduce accident frequencies, and robotics where dose reduction is important. There are also arguments that suggests that suitable safety cases could be formulated for AI-based plant control systems. Nevertheless, AI-based systems should be treated with caution - further research is required into suitable designs and safety demonstration techniques. (author)

  7. Advanced Applications of Neural Networks and Artificial Intelligence: A Review


    Koushal Kumar; Gour Sundar Mitra Thakur


    Artificial Neural Network is a branch of Artificial intelligence and has been accepted as a new computing technology in computer science fields. This paper reviews the field of Artificial intelligence and focusing on recent applications which uses Artificial Neural Networks (ANN’s) and Artificial Intelligence (AI). It also considers the integration of neural networks with other computing methods Such as fuzzy logic to enhance the interpretation ability of data. Artificial Neural Networks is c...

  8. Multimedia watermarking techniques and applications

    CERN Document Server

    Kirovski, Darko


    Intellectual property owners must continually exploit new ways of reproducing, distributing, and marketing their products. However, the threat of piracy looms as a major problem with digital distribution and storage technologies. Multimedia Watermarking Techniques and Applications covers all current and future trends in the design of modern systems that use watermarking to protect multimedia content. Containing the works of contributing authors who are worldwide experts in the field, this volume is intended for researchers and practitioners, as well as for those who want a broad understanding

  9. Applying AI tools to operational space environmental analysis (United States)

    Krajnak, Mike; Jesse, Lisa; Mucks, John


    The U.S. Air Force and National Oceanic Atmospheric Agency (NOAA) space environmental operations centers are facing increasingly complex challenges meeting the needs of their growing user community. These centers provide current space environmental information and short term forecasts of geomagnetic activity. Recent advances in modeling and data access have provided sophisticated tools for making accurate and timely forecasts, but have introduced new problems associated with handling and analyzing large quantities of complex data. AI (Artificial Intelligence) techniques have been considered as potential solutions to some of these problems. Fielding AI systems has proven more difficult than expected, in part because of operational constraints. Using systems which have been demonstrated successfully in the operational environment will provide a basis for a useful data fusion and analysis capability. Our approach uses a general purpose AI system already in operational use within the military intelligence community, called the Temporal Analysis System (TAS). TAS is an operational suite of tools supporting data processing, data visualization, historical analysis, situation assessment and predictive analysis. TAS includes expert system tools to analyze incoming events for indications of particular situations and predicts future activity. The expert system operates on a knowledge base of temporal patterns encoded using a knowledge representation called Temporal Transition Models (TTM's) and an event database maintained by the other TAS tools. The system also includes a robust knowledge acquisition and maintenance tool for creating TTM's using a graphical specification language. The ability to manipulate TTM's in a graphical format gives non-computer specialists an intuitive way of accessing and editing the knowledge base. To support space environmental analyses, we used TAS's ability to define domain specific event analysis abstractions. The prototype system defines

  10. Artificial intelligence - NASA. [robotics for Space Station (United States)

    Erickson, J. D.


    Artificial Intelligence (AI) represents a vital common space support element needed to enable the civil space program and commercial space program to perform their missions successfully. It is pointed out that advances in AI stimulated by the Space Station Program could benefit the U.S. in many ways. A fundamental challenge for the civil space program is to meet the needs of the customers and users of space with facilities enabling maximum productivity and having low start-up costs, and low annual operating costs. An effective way to meet this challenge may involve a man-machine system in which artificial intelligence, robotics, and advanced automation are integrated into high reliability organizations. Attention is given to the benefits, NASA strategy for AI, candidate space station systems, the Space Station as a stepping stone, and the commercialization of space.

  11. International Conference on Frontiers of Intelligent Computing : Theory and Applications

    CERN Document Server

    Udgata, Siba; Biswal, Bhabendra


    This volume contains the papers presented at the Second International Conference on Frontiers in Intelligent Computing: Theory and Applications (FICTA-2013) held during 14-16 November 2013 organized by Bhubaneswar Engineering College (BEC), Bhubaneswar, Odisha, India. It contains 63 papers focusing on application of intelligent techniques which includes evolutionary computation techniques like genetic algorithm, particle swarm optimization techniques, teaching-learning based optimization etc  for various engineering applications such as data mining, Fuzzy systems, Machine Intelligence and ANN, Web technologies and Multimedia applications and Intelligent computing and Networking etc.

  12. 3rd Workshop on "Combinations of Intelligent Methods and Applications"

    CERN Document Server

    Palade, Vasile


    The combination of different intelligent methods is a very active research area in Artificial Intelligence (AI). The aim is to create integrated or hybrid methods that benefit from each of their components.  The 3rd Workshop on “Combinations of Intelligent Methods and Applications” (CIMA 2012) was intended to become a forum for exchanging experience and ideas among researchers and practitioners who are dealing with combining intelligent methods either based on first principles or in the context of specific applications. CIMA 2012 was held in conjunction with the 22nd European Conference on Artificial Intelligence (ECAI 2012).This volume includes revised versions of the papers presented at CIMA 2012.  .

  13. Case studies in intelligent computing achievements and trends

    CERN Document Server

    Issac, Biju


    Although the field of intelligent systems has grown rapidly in recent years, there has been a need for a book that supplies a timely and accessible understanding of this important technology. Filling this need, Case Studies in Intelligent Computing: Achievements and Trends provides an up-to-date introduction to intelligent systems.This edited book captures the state of the art in intelligent computing research through case studies that examine recent developments, developmental tools, programming, and approaches related to artificial intelligence (AI). The case studies illustrate successful ma

  14. International Conference on Multimedia and Ubiquitous Engineering

    CERN Document Server

    Chen, Shu-Ching; Gil, Joon-Min; Yen, Neil; Multimedia and Ubiquitous Engineering


    The aims of these proceedings are to provide a complete coverage of the areas outlined, and to bring together researchers from academic and industry to share ideas, challenges, and solutions relating to the multifaceted aspects of this field. New multimedia standards (for example, MPEG-21) facilitate the seamless integration of multiple modalities into interoperable multimedia frameworks, transforming the way people work and interact with multimedia data. These key technologies and multimedia solutions interact and collaborate with each other in increasingly effective ways, contributing to the multimedia revolution and having a significant impact across a wide spectrum of consumer, business, healthcare, education, and governmental domains.

  15. Multimedia Transformation: A Special Report on Multimedia in Schools (United States)

    Education Week, 2011


    In science and math classes across the country, digital tools are being used to conduct experiments, analyze data, and run 3-D simulations to explain complex concepts. Language arts teachers are now pushing the definition of literacy to include the ability to express ideas through media. This report, "Multimedia Transformation," examines the many…

  16. Multimedia Adaptation in Ubiquitous Environments: Benefits of Structured Multimedia Documents

    NARCIS (Netherlands)

    P.S. Cesar Garcia (Pablo Santiago); I. Vaishnavi (Ishan); R. Kernchen; S. Meissner; M. Boussard; A. Spedalieri; B. Gao (Bo); D.C.A. Bulterman (Dick)


    htmlabstractThis paper demonstrates the advantages of using structured multimedia documents for session management and media distribution in ubiquitous environments. We show how document manipulations can be used to perform powerful operations such as content to context adaptation and presentation

  17. Exploiting Multimedia in Creating and Analysing Multimedia Web Archives

    Directory of Open Access Journals (Sweden)

    Jonathon S. Hare


    Full Text Available The data contained on the web and the social web are inherently multimedia and consist of a mixture of textual, visual and audio modalities. Community memories embodied on the web and social web contain a rich mixture of data from these modalities. In many ways, the web is the greatest resource ever created by human-kind. However, due to the dynamic and distributed nature of the web, its content changes, appears and disappears on a daily basis. Web archiving provides a way of capturing snapshots of (parts of the web for preservation and future analysis. This paper provides an overview of techniques we have developed within the context of the EU funded ARCOMEM (ARchiving COmmunity MEMories project to allow multimedia web content to be leveraged during the archival process and for post-archival analysis. Through a set of use cases, we explore several practical applications of multimedia analytics within the realm of web archiving, web archive analysis and multimedia data on the web in general.

  18. Pemanfaatan Multimedia sebagai Media Penyuluhan Kesehatan Gigi

    Directory of Open Access Journals (Sweden)

    Hestieyonini Hadnyawati


    Full Text Available The effort of suppression promotion and preventive as practice principles of "paradigma sehat" are concept which announcement by Departemen Kesehatan Republik Indonesia in framework reach Indonesia Sehat 2010. This effort as well as possible to get done by everyone Indonesia peoples, with the holistic through way dental education. For this application dental education needed medium. Multimedia are application various medium which different for associate and serve information in form text, audio, chart, animation, and video. Multimedia find occupy somebody for keep 90% what he read, hear, se, mention and done. Using multimedia as dental education medium can be used CD/VCD multimedia module, multimedia presentation, and multimedia web. With this reminder, so using multimedia technology find service as alternative medium for public dental education.

