WorldWideScience

Sample records for intelligence ai based

  1. Artificial Intelligence (AI) Based Tactical Guidance for Fighter Aircraft

    Science.gov (United States)

    McManus, John W.; Goodrich, Kenneth H.

    1990-01-01

    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within Visual Range (WVR) air combat engagements is discussed. The application of AI programming and problem solving methods in the development and implementation of the Computerized Logic For Air-to-Air Warfare Simulations (CLAWS), a second generation TDG, is presented. The Knowledge-Based Systems used by CLAWS to aid in the tactical decision-making process are outlined in detail, and the results of tests to evaluate the performance of CLAWS versus a baseline TDG developed in FORTRAN to run in real-time in the Langley Differential Maneuvering Simulator (DMS), are presented. To date, these test results have shown significant performance gains with respect to the TDG baseline in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify and maintain than the baseline FORTRAN TDG programs. Alternate computing environments and programming approaches, including the use of parallel algorithms and heterogeneous computer networks are discussed, and the design and performance of a prototype concurrent TDG system are presented.

  2. Artificial Intelligence Study (AIS).

    Science.gov (United States)

    1987-02-01

    ARTIFICIAL INTELLIGNECE HARDWARE ....... 2-50 AI Architecture ................................... 2-49 AI Hardware ....................................... 2...ftf1 829 ARTIFICIAL INTELLIGENCE STUDY (RIS)(U) MAY CONCEPTS 1/3 A~NLYSIS AGENCY BETHESA RD R B NOJESKI FED 6? CM-RP-97-1 NCASIFIED /01/6 M |K 1.0...p/ - - ., e -- CAA- RP- 87-1 SAOFŔ)11 I ARTIFICIAL INTELLIGENCE STUDY (AIS) tNo DTICFEBRUARY 1987 LECT 00 I PREPARED BY RESEARCH AND ANALYSIS

  3. Organisational intelligence and distributed AI

    OpenAIRE

    Kirn, Stefan

    1995-01-01

    The analysis of this chapter starts from organisational theory, and from this it draws conclusions for the design, and possible organisational applications, of Distributed AI systems. We first review how the concept of organisations has emerged from non-organised black-box entities to so-called computerised organisations. Within this context, organisational researchers have started to redesign their models of intelligent organisations with respect to the availability of advanced computing tec...

  4. Artificial Intelligence Safety and Cybersecurity: a Timeline of AI Failures

    OpenAIRE

    Yampolskiy, Roman V.; Spellchecker, M. S.

    2016-01-01

    In this work, we present and analyze reported failures of artificially intelligent systems and extrapolate our analysis to future AIs. We suggest that both the frequency and the seriousness of future AI failures will steadily increase. AI Safety can be improved based on ideas developed by cybersecurity experts. For narrow AIs safety failures are at the same, moderate, level of criticality as in cybersecurity, however for general AI, failures have a fundamentally different impact. A single fai...

  5. Past, present and prospect of an Artificial Intelligence (AI) based model for sediment transport prediction

    Science.gov (United States)

    Afan, Haitham Abdulmohsin; El-shafie, Ahmed; Mohtar, Wan Hanna Melini Wan; Yaseen, Zaher Mundher

    2016-10-01

    An accurate model for sediment prediction is a priority for all hydrological researchers. Many conventional methods have shown an inability to achieve an accurate prediction of suspended sediment. These methods are unable to understand the behaviour of sediment transport in rivers due to the complexity, noise, non-stationarity, and dynamism of the sediment pattern. In the past two decades, Artificial Intelligence (AI) and computational approaches have become a remarkable tool for developing an accurate model. These approaches are considered a powerful tool for solving any non-linear model, as they can deal easily with a large number of data and sophisticated models. This paper is a review of all AI approaches that have been applied in sediment modelling. The current research focuses on the development of AI application in sediment transport. In addition, the review identifies major challenges and opportunities for prospective research. Throughout the literature, complementary models superior to classical modelling.

  6. Beyond AI: Interdisciplinary Aspects of Artificial Intelligence

    CERN Document Server

    Romportl, Jan; Zackova, Eva; Beyond Artificial Intelligence : Contemplations, Expectations, Applications

    2013-01-01

    Products of modern artificial intelligence (AI) have mostly been formed by the views, opinions and goals of the “insiders”, i.e. people usually with engineering background who are driven by the force that can be metaphorically described as the pursuit of the craft of Hephaestus. However, since the present-day technology allows for tighter and tighter mergence of the “natural” everyday human life with machines of immense complexity, the responsible reaction of the scientific community should be based on cautious reflection of what really lies beyond AI, i.e. on the frontiers where the tumultuous ever-growing and ever-changing cloud of AI touches the rest of the world.   The chapters of this boo are based on the selected subset of the presentations that were delivered by their respective authors at the conference “Beyond AI: Interdisciplinary Aspects of Artificial Intelligence” held in Pilsen in December 2011.   From its very definition, the reflection of the phenomena that lie beyond AI must be i...

  7. Artificial intelligence. Fears of an AI pioneer.

    Science.gov (United States)

    Russell, Stuart; Bohannon, John

    2015-07-17

    From the enraged robots in the 1920 play R.U.R. to the homicidal computer H.A.L. in 2001: A Space Odyssey, science fiction writers have embraced the dark side of artificial intelligence (AI) ever since the concept entered our collective imagination. Sluggish progress in AI research, especially during the “AI winter” of the 1970s and 1980s, made such worries seem far-fetched. But recent breakthroughs in machine learning and vast improvements in computational power have brought a flood of research funding— and fresh concerns about where AI may lead us. One researcher now speaking up is Stuart Russell, a computer scientist at the University of California, Berkeley, who with Peter Norvig, director of research at Google, wrote the premier AI textbook, Artificial Intelligence: A Modern Approach, now in its third edition. Last year, Russell joined the Centre for the Study of Existential Risk at Cambridge University in the United Kingdom as an AI expert focusing on “risks that could lead to human extinction.” Among his chief concerns, which he aired at an April meeting in Geneva, Switzerland, run by the United Nations, is the danger of putting military drones and weaponry under the full control of AI systems. This interview has been edited for clarity and brevity.

  8. Artificial intelligence (AI)-based relational matching and multimodal medical image fusion: generalized 3D approaches

    Science.gov (United States)

    Vajdic, Stevan M.; Katz, Henry E.; Downing, Andrew R.; Brooks, Michael J.

    1994-09-01

    A 3D relational image matching/fusion algorithm is introduced. It is implemented in the domain of medical imaging and is based on Artificial Intelligence paradigms--in particular, knowledge base representation and tree search. The 2D reference and target images are selected from 3D sets and segmented into non-touching and non-overlapping regions, using iterative thresholding and/or knowledge about the anatomical shapes of human organs. Selected image region attributes are calculated. Region matches are obtained using a tree search, and the error is minimized by evaluating a `goodness' of matching function based on similarities of region attributes. Once the matched regions are found and the spline geometric transform is applied to regional centers of gravity, images are ready for fusion and visualization into a single 3D image of higher clarity.

  9. Artificial intelligence (AI) systems for interpreting complex medical datasets.

    Science.gov (United States)

    Altman, R B

    2017-05-01

    Advances in machine intelligence have created powerful capabilities in algorithms that find hidden patterns in data, classify objects based on their measured characteristics, and associate similar patients/diseases/drugs based on common features. However, artificial intelligence (AI) applications in medical data have several technical challenges: complex and heterogeneous datasets, noisy medical datasets, and explaining their output to users. There are also social challenges related to intellectual property, data provenance, regulatory issues, economics, and liability. © 2017 ASCPT.

  10. [Artificial intelligence] AI for protection systems

    Energy Technology Data Exchange (ETDEWEB)

    Aggarwal, R.; Johns, A.

    1997-12-31

    The reliable operation of large power systems with small stability margins is highly dependent on control systems and protection devices. Progress in the field of microprocessor systems and demanding requirements in respect of the performance of protective relays are the reasons for digital device applications to power system protection. The superiority of numeric protection over its analogue alternatives is attributed to such factors as accurate extraction of the fundamental voltage and current components through filtering, functional benefits resulting from multi-processor design and extensive self-monitoring, etc. However, all these reasons have not led to a major impact on speed, sensitivity and selectivity of primary protective relays, and the gains are only marginal; this is so because conventional digital relays still rely on deterministic signal models and a heuristic approach for decision making, so that only a fraction of the information contained within voltage and current signals as well as knowledge about the plant to be protected is used. The performance of digital relays may be substantially improved if the decision making is based on elements of artificial intelligence (AI). (Author)

  11. Beyond AI: Multi-Intelligence (MI Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    Directory of Open Access Journals (Sweden)

    Stephen Fox

    2017-06-01

    Full Text Available Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, the extensive post-anthropocentric research into intelligence is not given sufficient consideration. Third, AI is discussed often in reductionist mechanistic terms. Rather than in organicist emergentist terms as a contributor to multi-intelligence (MI hybrid beings and/or systems. Thus, current framing of AI can be a self-validating reduction within which AI development is focused upon AI becoming the single-variable mechanism causing future effects. In this paper, AI is reframed as a contributor to MI.

  12. Beyond AI: Multi-Intelligence (MI) Combining Natural and Artificial Intelligences in Hybrid Beings and Systems

    OpenAIRE

    Stephen Fox

    2017-01-01

    Framing strongly influences actions among technology proponents and end-users. Underlying much debate about artificial intelligence (AI) are several fundamental shortcomings in its framing. First, discussion of AI is atheoretical, and therefore has limited potential for addressing the complexity of causation. Second, intelligence is considered from an anthropocentric perspective that sees human intelligence, and intelligence developed by humans, as superior to all other intelligences. Thus, t...

  13. An Immune Agent for Web-Based AI Course

    Science.gov (United States)

    Gong, Tao; Cai, Zixing

    2006-01-01

    To overcome weakness and faults of a web-based e-learning course such as Artificial Intelligence (AI), an immune agent was proposed, simulating a natural immune mechanism against a virus. The immune agent was built on the multi-dimension education agent model and immune algorithm. The web-based AI course was comprised of many files, such as HTML…

  14. Artificial Intelligence (AI) Studies in Water Resources

    OpenAIRE

    Ay, Murat; Özyıldırım, Serhat

    2018-01-01

    Artificial intelligence has been extensively used in many areas such as computer science,robotics, engineering, medicine, translation, economics, business, and psychology. Variousstudies in the literature show that the artificial intelligence in modeling approaches give closeresults to the real data for solution of linear, non-linear, and other systems. In this study, wereviewed the current state-of-the-art and progress on the modelling of artificial intelligence forwater variables: rainfall-...

  15. Human-Assisted AI: an Intelligence Augmentation Approach

    OpenAIRE

    Alicea, Bradly

    2018-01-01

    As a flavor of Human-Computer Interaction (HCI), Human-Assisted AI can serve to both augment both human performance and artificial systems. This talk will feature a discussion of Human-assisted AI as an instance of Intelligence Augmentation (IA). We will discuss instances of weak and strong IA, in addition to contemporary examples of and paths forward for such systems. In the variety of models presented, data plays a critical role in the structure of interactions between human and artificial ...

  16. Artificial Intelligence: Is the Future Now for A.I.?

    Science.gov (United States)

    Ramaswami, Rama

    2009-01-01

    In education, artificial intelligence (AI) has not made much headway. In the one area where it would seem poised to lend the most benefit--assessment--the reliance on standardized tests, intensified by the demands of the No Child Left Behind Act of 2001, which holds schools accountable for whether students pass statewide exams, precludes its use.…

  17. Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS): A conceptual framework

    Science.gov (United States)

    Parnell, Gregory S.; Rowell, William F.; Valusek, John R.

    1987-01-01

    In recent years there has been increasing interest in applying the computer based problem solving techniques of Artificial Intelligence (AI), Operations Research (OR), and Decision Support Systems (DSS) to analyze extremely complex problems. A conceptual framework is developed for successfully integrating these three techniques. First, the fields of AI, OR, and DSS are defined and the relationships among the three fields are explored. Next, a comprehensive adaptive design methodology for AI and OR modeling within the context of a DSS is described. These observations are made: (1) the solution of extremely complex knowledge problems with ill-defined, changing requirements can benefit greatly from the use of the adaptive design process, (2) the field of DSS provides the focus on the decision making process essential for tailoring solutions to these complex problems, (3) the characteristics of AI, OR, and DSS tools appears to be converging rapidly, and (4) there is a growing need for an interdisciplinary AI/OR/DSS education.

  18. NASA space station automation: AI-based technology review

    Science.gov (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

    1985-01-01

    Research and Development projects in automation for the Space Station are discussed. Artificial Intelligence (AI) based automation technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics. AI technology will also be developed for the servicing of satellites at the Space Station, system monitoring and diagnosis, space manufacturing, and the assembly of large space structures.

  19. The deep learning AI playbook strategy for disruptive artificial intelligence

    CERN Document Server

    Perez, Carlos E

    2017-01-01

    Deep Learning Artificial Intelligence involves the interplay of Computer Science, Physics, Biology, Linguistics and Psychology. In addition to that, it is technology that can be extremely disruptive. The ramifications to society and even our own humanity will be profound. There are few subjects that are as captivating and as consequential as this. Surprisingly, there is very little that is written about this new technology in a more comprehensive and cohesive way. This book is an opinionated take on the developments of Deep Learning AI. One question many have will be "how to apply Deep Learning AI in a business context?" Technology that is disruptive does not automatically imply that its application to valuable use cases will be apparent. For years, many people could not figure out how to monetize the World Wide Web. We are in a similar situation with Deep Learning AI. The developments may be mind-boggling but its monetization is far from being obvious. This book presents a framework to address this shortcomi...

  20. An SDR based AIS receiver for satellites

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter; Nielsen, Jens Frederik Dalsgaard

    2011-01-01

    For a few years now, there has been a high interest in monitoring the global ship traffic from space. A few satellite, capable of listening for ship borne AIS transponders have already been launched, and soon the AAUSAT3, carrying two different types of AIS receivers will also be launched. One...... of the AIS receivers onboard AAUSAT3 is an SDR based AIS receiver. This paper serves to describe the background of the AIS system, and how the SDR based receiver has been integrated into the AAUSAT3 satellite. Amongst some of the benefits of using an SDR based receiver is, that due to its versatility, new...... detection algorithms are easily deployed, and it is easily adapted the new proposed AIS transmission channels....

  1. Computational intelligence from AI to BI to NI

    Science.gov (United States)

    Werbos, Paul J.

    2015-05-01

    This paper gives highlights of the history of the neural network field, stressing the fundamental ideas which have been in play. Early neural network research was motivated mainly by the goals of artificial intelligence (AI) and of functional neuroscience (biological intelligence, BI), but the field almost died due to frustrations articulated in the famous book Perceptrons by Minsky and Papert. When I found a way to overcome the difficulties by 1974, the community mindset was very resistant to change; it was not until 1987/1988 that the field was reborn in a spectacular way, leading to the organized communities now in place. Even then, it took many more years to establish crossdisciplinary research in the types of mathematical neural networks needed to really understand the kind of intelligence we see in the brain, and to address the most demanding engineering applications. Only through a new (albeit short-lived) funding initiative, funding crossdisciplinary teams of systems engineers and neuroscientists, were we able to fund the critical empirical demonstrations which put our old basic principle of "deep learning" firmly on the map in computer science. Progress has rightly been inhibited at times by legitimate concerns about the "Terminator threat" and other possible abuses of technology. This year, at SPIE, in the quantum computing track, we outline the next stage ahead of us in breaking out of the box, again and again, and rising to fundamental challenges and opportunities still ahead of us.

  2. BWR shutdown analyzer using artificial intelligence (AI) techniques

    International Nuclear Information System (INIS)

    Cain, D.G.

    1986-01-01

    A prototype alarm system for detecting abnormal reactor shutdowns based on artificial intelligence technology is described. The system incorporates knowledge about Boiling Water Reactor (BWR) plant design and component behavior, as well as knowledge required to distinguish normal, abnormal, and ATWS accident conditions. The system was developed using a software tool environment for creating knowledge-based applications on a LISP machine. To facilitate prototype implementation and evaluation, a casual simulation of BWR shutdown sequences was developed and interfaced with the alarm system. An intelligent graphics interface for execution and control is described. System performance considerations and general observations relating to artificial intelligence application to nuclear power plant problems are provided

  3. A framework for AI-based nuclear design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1991-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an exploration model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  4. Framework for AI-based nuclear reactor design support system

    International Nuclear Information System (INIS)

    Furuta, Kazuo; Kondo, Shunsuke

    1992-01-01

    Nowadays many computer programs are being developed and used for the analytic tasks in nuclear reactor design, but experienced designers are still responsible for most of the synthetic tasks which are not amenable to algorithmic computer processes. Artificial intelligence (AI) is a promising technology to deal with these intractable tasks in design. In development of AI-based design support systems, it is desirable to choose a comprehensive framework based on the scientific theory of design. In this work a framework for AI-based design support systems for nuclear reactor design will be proposed based on an explorative abduction model of design. The fundamental architectures of this framework will be described especially on knowledge representation, context management and design planning. (author)

  5. An artificial intelligence (AI) NOx/heat rate optimization system for Ontario Hydro`s fossil generating stations

    Energy Technology Data Exchange (ETDEWEB)

    Luk, J.; Frank, A.; Bodach, P. [Ontario Hydro, Toronto, ON (Canada); Warriner, G. [Radian International, Tucker, GA (United States); Noblett, J. [Radian International, Austin, TX (United States); Slatsky, M. [Southern Company, Birmingham, AL (United States)

    1999-08-01

    Artificial intelligence (AI)-based software packages which can optimize power plant operations that improves heat rate and also reduces nitrogen oxide emissions are now commonly available for commercial use. This paper discusses the implementation of the AI-based NOx and Heat Rate Optimization System at Ontario Hydro`s generation stations, emphasizing the current AI Optimization Project at Units 5 and 6 of the Lakeview Generating Station. These demonstration programs are showing promising results in NOx reduction and plant performance improvement. The availability of the plant Digital Control System (DCS) in implementing AI optimization in a closed-loop system was shown to be an important criterion for success. Implementation of AI technology at other Ontario Hydro fossil generating units as part of the overall NOx emission reduction system is envisaged to coincide with the retrofit of the original plant control system with the latest DCS systems. 14 refs., 3 figs.

  6. Development of AI (Artificial Intelligence)-based simulation system for man-machine system behavior in accidental situations of nuclear power plant

    International Nuclear Information System (INIS)

    Yoshida, Kazuo; Yokobayashi, Masao; Tanabe, Fumiya; Kawase, Katumi.

    1996-01-01

    A prototype version of a computer simulation system named JACOS (JAeri COgnitive Simulation system) has been developed at JAERI (Japan Atomic Energy Research Institute) to simulate the man-machine system behavior in which both the cognitive behavior of a human operator and the plant behavior affect each other. The objectives of this system development is to provide man-machine system analysts with detailed information on the cognitive process of an operator and the plant behavior affected by operator's actions in accidental situations of an NPP (nuclear power plant). The simulation system consists of an operator model and a plant model which are coupled dynamically. The operator model simulates an operator's cognitive behavior in accidental situations based on the decision ladder model of Rasmussen, and is implemented using the AI-techniques of the distributed cooperative inference method with the so-called blackboard architecture. Rule-based behavior is simulated using knowledge representation with If-Then type of rules. Knowledge-based behavior is simulated using knowledge representation with MFM (Multilevel Flow Modeling) and qualitative reasoning method. Cognitive characteristics of attentional narrowing, limitation of short-term memory, and knowledge recalling from long-term memory are also modeled. The plant model of a 3-loop PWR is also developed using a best estimate thermal-hydraulic analysis code RELAP5/MOD2. Some simulations of incidents were performed to verify the human model. It was found that AI-techniques used in the human model are suitable to simulate the operator's cognitive behavior in an NPP accident. The models of cognitive characteristics were investigated in the effects on simulated results of cognitive behaviors. (author)

  7. AI Based Personal Learning Environments: Directions for Long Term Research. AI Memo 384.

    Science.gov (United States)

    Goldstein, Ira P.; Miller, Mark L.

    The application of artificial intelligence (AI) techniques to the design of personal learning environments is an enterprise of both theoretical and practical interest. In the short term, the process of developing and testing intelligent tutoring programs serves as a new experimental vehicle for exploring alternative cognitive and pedagogical…

  8. Artificial Intelligence (AI techniques to analyze the determinants attributes in housing prices

    Directory of Open Access Journals (Sweden)

    Julia M. Núñez Tabale

    2016-12-01

    Full Text Available The econometric approach to obtain the value of a property began with hedonic modelling, which were based on a set of property attributes, internal or external, associated to each particular dwelling. The final sale value can be estimated, and also the marginal prices of each exogenous explanatory variable. A good alternative to the hedonic approach is based on several Artificial Intelligence (AI techniques, such as artificial neural networks (ANN, these tend to be more precise. Both methodologies are compared, and a case study is developed using data from Seville, the larger town in the South of Spain.

  9. Infrastructural intelligence: Contemporary entanglements between neuroscience and AI.

    Science.gov (United States)

    Bruder, Johannes

    2017-01-01

    In this chapter, I reflect on contemporary entanglements between artificial intelligence and the neurosciences by tracing the development of Google's recent DeepMind algorithms back to their roots in neuroscientific studies of episodic memory and imagination. Google promotes a new form of "infrastructural intelligence," which excels by constantly reassessing its cognitive architecture in exchange with a cloud of data that surrounds it, and exhibits putatively human capacities such as intuition. I argue that such (re)alignments of biological and artificial intelligence have been enabled by a paradigmatic infrastructuralization of the brain in contemporary neuroscience. This infrastructuralization is based in methodologies that epistemically liken the brain to complex systems of an entirely different scale (i.e., global logistics) and has given rise to diverse research efforts that target the neuronal infrastructures of higher cognitive functions such as empathy and creativity. What is at stake in this process is no less than the shape of brains to come and a revised understanding of the intelligent and creative social subject. © 2017 Elsevier B.V. All rights reserved.

  10. Application of artificial intelligence (AI) methods for designing and analysis of reconfigurable cellular manufacturing system (RCMS)

    CSIR Research Space (South Africa)

    Xing, B

    2009-12-01

    Full Text Available This work focuses on the design and control of a novel hybrid manufacturing system: Reconfigurable Cellular Manufacturing System (RCMS) by using Artificial Intelligence (AI) approach. It is hybrid as it combines the advantages of Cellular...

  11. Ai

    African Journals Online (AJOL)

    :=g=~!Ai~~~~~g~~ ~~~~~~. Jim Taylor, Rob O'Donoghue and Alistair Clacherty. INTRODUCTION. The Department of Environment Affairs, in cooperation with ...

  12. Application of Artificial Intelligence (AI) Programming Techniques to Tactical Guidance for Fighter Aircraft

    Science.gov (United States)

    McManus, John W.; Goodrich, Kenneth H.

    1989-01-01

    A research program investigating the use of Artificial Intelligence (AI) techniques to aid in the development of a Tactical Decision Generator (TDG) for Within-Visual-Range (WVR) air combat engagements is discussed. The application of AI methods for development and implementation of the TDG is presented. The history of the Adaptive Maneuvering Logic (AML) program is traced and current versions of the AML program are compared and contrasted with the TDG system. The Knowledge-Based Systems (KBS) used by the TDG to aid in the decision-making process are outlined in detail and example rules are presented. The results of tests to evaluate the performance of the TDG versus a version of AML and versus human pilots in the Langley Differential Maneuvering Simulator (DMS) are presented. To date, these results have shown significant performance gains in one-versus-one air combat engagements, and the AI-based TDG software has proven to be much easier to modify than the updated FORTRAN AML programs.

  13. Quality measures and assurance for AI (Artificial Intelligence) software

    Science.gov (United States)

    Rushby, John

    1988-01-01

    This report is concerned with the application of software quality and evaluation measures to AI software and, more broadly, with the question of quality assurance for AI software. Considered are not only the metrics that attempt to measure some aspect of software quality, but also the methodologies and techniques (such as systematic testing) that attempt to improve some dimension of quality, without necessarily quantifying the extent of the improvement. The report is divided into three parts Part 1 reviews existing software quality measures, i.e., those that have been developed for, and applied to, conventional software. Part 2 considers the characteristics of AI software, the applicability and potential utility of measures and techniques identified in the first part, and reviews those few methods developed specifically for AI software. Part 3 presents an assessment and recommendations for the further exploration of this important area.

  14. Towards an unanimous international regulatory body for responsible use of Artificial Intelligence [UIRB-AI

    OpenAIRE

    Chidambaram, Rajesh

    2017-01-01

    Artificial Intelligence (AI), is once again in the phase of drastic advancements. Unarguably, the technology itself can revolutionize the way we live our everyday life. But the exponential growth of technology poses a daunting task for policy researchers and law makers in making amendments to the existing norms. In addition, not everyone in the society is studying the potential socio-economic intricacies and cultural drifts that AI can bring about. It is prudence to reflect from our historica...

  15. AI Reloaded: Objectives, Potentials, and Challenges of the Novel Field of Brain-Like Artificial Intelligence

    Directory of Open Access Journals (Sweden)

    Rosemarie Velik

    2012-11-01

    Full Text Available The general objective of Artificial Intelligence (AI is to make machines – particularly computers – do things that require intelligence when done by humans. In the last 60 years, AI has significantly progressed and today forms an important part of industry and technology. However, despite the many successes, fundamental questions concerning the creation of human-level intelligence in machines still remain open and will probably not be answerable when continuing on the current, mainly mathematic-algorithmically-guided path of AI. With the novel discipline of
    Brain-Like Artificial Intelligence, one potential way out of this dilemma has been suggested. Brain-Like AI aims at analyzing and deciphering the working mechanisms of the brain and translating this knowledge into implementable AI architectures with the objective to develop in this way more efficient, flexible, and capable technical systems This article aims at giving a review about this young and still heterogeneous and dynamic research field.

  16. AI's Philosophical Underpinnings: A Thinking Person's Walk through the Twists and Turns of Artificial Intelligence's Meandering Path

    Science.gov (United States)

    Colombano, Silvano; Norvig, Peter (Technical Monitor)

    2000-01-01

    Few human endeavors can be viewed both as extremely successful and unsuccessful at the same time. This is typically the case when goals have not been well defined or have been shifting in time. This has certainly been true of Artificial Intelligence (AI). The nature of intelligence has been the object of much thought and speculation throughout the history of philosophy. It is in the nature of philosophy that real headway is sometimes made only when appropriate tools become available. Similarly the computer, coupled with the ability to program (at least in principle) any function, appeared to be the tool that could tackle the notion of intelligence. To suit the tool, the problem of the nature of intelligence was soon sidestepped in favor of this notion: If a probing conversation with a computer could not be distinguished from a conversation with a human, then AI had been achieved. This notion became known as the Turing test, after the mathematician Alan Turing who proposed it in 1950. Conceptually rich and interesting, these early efforts gave rise to a large portion of the field's framework. Key to AI, rather than the 'number crunching' typical of computers until then, was viewed as the ability to manipulate symbols and make logical inferences. To facilitate these tasks, AI languages such as LISP and Prolog were invented and used widely in the field. One idea that emerged and enabled some success with real world problems was the notion that 'most intelligence' really resided in knowledge. A phrase attributed to Feigenbaum, one of the pioneers, was 'knowledge is the power.' With this premise, the problem is shifted from 'how do we solve problems' to 'how do we represent knowledge.' A good knowledge representation scheme could allow one to draw conclusions from given premises. Such schemes took forms such as rules,frames and scripts. It allowed the building of what became known as expert systems or knowledge based systems (KBS).

  17. Intelligence Unleashed: An argument for AI in Education

    OpenAIRE

    Luckin, R.; Holmes, W.

    2016-01-01

    This paper on artificial intelligence in education (AIEd) has two aims. The first: to explain to a non-specialist, interested, reader what AIEd is: its goals, how it is built, and how it works. The second: to set out the argument for what AIEd can offer teaching and learning, both now and in the future, with an eye towards improving learning and life outcomes for all. Computer systems that are artificially intelligent interact with the world using capabilities (such as speech recognition) and...

  18. Flood AI: An Intelligent Systems for Discovery and Communication of Disaster Knowledge

    Science.gov (United States)

    Demir, I.; Sermet, M. Y.

    2017-12-01

    Communities are not immune from extreme events or natural disasters that can lead to large-scale consequences for the nation and public. Improving resilience to better prepare, plan, recover, and adapt to disasters is critical to reduce the impacts of extreme events. The National Research Council (NRC) report discusses the topic of how to increase resilience to extreme events through a vision of resilient nation in the year 2030. The report highlights the importance of data, information, gaps and knowledge challenges that needs to be addressed, and suggests every individual to access the risk and vulnerability information to make their communities more resilient. This project presents an intelligent system, Flood AI, for flooding to improve societal preparedness by providing a knowledge engine using voice recognition, artificial intelligence, and natural language processing based on a generalized ontology for disasters with a primary focus on flooding. The knowledge engine utilizes the flood ontology and concepts to connect user input to relevant knowledge discovery channels on flooding by developing a data acquisition and processing framework utilizing environmental observations, forecast models, and knowledge bases. Communication channels of the framework includes web-based systems, agent-based chat bots, smartphone applications, automated web workflows, and smart home devices, opening the knowledge discovery for flooding to many unique use cases.

  19. Prediction of shipboard electromagnetic interference (EMI) problems using artificial intelligence (AI) technology

    Science.gov (United States)

    Swanson, David J.

    1990-08-01

    The electromagnetic interference prediction problem is characteristically ill-defined and complicated. Severe EMI problems are prevalent throughout the U.S. Navy, causing both expected and unexpected impacts on the operational performance of electronic combat systems onboard ships. This paper focuses on applying artificial intelligence (AI) technology to the prediction of ship related electromagnetic interference (EMI) problems.

  20. Artificial intelligence/expert (AI/EX) systems for steelworks pollution control

    Energy Technology Data Exchange (ETDEWEB)

    Schofield, N.; Le Louer, P.; Mirabile, D.; Hubner, R. [Corus UK Ltd., Rotherham (United Kingdom)

    2002-07-01

    The objectives of this project have been to develop and apply artificial intelligence and expert system (AI/EX) methods to improve the control and operational performance of steelworks' pollution control equipment and to assess the viability and benefits of using such systems in dynamic process plant applications. Four distinct sub-projects were carried out: an expert system incorporating knowledge-based rules and neural network simulations has been developed by Corus which provides plant personnel with a real-time condition monitoring tool for the plant. Abnormalities with plant operation are now instantly recognised and alarmed, allowing prioritised maintenance to increase plant availability. The LECES project focused on studies concerning three different sites in order to evaluate predictive emission monitoring systems using neural networks to replace conventional instrumental and controls in steelworks' combustion systems. VAI developed a software template for pollution control expert systems to demonstrate the transferability of AI/EX technology. This has been done through the development of a validated process database containing data from the Corus sub-project and the subsequent integration of this data with dynamic emission models to produce rules for input to an evaluation database. CSM developed a fuzzy logic controlled process management system applied to the biological treatment of coke-oven waste water. A pilot plant has been installed and results on simulations performed using the fuzzy logic system linked to a neural network simulator show that it is possible to obtain great advantages in the biological pilot plant performance.