  19. Artificial intelligence

    CERN Document Server

    Hunt, Earl B


    Artificial Intelligence provides information pertinent to the fundamental aspects of artificial intelligence. This book presents the basic mathematical and computational approaches to problems in the artificial intelligence field.Organized into four parts encompassing 16 chapters, this book begins with an overview of the various fields of artificial intelligence. This text then attempts to connect artificial intelligence problems to some of the notions of computability and abstract computing devices. Other chapters consider the general notion of computability, with focus on the interaction bet

  20. Intelligent mechatronics; Intelligent mechatronics

    Energy Technology Data Exchange (ETDEWEB)

    Hashimoto, H. [The University of Tokyo, Tokyo (Japan). Institute of Industrial Science


    Intelligent mechatronics (IM) was explained as follows: a study of IM essentially targets realization of a robot namely, but in the present stage the target is a creation of new values by intellectualization of machine, that is, a combination of the information infrastructure and the intelligent machine system. IM is also thought to be constituted of computers positively used and micromechatronics. The paper next introduces examples of IM study, mainly those the author is concerned with as shown below: sensor gloves, robot hands, robot eyes, tele operation, three-dimensional object recognition, mobile robot, magnetic bearing, construction of remote controlled unmanned dam, robot network, sensitivity communication using neuro baby, etc. 27 figs.

  1. The psychology of multimedia databases

    NARCIS (Netherlands)

    M.G.L.M. van Doorn (Mark); A.P. de Vries (Arjen)


    textabstractMultimedia information retrieval in digital libraries is a difficult task for computers in general. Humans on the other hand are experts in perception, concept representation, knowledge organization and memory retrieval. Cognitive psychology and science describe how cognition works in

  2. Multimedia and Technology in Learning (United States)

    Mantiri, Franky


    This essay explores the use of computer technology and multimedia in students learning. Undoubtedly, the advent of computer technology has changed the way humans learn and do things. Moreover, "Computer has become standard equipment" (Bitter & Pierson, 2002) in everyday life. The ability to process data in a real time has helped…

  3. Content independence in multimedia databases

    NARCIS (Netherlands)

    A.P. de Vries (Arjen)


    textabstractA database management system is a general-purpose software system that facilitates the processes of defining, constructing, and manipulating databases for various applications. This article investigates the role of data management in multimedia digital libraries, and its implications for

  4. Hypervideos and interactive multimedia presentations

    NARCIS (Netherlands)

    B. Meixner (Britta)


    textabstractHypervideos and interactive multimedia presentations allow the creation of fully interactive and enriched video. It is possible to organize video scenes in a nonlinear way. Additional information can be added to the video ranging from short descriptions to images and more videos.

  5. Learning Words through Multimedia Application

    DEFF Research Database (Denmark)

    Zhang, Chun


      This study explores the relevance of multimedia application in relation to vocabulary acquisition in the classroom of Chinese as a foreign language. The herein depicted application refers to the computer-assisted implicit word-learning, wherein the Danish students built hypertexts to acquire...... meanings of unknown words aiming to research and to enlarging Chinese vocabulary.  ...

  6. MIMO Based Multimedia Communication System


    Kandar, D.; Dhar, Sourav; Bera, Rabindranath; Sarkar, C. K.


    High data rate is required for multimedia communication. But the communication at high data rate is always challenging. In this work we have successfully performed data chatting, Voice chatting and high quality video transmission between two distant units using MIMO adapter, Direct sequence spread spectrum system and MATLAB/SIMULINK platform.

  7. Editor’s Note

    Directory of Open Access Journals (Sweden)

    Manju Khari


    Full Text Available The International Journal of Interactive Multimedia and Artificial Intelligence (IJIMAI provides an interdisciplinary forum in which scientists and professionals share their research results and report new advances on tools that use AI with interactive multimedia techniques.

  8. Artificial intelligence in hematology. (United States)

    Zini, Gina


    Artificial intelligence (AI) is a computer based science which aims to simulate human brain faculties using a computational system. A brief history of this new science goes from the creation of the first artificial neuron in 1943 to the first artificial neural network application to genetic algorithms. The potential for a similar technology in medicine has immediately been identified by scientists and researchers. The possibility to store and process all medical knowledge has made this technology very attractive to assist or even surpass clinicians in reaching a diagnosis. Applications of AI in medicine include devices applied to clinical diagnosis in neurology and cardiopulmonary diseases, as well as the use of expert or knowledge-based systems in routine clinical use for diagnosis, therapeutic management and for prognostic evaluation. Biological applications include genome sequencing or DNA gene expression microarrays, modeling gene networks, analysis and clustering of gene expression data, pattern recognition in DNA and proteins, protein structure prediction. In the field of hematology the first devices based on AI have been applied to the routine laboratory data management. New tools concern the differential diagnosis in specific diseases such as anemias, thalassemias and leukemias, based on neural networks trained with data from peripheral blood analysis. A revolution in cancer diagnosis, including the diagnosis of hematological malignancies, has been the introduction of the first microarray based and bioinformatic approach for molecular diagnosis: a systematic approach based on the monitoring of simultaneous expression of thousands of genes using DNA microarray, independently of previous biological knowledge, analysed using AI devices. Using gene profiling, the traditional diagnostic pathways move from clinical to molecular based diagnostic systems.

  9. The multimedia corrosion guide, 2. edition

    International Nuclear Information System (INIS)

    Audisio, S.


    Collecting the knowledge and experience of 26 international experts, the Multimedia Corrosion Guide is a reference book in the field of corrosion, for scientists, engineers, technicians and students. Also available in English, the second edition is more than just an update; it contains new chapters, new corrosion case studies and new smart functions. When knowledge is combined with experience, the result is a work of unprecedented quality and detail. Under the supervision of Professor Dr. S. Audisio of the Industrial Physical Chemistry Laboratory, INSA de Lyon, France, leading corrosion specialists from industry (Aerospatiale, CEA, EDF, ELF, Fragema, GDF, Pechiney, Renault, Rhone-Poulenc, Ugine...) have joined forces with experts from renowned French universities (INSA, UTC, ENSEEP, ENSCP, ENSAM...) to produce this book. In addition to the Corrosion Treatise, this program also contains a Case Studies Library, a corrosion database to which users can add their own experience base. New cases are automatically inserted alongside the existing ones, with the same selection criteria. Numerous other advanced functions make this second edition a unique, intelligent, professional and invaluable reference tool. (authors)

  10. Two new Oxalis species (Oxalidaceae) from the Ai-Ais / Richtersveld Transfrontier Park, South Africa

    NARCIS (Netherlands)

    Roets, F.; Oberlander, K.C.; Dreyer, L.L.


    South Africa has a rich, but scantily surveyed, desert flora. Documenting annual and geophytic species in this biome is challenging, as they usually only flower after adequate precipitation, which is characteristically erratic and infrequent. Recent floristic surveys in the Ai-Ais / Richtersveld

  11. Use of AI-1024 and AI-4096 analyzers in multiple regimes

    International Nuclear Information System (INIS)

    Zaika, N.D.; Kovtunenko, I.S.; Savchuk, O.G.


    The operation of pulse multichannel analyzers in the following multidimensional modes: AI-1024-4 - amplitude mode from several transducers; amplitude mode from several transducers at different time intervals; AI-4096-3M - amplitude mode at different time intervals in each of four groups with unit BVI-1

  12. Artificial intelligence applications in the intensive care unit. (United States)

    Hanson, C W; Marshall, B E


    To review the history and current applications of artificial intelligence in the intensive care unit. The MEDLINE database, bibliographies of selected articles, and current texts on the subject. The studies that were selected for review used artificial intelligence tools for a variety of intensive care applications, including direct patient care and retrospective database analysis. All literature relevant to the topic was reviewed. Although some of the earliest artificial intelligence (AI) applications were medically oriented, AI has not been widely accepted in medicine. Despite this, patient demographic, clinical, and billing data are increasingly available in an electronic format and therefore susceptible to analysis by intelligent software. Individual AI tools are specifically suited to different tasks, such as waveform analysis or device control. The intensive care environment is particularly suited to the implementation of AI tools because of the wealth of available data and the inherent opportunities for increased efficiency in inpatient care. A variety of new AI tools have become available in recent years that can function as intelligent assistants to clinicians, constantly monitoring electronic data streams for important trends, or adjusting the settings of bedside devices. The integration of these tools into the intensive care unit can be expected to reduce costs and improve patient outcomes.