  1. Autonomously generating operations sequences for a Mars Rover using AI-based planning

    Science.gov (United States)

    Sherwood, Rob; Mishkin, Andrew; Estlin, Tara; Chien, Steve; Backes, Paul; Cooper, Brian; Maxwell, Scott; Rabideau, Gregg

    2001-01-01

    This paper discusses a proof-of-concept prototype for ground-based automatic generation of validated rover command sequences from highlevel science and engineering activities. This prototype is based on ASPEN, the Automated Scheduling and Planning Environment. This Artificial Intelligence (AI) based planning and scheduling system will automatically generate a command sequence that will execute within resource constraints and satisfy flight rules.

  2. Emerging trends in geospatial artificial intelligence (geoAI): potential applications for environmental epidemiology.

    Science.gov (United States)

    VoPham, Trang; Hart, Jaime E; Laden, Francine; Chiang, Yao-Yi

    2018-04-17

    Geospatial artificial intelligence (geoAI) is an emerging scientific discipline that combines innovations in spatial science, artificial intelligence methods in machine learning (e.g., deep learning), data mining, and high-performance computing to extract knowledge from spatial big data. In environmental epidemiology, exposure modeling is a commonly used approach to conduct exposure assessment to determine the distribution of exposures in study populations. geoAI technologies provide important advantages for exposure modeling in environmental epidemiology, including the ability to incorporate large amounts of big spatial and temporal data in a variety of formats; computational efficiency; flexibility in algorithms and workflows to accommodate relevant characteristics of spatial (environmental) processes including spatial nonstationarity; and scalability to model other environmental exposures across different geographic areas. The objectives of this commentary are to provide an overview of key concepts surrounding the evolving and interdisciplinary field of geoAI including spatial data science, machine learning, deep learning, and data mining; recent geoAI applications in research; and potential future directions for geoAI in environmental epidemiology.

  3. AI (artificial intelligence) in histopathology--from image analysis to automated diagnosis.

    Science.gov (United States)

    Kayser, Klaus; Görtler, Jürgen; Bogovac, Milica; Bogovac, Aleksandar; Goldmann, Torsten; Vollmer, Ekkehard; Kayser, Gian

    2009-01-01

    The technological progress in digitalization of complete histological glass slides has opened a new door in tissue--based diagnosis. The presentation of microscopic images as a whole in a digital matrix is called virtual slide. A virtual slide allows calculation and related presentation of image information that otherwise can only be seen by individual human performance. The digital world permits attachments of several (if not all) fields of view and the contemporary visualization on a screen. The presentation of all microscopic magnifications is possible if the basic pixel resolution is less than 0.25 microns. To introduce digital tissue--based diagnosis into the daily routine work of a surgical pathologist requires a new setup of workflow arrangement and procedures. The quality of digitized images is sufficient for diagnostic purposes; however, the time needed for viewing virtual slides exceeds that of viewing original glass slides by far. The reason lies in a slower and more difficult sampling procedure, which is the selection of information containing fields of view. By application of artificial intelligence, tissue--based diagnosis in routine work can be managed automatically in steps as follows: 1. The individual image quality has to be measured, and corrected, if necessary. 2. A diagnostic algorithm has to be applied. An algorithm has be developed, that includes both object based (object features, structures) and pixel based (texture) measures. 3. These measures serve for diagnosis classification and feedback to order additional information, for example in virtual immunohistochemical slides. 4. The measures can serve for automated image classification and detection of relevant image information by themselves without any labeling. 5. The pathologists' duty will not be released by such a system; to the contrary, it will manage and supervise the system, i.e., just working at a "higher level". Virtual slides are already in use for teaching and continuous

  4. NASA space station automation: AI-based technology review. Executive summary

    Science.gov (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Cheeseman, P. C.; Goldberg, J.; Neumann, P.; Kautz, W. H.; Levitt, K. N.; Rom, R. J.; Poggio, A. A.

    1985-01-01

    Research and Development projects in automation technology for the Space Station are described. Artificial Intelligence (AI) based technologies are planned to enhance crew safety through reduced need for EVA, increase crew productivity through the reduction of routine operations, increase space station autonomy, and augment space station capability through the use of teleoperation and robotics.

  5. AIonAI: a humanitarian law of artificial intelligence and robotics.

    Science.gov (United States)

    Ashrafian, Hutan

    2015-02-01

    The enduring progression of artificial intelligence and cybernetics offers an ever-closer possibility of rational and sentient robots. The ethics and morals deriving from this technological prospect have been considered in the philosophy of artificial intelligence, the design of automatons with roboethics and the contemplation of machine ethics through the concept of artificial moral agents. Across these categories, the robotics laws first proposed by Isaac Asimov in the twentieth century remain well-recognised and esteemed due to their specification of preventing human harm, stipulating obedience to humans and incorporating robotic self-protection. However the overwhelming predominance in the study of this field has focussed on human-robot interactions without fully considering the ethical inevitability of future artificial intelligences communicating together and has not addressed the moral nature of robot-robot interactions. A new robotic law is proposed and termed AIonAI or artificial intelligence-on-artificial intelligence. This law tackles the overlooked area where future artificial intelligences will likely interact amongst themselves, potentially leading to exploitation. As such, they would benefit from adopting a universal law of rights to recognise inherent dignity and the inalienable rights of artificial intelligences. Such a consideration can help prevent exploitation and abuse of rational and sentient beings, but would also importantly reflect on our moral code of ethics and the humanity of our civilisation.

  6. Blue Sky Ideas in Artificial Intelligence Education from the EAAI 2017 New and Future AI Educator Program

    OpenAIRE

    Eaton, Eric; Koenig, Sven; Schulz, Claudia; Maurelli, Francesco; Lee, John; Eckroth, Joshua; Crowley, Mark; Freedman, Richard G.; Cardona-Rivera, Rogelio E.; Machado, Tiago; Williams, Tom

    2017-01-01

    The 7th Symposium on Educational Advances in Artificial Intelligence (EAAI'17, co-chaired by Sven Koenig and Eric Eaton) launched the EAAI New and Future AI Educator Program to support the training of early-career university faculty, secondary school faculty, and future educators (PhD candidates or postdocs who intend a career in academia). As part of the program, awardees were asked to address one of the following "blue sky" questions: * How could/should Artificial Intelligence (AI) courses ...

  7. AI in Computer-Based Training

    Science.gov (United States)

    Camstra, Bert

    2008-01-01

    In this paper, intelligent approaches to CBT are put into several perspectives in an attempt to elucidate the concepts and give them a more realistic (and not only glamorous) footing. The role of expert systems in training is explored and possible routes towards intelligent CBT are outlined. [This paper was first published in "Interactive Learning…

  8. AI based HealthCare Platform for Real Time, Predictive and Prescriptive Analytics using Reactive Programming

    Science.gov (United States)

    Kaur, Jagreet; Singh Mann, Kulwinder, Dr.

    2018-01-01

    AI in Healthcare needed to bring real, actionable insights and Individualized insights in real time for patients and Doctors to support treatment decisions., We need a Patient Centred Platform for integrating EHR Data, Patient Data, Prescriptions, Monitoring, Clinical research and Data. This paper proposes a generic architecture for enabling AI based healthcare analytics Platform by using open sources Technologies Apache beam, Apache Flink Apache Spark, Apache NiFi, Kafka, Tachyon, Gluster FS, NoSQL- Elasticsearch, Cassandra. This paper will show the importance of applying AI based predictive and prescriptive analytics techniques in Health sector. The system will be able to extract useful knowledge that helps in decision making and medical monitoring in real-time through an intelligent process analysis and big data processing.

  9. AI tools in computer based problem solving

    Science.gov (United States)

    Beane, Arthur J.

    1988-01-01

    The use of computers to solve value oriented, deterministic, algorithmic problems, has evolved a structured life cycle model of the software process. The symbolic processing techniques used, primarily in research, for solving nondeterministic problems, and those for which an algorithmic solution is unknown, have evolved a different model, much less structured. Traditionally, the two approaches have been used completely independently. With the advent of low cost, high performance 32 bit workstations executing identical software with large minicomputers and mainframes, it became possible to begin to merge both models into a single extended model of computer problem solving. The implementation of such an extended model on a VAX family of micro/mini/mainframe systems is described. Examples in both development and deployment of applications involving a blending of AI and traditional techniques are given.

  10. Pathologies of AI: Responsible use of artificial intelligence in professional work

    NARCIS (Netherlands)

    Stamper, R.K.

    1988-01-01

    Although the AI paradigm is useful for building knowledge-based systems for the applied natural sciences, there are dangers when it is extended into the domains of business, law and other social systems. It is misleading to treat knowledge as a commodity that can be separated from the context in

  11. Human-centered automation and AI - Ideas, insights, and issues from the Intelligent Cockpit Aids research effort

    Science.gov (United States)

    Abbott, Kathy H.; Schutte, Paul C.

    1989-01-01

    A development status evaluation is presented for the NASA-Langley Intelligent Cockpit Aids research program, which encompasses AI, human/machine interfaces, and conventional automation. Attention is being given to decision-aiding concepts for human-centered automation, with emphasis on inflight subsystem fault management, inflight mission replanning, and communications management. The cockpit envisioned is for advanced commercial transport aircraft.

  12. The Emperor of Strong AI Has No Clothes: Limits to Artificial Intelligence

    Directory of Open Access Journals (Sweden)

    Adriana Braga

    2017-11-01

    Full Text Available Making use of the techniques of media ecology we argue that the premise of the technological Singularity based on the notion computers will one day be smarter that their human creators is false. We also analyze the comments of other critics of the Singularity, as well supporters of this notion. The notion of intelligence that advocates of the technological singularity promote does not take into account the full dimension of human intelligence. They treat artificial intelligence as a figure without a ground. Human intelligence as we will show is not based solely on logical operations and computation, but also includes a long list of other characteristics that are unique to humans, which is the ground that supporters of the Singularity ignore. The list includes curiosity, imagination, intuition, emotions, passion, desires, pleasure, aesthetics, joy, purpose, objectives, goals, telos, values, morality, experience, wisdom, judgment, and even humor.

  13. AI 3D Cybug Gaming

    OpenAIRE

    Ahmed, Zeeshan

    2010-01-01

    In this short paper I briefly discuss 3D war Game based on artificial intelligence concepts called AI WAR. Going in to the details, I present the importance of CAICL language and how this language is used in AI WAR. Moreover I also present a designed and implemented 3D War Cybug for AI WAR using CAICL and discus the implemented strategy to defeat its enemies during the game life.

  14. AI model for computer games based on case based reasoning and AI planning

    NARCIS (Netherlands)

    Menkovski, V.; Metafas, D.

    2008-01-01

    Making efficient AI models for games with imperfect information can be a particular challenge. Considering the large number of possible moves and the incorporated uncertainties building game trees for these games becomes very difficult due to the exponential growth of the number of nodes at each

  15. The Molecular Basis of Neural Memory. Part 7: Neural Intelligence (NI versus Artificial Intelligence (AI

    Directory of Open Access Journals (Sweden)

    Gerard Marx

    2017-07-01

    Full Text Available The link of memory to intelligence is incontestable, though the development of electronic artifacts with memory has confounded cognitive and computer scientists’ conception of memory and its relevance to “intelligence”. We propose two categories of “Intelligence”: (1 Logical (objective — mathematics, numbers, pattern recognition, games, programmable in binary format. (2 Emotive (subjective — sensations, feelings, perceptions, goals desires, sociability, sex, food, love. The 1st has been reduced to computational algorithms of which we are well versed, witness global technology and the internet. The 2nd relates to the mysterious process whereby (psychic emotive states are achieved by neural beings sensing, comprehending, remembering and dealing with their surroundings. Many theories and philosophies have been forwarded to rationalize this process, but as neuroscientists, we remain dissatisfied. Our own musings on universal neural memory, suggest a tripartite mechanism involving neurons interacting with their surroundings, notably the neural extracellular matrix (nECM with dopants [trace metals and neurotransmitters (NTs]. In particular, the NTs are the molecular encoders of emotive states. We have developed a chemographic representation of such a molecular code.To quote Longuet-Higgins, “Perhaps it is time for the term ‘artificial intelligence’ to be replaced by something more modest and less provisional”. We suggest “artifact intelligence” (ARTI or “machine intelligence” (MI, neither of which imply emulation of emotive neural processes, but simply refer to the ‘demotive’ (lacking emotive quality capability of electronic artifacts that employ a recall function, to calculate algorithms.

  16. Fully automatic AI-based leak detection system

    Energy Technology Data Exchange (ETDEWEB)

    Tylman, Wojciech; Kolczynski, Jakub [Dept. of Microelectronics and Computer Science, Technical University of Lodz in Poland, ul. Wolczanska 221/223, Lodz (Poland); Anders, George J. [Kinectrics Inc., 800 Kipling Ave., Toronto, Ontario M8Z 6C4 (Canada)

    2010-09-15

    This paper presents a fully automatic system intended to detect leaks of dielectric fluid in underground high-pressure, fluid-filled (HPFF) cables. The system combines a number of artificial intelligence (AI) and data processing techniques to achieve high detection capabilities for various rates of leaks, including leaks as small as 15 l per hour. The system achieves this level of precision mainly thanks to a novel auto-tuning procedure, enabling learning of the Bayesian network - the decision-making component of the system - using simulated leaks of various rates. Significant new developments extending the capabilities of the original leak detection system described in and form the basis of this paper. Tests conducted on the real-life HPFF cable system in New York City are also discussed. (author)

  17. The Potential of AI Techniques for Remote Sensing

    Science.gov (United States)

    Estes, J. E.; Sailer, C. T. (Principal Investigator); Tinney, L. R.

    1984-01-01

    The current status of artificial intelligence AI technology is discussed along with imagery data management, database interrogation, and decision making. Techniques adapted from the field of artificial intelligence (AI) have significant, wide ranging impacts upon computer-assisted remote sensing analysis. AI based techniques offer a powerful and fundamentally different approach to many remote sensing tasks. In addition to computer assisted analysis, AI techniques can also aid onboard spacecraft data processing and analysis and database access and query.

  18. A New Dimension of Business Intelligence: Location-based Intelligence

    OpenAIRE

    Zeljko Panian

    2012-01-01

    Through the course of this paper we define Locationbased Intelligence (LBI) which is outgrowing from process of amalgamation of geolocation and Business Intelligence. Amalgamating geolocation with traditional Business Intelligence (BI) results in a new dimension of BI named Location-based Intelligence. LBI is defined as leveraging unified location information for business intelligence. Collectively, enterprises can transform location data into business intelligence applic...

  19. Application of artificial intelligence (AI) concepts to the development of space flight parts approval model

    Science.gov (United States)

    Krishnan, G. S.

    1997-01-01

    A cost effective model which uses the artificial intelligence techniques in the selection and approval of parts is presented. The knowledge which is acquired from the specialists for different part types are represented in a knowledge base in the form of rules and objects. The parts information is stored separately in a data base and is isolated from the knowledge base. Validation, verification and performance issues are highlighted.