  13. On the Nature of Intelligence (United States)

    Churchland, Paul M.

    Alan Turing is the consensus patron saint of the classical research program in Artificial Intelligence (AI), and his behavioral test for the possession of conscious intelligence has become his principal legacy in the mind of the academic public. Both takes are mistakes. That test is a dialectical throwaway line even for Turing himself, a tertiary gesture aimed at softening the intellectual resistance to a research program which, in his hands, possessed real substance, both mathematical and theoretical. The wrangling over his celebrated test has deflected attention away from those more substantial achievements, and away from the enduring obligation to construct a substantive theory of what conscious intelligence really is, as opposed to an epistemological account of how to tell when you are confronting an instance of it. This essay explores Turing's substantive research program on the nature of intelligence, and argues that the classical AI program is not its best expression, nor even the expression intended by Turing. It then attempts to put the famous Test into its proper, and much reduced, perspective.

  14. Artificial Intelligence and Moral intelligence


    Laura Pana


    We discuss the thesis that the implementation of a moral code in the behaviour of artificial intelligent systems needs a specific form of human and artificial intelligence, not just an abstract intelligence. We present intelligence as a system with an internal structure and the structural levels of the moral system, as well as certain characteristics of artificial intelligent agents which can/must be treated as 1- individual entities (with a complex, specialized, autonomous or selfdetermined,...

  15. Incidence of EMILY’S multimedia software and its impact on early childhood education

    Directory of Open Access Journals (Sweden)

    Nelson Eduardo Mariscal Huacon


    Full Text Available The multimedia software for teaching logical-mathematical relationships in early childhood education today has achieved significant changes in teaching, leaving using traditional methods and teaching techniques to apply information technology and communications - ICT within the teaching-learning process, and that is where the imperative of using a multimedia software using it as a central focus for early childhood education arises. The main objective of this research was to apply a multimedia software to improve the teaching-learning process in logical relationships - math children early education Early Education Center .El Mamey”. It is noted that the factors influencing the teaching of children aged between 3 and 5 years are: habits, motivation, methodology, family and emotional intelligence, all this leading to use of a multimedia software to improve cognitive, psychomotor and even more so when you learn playing skills. The above is based on surveys of parents i / or legal representatives of children of early childhood education, where the use of multimedia software Emily’s are considered feasible.

  16. Strategic Team AI Path Plans: Probabilistic Pathfinding

    Directory of Open Access Journals (Sweden)

    Tng C. H. John


    Full Text Available This paper proposes a novel method to generate strategic team AI pathfinding plans for computer games and simulations using probabilistic pathfinding. This method is inspired by genetic algorithms (Russell and Norvig, 2002, in that, a fitness function is used to test the quality of the path plans. The method generates high-quality path plans by eliminating the low-quality ones. The path plans are generated by probabilistic pathfinding, and the elimination is done by a fitness test of the path plans. This path plan generation method has the ability to generate variation or different high-quality paths, which is desired for games to increase replay values. This work is an extension of our earlier work on team AI: probabilistic pathfinding (John et al., 2006. We explore ways to combine probabilistic pathfinding and genetic algorithm to create a new method to generate strategic team AI pathfinding plans.

  17. Artificial intelligence for Space Station automation: Crew safety, productivity, autonomy, augmented capability (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Cheeseman, P. C.; Geldberg, J.


    Artificial intelligence (AI) R&D projects for the successful and efficient operation of the Space Station are described. The book explores the most advanced AI-based technologies, reviews the results of concept design studies to determine required AI capabilities, details demonstrations that would indicate the existence of these capabilities, and develops an R&D plan leading to such demonstrations. Particular attention is given to teleoperation and robotics, sensors, expert systems, computers, planning, and man-machine interface.

  18. An Intelligent System for Document Retrieval in Distributed Office Environments. (United States)

    Mukhopadhyay, Uttam; And Others


    MINDS (Multiple Intelligent Node Document Servers) is a distributed system of knowledge-based query engines for efficiently retrieving multimedia documents in an office environment of distributed workstations. By learning document distribution patterns and user interests and preferences during system usage, it customizes document retrievals for…

  19. Artificial Intelligence Is for Real: Undergraduate Students Should Know about It. (United States)

    Liebowitz, Jay


    Discussion of the possibilities of introducing artificial intelligence (AI) into the undergraduate curriculum highlights the introduction of AI in an introduction to information processing course for business students at George Washington University. Topics discussed include robotics, expert systems prototyping in class, and the interdisciplinary…

  20. Exploiting Artificial Intelligence To Enhance Training: A Short- and Medium-Term Perspective. (United States)

    Cumming, Geoff

    This paper is an introductory discussion of industrial training, artificial intelligence (AI), and AI applications in training, prepared in the context of the United Kingdom Training Commission (TC) program. Following an outline of the activities and aims of the program, individual sections describe perspectives on: (1) training needs, including…

  1. Applications of artificial intelligence systems in the analysis of epidemiological data. (United States)

    Flouris, Andreas D; Duffy, Jack


    A brief review of the germane literature suggests that the use of artificial intelligence (AI) statistical algorithms in epidemiology has been limited. We discuss the advantages and disadvantages of using AI systems in large-scale sets of epidemiological data to extract inherent, formerly unidentified, and potentially valuable patterns that human-driven deductive models may miss.

  2. Survey of Artificial Intelligence and Expert Systems in Library and Information Science Literature. (United States)

    Hsieh, Cynthia C.; Hall, Wendy


    Examines the definition and history of artificial intelligence (AI) and investigates the body of literature on AI found in "Library Literature" and "Library and Information Science Abstracts." The results reported include the number of articles by year and per journal, and the percentage of articles dealing with library…

  3. Artificial Intelligence, Expert Systems, Natural Language Interfaces, Knowledge Engineering and the Librarian. (United States)

    Davies, Jim

    This paper begins by examining concepts of artificial intelligence (AI) and discusses various definitions of the concept that have been suggested in the literature. The nesting relationship of expert systems within the broader framework of AI is described, and expert systems are characterized as knowledge-based systems (KBS) which attempt to solve…

  4. Artificial Intelligence Needs More Emphasis on Basic Research: President's Quarterly Message


    McCarthy, John


    Too few people are doing basic research in AI relative to the number working on applications. The ratio of basic/applied is less in AI than in the older sciences and than in computer science generally. This is unfortunate, because reaching human level artificial intelligence will require fundamental conceptual advances.

  5. Artificial Intelligence and Expert Systems Research and Their Possible Impact on Information Science. (United States)

    Borko, Harold


    Defines artificial intelligence (AI) and expert systems; describes library applications utilizing AI to automate creation of document representations, request formulations, and design and modify search strategies for information retrieval systems; discusses expert system development for information services; and reviews impact of these…

  6. Life 3.0: being human in the age of artificial intelligence

    National Research Council Canada - National Science Library

    Tegmark, Max


    ...? How likely is the emergence of suprahuman intelligence? A.I. is the future of science, technology, and business--and there is no person better qualified or situated to explore that future than Max Tegmark. What has A.I. brought us...

  7. Artificial intelligence as a reflection of reality in the twenty-first century

    Directory of Open Access Journals (Sweden)

    Gusev S. S.


    Full Text Available the article discusses artificial intelligence (AI at the present stage of development, as a way of presenting and understanding AI as the mechanisms of computers. Features a large bunch of some algorithmic procedures for the solution by computer of a specific task, an example of which can serve as an attempt of modeling of biological neural networks.

  8. Artificial Intelligence Application in Power Generation Industry: Initial considerations (United States)

    Ismail, Rahmat Izaizi B.; Ismail Alnaimi, Firas B.; AL-Qrimli, Haidar F.


    With increased competitiveness in power generation industries, more resources are directed in optimizing plant operation, including fault detection and diagnosis. One of the most powerful tools in faults detection and diagnosis is artificial intelligence (AI). Faults should be detected early so correct mitigation measures can be taken, whilst false alarms should be eschewed to avoid unnecessary interruption and downtime. For the last few decades there has been major interest towards intelligent condition monitoring system (ICMS) application in power plant especially with AI development particularly in artificial neural network (ANN). ANN is based on quite simple principles, but takes advantage of their mathematical nature, non-linear iteration to demonstrate powerful problem solving ability. With massive possibility and room for improvement in AI, the inspiration for researching them are apparent, and literally, hundreds of papers have been published, discussing the findings of hybrid AI for condition monitoring purposes. In this paper, the studies of ANN and genetic algorithm (GA) application will be presented.

  9. Imagining the thinking machine: technological myths and the rise of Artificial Intelligence


    Natale, Simone; Ballatore, Andrea


    This article discusses the role of technological myths in the development of Artificial Intelligence (AI) technologies from 1950s to the early 1970s. It shows how the rise of AI was accompanied by the construction of a powerful cultural myth: the creation of a thinking machine, which would be able to perfectly simulate the cognitive faculties of the human mind. Based on a content analysis of articles on Artificial Intelligence published in two magazines, the Scientific American and the New Sc...

  10. AI in Computer-Based Training (United States)

    Camstra, Bert


    In this paper, intelligent approaches to CBT are put into several perspectives in an attempt to elucidate the concepts and give them a more realistic (and not only glamorous) footing. The role of expert systems in training is explored and possible routes towards intelligent CBT are outlined. [This paper was first published in "Interactive Learning…

  11. New trends in computational collective intelligence

    CERN Document Server

    Kim, Sang-Wook; Trawiński, Bogdan


    This book consists of 20 chapters in which the authors deal with different theoretical and practical aspects of new trends in Collective Computational Intelligence techniques. Computational Collective Intelligence methods and algorithms are one the current trending research topics from areas related to Artificial Intelligence, Soft Computing or Data Mining among others. Computational Collective Intelligence is a rapidly growing field that is most often understood as an AI sub-field dealing with soft computing methods which enable making group decisions and processing knowledge among autonomous units acting in distributed environments. Web-based Systems, Social Networks, and Multi-Agent Systems very often need these tools for working out consistent knowledge states, resolving conflicts and making decisions. The chapters included in this volume cover a selection of topics and new trends in several domains related to Collective Computational Intelligence: Language and Knowledge Processing, Data Mining Methods an...

  12. A preliminary study of current multimedia information technology

    Energy Technology Data Exchange (ETDEWEB)

    Lee, J.C.


    This paper surveys more than 70 articles published in the IEEE Multimedia journal and other journals. The survey summarizes aspects of multimedia information technology and categorizes application areas of multimedia information technology and interesting research areas related to it.

  13. GPU: the biggest key processor for AI and parallel processing (United States)

    Baji, Toru


    Two types of processors exist in the market. One is the conventional CPU and the other is Graphic Processor Unit (GPU). Typical CPU is composed of 1 to 8 cores while GPU has thousands of cores. CPU is good for sequential processing, while GPU is good to accelerate software with heavy parallel executions. GPU was initially dedicated for 3D graphics. However from 2006, when GPU started to apply general-purpose cores, it was noticed that this architecture can be used as a general purpose massive-parallel processor. NVIDIA developed a software framework Compute Unified Device Architecture (CUDA) that make it possible to easily program the GPU for these application. With CUDA, GPU started to be used in workstations and supercomputers widely. Recently two key technologies are highlighted in the industry. The Artificial Intelligence (AI) and Autonomous Driving Cars. AI requires a massive parallel operation to train many-layers of neural networks. With CPU alone, it was impossible to finish the training in a practical time. The latest multi-GPU system with P100 makes it possible to finish the training in a few hours. For the autonomous driving cars, TOPS class of performance is required to implement perception, localization, path planning processing and again SoC with integrated GPU will play a key role there. In this paper, the evolution of the GPU which is one of the biggest commercial devices requiring state-of-the-art fabrication technology will be introduced. Also overview of the GPU demanding key application like the ones described above will be introduced.

  14. SNAP and AI Fuel Summary Report

    International Nuclear Information System (INIS)

    Lords, R.E.


    The SNAP and AI Fuel Summary Report provides a detailed overview of treatment and storage of these fuels from fabrication through current storage including design parameters and reactor history. Chemical and physical characteristics are described, and potential indicators of as-stored fuel conditions are emphasized

  15. Automating Commercial Video Game Development using Computational Intelligence


    Tse G. Tan; Jason Teo; Patricia Anthony


    Problem statement: The retail sales of computer and video games have grown enormously during the last few years, not just in United States (US), but also all over the world. This is the reason a lot of game developers and academic researchers have focused on game related technologies, such as graphics, audio, physics and Artificial Intelligence (AI) with the goal of creating newer and more fun games. In recent years, there has been an increasing interest in game AI for pro...

  16. Energy Demand Forecasting: Combining Cointegration Analysis and Artificial Intelligence Algorithm


    Huang, Junbing; Tang, Yuee; Chen, Shuxing


    Energy is vital for the sustainable development of China. Accurate forecasts of annual energy demand are essential to schedule energy supply and provide valuable suggestions for developing related industries. In the existing literature on energy use prediction, the artificial intelligence-based (AI-based) model has received considerable attention. However, few econometric and statistical evidences exist that can prove the reliability of the current AI-based model, an area that still needs to ...

  17. Artificial Intelligence at Advanced Information and Decision Systems


    McCune, Brian P.


    Advanced Information and Decision Systems (AI-DS) is a relatively new, employee-owned company that does basic and applied research, product development, and consulting in the fields of artificial intelligence, computer science, decision analysis, operations research, control theory, estimation theory, and signal processing. AI&DS performs studies, analyses, systems design and evaluation, and software development for a variety of industrial clients and government agencies, including the Depart...

  18. Artificial intelligence and foreign policy decision-making


    Berkoff, Russ H.


    Approved for public release; distribution is unlimited With the advent of a global information society, the US will seek to tap the potential of advanced computing capability to enhance its ability to conduct foreign policy decision making. This thesis explores the potential for improving individual and organizational decision making capabilities by means of artificial intelligence (AI). The use of AI will allow us to take advantage of the plethora of information available to obtain an edg...

  19. Artificial Intelligence Techniques Applications for Power Disturbances Classification


    K.Manimala; Dr.K.Selvi; R.Ahila


    Artificial Intelligence (AI) methods are increasingly being used for problem solving. This paper concerns using AI-type learning machines for power quality problem, which is a problem of general interest to power system to provide quality power to all appliances. Electrical power of good quality is essential for proper operation of electronic equipments such as computers and PLCs. Malfunction of such equipment may lead to loss of production or disruption of critical services resulting in huge...

  20. Tangible Multimedia: A Case Study for Bringing Tangibility into Multimedia Learning (United States)

    Tsong, Chau Kien; Chong, Toh Seong; Samsudin, Zarina


    Multimedia augmented with tangible objects is an area that has not been explored. Current multimedia systems lack the natural elements that allow young children to learn tangibly and intuitively. In view of this, we propose a research to merge tangible objects with multimedia for preschoolers, and propose to term it as "tangible…


    Directory of Open Access Journals (Sweden)

    Orlova Elena V.


    Full Text Available The article deals with the prerequisites of shift of music education paradigm in the XXI century, tells about emergence of new forms in the creative efforts of musicians enrolled in primary schools, and at secondary and highest education levels. Different types and genres of the multimedia creativity are considered. They were in demand by musicians at various events-contests, including Russian and international festivals and competitions in terms of which the music was called upon to play a leading role. Criteria of estimates of new forms of artistic expression are developed. The article contains some video examples given the varying multimedia projects noted by juries of several international competitions held in Moscow (Russia in 2008-2013.

  2. The coming of age of artificial intelligence in medicine. (United States)

    Patel, Vimla L; Shortliffe, Edward H; Stefanelli, Mario; Szolovits, Peter; Berthold, Michael R; Bellazzi, Riccardo; Abu-Hanna, Ameen


    This paper is based on a panel discussion held at the Artificial Intelligence in Medicine Europe (AIME) conference in Amsterdam, The Netherlands, in July 2007. It had been more than 15 years since Edward Shortliffe gave a talk at AIME in which he characterized artificial intelligence (AI) in medicine as being in its "adolescence" (Shortliffe EH. The adolescence of AI in medicine: will the field come of age in the '90s? Artificial Intelligence in Medicine 1993;5:93-106). In this article, the discussants reflect on medical AI research during the subsequent years and characterize the maturity and influence that has been achieved to date. Participants focus on their personal areas of expertise, ranging from clinical decision-making, reasoning under uncertainty, and knowledge representation to systems integration, translational bioinformatics, and cognitive issues in both the modeling of expertise and the creation of acceptable systems.

  3. Artificial intelligence - New tools for aerospace project managers (United States)

    Moja, D. C.