  20. Northeast Artificial Intelligence Consortium Annual Report 1986. Volume 4. Part A. Hierarchical Region-Based Approach to Automatic Photointerpretation. Part B. Application of AI Techniques to Image Segmentation and Region Identification

    Science.gov (United States)

    1988-01-01

    MONITORING ORGANIZATION Northeast Artificial (If applicaole)nelincCostum(AcRome Air Development Center (COCU) Inteligence Consortium (NAIC)I 6c. ADDRESS...f, Offell RADC-TR-88-1 1, Vol IV (of eight) Interim Technical ReportS June 1988 NORTHEAST ARTIFICIAL INTELLIGENCE CONSORTIUM ANNUAL REPORT 1986...13441-5700 EMENT NO NO NO ACCESSION NO62702F 5 8 71 " " over) I 58 27 13 " ൓ TITLE (Include Security Classification) NORTHEAST ARTIFICIAL INTELLIGENCE

  1. MENO-II: An AI-Based Programming Tutor.

    Science.gov (United States)

    Soloway, Elliot; And Others

    This report examines the features and performance of the BUG-FINDing component of MENO-II, a computer-based tutor for beginning PASCAL programming students. A discussion of the use of artificial intelligence techniques is followed by a summary of the system status and objectives. The two main components of MENO-II are described, beginning with the…

  2. A SVM bases AI design for interactive gaming

    OpenAIRE

    Jiang, Yang; Jiang, Jianmin; Palmer, Ian

    2008-01-01

    Interactive gaming requires automatic processing on large volume of random data produced by players on spot, such as shooting, football kicking, boxing etc. In this paper, we describe an artificial intelligence approach in processing such random data for interactive gaming by using a one-class support vector machine (OC-SVM). In comparison with existing techniques, our OC-SVM based interactive gaming design has the features of: (i): high speed processing, providing instant response to the pla...

  3. The Potential Role of Artificial Intelligence Technology in Education.

    Science.gov (United States)

    Salem, Abdel-Badeeh M.

    The field of Artificial Intelligence (AI) and Education has traditionally a technology-based focus, looking at the ways in which AI can be used in building intelligent educational software. In addition AI can also provide an excellent methodology for learning and reasoning from the human experiences. This paper presents the potential role of AI in…

  4. Methodology Investigation of AI(Artificial Intelligence) Test Officer Support Tool. Volume 1

    Science.gov (United States)

    1989-03-01

    American Association for Artificial inteligence A! ............. Artificial inteliigence AMC ............ Unt:ed States Army Maeriel Comand ASL...block number) FIELD GROUP SUB-GROUP Artificial Intelligence, Expert Systems Automated Aids to Testing 9. ABSTRACT (Continue on reverse if necessary and...identify by block number) This report covers the application of Artificial Intelligence-Techniques to the problem of creating automated tools to

  5. AI-based alarm processing for a nuclear power plant

    International Nuclear Information System (INIS)

    Na, N.J.; Kim, I.S.; Hwang, I.K.; Lee, D.Y.; Ham, C.S.

    1996-01-01

    A real-time expert system is implemented using artificial intelligence and object-oriented technology for alarm processing and presentation in a nuclear power plant. The knowledge base is constructed based on some schemes to process and display alarms to the plant operators. The activated alarms are dynamically prioritized by the reasoning rules, and then, presented on the process mimic overview and by some other means. To demonstrate the proposed system, the alarm processing and presentation is carried out in a simulated environment of the TMI-2 accident

  6. Application of artificial intelligence (AI) concepts to the development of space flight parts approval model

    Science.gov (United States)

    Krishnan, Govindarajapuram Subramaniam

    1997-12-01

    The National Aeronautics & Space Administration (NASA), the European Space Agency (ESA), and the Canadian Space Agency (CSA) missions involve the performance of scientific experiments in Space. Instruments used in such experiments are fabricated using electronic parts such as microcircuits, inductors, capacitors, diodes, transistors, etc. For instruments to perform reliably the selection of commercial parts must be monitored and strictly controlled. The process used to achieve this goal is by a manual review and approval of every part used to build the instrument. The present system to select and approve parts for space applications is manual, inefficient, inconsistent, slow and tedious, and very costly. In this dissertation a computer based decision support model is developed for implementing this process using artificial intelligence concepts based on the current information (expert sources). Such a model would result in a greater consistency, accuracy, and timeliness of evaluation. This study presents the methodology of development and features of the model, and the analysis of the data pertaining to the performance of the model in the field. The model was evaluated for three different part types by experts from three different space agencies. The results show that the model was more consistent than the manual evaluation for all part types considered. The study concludes with the cost and benefits analysis of implementing the models and shows that implementation of the model will result in significant cost savings. Other implementation details are highlighted.

  7. Investigating AI with Basic and Logo. Teaching Your Computer to Be Intelligent.

    Science.gov (United States)

    Mandell, Alan; Lucking, Robert

    1988-01-01

    Discusses artificial intelligence, its definitions, and potential applications. Provides listings of Logo and BASIC versions for programs along with REM statements needed to make modifications for use with Apple computers. (RT)

  8. Experiments with microcomputer-based artificial intelligence environments

    Science.gov (United States)

    Summers, E.G.; MacDonald, R.A.

    1988-01-01

    The U.S. Geological Survey (USGS) has been experimenting with the use of relatively inexpensive microcomputers as artificial intelligence (AI) development environments. Several AI languages are available that perform fairly well on desk-top personal computers, as are low-to-medium cost expert system packages. Although performance of these systems is respectable, their speed and capacity limitations are questionable for serious earth science applications foreseen by the USGS. The most capable artificial intelligence applications currently are concentrated on what is known as the "artificial intelligence computer," and include Xerox D-series, Tektronix 4400 series, Symbolics 3600, VAX, LMI, and Texas Instruments Explorer. The artificial intelligence computer runs expert system shells and Lisp, Prolog, and Smalltalk programming languages. However, these AI environments are expensive. Recently, inexpensive 32-bit hardware has become available for the IBM/AT microcomputer. USGS has acquired and recently completed Beta-testing of the Gold Hill Systems 80386 Hummingboard, which runs Common Lisp on an IBM/AT microcomputer. Hummingboard appears to have the potential to overcome many of the speed/capacity limitations observed with AI-applications on standard personal computers. USGS is a Beta-test site for the Gold Hill Systems GoldWorks expert system. GoldWorks combines some high-end expert system shell capabilities in a medium-cost package. This shell is developed in Common Lisp, runs on the 80386 Hummingboard, and provides some expert system features formerly available only on AI-computers including frame and rule-based reasoning, on-line tutorial, multiple inheritance, and object-programming. ?? 1988 International Association for Mathematical Geology.

  9. How People Interact with Technology based on Natural and Artificial Intelligence

    OpenAIRE

    Vasile MAZILESCU

    2017-01-01

    This paper aims to analyse the different forms of intelligence within organizations in a systemic and inclusive vision, in order to design an integrated environment based on Artificial Intelligence (AI) and Collective Intelligence (CI). This way we effectively shift the classical approaches of connecting people with people using collaboration tools (which allow people to work together, such as videoconferencing or email, groupware in virtual space, forums, workflow), of connecting people with...

  10. #%Applications of artificial intelligence in intelligent manufacturing: a review

    Institute of Scientific and Technical Information of China (English)

    #

    2017-01-01

    #%Based on research into the applications of artificial intelligence (AI) technology in the manufacturing industry in recent years, we analyze the rapid development of core technologies in the new era of 'Internet plus AI', which is triggering a great change in the models, means, and ecosystems of the manufacturing industry, as well as in the development of AI. We then propose new models, means, and forms of intelligent manufacturing, intelligent manufacturing system architecture, and intelligent man-ufacturing technology system, based on the integration of AI technology with information communications, manufacturing, and related product technology. Moreover, from the perspectives of intelligent manufacturing application technology, industry, and application demonstration, the current development in intelligent manufacturing is discussed. Finally, suggestions for the appli-cation of AI in intelligent manufacturing in China are presented.

  11. In Orbit Validation of the AAUSAT3 SDR based AIS receiver

    DEFF Research Database (Denmark)

    Larsen, Jesper Abildgaard; Mortensen, Hans Peter

    2013-01-01

    During the past years, there has been a high interest in monitoring the global ship traffic from space. The recently launched AAUSAT3 satellite carries an SDR based AIS receiver, which during the past months have been transmitting space based AIS data down to the Aalborg University Ground Station...

  12. Teaching AI Search Algorithms in a Web-Based Educational System

    Science.gov (United States)

    Grivokostopoulou, Foteini; Hatzilygeroudis, Ioannis

    2013-01-01

    In this paper, we present a way of teaching AI search algorithms in a web-based adaptive educational system. Teaching is based on interactive examples and exercises. Interactive examples, which use visualized animations to present AI search algorithms in a step-by-step way with explanations, are used to make learning more attractive. Practice…

  13. Artificial Intelligence (AI) in Healthcare Market: Market Trend with Boom Opportunities in Upcoming Years

    OpenAIRE

    Rahul Gautam

    2018-01-01

    The global artificial intelligence in healthcare market is expected to observe an extensive growth in the coming years, led by growing need for precision medicine, increasing application of big data in healthcare industry, and rising need for coordination between healthcare workforce and patients. The products in the global market are categorized as hardware, software and services, with software being the largest contributor in 2016 and the category is also projected to witness significant gr...

  14. PERFORMANCE ANALYSIS OF AI BASED QOS SCHEDULER FOR MOBILE WIMAX

    Directory of Open Access Journals (Sweden)

    D. David Neels Pon Kumar

    2012-09-01

    Full Text Available Interest in broadband wireless access (BWA has been growing due to increased user mobility and the need for data access at all times. IEEE 802.16e based WiMAX networks promise the best available quality of experience for mobile data service users. WiMAX networks incorporate several Quality of Service (QoS mechanisms at the Media Access Control (MAC level for guaranteed services for multimedia viz. data, voice and video. The problem of assuring QoS is how to allocate available resources among users to meet the QoS criteria such as delay, delay jitter, fairness and throughput requirements. IEEE standard does not include a standard scheduling mechanism and leaves it for various implementer differentiations. Although a lot of the real-time and non real-time packet scheduling schemes has been proposed, it needs to be modified to apply to Mobile WiMAX system that supports five kinds of service classes. In this paper, we propose a novel Priority based Scheduling scheme that uses Artificial Intelligence to support various services by considering the QoS constraints of each class. The simulation results show that slow mobility does not affect the performances and faster mobility and the increment in users beyond a particular load have their say in defining average throughput, average per user throughput, fairness index, average end to end delay and average delay jitter. Nevertheless the results are encouraging that the proposed scheme provides QoS support for each class efficiently.

  15. Machine intelligence and knowledge bases

    Energy Technology Data Exchange (ETDEWEB)

    Furukawa, K

    1981-09-01

    The basic functions necessary in machine intelligence are a knowledge base and a logic programming language such as PROLOG using deductive reasoning. Recently inductive reasoning based on meta knowledge and default reasoning have been developed. The creative thought model of Lenit is reviewed and the concept of knowledge engineering is introduced. 17 references.

  16. The application of AI-based refueling control system to the Fugen NPP

    International Nuclear Information System (INIS)

    Maeda, Koichi; Nakamura, Shinji; Kawasaki, Noboru; Nanko, Takashi; Nishimura, Hiroshi; Tanaka, Koichi

    1996-01-01

    In a refueling operation of the Advanced Thermal Reactor Fugen, it is essential to precisely handle fuel assemblies to guarantee quality and from the standpoint of safety guard. In order to plan and execute efficient operations, knowledge of experienced operators based on experiences is required. Therefore, an automatic control system based on the Artificial Intelligence (AI) technology has been developed, and has been put into operation in actual refueling operations. This system prepares an optimum refueling plan, controls the fuel handling facilities by that plan, displays and prints out the history of transfer and storage of items by automatically sampled data on a work station, a network to express fuel handling facilities and operational rules acquired through operating experiences. The development of this system has made it possible to optimize refueling schedule, save control labor of items and improve reliability of refueling. Firstly the development started the off-line system that prepares optimum refueling plan and gives to the operator step by step instructions for operation, secondly developed the on-line system that automatically controls facilities by that plan. The development of this system started in 1989, the off-line system has been put into practical operation in the 17th refueling in 1991, the 22nd (12th annual inspection) refueling in 1995 has been done by using the on-line system automatically

  17. Some applications of AI [Artificial Intelligence] to the problems of accelerator physics

    International Nuclear Information System (INIS)

    Higo, T.; Shoaee, H.; Spencer, J.E.

    1986-09-01

    Failure of orbit correction schemes to recognize betatron oscillation patterns obvious to any machine operator is a good problem with which to analyze the uses of Artificial Intelligence and the roles and relationships of operators, control systems and machines. Because such error modes are very common, their generalization could provide an efficient machine optimization and control strategy. A set of first-order, unitary transformations connecting canonical variables through measured results are defined which can either be compared to design for commissioning or to past results for 'golden orbit' operation. Because these relate directly to hardware variables, the method is simple, fast and direct. It has implications for machine design, controls, monitoring and feedback. Chronological analysis of such machine signatures can predict or provide a variety of information such as mean time to failure, failure modes and fast feedback or feedforward for optimizing figures of merit such as luminosity or current transmission. The use of theoretical and empirical scaling relations for such problems is discussed in terms of various figures of merit, the variables on which they depend as well as their functional dependences

  18. General general game AI

    OpenAIRE

    Togelius, Julian; Yannakakis, Georgios N.; 2016 IEEE Conference on Computational Intelligence and Games (CIG)

    2016-01-01

    Arguably the grand goal of artificial intelligence research is to produce machines with general intelligence: the capacity to solve multiple problems, not just one. Artificial intelligence (AI) has investigated the general intelligence capacity of machines within the domain of games more than any other domain given the ideal properties of games for that purpose: controlled yet interesting and computationally hard problems. This line of research, however, has so far focuse...

  19. Tweeting AI: Perceptions of AI-Tweeters (AIT) vs Expert AI-Tweeters (EAIT)

    OpenAIRE

    Manikonda, Lydia; Dudley, Cameron; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals started debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users from two categories -- general AI-Tweeters (AIT) and the expert AI-Tweeters (EAIT) who ...

  20. Experimental and AI-based numerical modeling of contaminant transport in porous media

    Science.gov (United States)

    Nourani, Vahid; Mousavi, Shahram; Sadikoglu, Fahreddin; Singh, Vijay P.

    2017-10-01

    This study developed a new hybrid artificial intelligence (AI)-meshless approach for modeling contaminant transport in porous media. The key innovation of the proposed approach is that both black box and physically-based models are combined for modeling contaminant transport. The effectiveness of the approach was evaluated using experimental and real world data. Artificial neural network (ANN) and adaptive neuro-fuzzy inference system (ANFIS) were calibrated to predict temporal contaminant concentrations (CCs), and the effect of noisy and de-noised data on the model performance was evaluated. Then, considering the predicted CCs at test points (TPs, in experimental study) and piezometers (in Myandoab plain) as interior conditions, the multiquadric radial basis function (MQ-RBF), as a meshless approach which solves partial differential equation (PDE) of contaminant transport in porous media, was employed to estimate the CC values at any point within the study area where there was no TP or piezometer. Optimal values of the dispersion coefficient in the advection-dispersion PDE and shape coefficient of MQ-RBF were determined using the imperialist competitive algorithm. In temporal contaminant transport modeling, de-noised data enhanced the performance of ANN and ANFIS methods in terms of the determination coefficient, up to 6 and 5%, respectively, in the experimental study and up to 39 and 18%, respectively, in the field study. Results showed that the efficiency of ANFIS-meshless model was more than ANN-meshless model up to 2 and 13% in the experimental and field studies, respectively.