    Artificial Intelligence (AI) is currently being used for business-oriented, money-making applications, such as medical diagnosis, computer system configuration, and geological exploration. The present paper has the objective to assess new AI tools and techniques which will be available to assist aerospace managers in the accomplishment of their tasks. A study conducted by Brown and Cheeseman (1983) indicates that AI will be employed in all traditional management areas, taking into account goal setting, decision making, policy formulation, evaluation, planning, budgeting, auditing, personnel management, training, legal affairs, and procurement. Artificial intelligence/expert systems are discussed, giving attention to the three primary areas concerned with intelligent robots, natural language interfaces, and expert systems. Aspects of information retrieval are also considered along with the decision support system, and expert systems for project planning and scheduling.


    Directory of Open Access Journals (Sweden)

    Ali Akbar Ziaee


    Full Text Available Artificial Intelligence has the potential to empower humans through enhanced learning and performance. But if this potential is to be realized and accepted, the ethical aspects as well as the technical must be addressed. Many engineers claim that AI will be smarter than human brains, including scientific creativity, general wisdom and social skills, so we must consider it an important factor for making decisions in our social life and especially in our Islamic societies. The most important challenges will be the quality of representing the Islamic values like piety, obedience, Halal and Haram, and etc in the form of semantics. In this paper, I want to emphasize on the role of Divine Islamic values in the application of AI and discuss it according to philosophy of AI and Islamic perspective.Keywords- Value, expert, Community Development, Artificial Intelligence, Superintelligence, Friendly Artificial Intelligence

  5. The Coming of Age of Artificial Intelligence in Medicine* (United States)

    Patel, Vimla L.; Shortliffe, Edward H.; Stefanelli, Mario; Szolovits, Peter; Berthold, Michael R.; Bellazzi, Riccardo; Abu-Hanna, Ameen


    Summary This paper is based on a panel discussion held at the Artificial Intelligence in Medicine Europe (AIME) conference in Amsterdam, The Netherlands, in July 2007. It had been more than 15 years since Edward Shortliffe gave a talk at AIME in which he characterized artificial intelligence (AI) in medicine as being in its “adolescence” (Shortliffe EH. The adolescence of AI in medicine: Will the field come of age in the ‘90s? Artificial Intelligence in Medicine 1993; 5:93–106). In this article, the discussants reflect on medical AI research during the subsequent years and attempt to characterize the maturity and influence that has been achieved to date. Participants focus on their personal areas of expertise, ranging from clinical decision making, reasoning under uncertainty, and knowledge representation to systems integration, translational bioinformatics, and cognitive issues in both the modeling of expertise and the creation of acceptable systems. PMID:18790621



    Orlova Elena V.


    The article deals with the prerequisites of shift of music education paradigm in the XXI century, tells about emergence of new forms in the creative efforts of musicians enrolled in primary schools, and at secondary and highest education levels. Different types and genres of the multimedia creativity are considered. They were in demand by musicians at various events-contests, including Russian and international festivals and competitions in terms of which the music was called upon to play a l...

  7. Artificial Intelligence. (United States)

    Information Technology Quarterly, 1985


    This issue of "Information Technology Quarterly" is devoted to the theme of "Artificial Intelligence." It contains two major articles: (1) Artificial Intelligence and Law" (D. Peter O'Neill and George D. Wood); (2) "Artificial Intelligence: A Long and Winding Road" (John J. Simon, Jr.). In addition, it contains two sidebars: (1) "Calculating and…

  8. Competitive Intelligence. (United States)

    Bergeron, Pierrette; Hiller, Christine A.


    Reviews the evolution of competitive intelligence since 1994, including terminology and definitions and analytical techniques. Addresses the issue of ethics; explores how information technology supports the competitive intelligence process; and discusses education and training opportunities for competitive intelligence, including core competencies…

  9. Implementing embedded artificial intelligence rules within algorithmic programming languages (United States)

    Feyock, Stefan


    Most integrations of artificial intelligence (AI) capabilities with non-AI (usually FORTRAN-based) application programs require the latter to execute separately to run as a subprogram or, at best, as a coroutine, of the AI system. In many cases, this organization is unacceptable; instead, the requirement is for an AI facility that runs in embedded mode; i.e., is called as subprogram by the application program. The design and implementation of a Prolog-based AI capability that can be invoked in embedded mode are described. The significance of this system is twofold: Provision of Prolog-based symbol-manipulation and deduction facilities makes a powerful symbolic reasoning mechanism available to applications programs written in non-AI languages. The power of the deductive and non-procedural descriptive capabilities of Prolog, which allow the user to describe the problem to be solved, rather than the solution, is to a large extent vitiated by the absence of the standard control structures provided by other languages. Embedding invocations of Prolog rule bases in programs written in non-AI languages makes it possible to put Prolog calls inside DO loops and similar control constructs. The resulting merger of non-AI and AI languages thus results in a symbiotic system in which the advantages of both programming systems are retained, and their deficiencies largely remedied.

  10. VR/Multimedia Synthesis, Phase II

    National Research Council Canada - National Science Library

    Hoffman, Helene


    ...) with extant multimedia (MM) resources. Case based scenarios promote exploration, discovery, and active learning by enabling users to dissect 3-D anatomic models while accessing supporting resource elements...

  11. Building multimedia data warehouses from distributed data

    Directory of Open Access Journals (Sweden)

    Tania Cerquitelli


    Full Text Available La mediación de datos multimedia está caracterizada por tres aspectos importantes: la integración de datos multimedia, la arquitectura de sistema y una evaluación global de las búsquedas. El problema de la mediación multimedia puede ser visto desde un punto de vista arquitectónico en el que deben identificarse arquitecturas de mediación adecuadas, adaptadas a las características de los datos multimedia (como por ejemplo, volumen vs. costos de comunicación y ancho de banda. Debido a las características de los datos multimedia (distribución, homogeneidad, volumen, etc., el proceso de integración requiere de tiempo y recursos. La contribución de este artículo se asocia con la explotación de los datos multimedia. Se proporcionan los mecanismos para analizar las colecciones de datos multimedia provenientes de fuentes heterogéneas y distribuidas. Como solución se propone un servicio de búsqueda para datos multimedia distribuidos, adaptados para crear depósitos de datos multimedia.

  12. 3rd International Conference on Multimedia Technology

    CERN Document Server

    Yang, Jian; Jiao, Feng


    Proceedings of the 3rd International Conference on Multimedia Technology (ICMT2013) focuses on both the theory and applications of multimedia technology. The recent advances, new research findings and applications in the fields of theoretical, experimental and applied image & video processing and multimedia technology presented at the conference are brought together in this book. It will serve as a valuable reference for scientists and engineers working in multimedia and related fields. Prof. Aly A. Farag works at the University of Louisville, USA; Prof. Jian Yang works at Tsinghua University, China; Dr. Feng Jiao works at Nanjing University of Information Science & Technology, China.

  13. Service Characteristics Based High Speed Multimedia Transport Protocol

    National Research Council Canada - National Science Library

    Chen, C


    .... This multimedia protocol will automatically extract service requirements from multimedia applications by selecting certain sets of parameters from user applications to optimally drive the lower level physical network...

  14. Multimedia CALLware: The Developer's Responsibility. (United States)

    Dodigovic, Marina

    The early computer-assisted-language-learning (CALL) programs were silent and mostly limited to screen or printer supported written text as the prevailing communication resource. The advent of powerful graphics, sound and video combined with AI-based parsers and sound recognition devices gradually turned the computer into a rather anthropomorphic…

  15. Approaches to the study of intelligence (United States)

    Norman, Donald A.


    A survey and an evaluation are conducted for the Rosenbloom et al. (1991) 'SOAR' model of intelligence, both as found in humans and in prospective AI systems, which views it as a representational system for goal-oriented symbolic activity based on a physical symbol system. Attention is given to SOAR's implications for semantic and episodic memory, symbol processing, and search within a uniform problem space; also noted are the relationships of SOAR to competing AI schemes, and its potential usefulness as a theoretical tool for cognitive psychology.

  16. The Third Age of Artificial Intelligence


    Miailhe, Nicolas; Hodes, Cyrus


    If the definitional boundaries of Artificial Intelligence (AI) remains contested, experts agree that we are witnessing a revolution. “Is this time different?” is the question that they worryingly argue over when they analyze the socio-economic impact of the AI revolution as compared with the other industrial revolutions of the 19th and 20th centuries. This Schumpeterian wave may prove to be a creative destruction raising incomes, enhancing quality of life for all and generating previously uni...

  17. Artificial intelligence techniques in power systems

    Energy Technology Data Exchange (ETDEWEB)

    Laughton, M.A.