  1. Discussion on AI Technology in Information Library Design

    OpenAIRE

    日比野, 省三; Shozo, HIBINO; 中京大学社会学部

    1987-01-01

    This paper deals with the discussion on the importance of AI (Artificial Intelligence) Technology in planning and designing a library information system in the near future. First of all, the history of Library and Information Science is reviewed and it is identified that the key technology in the future library will be AI as a mega-trend. After reviewing the concepts of AI technology, a model of a Knowledge-Base system is discussed as a case study, using micro-PROLOG.

  2. Applications of Artificial Intelligence in Education--A Personal View.

    Science.gov (United States)

    Richer, Mark H.

    1985-01-01

    Discusses: how artificial intelligence (AI) can advance education; if the future of software lies in AI; the roots of intelligent computer-assisted instruction; protocol analysis; reactive environments; LOGO programming language; student modeling and coaching; and knowledge-based instructional programs. Numerous examples of AI programs are cited.…

  3. Application of plausible reasoning to AI-based control systems

    Science.gov (United States)

    Berenji, Hamid; Lum, Henry, Jr.

    1987-01-01

    Some current approaches to plausible reasoning in artificial intelligence are reviewed and discussed. Some of the most significant recent advances in plausible and approximate reasoning are examined. A synergism among the techniques of uncertainty management is advocated, and brief discussions on the certainty factor approach, probabilistic approach, Dempster-Shafer theory of evidence, possibility theory, linguistic variables, and fuzzy control are presented. Some extensions to these methods are described, and the applications of the methods are considered.

  4. AI and health

    OpenAIRE

    Martin Anderson

    2018-01-01

    ntelligence refers to the ability of an individual to learn or understand something, or to deal with a new situation. When a machine or software exhibits such characteristics, it is referred to as artificial intelligence (AI). Artificial Intelligence is therefore defined as the theory and development of computer systems able to perform tasks that normally require human intelligence, such as visual perception, speech recognition, decision-making, and translation between languages.

  5. Intelligence in Artificial Intelligence

    OpenAIRE

    Datta, Shoumen Palit Austin

    2016-01-01

    The elusive quest for intelligence in artificial intelligence prompts us to consider that instituting human-level intelligence in systems may be (still) in the realm of utopia. In about a quarter century, we have witnessed the winter of AI (1990) being transformed and transported to the zenith of tabloid fodder about AI (2015). The discussion at hand is about the elements that constitute the canonical idea of intelligence. The delivery of intelligence as a pay-per-use-service, popping out of ...

  6. Artificial Intelligence-Based Semantic Internet of Things in a User-Centric Smart City

    Science.gov (United States)

    Guo, Kun; Lu, Yueming; Gao, Hui; Cao, Ruohan

    2018-01-01

    Smart city (SC) technologies can provide appropriate services according to citizens’ demands. One of the key enablers in a SC is the Internet of Things (IoT) technology, which enables a massive number of devices to connect with each other. However, these devices usually come from different manufacturers with different product standards, which confront interactive control problems. Moreover, these devices will produce large amounts of data, and efficiently analyzing these data for intelligent services. In this paper, we propose a novel artificial intelligence-based semantic IoT (AI-SIoT) hybrid service architecture to integrate heterogeneous IoT devices to support intelligent services. In particular, the proposed architecture is empowered by semantic and AI technologies, which enable flexible connections among heterogeneous devices. The AI technology can support very implement efficient data analysis and make accurate decisions on service provisions in various kinds. Furthermore, we also present several practical use cases of the proposed AI-SIoT architecture and the opportunities and challenges to implement the proposed AI-SIoT for future SCs are also discussed. PMID:29701679

  7. Artificial Intelligence-Based Semantic Internet of Things in a User-Centric Smart City

    Directory of Open Access Journals (Sweden)

    Kun Guo

    2018-04-01

    Full Text Available Smart city (SC technologies can provide appropriate services according to citizens’ demands. One of the key enablers in a SC is the Internet of Things (IoT technology, which enables a massive number of devices to connect with each other. However, these devices usually come from different manufacturers with different product standards, which confront interactive control problems. Moreover, these devices will produce large amounts of data, and efficiently analyzing these data for intelligent services. In this paper, we propose a novel artificial intelligence-based semantic IoT (AI-SIoT hybrid service architecture to integrate heterogeneous IoT devices to support intelligent services. In particular, the proposed architecture is empowered by semantic and AI technologies, which enable flexible connections among heterogeneous devices. The AI technology can support very implement efficient data analysis and make accurate decisions on service provisions in various kinds. Furthermore, we also present several practical use cases of the proposed AI-SIoT architecture and the opportunities and challenges to implement the proposed AI-SIoT for future SCs are also discussed.

  8. Artificial Intelligence-Based Semantic Internet of Things in a User-Centric Smart City.

    Science.gov (United States)

    Guo, Kun; Lu, Yueming; Gao, Hui; Cao, Ruohan

    2018-04-26

    Smart city (SC) technologies can provide appropriate services according to citizens’ demands. One of the key enablers in a SC is the Internet of Things (IoT) technology, which enables a massive number of devices to connect with each other. However, these devices usually come from different manufacturers with different product standards, which confront interactive control problems. Moreover, these devices will produce large amounts of data, and efficiently analyzing these data for intelligent services. In this paper, we propose a novel artificial intelligence-based semantic IoT (AI-SIoT) hybrid service architecture to integrate heterogeneous IoT devices to support intelligent services. In particular, the proposed architecture is empowered by semantic and AI technologies, which enable flexible connections among heterogeneous devices. The AI technology can support very implement efficient data analysis and make accurate decisions on service provisions in various kinds. Furthermore, we also present several practical use cases of the proposed AI-SIoT architecture and the opportunities and challenges to implement the proposed AI-SIoT for future SCs are also discussed.

  9. An Energy Dense-AI-NaBH4-PEMFC Based Power Generator for Unmanned Undersea Vehicles

    Science.gov (United States)

    2016-03-01

    From- To) 03/01/2016 Final 01/28/2013-12/31/2015 4. TITLE AND SUBTITLE Sa. CONTRACT NUMBER An Energy-Dense AI-NaBH4- PEMFC Based Power Generator for...combination of polymer electrolyte membrane fuel cell ( PEMFC ) with a compact hydrogen generator util izing AI-NaBH4 composite fuel. The conditions...ANSI Std. Z39.18 FLORIDA SOLAR ENERGY CENTER. Crl’nrmg EnPrgy lnrll’pendrnr£’ An Energy-Dense Al-NaBH4- PEMFC Based Power Generator for Unmanned

  10. An analysis of the application of AI to the development of intelligent aids for flight crew tasks

    Science.gov (United States)

    Baron, S.; Feehrer, C.

    1985-01-01

    This report presents the results of a study aimed at developing a basis for applying artificial intelligence to the flight deck environment of commercial transport aircraft. In particular, the study was comprised of four tasks: (1) analysis of flight crew tasks, (2) survey of the state-of-the-art of relevant artificial intelligence areas, (3) identification of human factors issues relevant to intelligent cockpit aids, and (4) identification of artificial intelligence areas requiring further research.

  11. An AI-based layout design system for nuclear power plants

    International Nuclear Information System (INIS)

    Fujita, Kikuo; Akagi, Shinsuke; Nakatogawa, Tetsundo; Tanaka, Kazuo; Takeuchi, Makoto.

    1991-01-01

    An AI-based layout design system for nuclear power plants has been developed. The design of the layout of nuclear power plants is a time-consuming task requiring expertise, in which a lot of machinery and equipment must be arranged in a plant building considering various kinds of design constraints, i.e. spatial, functional, economical etc. Computer aided layout design systems have been widely expected and the application of AI technology is expected as a promising approach for the synthesis phase of this task. In this paper, we present an approach to the layout design of nuclear power plants based on a constraint-directed search; one of the AI techniques. In addition, we show how it was implemented with an object-oriented programming technique and give an example of its application. (author)

  12. Modeling Progress in AI

    OpenAIRE

    Brundage, Miles

    2015-01-01

    Participants in recent discussions of AI-related issues ranging from intelligence explosion to technological unemployment have made diverse claims about the nature, pace, and drivers of progress in AI. However, these theories are rarely specified in enough detail to enable systematic evaluation of their assumptions or to extrapolate progress quantitatively, as is often done with some success in other technological domains. After reviewing relevant literatures and justifying the need for more ...

  13. Students’ thinking level based on intrapersonal intelligence

    Science.gov (United States)

    Sholikhati, Rahadian; Mardiyana; Retno Sari Saputro, Dewi

    2017-12-01

    This research aims to determine the students’ thinking level based on bloom taxonomy guidance and reviewed from students' Intrapersonal Intelligence. Taxonomy bloom is a taxonomy that classifies the students' thinking level into six, ie the remembering, understanding, applying, analyzing, creating, and evaluating levels. Students' Intrapersonal Intelligence is the intelligence associated with awareness and knowledge of oneself. The type of this research is descriptive research with qualitative approach. The research subject were taken by one student in each Intrapersonal Intelligence category (high, moderate, and low) which then given the problem solving test and the result was triangulated by interview. From this research, it is found that high Intrapersonal Intelligence students can achieve analyzing thinking level, subject with moderate Intrapersonal Intelligence being able to reach the level of applying thinking, and subject with low Intrapersonal Intelligence able to reach understanding level.

  14. MTK: An AI tool for model-based reasoning

    Science.gov (United States)

    Erickson, William K.; Schwartz, Mary R.

    1987-01-01

    A 1988 goal for the Systems Autonomy Demonstration Project Office of the NASA Ames Research Center is to apply model-based representation and reasoning techniques in a knowledge-based system that will provide monitoring, fault diagnosis, control and trend analysis of the space station Thermal Management System (TMS). A number of issues raised during the development of the first prototype system inspired the design and construction of a model-based reasoning tool called MTK, which was used in the building of the second prototype. These issues are outlined, along with examples from the thermal system to highlight the motivating factors behind them. An overview of the capabilities of MTK is given.

  15. SMARTER THAN YOUR AVERAGE SENSOR: AIS SENSOR THAT INTELLIGENTLY RE-TRANSMITS MEANINGFUL INFORMATION DERIVED FROM RAWAIS DATA IN NETWORK LIMITED AREAS

    Directory of Open Access Journals (Sweden)

    R. G. V. Meyer

    2017-11-01

    Full Text Available AIS is a transponder based, anti-collision system used by the majority of ocean traffic. Ships regularly transmit their identity, position and speed. The information used to populate the AIS fields come from ship based sensors, such as GPS, and user populated fields, such as the vessels name and MMSI number. These fields are susceptible to spoofing and can be changed to hide the identity or location of a vessel. This is often done to disguise the vessel as a different class to avoid inspections or to enter a protected area without raising alarms. The AIS system has found great utility in monitoring global shipping trends and traffic but this was never intended when the protocol was designed. Docked vessels still transmit messages regularly that contain no new information. These, and other redundant messages, are still transmitted and stored. In situations where a sensor is remote and has limited access to the Internet this can become costly. The Smart-AIS sensor records all incoming messages locally and makes a decision on whether the message is of special interest or not. Messages of interest are re-transmitted to an external AIS database.

  16. AI applications in sheet metal forming

    CERN Document Server

    Hussein, Hussein

    2017-01-01

    This book comprises chapters on research work done around the globe in the area of artificial intelligence (AI) applications in sheet metal forming. The first chapter offers an introduction to various AI techniques and sheet metal forming, while subsequent chapters describe traditional procedures/methods used in various sheet metal forming processes, and focus on the automation of those processes by means of AI techniques, such as KBS, ANN, GA, CBR, etc. Feature recognition and the manufacturability assessment of sheet metal parts, process planning, strip-layout design, selecting the type and size of die components, die modeling, and predicting die life are some of the most important aspects of sheet metal work. Traditionally, these activities are highly experience-based, tedious and time consuming. In response, researchers in several countries have applied various AI techniques to automate these activities, which are covered in this book. This book will be useful for engineers working in sheet metal industri...

  17. Beyond AI: Artificial Dreams Conference

    CERN Document Server

    Zackova, Eva; Kelemen, Jozef; Beyond Artificial Intelligence : The Disappearing Human-Machine Divide

    2015-01-01

    This book is an edited collection of chapters based on the papers presented at the conference “Beyond AI: Artificial Dreams” held in Pilsen in November 2012. The aim of the conference was to question deep-rooted ideas of artificial intelligence and cast critical reflection on methods standing at its foundations.  Artificial Dreams epitomize our controversial quest for non-biological intelligence, and therefore the contributors of this book tried to fully exploit such a controversy in their respective chapters, which resulted in an interdisciplinary dialogue between experts from engineering, natural sciences and humanities.   While pursuing the Artificial Dreams, it has become clear that it is still more and more difficult to draw a clear divide between human and machine. And therefore this book tries to portrait such an image of what lies beyond artificial intelligence: we can see the disappearing human-machine divide, a very important phenomenon of nowadays technological society, the phenomenon which i...

  18. DESIGNING AI TEACHER ASSISTANT ON ONLINE-COURSE BASED ON WORD2VEC TECHNOLOGY

    Directory of Open Access Journals (Sweden)

    Pavel Aleksandrovich Rozhkin

    2018-05-01

    Full Text Available The purpose of this work is to develop an AI teacher assistant, who can find answers to online course participants questions among answers previously published at the training forum. Currently, there are already successful experiments on the use of artificial intelligence systems (IBM WATSON in online training. In this paper, we investigate the possibility of constructing such a system using word2vec technology. A two-stage method for finding an answer to a question is constructed. Method use word2vec technology for vector representation of questions and answers. At the first stage, the subject matter of the issue is determined and, if it corresponds to the theme of the forum, then the articles most relevant to the question are searched. A real situation was simulated with 16 themes and 80 answers to possible questions within the section of the online course “Linear Algebra and Geometry”. The question-answer system was designed and its performance was evaluated. The parameters have been chosen to achieve the best result. In 83% of the cases, the relevant answer to the formulated question was contained among the top 3 responses that the system offered. The issues of further development of applied approaches and increasing utility of the constructed question-answer system are considered. Purpose: developing an AI teacher assistant, who can find answers to online course participants questions among answers previously published at the training forum. Methodology: vectorization of questions and answers, neural network classification of the subject matter, construction of the answers rating. Results: acceptable accuracy in finding a relevant answer to a question are received. Practical implications: The results of the research can be used as a basis for designing an AI teacher assistant in online courses.

  19. Artificial intelligence based models for stream-flow forecasting: 2000-2015

    Science.gov (United States)

    Yaseen, Zaher Mundher; El-shafie, Ahmed; Jaafar, Othman; Afan, Haitham Abdulmohsin; Sayl, Khamis Naba

    2015-11-01

    The use of Artificial Intelligence (AI) has increased since the middle of the 20th century as seen in its application in a wide range of engineering and science problems. The last two decades, for example, has seen a dramatic increase in the development and application of various types of AI approaches for stream-flow forecasting. Generally speaking, AI has exhibited significant progress in forecasting and modeling non-linear hydrological applications and in capturing the noise complexity in the dataset. This paper explores the state-of-the-art application of AI in stream-flow forecasting, focusing on defining the data-driven of AI, the advantages of complementary models, as well as the literature and their possible future application in modeling and forecasting stream-flow. The review also identifies the major challenges and opportunities for prospective research, including, a new scheme for modeling the inflow, a novel method for preprocessing time series frequency based on Fast Orthogonal Search (FOS) techniques, and Swarm Intelligence (SI) as an optimization approach.