    Since the early to mid 1980s much of the effort in power systems analysis has turned away from the methodology of formal mathematical modelling which came from the fields of operations research, control theory and numerical analysis to the less rigorous techniques of artificial intelligence (AI). Today the main AI techniques found in power systems applications are those utilising the logic and knowledge representations of expert systems, fuzzy systems, artificial neural networks (ANN) and, more recently, evolutionary computing. These techniques will be outlined in this chapter and the power system applications indicated. (Author)

  18. Applications of artificial intelligence to reactor and plant control

    International Nuclear Information System (INIS)

    Bernard, J.A.


    Potential improvements in plant efficiency and reliability are often cited as reasons for developing and applying artificial intelligence (AI) techniques, principally expert systems, to the control and operation of nuclear reactors. Nevertheless, there have been few such applications and then mostly at the prototype level. Therefore, if AI techniques are to contribute to process control, methods must be identified by which rule-based and analytic approaches can be merged. This hypothesis is the basic premise of this article. Presented below are 1. a brief review of the human approach towards process control, 2. a discussion of the suitability of AI methodologies for the performance of control tasks, 3. examples of AI applications to both open- and closed-loop control, 4. an enumeration of unresolved issues associated with the use of AI for control, and 5. a discussion of the possible role of expert system techniques in process control. (orig./GL)

  19. Intelligent Information Retrieval for a Multimedia Database Using Captions (United States)


    F-14 Collecting file F-14A Collecting file F- 3D Collecting file F-3H Collecting file F-4B Collecting file F-4G Collecting file F-4J Collecting file F...Collecting file AC-130 Collecting file ATB Collecting file AV-8 Collecting file C-130 Collecting file F-15 Collecting file F-3 Collecting file F- 3D -1...Jacobs and Zernik (1988) have proposed a gradual method to defining new words for the lexicon by analyzing a sequence of example text, making

  20. Intelligent Multi-Media Presentation Using Rhetorical Structure Theory (United States)


    platforms and across all web browsers that support the Java plug-in. A JavaScript API allows the Virtual Adviser to interact with the page content and be... article establishes which element is the headline, which is the image caption, and which is the body of the article . Presentation Scheduling... quality UK male voice don_diphone sets a low- quality UK male voice kal_diphone sets a low- quality US male voice

  1. Artificial intelligence in medicine: humans need not apply? (United States)

    Diprose, William; Buist, Nicholas


    Artificial intelligence (AI) is a rapidly growing field with a wide range of applications. Driven by economic constraints and the potential to reduce human error, we believe that over the coming years AI will perform a significant amount of the diagnostic and treatment decision-making traditionally performed by the doctor. Humans would continue to be an important part of healthcare delivery, but in many situations, less expensive fit-for-purpose healthcare workers could be trained to 'fill the gaps' where AI are less capable. As a result, the role of the doctor as an expensive problem-solver would become redundant.

  2. Multisensor system and artificial intelligence in housing for the elderly. (United States)

    Chan, M; Bocquet, H; Campo, E; Val, T; Estève, D; Pous, J


    To improve the safety of a growing proportion of elderly and disabled people in the developed countries, a multisensor system based on Artificial Intelligence (AI), Advanced Telecommunications (AT) and Information Technology (IT) has been devised and fabricated. Thus, the habits and behaviours of these populations will be recorded without disturbing their daily activities. AI will diagnose any abnormal behavior or change and the system will warn the professionals. Gerontology issues are presented together with the multisensor system, the AI-based learning and diagnosis methodology and the main functionalities.

  3. Natural language processing in psychiatry. Artificial intelligence technology and psychopathology. (United States)

    Garfield, D A; Rapp, C; Evens, M


    The potential benefit of artificial intelligence (AI) technology as a tool of psychiatry has not been well defined. In this essay, the technology of natural language processing and its position with regard to the two main schools of AI is clearly outlined. Past experiments utilizing AI techniques in understanding psychopathology are reviewed. Natural language processing can automate the analysis of transcripts and can be used in modeling theories of language comprehension. In these ways, it can serve as a tool in testing psychological theories of psychopathology and can be used as an effective tool in empirical research on verbal behavior in psychopathology.

  4. Towards a nuclear industry boosted by artificial intelligence?

    International Nuclear Information System (INIS)

    Le Ngoc, B.


    Artificial intelligence (AI) is deemed as the fourth industrial revolution after the steam engine, electric power and the computer. Auto manufacturers invest a lot in AI to develop autonomous vehicles. Nuclear industry that has to deal with a huge amount of data due to the complexity of its installations may benefit from AI in terms of quick handling of complex situations, of reducing the rate of errors, of drawing adequate conclusions through the right crossing of data and of improving decision making. (A.C.)

  5. S&T converging trends in dealing with disaster: A review on AI tools

    International Nuclear Information System (INIS)

    Hasan, Abu Bakar; Isa, Mohd Hafez Mohd.


    Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T

  6. S&T converging trends in dealing with disaster: A review on AI tools (United States)

    Hasan, Abu Bakar; Isa, Mohd. Hafez Mohd.


    Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T.

  7. S&T converging trends in dealing with disaster: A review on AI tools

    Energy Technology Data Exchange (ETDEWEB)

    Hasan, Abu Bakar, E-mail:; Isa, Mohd Hafez Mohd. [Faculty of Science and Technology, Universiti Sains Islam Malaysia, 71800 Nilai, Negeri Sembilan (Malaysia)


    Science and Technology (S&T) has been able to help mankind to solve or minimize problems when arise. Different methodologies, techniques and tools were developed or used for specific cases by researchers, engineers, scientists throughout the world, and numerous papers and articles have been written by them. Nine selected cases such as flash flood, earthquakes, workplace accident, fault in aircraft industry, seismic vulnerability, disaster mitigation and management, and early fault detection in nuclear industry have been studied. This paper looked at those cases, and their results showed nearly 60% uses artificial intelligence (AI) as a tool. This paper also did some review that will help young researchers in deciding the types of AI tools to be selected; thus proving the future trends in S&T.

  8. New progress of FEM simulation and AI application in rolling at RAL

    International Nuclear Information System (INIS)

    Liu Xianghua; Wang Guodong; Zhao Kun


    New progresses on FEM simulation and AI application in rolling have been achieved at RAL recently. The existence and uniqueness of the extreme point of total functional for rolling problem has been proved. Different rolling processes, such as H-beam rolling, ribbing strip rolling, slab sizing, have been solved by our in-house FEM software package. The simulation results have been put into production use to improve the precision of math models. The Artificial Neural Network has been used to predict rolling force, coiling temperature, microstructure and properties of the rolled products. An expert system for deviation diagnoses of strip thickness has been developed for industry use. Synergetic Artificial Intelligence has also been applied to rolling scheduling. We are making continuous efforts to develop AI applications for rolling line co-operating in China steel industry. (author)


    Directory of Open Access Journals (Sweden)

    Roxana Mihaela CATEA


    Full Text Available The paper focuses on the emerging European legislation in the area of artificial intelligence and robotics, based on the currently fast developing technical procedures for the manufacture of products characterized by autonomy. The importance of having a clear and stable legislation for the production and spread of technical devices has been under discussion for some time now and member states have reached preliminary conclusions regarding the definition and criteria by which one can identify artificial intelligence. Also, continuous innovation lead to the necessity of integrating these AI products in common household economy and therefore, the need for a proper legal framework addressing both liability and limits for creating and operating machines for civil use arose. This article shall review the measures already taken by the European Parliament and the European Commission for the establishment of a standardized legal framework related to robotic and artificial intelligence products. The objectives of this study are to analyze the general guidelines available as created by the EU legislator which shall ultimately be transposed in national legislation, in order to supersede the current lack of regulations for companies developing and selling AI products nation-wide.

  10. Three IQs of AI Systems and their Testing Methods


    Liu, Feng; Shi, Yong; Liu, Ying


    The rapid development of artificial intelligence has brought the artificial intelligence threat theory as well as the problem about how to evaluate the intelligence level of intelligent products. Both need to find a quantitative method to evaluate the intelligence level of intelligence systems, including human intelligence. Based on the standard intelligence system and the extended Von Neumann architecture, this paper proposes General IQ, Service IQ and Value IQ evaluation methods for intelli...

  11. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    Energy Technology Data Exchange (ETDEWEB)

    Caron, Sascha [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands); Nikhef, Amsterdam (Netherlands); Kim, Jong Soo [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); Rolbiecki, Krzysztof [UAM/CSIC, Instituto de Fisica Teorica, Madrid (Spain); University of Warsaw, Faculty of Physics, Warsaw (Poland); Ruiz de Austri, Roberto [IFIC-UV/CSIC, Instituto de Fisica Corpuscular, Valencia (Spain); Stienen, Bob [Radboud Universiteit, Institute for Mathematics, Astro- and Particle Physics IMAPP, Nijmegen (Netherlands)


    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from An on-line interface to the program for quick testing purposes can be found at (orig.)

  12. The BSM-AI project: SUSY-AI-generalizing LHC limits on supersymmetry with machine learning

    International Nuclear Information System (INIS)

    Caron, Sascha; Kim, Jong Soo; Rolbiecki, Krzysztof; Ruiz de Austri, Roberto; Stienen, Bob


    A key research question at the Large Hadron Collider is the test of models of new physics. Testing if a particular parameter set of such a model is excluded by LHC data is a challenge: it requires time consuming generation of scattering events, simulation of the detector response, event reconstruction, cross section calculations and analysis code to test against several hundred signal regions defined by the ATLAS and CMS experiments. In the BSM-AI project we approach this challenge with a new idea. A machine learning tool is devised to predict within a fraction of a millisecond if a model is excluded or not directly from the model parameters. A first example is SUSY-AI, trained on the phenomenological supersymmetric standard model (pMSSM). About 300, 000 pMSSM model sets - each tested against 200 signal regions by ATLAS - have been used to train and validate SUSY-AI. The code is currently able to reproduce the ATLAS exclusion regions in 19 dimensions with an accuracy of at least 93%. It has been validated further within the constrained MSSM and the minimal natural supersymmetric model, again showing high accuracy. SUSY-AI and its future BSM derivatives will help to solve the problem of recasting LHC results for any model of new physics. SUSY-AI can be downloaded from An on-line interface to the program for quick testing purposes can be found at (orig.)

  13. Intelligence Ethics:

    DEFF Research Database (Denmark)

    Rønn, Kira Vrist


    Questions concerning what constitutes a morally justified conduct of intelligence activities have received increased attention in recent decades. However, intelligence ethics is not yet homogeneous or embedded as a solid research field. The aim of this article is to sketch the state of the art...... of intelligence ethics and point out subjects for further scrutiny in future research. The review clusters the literature on intelligence ethics into two groups: respectively, contributions on external topics (i.e., the accountability of and the public trust in intelligence agencies) and internal topics (i.......e., the search for an ideal ethical framework for intelligence actions). The article concludes that there are many holes to fill for future studies on intelligence ethics both in external and internal discussions. Thus, the article is an invitation – especially, to moral philosophers and political theorists...

  14. Launch vehicle operations cost reduction through artificial intelligence techniques (United States)

    Davis, Tom C., Jr.


    NASA's Kennedy Space Center has attempted to develop AI methods in order to reduce the cost of launch vehicle ground operations as well as to improve the reliability and safety of such operations. Attention is presently given to cost savings estimates for systems involving launch vehicle firing-room software and hardware real-time diagnostics, as well as the nature of configuration control and the real-time autonomous diagnostics of launch-processing systems by these means. Intelligent launch decisions and intelligent weather forecasting are additional applications of AI being considered.


    DEFF Research Database (Denmark)

    Sonnenwald, Diane H.


    A description is given of UIMS (User Interface Management System), a system using a variety of artificial intelligence techniques to build knowledge-based user interfaces combining functionality and information from a variety of computer systems that maintain, test, and configure customer telephone...... and data networks. Three artificial intelligence (AI) techniques used in UIMS are discussed, namely, frame representation, object-oriented programming languages, and rule-based systems. The UIMS architecture is presented, and the structure of the UIMS is explained in terms of the AI techniques....

  16. Man-machine communication in reactor control using AI methods

    International Nuclear Information System (INIS)

    Klebau, J.; Lindner, A.; Fiedler, U.


    In the last years the interest in process control has expecially focused on problems of man-machine communication. It depends on its great importance to process performance and user acceptance. Advanced computerized operator aids, e.g. in nuclear power plants, are as well as their man-machine interface. In the Central Institute for Nuclear Research in Rossendorf a computerized operator support system for nuclear power plants is designed, which is involved in a decentralized process automation system. A similar but simpler system, the Hierarchical Informational System (HIS) at the Rossendorf Research Reactor, works with a computer controlled man-machine interface, based on menu. In the special case of the disturbance analysis program SAAP-2, which is included in the HIS, the limits of menu techniques are obviously. Therefore it seems to be necessary and with extended hard- and software possible to realize an user controlled natural language interface using Artificial Intelligence (AI) methods. The draft of such a system is described. It should be able to learn during a teaching phase all phrases and their meanings. The system will work on the basis of a self-organizing, associative data structure. It is used to recognize a great amount of words which are used in language analysis. Error recognition and, if possible, correction is done by means of a distance function in the word set. Language analysis should be carried out with a simplified word class controlled functional analysis. With this interface it is supposed to get experience in intelligent man-machine communication to enhance operational safety in future. (author)

  17. Multimedia Based E-learning : Design and Integration of Multimedia Content in E-learning

    Directory of Open Access Journals (Sweden)

    Abdulaziz Omar Alsadhan


    Full Text Available The advancement in multimedia and information technologies also have impacted the way of imparting education. This advancement has led to rapid use of e learning systems and has enabled greater integration of multimedia content into e learning systems. This paper present a model for development of e learning systems based on multimedia content. The model is called “Multimedia based e learning” and is loosely based on waterfall software development model. This model consists of three distinct phases; Multimedia Content Modelling, Multimedia content Development, Multimedia content Integration. These three phases are further sub divided into 7 different activities which are analysis, design, technical requirements, content development, content production & integration, implementation and evaluation. This model defines a general framework that can be applied for the development of e learning systems across all disciplines and subjects.

  18. Two Fundamental Problems Connected with AI


    Dobrev, Dimiter


    This paper is about two fundamental problems in the field of computer science. Solving these two problems is important because it has to do with the creation of Artificial Intelligence. In fact, these two problems are not very famous because they have not many applications outside the field of Artificial Intelligence. In this paper we will give a solution neither of the first nor of the second problem. Our goal will be to formulate these two problems and to give some ideas for...

  19. Artificial intelligence in nuclear engineering: developments, lesson learned and future directions

    Energy Technology Data Exchange (ETDEWEB)

    Ruan, Da [The Belgian Nuclear Research Centre (SCK.CEN), Mol (Belgium)]. E-mail:


    Full text of publication follows: In this lecture, an overview on artificial intelligence (AI) from control to decision making in nuclear engineering will be given mainly based on the 10 years progress of the FLINS forum (Fuzzy Logic and Intelligent Technology in Nuclear Science). Some FLINS concrete examples on nuclear reactor operation, nuclear safeguards information management, and cost estimation under uncertainty for a large nuclear project will be illustrated for the potential use of AI in nuclear engineering. Recommendations and future research directions on AI in nuclear engineering will be suggested from a practical point of view. (author)

  20. Artificial intelligence in nuclear engineering: developments, lesson learned and future directions

    International Nuclear Information System (INIS)

    Ruan, Da


    Full text of publication follows: In this lecture, an overview on artificial intelligence (AI) from control to decision making in nuclear engineering will be given mainly based on the 10 years progress of the FLINS forum (Fuzzy Logic and Intelligent Technology in Nuclear Science). Some FLINS concrete examples on nuclear reactor operation, nuclear safeguards information management, and cost estimation under uncertainty for a large nuclear project will be illustrated for the potential use of AI in nuclear engineering. Recommendations and future research directions on AI in nuclear engineering will be suggested from a practical point of view. (author)

  1. Intelligence Naturelle et Intelligence Artificielle


    Dubois, Daniel


    Cet article présente une approche systémique du concept d’intelligence naturelle en ayant pour objectif de créer une intelligence artificielle. Ainsi, l’intelligence naturelle, humaine et animale non-humaine, est une fonction composée de facultés permettant de connaître et de comprendre. De plus, l'intelligence naturelle reste indissociable de la structure, à savoir les organes du cerveau et du corps. La tentation est grande de doter les systèmes informatiques d’une intelligence artificielle ...

  2. Deploying Embodied AI into Virtual Worlds (United States)

    Burden, David J. H.

    The last two years have seen the start of commercial activity within virtual worlds. Unlike computer games where Non-Player-Character avatars are common, in most virtual worlds they are the exception — and until recently in Second Life they were non-existent. However there is real commercial scope for Als in these worlds — in roles from virtual sales staff and tutors to personal assistants. Deploying an embodied AI into a virtual world offers a unique opportunity to evaluate embodied Als, and to develop them within an environment where human and computer are on almost equal terms. This paper presents an architecture being used for the deployment of chatbot driven avatars within the Second Life virtual world, looks at the challenges of deploying an AI within such a virtual world, the possible implications for the Turing Test, and identifies research directions for the future.