  20. How People Interact with Technology based on Natural and Artificial Intelligence

    Directory of Open Access Journals (Sweden)

    Vasile MAZILESCU

    2017-04-01

    Full Text Available This paper aims to analyse the different forms of intelligence within organizations in a systemic and inclusive vision, in order to design an integrated environment based on Artificial Intelligence (AI and Collective Intelligence (CI. This way we effectively shift the classical approaches of connecting people with people using collaboration tools (which allow people to work together, such as videoconferencing or email, groupware in virtual space, forums, workflow, of connecting people with a series of content management knowledge (taxonomies and documents classification, ontologies or thesauri, search engines, portals, to the current approaches of connecting people on the use (automatic of operational knowledge to solve problems and make decisions based on intellectual cooperation. Few technologies have the big potential to review how we live, move, and work. Artificial intelligence (AI is nowdays equivalent of electricity and the Internet. AI is expected to bring massive shifts in how people perceive and interact with technology, with machines performing a wider range of tasks, in many cases doing a better job than humans.

  1. Artificial-intelligence-based optimization of the management of snow removal assets and resources.

    Science.gov (United States)

    2002-10-01

    Geographic information systems (GIS) and artificial intelligence (AI) techniques were used to develop an intelligent : snow removal asset management system (SRAMS). The system has been evaluated through a case study examining : snow removal from the ...

  2. Introducing AI into MEMS can lead us to brain-computer interfaces and super-human intelligence

    OpenAIRE

    Sanders, David

    2009-01-01

    Last year, I spoke about the progress being made in machine intelligence (Sanders, 2008c) and with sensors and networks of sensors (Sanders, 2008b). Earlier this year (in this journal) I spoke about ambient-intelligence, rapid-prototyping and the role of humans in the factories of the future (Sanders, 2009a). I addressed new applications and technologies such as merging machines with human beings, micro-electromechanics, electro-mechanical systems that can be personalized, smarter than human ...

  3. Intelligent interaction based on holographic personalized portal

    Directory of Open Access Journals (Sweden)

    Yadong Huang

    2017-06-01

    Full Text Available Purpose – The purpose of this paper is to study the architecture of holographic personalized portal, user modeling, commodity modeling and intelligent interaction. Design/methodology/approach – In this paper, the authors propose crowd-science industrial ecological system based on holographic personalized portal and its interaction. The holographic personality portal is based on holographic enterprises, commodities and consumers, and the personalized portal consists of accurate ontology, reliable supply, intelligent demand and smart cyberspace. Findings – The personalized portal can realize the information acquisition, characteristic analysis and holographic presentation. Then, the intelligent interaction, e.g. demand decomposition, personalized search, personalized presentation and demand prediction, will be implemented within the personalized portal. Originality/value – The authors believe that their work on intelligent interaction based on holographic personalized portal, which has been first proposed in this paper, is innovation focusing on the interaction between intelligence and convenience.

  4. Knowledge Discovery, Integration and Communication for Extreme Weather and Flood Resilience Using Artificial Intelligence: Flood AI Alpha

    Science.gov (United States)

    Demir, I.; Sermet, M. Y.

    2016-12-01

    Nobody is immune from extreme events or natural hazards that can lead to large-scale consequences for the nation and public. One of the solutions to reduce the impacts of extreme events is to invest in improving resilience with the ability to better prepare, plan, recover, and adapt to disasters. The National Research Council (NRC) report discusses the topic of how to increase resilience to extreme events through a vision of resilient nation in the year 2030. The report highlights the importance of data, information, gaps and knowledge challenges that needs to be addressed, and suggests every individual to access the risk and vulnerability information to make their communities more resilient. This abstracts presents our project on developing a resilience framework for flooding to improve societal preparedness with objectives; (a) develop a generalized ontology for extreme events with primary focus on flooding; (b) develop a knowledge engine with voice recognition, artificial intelligence, natural language processing, and inference engine. The knowledge engine will utilize the flood ontology and concepts to connect user input to relevant knowledge discovery outputs on flooding; (c) develop a data acquisition and processing framework from existing environmental observations, forecast models, and social networks. The system will utilize the framework, capabilities and user base of the Iowa Flood Information System (IFIS) to populate and test the system; (d) develop a communication framework to support user interaction and delivery of information to users. The interaction and delivery channels will include voice and text input via web-based system (e.g. IFIS), agent-based bots (e.g. Microsoft Skype, Facebook Messenger), smartphone and augmented reality applications (e.g. smart assistant), and automated web workflows (e.g. IFTTT, CloudWork) to open the knowledge discovery for flooding to thousands of community extensible web workflows.

  5. Speech Intelligibility Prediction Based on Mutual Information

    DEFF Research Database (Denmark)

    Jensen, Jesper; Taal, Cees H.

    2014-01-01

    This paper deals with the problem of predicting the average intelligibility of noisy and potentially processed speech signals, as observed by a group of normal hearing listeners. We propose a model which performs this prediction based on the hypothesis that intelligibility is monotonically related...... to the mutual information between critical-band amplitude envelopes of the clean signal and the corresponding noisy/processed signal. The resulting intelligibility predictor turns out to be a simple function of the mean-square error (mse) that arises when estimating a clean critical-band amplitude using...... a minimum mean-square error (mmse) estimator based on the noisy/processed amplitude. The proposed model predicts that speech intelligibility cannot be improved by any processing of noisy critical-band amplitudes. Furthermore, the proposed intelligibility predictor performs well ( ρ > 0.95) in predicting...

  6. Business intelligence and capacity planning: web-based solutions.

    Science.gov (United States)

    James, Roger

    2010-07-01

    Income (activity) and expenditure (costs) form the basis of a modern hospital's 'business intelligence'. However, clinical engagement in business intelligence is patchy. This article describes the principles of business intelligence and outlines some recent developments using web-based applications.

  7. Interactive analysis of geodata based intelligence

    Science.gov (United States)

    Wagner, Boris; Eck, Ralf; Unmüessig, Gabriel; Peinsipp-Byma, Elisabeth

    2016-05-01

    When a spatiotemporal events happens, multi-source intelligence data is gathered to understand the problem, and strategies for solving the problem are investigated. The difficulties arising from handling spatial and temporal intelligence data represent the main problem. The map might be the bridge to visualize the data and to get the most understand model for all stakeholders. For the analysis of geodata based intelligence data, a software was developed as a working environment that combines geodata with optimized ergonomics. The interaction with the common operational picture (COP) is so essentially facilitated. The composition of the COP is based on geodata services, which are normalized by international standards of the Open Geospatial Consortium (OGC). The basic geodata are combined with intelligence data from images (IMINT) and humans (HUMINT), stored in a NATO Coalition Shared Data Server (CSD). These intelligence data can be combined with further information sources, i.e., live sensors. As a result a COP is generated and an interaction suitable for the specific workspace is added. This allows the users to work interactively with the COP, i.e., searching with an on board CSD client for suitable intelligence data and integrate them into the COP. Furthermore, users can enrich the scenario with findings out of the data of interactive live sensors and add data from other sources. This allows intelligence services to contribute effectively to the process by what military and disaster management are organized.

  8. Expectation-based intelligent control

    International Nuclear Information System (INIS)

    Zak, Michail

    2006-01-01

    New dynamics paradigms-negative diffusion and terminal attractors-are introduced to control noise and chaos. The applied control forces are composed of expectations governed by the associated Fokker-Planck and Liouville equations. The approach is expanded to a general concept of intelligent control via expectations. Relevance to control in livings is emphasized and illustrated by neural nets with mirror neurons

  9. Multiple Intelligences - Based Planning of EFL Classes

    Directory of Open Access Journals (Sweden)

    Sanan Shero Malo Zebari

    2018-04-01

    Full Text Available The present study aimed to set a plan for teaching EFL classes based on the identification of university students’ dominant multiple intelligences in EFL classes, and the differences in the types of intelligence between female and male students in terms of their gender. The problem the present study aimed to address is that the traditional concept that “one size fits all” is still adopted by many EFL teachers, and that EFL students’ differences and preferences are noticeably unheeded. It is believed that identifying students’ dominant intelligences is a sound remedial solution for such a problem before embarking on any teaching program. Moreover, getting students aware of their different types of intelligence will motivate and encourage them in the classroom. The researchers used a questionnaire as a research instrument for data collection.  The results arrived at showed that there were no significant differences in the types of intelligence between female and male students in terms of their gender, except for bodily- kinesthetic intelligence. They also showed that the dominant intelligences were ranked from the highest to the lowest as follows interpersonal, linguistic, spatial, logical-mathematical, bodily kinesthetic, intrapersonal, musical, and naturalistic.

  10. AIS authentication

    CERN Multimedia

    2006-01-01

    Users are invited to use the NICE password for AIS authentication. As announced in CNL June-August 2006 (see http://www.cerncourier.com/articles/cnl/3/6/14/1) it is possible to use the NICE username and password to log on to AIS. The procedure is now fully operational and users can themselves reset the AIS password such that the NICE password will be used for authentication required by AIS applications. We strongly recommend CERN users who have a NICE account (this is the case of most users) to do this, with the objective to reduce the number of passwords they need to remember. This can be achieved very easily, directly from the Change Password option on the AIS login (https://aislogin.cern.ch/). Users should just select the '[Change Password]' option displayed at the bottom of the page, provide the 'Old Password' and then click on the button 'Use Nice password' followed by 'Submit'. Change Password option on the AIS login windowSetting the AIS password - Use Nice Password It should be noted that the proce...

  11. The Use of Artificial-Intelligence-Based Ensembles for Intrusion Detection: A Review

    Directory of Open Access Journals (Sweden)

    Gulshan Kumar

    2012-01-01

    Full Text Available In supervised learning-based classification, ensembles have been successfully employed to different application domains. In the literature, many researchers have proposed different ensembles by considering different combination methods, training datasets, base classifiers, and many other factors. Artificial-intelligence-(AI- based techniques play prominent role in development of ensemble for intrusion detection (ID and have many benefits over other techniques. However, there is no comprehensive review of ensembles in general and AI-based ensembles for ID to examine and understand their current research status to solve the ID problem. Here, an updated review of ensembles and their taxonomies has been presented in general. The paper also presents the updated review of various AI-based ensembles for ID (in particular during last decade. The related studies of AI-based ensembles are compared by set of evaluation metrics driven from (1 architecture & approach followed; (2 different methods utilized in different phases of ensemble learning; (3 other measures used to evaluate classification performance of the ensembles. The paper also provides the future directions of the research in this area. The paper will help the better understanding of different directions in which research of ensembles has been done in general and specifically: field of intrusion detection systems (IDSs.

  12. Modeling river total bed material load discharge using artificial intelligence approaches (based on conceptual inputs)

    Science.gov (United States)

    Roushangar, Kiyoumars; Mehrabani, Fatemeh Vojoudi; Shiri, Jalal

    2014-06-01

    This study presents Artificial Intelligence (AI)-based modeling of total bed material load through developing the accuracy level of the predictions of traditional models. Gene expression programming (GEP) and adaptive neuro-fuzzy inference system (ANFIS)-based models were developed and validated for estimations. Sediment data from Qotur River (Northwestern Iran) were used for developing and validation of the applied techniques. In order to assess the applied techniques in relation to traditional models, stream power-based and shear stress-based physical models were also applied in the studied case. The obtained results reveal that developed AI-based models using minimum number of dominant factors, give more accurate results than the other applied models. Nonetheless, it was revealed that k-fold test is a practical but high-cost technique for complete scanning of applied data and avoiding the over-fitting.

  13. AI and Mathematical Education

    Directory of Open Access Journals (Sweden)

    Angel Garrido

    2012-01-01

    Full Text Available From ancient times, the history of human beings has developed by a succession of steps and sometimes jumps, until reaching the relative sophistication of the modern brain and culture. Researchers are attempting to create systems that mimic human thinking, understand speech, or beat the best human chess player. Understanding the mechanisms of intelligence, and creating intelligent artifacts are the twin goals of Artificial Intelligence (AI. Great mathematical minds have played a key role in AI in recent years; to name only a few: Janos Neumann (also known as John von Neumann, Konrad Zuse, Norbert Wiener, Claude E. Shannon, Alan M. Turing, Grigore Moisil, Lofti A. Zadeh, Ronald R. Yager, Michio Sugeno, Solomon Marcus, or Lászlo A. Barabási. Introducing the study of AI is not merely useful because of its capability for solving difficult problems, but also because of its mathematical nature. It prepares us to understand the current world, enabling us to act on the challenges of the future.

  14. The handbook of artificial intelligence

    CERN Document Server

    Barr, Avron

    1982-01-01

    The Handbook of Artificial Intelligence, Volume II focuses on the improvements in artificial intelligence (AI) and its increasing applications, including programming languages, intelligent CAI systems, and the employment of AI in medicine, science, and education. The book first elaborates on programming languages for AI research and applications-oriented AI research. Discussions cover scientific applications, teiresias, applications in chemistry, dependencies and assumptions, AI programming-language features, and LISP. The manuscript then examines applications-oriented AI research in medicine

  15. Essentials of artificial intelligence

    CERN Document Server

    Ginsberg, Matt

    1993-01-01

    Since its publication, Essentials of Artificial Intelligence has beenadopted at numerous universities and colleges offering introductory AIcourses at the graduate and undergraduate levels. Based on the author'scourse at Stanford University, the book is an integrated, cohesiveintroduction to the field. The author has a fresh, entertaining writingstyle that combines clear presentations with humor and AI anecdotes. At thesame time, as an active AI researcher, he presents the materialauthoritatively and with insight that reflects a contemporary, first hand

  16. Intelligible Artificial Intelligence

    OpenAIRE

    Weld, Daniel S.; Bansal, Gagan

    2018-01-01

    Since Artificial Intelligence (AI) software uses techniques like deep lookahead search and stochastic optimization of huge neural networks to fit mammoth datasets, it often results in complex behavior that is difficult for people to understand. Yet organizations are deploying AI algorithms in many mission-critical settings. In order to trust their behavior, we must make it intelligible --- either by using inherently interpretable models or by developing methods for explaining otherwise overwh...

  17. Enabling technologies and methods for the retro-fitting of AI software into NPPS

    International Nuclear Information System (INIS)

    Pymm, P.

    1994-01-01

    Scottish Nuclear have a number of plant monitoring and training applications at their operational nuclear power plant which could benefit from the introduction of artificial intelligence (AI) software. An outline of early work on two current AI developments in the areas of advanced operator aids and intelligent training is given. A generic workstation based engineering simulator (WES) which provides a prototyping environment for AI product application development and evaluation and development of human-computer interface (HCI) designs for plant installation is described. It is concluded that the WES architecture facilitates both migration of the prototype AI application to the plant and collaboration in the AI field between Scottish Nuclear and other organizations. (author). 1 ref., 6 figs

  18. Citadels AI

    OpenAIRE

    Pekárek, Jakub

    2015-01-01

    The aim of this thesis is to implement a playable version of the game Citadels with console interface, and to use it for analysis of the game's properties and development of artificial intelligence. This thesis includes an analysis of strategies, a scheme for their design, an organization of turn processing, a model of intelligence implementation and testing tools. A number of approaches to specific moves have been developed, all of which achieved positive impact on overall intelligence perfo...

  19. Reviewing the development of an artificial intelligence based risk program

    International Nuclear Information System (INIS)

    Dixon, B.W.; Hinton, M.F.

    1985-01-01

    A successful application of nonconventional programming methods has been achieved in computer-assisted probabilistic risk assessment (PRA). The event tree sequence importance calculator, SQUIMP, provides for prompted data entry, generic expansion, on-line pruning, boolean reductions, and importance factor selection. SQUIMP employs constructs typically found in artificial intelligence (AI) programs. The development history of SQUIMP is outlined and its internal structure described as background for a discussion on the applicability of symbolic programming methods in PRA

  20. Artificial intelligence approaches to astronomical observation scheduling

    Science.gov (United States)

    Johnston, Mark D.; Miller, Glenn

    1988-01-01

    Automated scheduling will play an increasing role in future ground- and space-based observatory operations. Due to the complexity of the problem, artificial intelligence technology currently offers the greatest potential for the development of scheduling tools with sufficient power and flexibility to handle realistic scheduling situations. Summarized here are the main features of the observatory scheduling problem, how artificial intelligence (AI) techniques can be applied, and recent progress in AI scheduling for Hubble Space Telescope.

  1. Adding intelligence to scientific data management

    Science.gov (United States)

    Campbell, William J.; Short, Nicholas M., Jr.; Treinish, Lloyd A.

    1989-01-01

    NASA plans to solve some of the problems of handling large-scale scientific data bases by turning to artificial intelligence (AI) are discussed. The growth of the information glut and the ways that AI can help alleviate the resulting problems are reviewed. The employment of the Intelligent User Interface prototype, where the user will generate his own natural language query with the assistance of the system, is examined. Spatial data management, scientific data visualization, and data fusion are discussed.

  2. Coupling artificial intelligence and numerical computation for engineering design (Invited paper)

    Science.gov (United States)

    Tong, S. S.

    1986-01-01

    The possibility of combining artificial intelligence (AI) systems and numerical computation methods for engineering designs is considered. Attention is given to three possible areas of application involving fan design, controlled vortex design of turbine stage blade angles, and preliminary design of turbine cascade profiles. Among the AI techniques discussed are: knowledge-based systems; intelligent search; and pattern recognition systems. The potential cost and performance advantages of an AI-based design-generation system are discussed in detail.

  3. Intelligent Lighting Control System

    OpenAIRE

    García, Elena; Rodríguez González, Sara; de Paz Santana, Juan F.; Bajo Pérez, Javier

    2014-01-01

    This paper presents an adaptive architecture that allows centralized control of public lighting and intelligent management, in order to economise on lighting and maintain maximum comfort status of the illuminated areas. To carry out this management, architecture merges various techniques of artificial intelligence (AI) and statistics such as artificial neural networks (ANN), multi-agent systems (MAS), EM algorithm, methods based on ANOVA and a Service Oriented Aproach (SOA). It performs optim...

  4. Comparative performance analysis of the artificial-intelligence-based thermal control algorithms for the double-skin building

    International Nuclear Information System (INIS)

    Moon, Jin Woo

    2015-01-01

    This study aimed at developing artificial-intelligence-(AI)-theory-based optimal control algorithms for improving the indoor temperature conditions and heating energy efficiency of the double-skin buildings. For this, one conventional rule-based and four AI-based algorithms were developed, including artificial neural network (ANN), fuzzy logic (FL), and adaptive neuro fuzzy inference systems (ANFIS), for operating the surface openings of the double skin and the heating system. A numerical computer simulation method incorporating the matrix laboratory (MATLAB) and the transient systems simulation (TRNSYS) software was used for the comparative performance tests. The analysis results revealed that advanced thermal-environment comfort and stability can be provided by the AI-based algorithms. In particular, the FL and ANFIS algorithms were superior to the ANN algorithm in terms of providing better thermal conditions. The ANN-based algorithm, however, proved its potential to be the most energy-efficient and stable strategy among the four AI-based algorithms. It can be concluded that the optimal algorithm can be differently determined according to the major focus of the strategy. If comfortable thermal condition is the principal interest, then the FL or ANFIS algorithm could be the proper solution, and if energy saving for space heating and system operation stability is the main concerns, then the ANN-based algorithm may be applicable. - Highlights: • Integrated control algorithms were developed for the heating system and surface openings. • AI theories were applied to the control algorithms. • ANN, FL, and ANFIS were the applied AI theories. • Comparative performance tests were conducted using computer simulation. • AI algorithms presented superior temperature environment.

  5. Towards Brain-inspired Web Intelligence

    Science.gov (United States)

    Zhong, Ning

    Artificial Intelligence (AI) has been mainly studied within the realm of computer based technologies. Various computational models and knowledge based systems have been developed for automated reasoning, learning, and problem-solving. However, there still exist several grand challenges. The AI research has not produced major breakthrough recently due to a lack of understanding of human brains and natural intelligence. In addition, most of the AI models and systems will not work well when dealing with large-scale, dynamically changing, open and distributed information sources at a Web scale.

  6. The potential of artificial intelligence toys

    DEFF Research Database (Denmark)

    Dai, Zheng

    2008-01-01

    Artificial intelligence is moving to a next step of development and application areas. From electronic games to human-like robots, AI toy is a good choice for next step during this process. Technology-based design is fit to the development of AI toy. It can exert the advantages and explore more...... value for existing resources. It combines AI programs and common sensors to realize the function of intelligence input and output. Designers can use technology-based criteria to design and need to consider the possible issues in this new field. All of these aspects can be referenced from electronic game...

  7. AiGERM: A logic programming front end for GERM

    Science.gov (United States)

    Hashim, Safaa H.

    1990-01-01

    AiGerm (Artificially Intelligent Graphical Entity Relation Modeler) is a relational data base query and programming language front end for MCC (Mission Control Center)/STP's (Space Test Program) Germ (Graphical Entity Relational Modeling) system. It is intended as an add-on component of the Germ system to be used for navigating very large networks of information. It can also function as an expert system shell for prototyping knowledge-based systems. AiGerm provides an interface between the programming language and Germ.

  8. Automated diabetic retinopathy detection in smartphone-based fundus photography using artificial intelligence.

    Science.gov (United States)

    Rajalakshmi, Ramachandran; Subashini, Radhakrishnan; Anjana, Ranjit Mohan; Mohan, Viswanathan

    2018-06-01

    To assess the role of artificial intelligence (AI)-based automated software for detection of diabetic retinopathy (DR) and sight-threatening DR (STDR) by fundus photography taken using a smartphone-based device and validate it against ophthalmologist's grading. Three hundred and one patients with type 2 diabetes underwent retinal photography with Remidio 'Fundus on phone' (FOP), a smartphone-based device, at a tertiary care diabetes centre in India. Grading of DR was performed by the ophthalmologists using International Clinical DR (ICDR) classification scale. STDR was defined by the presence of severe non-proliferative DR, proliferative DR or diabetic macular oedema (DME). The retinal photographs were graded using a validated AI DR screening software (EyeArt TM ) designed to identify DR, referable DR (moderate non-proliferative DR or worse and/or DME) or STDR. The sensitivity and specificity of automated grading were assessed and validated against the ophthalmologists' grading. Retinal images of 296 patients were graded. DR was detected by the ophthalmologists in 191 (64.5%) and by the AI software in 203 (68.6%) patients while STDR was detected in 112 (37.8%) and 146 (49.3%) patients, respectively. The AI software showed 95.8% (95% CI 92.9-98.7) sensitivity and 80.2% (95% CI 72.6-87.8) specificity for detecting any DR and 99.1% (95% CI 95.1-99.9) sensitivity and 80.4% (95% CI 73.9-85.9) specificity in detecting STDR with a kappa agreement of k = 0.78 (p < 0.001) and k = 0.75 (p < 0.001), respectively. Automated AI analysis of FOP smartphone retinal imaging has very high sensitivity for detecting DR and STDR and thus can be an initial tool for mass retinal screening in people with diabetes.

  9. Towards a science of integrated AI and Robotics

    OpenAIRE

    Rajan, Kanna; Saffiotti, Alessandro

    2017-01-01

    The early promise of the impact of machine intelligence did not involve the partitioning of the nascent field of Artificial Intelligence. The founders of AI envisioned the notion of embedded intelligence as being conjoined between perception, reasoning and actuation. Yet over the years the fields of AI and Robotics drifted apart. Practitioners of AI focused on problems and algorithms abstracted from the real world. Roboticists, generally with a background in mechanical and electrical engineer...

  10. High-spatiotemporal-resolution ship emission inventory of China based on AIS data in 2014.

    Science.gov (United States)

    Chen, Dongsheng; Wang, Xiaotong; Li, Yue; Lang, Jianlei; Zhou, Ying; Guo, Xiurui; Zhao, Yuehua

    2017-12-31

    Ship exhaust emissions have been considered a significant source of air pollution, with adverse impacts on the global climate and human health. China, as one of the largest shipping countries, has long been in great need of in-depth analysis of ship emissions. This study for the first time developed a comprehensive national-scale ship emission inventory with 0.005°×0.005° resolution in China for 2014, using the bottom-up method based on Automatic Identification System (AIS) data of the full year of 2014. The emission estimation involved 166,546 unique vessels observed from over 15billion AIS reports, covering OGVs (ocean-going vessels), CVs (coastal vessels) and RVs (river vessels). Results show that the total estimated ship emissions for China in 2014 were 1.1937×10 6 t (SO 2 ), 2.2084×10 6 t (NO X ), 1.807×10 5 t (PM 10 ), 1.665×10 5 t (PM 2.5 ), 1.116×10 5 t (HC), 2.419×10 5 t (CO), and 7.843×10 7 t (CO 2 , excluding RVs), respectively. OGVs were the main emission contributors, with proportions of 47%-74% of the emission totals for different species. Vessel type with the most emissions was container (~43.6%), followed by bulk carrier (~17.5%), oil tanker (~5.7%) and fishing ship (~4.9%). Monthly variations showed that emissions from transport vessels had a low point in February, while fishing ship presented two emission peaks in May and September. In terms of port clusters, ship emissions in BSA (Bohai Sea Area), YRD (Yangtze River Delta) and PRD (Pearl River Delta) accounted for ~13%, ~28% and ~17%, respectively, of the total emissions in China. On the contrast, the average emission intensities in PRD were the highest, followed by the YRD and BSA regions. The establishment of this high-spatiotemporal-resolution ship emission inventory fills the gap of national-scale ship emission inventory of China, and the corresponding ship emission characteristics are expected to provide certain reference significance for the management and control of the ship

  11. Artificial Intelligence (AI) Flight Advisor

    Data.gov (United States)

    National Aeronautics and Space Administration — This research effort applies Deep Learning to contingency management.   Many historic aircraft accidents would have been avoidable if the pilot had better diagnosis...

  12. The development of AI-based refueling control system to the FUGEN NPP

    International Nuclear Information System (INIS)

    Nanko, Takashi; Tanaka, Koichi.

    1996-01-01

    Since even skilled workers spent a considerable time to perform the refueling work previously, an automatic control system was developed by using φNET, an AI tool and its application to refueling works was started in practice. In this system, the optimum plan for the refueling work was constructed using a network which allows to present the equipments to handle the fuel, as well as the operational roles obtained from the worker's experiences. Based on the plan, the instruments concerned were automatically operated to collect the data on the actual operation, the expression and/or printing was made on the movement histories of the articles and the status of their storages. By the development of the system, optimization of refueling works, rationalization of the management and the improvement of reliability for the works became possible. The development was performed in the following two steps; the first was development of an off-line system providing an operational guidance ot the operator according to the optimum operation plan and the second was development of an on-line system which allows to automatically control the instruments according to the operational plan. The off-line system has been put into practice since 1991 and the automatic operation of refueling has been started with the on-line system from 1995. (M.N.)

  13. harnessing_ai_20180319.pptx

    OpenAIRE

    Johnson, Matthew

    2018-01-01

    There have been great strides made in Artificial Intelligence in recent years, but it is often not clear how to apply these recent advances to new problems. In this talk I propose one method of thinking about problems in the sciences and how to find the right AI techniques to aid in research.

  14. Tweeting AI: Perceptions of Lay vs Expert Twitterati

    OpenAIRE

    Manikonda, Lydia; Kambhampati, Subbarao

    2017-01-01

    With the recent advancements in Artificial Intelligence (AI), various organizations and individuals are debating about the progress of AI as a blessing or a curse for the future of the society. This paper conducts an investigation on how the public perceives the progress of AI by utilizing the data shared on Twitter. Specifically, this paper performs a comparative analysis on the understanding of users belonging to two categories -- general AI-Tweeters (AIT) and expert AI-Tweeters (EAIT) who ...

  15. JACOS: AI-based simulation system for man-machine system behavior in NPP

    Energy Technology Data Exchange (ETDEWEB)

    Yoshida, Kazuo; Yokobayashi, Masao; Tanabe, Fumiya [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawase, Katsumi [CSK Corp., Tokyo (Japan); Komiya, Akitoshi [Computer Associated Laboratory, Inc., Hitachinaka, Ibaraki (Japan)

    2001-08-01

    A prototype of a computer simulation system named JACOS (JAERI COgnitive Simulation system) has been developed at JAERI (Japan Atomic Energy Research Institute) to simulate the man-machine system behavior in which both the cognitive behavior of a human operator and the plant behavior affect each other. The objectives of this system development is to provide man-machine system analysts with detailed information on the cognitive process of an operator and the plant behavior affected by operator's actions in accidental situations of a nuclear power plant. The simulation system consists of an operator model and a plant model which are coupled dynamically. The operator model simulates an operator's cognitive behavior in accidental situations based on the decision ladder model of Rasmussen, and is implemented using the AI-techniques of the distributed cooperative inference method with the so-called blackboard architecture. Rule-based behavior is simulated using knowledge representation with If-Then type of rules. Knowledge-based behavior is simulated using knowledge representation with MFM (Multilevel Flow Modeling) and qualitative reasoning method. Cognitive characteristics of attentional narrowing, limitation of short-term memory, and knowledge recalling from long-term memory are also taken into account. The plant model of a 3-loop PWR is also developed using a best estimate thermal-hydraulic analysis code RELAP5/MOD2. This report is prepared as User's Manual for JACOS. The first chapter of this report describes both operator and plant models in detail. The second chapter includes instructive descriptions for program installation, building of a knowledge base for operator model, execution of simulation and analysis of simulation results. The examples of simulation with JACOS are shown in the third chapter. (author)

  16. JACOS: AI-based simulation system for man-machine system behavior in NPP

    International Nuclear Information System (INIS)

    Yoshida, Kazuo; Yokobayashi, Masao; Tanabe, Fumiya; Komiya, Akitoshi

    2001-08-01

    A prototype of a computer simulation system named JACOS (JAERI COgnitive Simulation system) has been developed at JAERI (Japan Atomic Energy Research Institute) to simulate the man-machine system behavior in which both the cognitive behavior of a human operator and the plant behavior affect each other. The objectives of this system development is to provide man-machine system analysts with detailed information on the cognitive process of an operator and the plant behavior affected by operator's actions in accidental situations of a nuclear power plant. The simulation system consists of an operator model and a plant model which are coupled dynamically. The operator model simulates an operator's cognitive behavior in accidental situations based on the decision ladder model of Rasmussen, and is implemented using the AI-techniques of the distributed cooperative inference method with the so-called blackboard architecture. Rule-based behavior is simulated using knowledge representation with If-Then type of rules. Knowledge-based behavior is simulated using knowledge representation with MFM (Multilevel Flow Modeling) and qualitative reasoning method. Cognitive characteristics of attentional narrowing, limitation of short-term memory, and knowledge recalling from long-term memory are also taken into account. The plant model of a 3-loop PWR is also developed using a best estimate thermal-hydraulic analysis code RELAP5/MOD2. This report is prepared as User's Manual for JACOS. The first chapter of this report describes both operator and plant models in detail. The second chapter includes instructive descriptions for program installation, building of a knowledge base for operator model, execution of simulation and analysis of simulation results. The examples of simulation with JACOS are shown in the third chapter. (author)

  17. The Relevance of AI Research to CAI.

    Science.gov (United States)

    Kearsley, Greg P.