  3. Aids to Computer-Based Multimedia Learning. (United States)

    Mayer, Richard E.; Moreno, Roxana


    Presents a cognitive theory of multimedia learning that draws on dual coding theory, cognitive load theory, and constructivist learning theory and derives some principles of instructional design for fostering multimedia learning. These include principles of multiple representation, contiguity, coherence, modality, and redundancy. (SLD)

  4. A Multitude of Risks in Multimedia. (United States)

    Loving, Bill

    Multimedia presentations offer educators and other communicators new avenues to reach audiences, but they combine a variety of legal hazards. Producers of multimedia can end up on the receiving end of lawsuits based on the many facets of copyright, privacy, and defamation law, as this guide illustrates. Copyright gives authors, composers,…

  5. Moodle 2.5 multimedia cookbook

    CERN Document Server

    Hilar, Silvina P


    With practical examples presented in the style of recipes, this book is designed for you to be able to dip in and out as you need, only using the multimedia options that you want at the time.This cookbook is designed specifically for teachers who want to begin creating interactive and engaging Moodle courses by utilizing the multimedia capabilities of Moodle.

  6. Using Multimedia for E-Learning (United States)

    Mayer, R. E.


    This paper reviews 12 research-based principles for how to design computer-based multimedia instructional materials to promote academic learning, starting with the multimedia principle (yielding a median effect size of d = 1.67 based on five experimental comparisons), which holds that people learn better from computer-based instruction containing…

  7. Scheduling multimedia services in cloud computing environment (United States)

    Liu, Yunchang; Li, Chunlin; Luo, Youlong; Shao, Yanling; Zhang, Jing


    Currently, security is a critical factor for multimedia services running in the cloud computing environment. As an effective mechanism, trust can improve security level and mitigate attacks within cloud computing environments. Unfortunately, existing scheduling strategy for multimedia service in the cloud computing environment do not integrate trust mechanism when making scheduling decisions. In this paper, we propose a scheduling scheme for multimedia services in multi clouds. At first, a novel scheduling architecture is presented. Then, We build a trust model including both subjective trust and objective trust to evaluate the trust degree of multimedia service providers. By employing Bayesian theory, the subjective trust degree between multimedia service providers and users is obtained. According to the attributes of QoS, the objective trust degree of multimedia service providers is calculated. Finally, a scheduling algorithm integrating trust of entities is proposed by considering the deadline, cost and trust requirements of multimedia services. The scheduling algorithm heuristically hunts for reasonable resource allocations and satisfies the requirement of trust and meets deadlines for the multimedia services. Detailed simulated experiments demonstrate the effectiveness and feasibility of the proposed trust scheduling scheme.

  8. DEA Multi-Media Drug Library (United States)

    ... Releases Speeches and Testimony Major Operations Multi-Media Library Micrograms Legislative & Legal Resources Events Social Media Directory ... Envío de información confidencial Press Room » Multi-Media Library IMAGE GALLERY Drug Photos Amphetamines/Stimulants K2/Spice ...

  9. Research on evaluation techniques for immersive multimedia (United States)

    Hashim, Aslinda M.; Romli, Fakaruddin Fahmi; Zainal Osman, Zosipha


    Nowadays Immersive Multimedia covers most usage in tremendous ways, such as healthcare/surgery, military, architecture, art, entertainment, education, business, media, sport, rehabilitation/treatment and training areas. Moreover, the significant of Immersive Multimedia to directly meet the end-users, clients and customers needs for a diversity of feature and purpose is the assembly of multiple elements that drive effective Immersive Multimedia system design, so evaluation techniques is crucial for Immersive Multimedia environments. A brief general idea of virtual environment (VE) context and `realism' concept that formulate the Immersive Multimedia environments is then provided. This is followed by a concise summary of the elements of VE assessment technique that is applied in Immersive Multimedia system design, which outlines the classification space for Immersive Multimedia environments evaluation techniques and gives an overview of the types of results reported. A particular focus is placed on the implications of the Immersive Multimedia environments evaluation techniques in relation to the elements of VE assessment technique, which is the primary purpose of producing this research. The paper will then conclude with an extensive overview of the recommendations emanating from the research.

  10. An Overview of Multimedia and the Law. (United States)

    Boelzner, David E.


    Reviews the areas of intellectual property law, including patent, copyright, and trademark, and discusses how multimedia raises legal issues in each area. Discusses trade secrets, issues raised by online technology, and issues for licensing and developing multimedia works. (Author/LRW)

  11. Multimedia Category Preferences of Working Engineers (United States)

    Baukal, Charles E., Jr.; Ausburn, Lynna J.


    Many have argued for the importance of continuing engineering education (CEE), but relatively few recommendations were found in the literature for how to use multimedia technologies to deliver it most effectively. The study reported here addressed this gap by investigating the multimedia category preferences of working engineers. Four categories…

  12. 14 CFR 1213.108 - Multimedia materials. (United States)


    ....108 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION RELEASE OF INFORMATION TO NEWS AND INFORMATION MEDIA § 1213.108 Multimedia materials. (a) NASA's multimedia material, from all... will provide the media, the public, and as necessary, NASA Headquarters with: (1) Selected prints and...

  13. Multimedia Instruction Initiative: Building Faculty Competence. (United States)

    Haile, Penelope J.

    Hofstra University began a university-wide initiative to enhance classroom instruction with multimedia technology and foster collaborative approaches to learning. The Multimedia Instruction Initiative emphasized teamwork among faculty, students, and computer center support staff to develop a technology-enriched learning environment supported by…

  14. AI in medical education--another grand challenge for medical informatics. (United States)

    Lillehaug, S I; Lajoie, S P


    The potential benefits of artificial intelligence in medicine (AIM) were never realized as anticipated. This paper addresses ways in which such potential can be achieved. Recent discussions of this topic have proposed a stronger integration between AIM applications and health information systems, and emphasize computer guidelines to support the new health care paradigms of evidence-based medicine and cost-effectiveness. These proposals, however, promote the initial definition of AIM applications as being AI systems that can perform or aid in diagnoses. We challenge this traditional philosophy of AIM and propose a new approach aiming at empowering health care workers to become independent self-sufficient problem solvers and decision makers. Our philosophy is based on findings from a review of empirical research that examines the relationship between the health care personnel's level of knowledge and skills, their job satisfaction, and the quality of the health care they provide. This review supports addressing the quality of health care by empowering health care workers to reach their full potential. As an aid in this empowerment process we argue for reviving a long forgotten AIM research area, namely, AI based applications for medical education and training. There is a growing body of research in artificial intelligence in education that demonstrates that the use of artificial intelligence can enhance learning in numerous domains. By examining the strengths of these educational applications and the results from previous AIM research we derive a framework for empowering medical personnel and consequently raising the quality of health care through the use of advanced AI based technology.

  15. Considering User's Access Pattern in Multimedia File Systems (United States)

    Cho, KyoungWoon; Ryu, YeonSeung; Won, Youjip; Koh, Kern


    Legacy buffer cache management schemes for multimedia server are grounded at the assumption that the application sequentially accesses the multimedia file. However, user access pattern may not be sequential in some circumstances, for example, in distance learning application, where the user may exploit the VCR-like function(rewind and play) of the system and accesses the particular segments of video repeatedly in the middle of sequential playback. Such a looping reference can cause a significant performance degradation of interval-based caching algorithms. And thus an appropriate buffer cache management scheme is required in order to deliver desirable performance even under the workload that exhibits looping reference behavior. We propose Adaptive Buffer cache Management(ABM) scheme which intelligently adapts to the file access characteristics. For each opened file, ABM applies either the LRU replacement or the interval-based caching depending on the Looping Reference Indicator, which indicates that how strong temporally localized access pattern is. According to our experiment, ABM exhibits better buffer cache miss ratio than interval-based caching or LRU, especially when the workload exhibits not only sequential but also looping reference property.

  16. Why Don't Accounting Students like AIS? (United States)

    Vatanasakdakul, Savanid; Aoun, Chadi


    Purpose: The demand for Accounting Information Systems (AIS) knowledge has increased exponentially over the past two decades, but studying AIS has not proved easy for many accounting students. The aim of the study is to understand the challenges accounting students face in studying AIS through investigation of the factors which may be contributing…

  17. Dicty_cDB: FC-AI04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

  18. Dicty_cDB: FC-AI10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

  19. Dicty_cDB: FC-AI23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

  20. Dicty_cDB: FC-AI05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...// Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