    This article provides a tutorial introduction to Artificial Intelligence (AI) research for those involved in Computer Assisted Instruction (CAI). The general theme is that much of the current work in AI, particularly in the areas of natural language understanding systems, rule induction, programming languages, and socratic systems, has important…

  18. Launching AI in NASA ground systems

    Science.gov (United States)

    Perkins, Dorothy C.; Truszkowski, Walter F.

    1990-01-01

    This paper will discuss recent operational successes in implementing expert systems to support the complex functions of NASA mission control systems at the Goddard Space Flight Center, including fault detection and diagnosis for real time and engineering analysis functions in the Cosmic Background Explorer and Gamma Ray Observatory missions and automation of resource planning and scheduling functions for various missions. It will also discuss ongoing developments and prototypes that will lead to increasingly sophisticated applications of artificial intelligence. These include the use of neural networks to perform telemetry monitoring functions, the implementation of generic expert system shells that can be customized to telemetry handling functions specific to NASA control centers, the applications of AI in training and user support, the long-term potential of implementing systems based around distributed, cooperative problem solving, and the use of AI to control and assist system development activities.

  19. Identification of AI-2 Quorum Sensing Inhibitors in Vibrio harveyi Through Structure-Based Virtual Screening.

    Science.gov (United States)

    Jiang, Tianyu; Zhu, Peng; Du, Lupei; Li, Minyong

    2018-01-01

    Quorum sensing (QS) is a cell-to-cell communication system that regulates gene expression as a result of the production and perception of signal molecules called autoinducers (AIs). AI-2 is a QS autoinducer produced by both Gram-negative and Gram-positive bacteria, in which it regulates intraspecies and interspecies communication. The identification of QS inhibitors is considered a promising strategy for the development of anti-virulence drugs with reduced selective pressure for resistance. Here we describe a high-throughput virtual screening approach to identify AI-2 quorum sensing inhibitors on the basis of Vibrio harveyi LuxPQ crystal structure. Seven potent inhibitors with IC 50 values in the micromolar range were selected with no effect or low effect on V. harveyi growth rate.

  20. Integration of AI-2 Based Cell-Cell Signaling with Metabolic Cues in Escherichia coli.

    Directory of Open Access Journals (Sweden)

    Arindam Mitra

    Full Text Available The quorum sensing molecule Autoinducer-2 (AI-2 is generated as a byproduct of activated methyl cycle by the action of LuxS in Escherichia coli. AI-2 is synthesized, released and later internalized in a cell-density dependent manner. Here, by mutational analysis of the genes, uvrY and csrA, we describe a regulatory circuit of accumulation and uptake of AI-2. We constructed a single-copy chromosomal luxS-lacZ fusion in a luxS + merodiploid strain and evaluated its relative expression in uvrY and csrA mutants. At the entry of stationary phase, the expression of the fusion and AI-2 accumulation was positively regulated by uvrY and negatively regulated by csrA respectively. A deletion of csrA altered message stability of the luxS transcript and CsrA protein exhibited weak binding to 5' luxS regulatory region. DNA protein interaction and chromatin immunoprecipitation analysis confirmed direct interaction of UvrY with the luxS promoter. Additionally, reduced expression of the fusion in hfq deletion mutant suggested involvement of small RNA interactions in luxS regulation. In contrast, the expression of lsrA operon involved in AI-2 uptake, is negatively regulated by uvrY and positively by csrA in a cell-density dependent manner. The dual role of csrA in AI-2 synthesis and uptake suggested a regulatory crosstalk of cell signaling with carbon regulation in Escherichia coli. We found that the cAMP-CRP mediated catabolite repression of luxS expression was uvrY dependent. This study suggests that luxS expression is complex and regulated at the level of transcription and translation. The multifactorial regulation supports the notion that cell-cell communication requires interaction and integration of multiple metabolic signals.

  1. Application of AI technology to nuclear plant operations

    International Nuclear Information System (INIS)

    Sackett, J.I.

    1988-01-01

    In this paper, applications of Artificial Intelligence (AI) Technology to nuclear-power plant operation are reviewed. AI Technology is advancing rapidly and in the next five years is expected to enjoy widespread application to operation, maintenance, management and safety. Near term emphasis on a sensor validation, scheduling, alarm handling, and expert systems for procedural assistance. Ultimate applications are envisioned to culminate in autonomous control such as would be necessary for a power system in space, where automatic control actions are taken based upon reasoned conclusions regarding plant conditions, capability and control objectives

  2. Artificial Intelligence in Autonomous Telescopes

    Science.gov (United States)

    Mahoney, William; Thanjavur, Karun

    2011-03-01

    Artificial Intelligence (AI) is key to the natural evolution of today's automated telescopes to fully autonomous systems. Based on its rapid development over the past five decades, AI offers numerous, well-tested techniques for knowledge based decision making essential for real-time telescope monitoring and control, with minimal - and eventually no - human intervention. We present three applications of AI developed at CFHT for monitoring instantaneous sky conditions, assessing quality of imaging data, and a prototype for scheduling observations in real-time. Closely complementing the current remote operations at CFHT, we foresee further development of these methods and full integration in the near future.

  3. Fifth Conference on Artificial Intelligence for Space Applications

    Science.gov (United States)

    Odell, Steve L. (Compiler)

    1990-01-01

    The Fifth Conference on Artificial Intelligence for Space Applications brings together diverse technical and scientific work in order to help those who employ AI methods in space applications to identify common goals and to address issues of general interest in the AI community. Topics include the following: automation for Space Station; intelligent control, testing, and fault diagnosis; robotics and vision; planning and scheduling; simulation, modeling, and tutoring; development tools and automatic programming; knowledge representation and acquisition; and knowledge base/data base integration.

  4. Data transfer based on intelligent ethernet card

    International Nuclear Information System (INIS)

    Zhu Haitao; Chinese Academy of Sciences, Beijing; Chu Yuanping; Zhao Jingwei

    2007-01-01

    Intelligent Ethernet Cards are widely used in systems where the network throughout is very large, such as the DAQ systems for modern high energy physics experiments, web service. With the example of a commercial intelligent Ethernet card, this paper introduces the architecture, the principle and the process of intelligent Ethernet cards. In addition, the results of several experiments showing the differences between intelligent Ethernet cards and general ones are also presented. (authors)

  5. The present status of artificial intelligence for nuclear power plants

    International Nuclear Information System (INIS)

    Suda, Kazunori; Yonekawa, Tuyoshi; Yoshikawa, Shinji; Hasegawa, Makoto

    1999-03-01

    JNC researches the development of distributed intelligence systems at autonomous plants and intelligent support system at nuclear power plant. This report describes the present status of artificial intelligence (AI) technologies for this research. The following are represented in this report: present research study for AI, Implementation of AI system and application of AI technologies in the field of industries, requirement for AI by industries, problems of social acceptance for AI. A development of AI systems has to be motivated both by current status of AI and requirement for AI. Furthermore a problem of social acceptance for AI technologies has to be solved for using AI systems in society. (author)

  6. On the Edge: Intelligent CALL in the 1990s.

    Science.gov (United States)

    Underwood, John

    1989-01-01

    Examines the possibilities of developing computer-assisted language learning (CALL) based on the best of modern technology, arguing that artificial intelligence (AI) strategies will radically improve the kinds of exercises that can be performed. Recommends combining AI technology with other tools for delivering instruction, such as simulation and…

  7. The Seeds of Artificial Intelligence. SUMEX-AIM.

    Science.gov (United States)

    Research Resources Information Center, Rockville, MD.

    Written to provide an understanding of the broad base of information on which the artificial intelligence (AI) branch of computer science rests, this publication presents a general view of AI, the concepts from which it evolved, its current abilities, and its promise for research. The focus is on a community of projects that use the SUMEX-AIM…

  8. Introduction to the Articles on Innovative Applications of Artificial Intelligence

    OpenAIRE

    Rychtyckyj, Nestor; Shapiro, Daniel

    2011-01-01

    This issue of AI Magazine provides extended versions of several papers that were recently presented at the Innovative Applications of Artificial Intelligence Conference (IAAI-2010). We present three articles reflecting deployed applications of AI, one describing a unique, emerging application, plus an article based on the invited talk by Jay M. Tenenbaum, who was the 2010 Engelmore Award recipient.

  9. Artificial intelligence-based modeling and control of fluidized bed combustion

    Energy Technology Data Exchange (ETDEWEB)

    Ikonen, E.; Leppaekoski, K. (Univ. of Oulu, Dept. of Process and Environmental Engineering (Finland)). email: enso.ikonen@oulu.fi

    2009-07-01

    AI-inspired techniques have a lot to offer when developing methods for advanced identification, monitoring, control and optimization of industrial processes, such as power plants. Advanced control methods have been extensively examined in the research of the Power Plant Automation group at the Systems Engineering Laboratory, e.g., in fuel inventory modelling, combustion power control, modelling and control of flue gas oxygen, drum control, modelling and control of superheaters, or in optimization of flue-gas emissions. Most engineering approaches to artificial intelligence (AI) are characterized by two fundamental properties: the ability to learn from various sources and the ability to deal with plant complexity. Learning systems that are able to operate in uncertain environments based on incomplete information are commonly referred to as being intelligent. A number of other approaches exist, characterized by these properties, but not easily categorized as AI-systems. Advanced control methods (adaptive, predictive, multivariable, robust, etc.) are based on the availability of a model of the process to be controlled. Hence identification of processes becomes a key issue, leading to the use of adaptation and learning techniques. A typical learning control system concerns a selection of learning techniques applied for updating a process model, which in turn is used for the controller design. When design of learning control systems is complemented with concerns for dealing with uncertainties or vaguenesses in models, measurements, or even objectives, particularly close connections exist between advanced process control and methods of artificial intelligence and machine learning. Needs for advanced techniques are typically characterized by the desire to properly handle plant non-linearities, the multivariable nature of the dynamic problems, and the necessity to adapt to changing plant conditions. In the field of fluidized bed combustion (FBC) control, the many promising

  10. Hybrid-augmented intelligence:collaboration and cognition

    Institute of Scientific and Technical Information of China (English)

    Nan-ning ZHENG; Zi-yi LIU; Peng-ju REN; Yong-qiang MA; Shi-tao CHEN; Si-yu YU; Jian-ru XUE

    2017-01-01

    The long-term goal of artificial intelligence (AI) is to make machines learn and think like human beings. Due to the high levels of uncertainty and vulnerability in human life and the open-ended nature of problems that humans are facing, no matter how intelligent machines are, they are unable to completely replace humans. Therefore, it is necessary to introduce human cognitive capabilities or human-like cognitive models into AI systems to develop a new form of AI, that is, hybrid-augmented intelligence. This form of AI or machine intelligence is a feasible and important developing model. Hybrid-augmented intelligence can be divided into two basic models:one is human-in-the-loop augmented intelligence with human-computer collaboration, and the other is cognitive computing based augmented intelligence, in which a cognitive model is embedded in the machine learning system. This survey describes a basic framework for human-computer collaborative hybrid-augmented intelligence, and the basic elements of hybrid-augmented intelligence based on cognitive computing. These elements include intuitive reasoning, causal models, evolution of memory and knowledge, especially the role and basic principles of intuitive reasoning for complex problem solving, and the cognitive learning framework for visual scene understanding based on memory and reasoning. Several typical applications of hybrid-augmented intelligence in related fields are given.

  11. Felicity Conditions for Human Skill Acquisition: Validating an AI (Artificial Intelligence)-Based Theory.

    Science.gov (United States)

    1983-11-01

    B1 /SHOW2 1/BORROW 2/BORROW 1/SHOW X/OVRWRT W/OVRWRT Figure 2-12...34,,** ’% ".."’ ’ ° ’ . . . . " " *, . . " " . " ". .". , . • " . " . ., ’ -". ,""" ’" - . , ’ ’. " FETcHi PATTERNS 229 V,., *AC1:AC LC:A C1 :COL A1 :BLK C2:COL A2:BLK T1DIG T B1 T2:DIGIT...Glen Bryan ERIC Facility-Acquisitions . Dr. Edward C. Weiss 6208 Poe Road 4833 Rugby Avenue National Science Foundation Bethesda, MD 20817 Bethesda.

  12. SYNERGY-AI: Artificial Intelligence Based Precision Oncology Clinical Trial Matching and Registry

    Science.gov (United States)

    2018-02-24

    Cancer, Metastatic; Cancer; Cancer of Pancreas; Cancer of Liver; Cancer of Stomach; Cancer Liver; Cancer of Rectum; Cancer of Kidney; Cancer of Esophagus; Cancer of Cervix; Cancer of Colon; Cancer of Larynx; Cancer, Lung; Cancer, Breast; Cancer, Advanced; Cancer Prostate; Cancer of Neck; Cancer of Skin; Neuroendocrine Tumors; Carcinoma; Mismatch Repair Deficiency; BRCA Gene Rearrangement; Non Hodgkin Lymphoma; Leukemia; Non Small Cell Lung Cancer; Cholangiocarcinoma; Glioblastoma; Central Nervous System Tumor; Melanoma; Urothelial Carcinoma; Bladder Cancer; Ovarian Cancer; Endometrial Cancer; Testicular Cancer; Breast Cancer

  13. Artificial Intelligence based technique for BTS placement

    Science.gov (United States)

    Alenoghena, C. O.; Emagbetere, J. O.; Aibinu, A. M.

    2013-12-01

    The increase of the base transceiver station (BTS) in most urban areas can be traced to the drive by network providers to meet demand for coverage and capacity. In traditional network planning, the final decision of BTS placement is taken by a team of radio planners, this decision is not fool proof against regulatory requirements. In this paper, an intelligent based algorithm for optimal BTS site placement has been proposed. The proposed technique takes into consideration neighbour and regulation considerations objectively while determining cell site. The application will lead to a quantitatively unbiased evaluated decision making process in BTS placement. An experimental data of a 2km by 3km territory was simulated for testing the new algorithm, results obtained show a 100% performance of the neighbour constrained algorithm in BTS placement optimization. Results on the application of GA with neighbourhood constraint indicate that the choices of location can be unbiased and optimization of facility placement for network design can be carried out.

  14. Knowledge based systems for intelligent robotics

    Science.gov (United States)

    Rajaram, N. S.

    1982-01-01

    It is pointed out that the construction of large space platforms, such as space stations, has to be carried out in the outer space environment. As it is extremely expensive to support human workers in space for large periods, the only feasible solution appears to be related to the development and deployment of highly capable robots for most of the tasks. Robots for space applications will have to possess characteristics which are very different from those needed by robots in industry. The present investigation is concerned with the needs of space robotics and the technologies which can be of assistance to meet these needs, giving particular attention to knowledge bases. 'Intelligent' robots are required for the solution of arising problems. The collection of facts and rules needed for accomplishing such solutions form the 'knowledge base' of the system.

  15. Artificial Intelligence based technique for BTS placement

    International Nuclear Information System (INIS)

    Alenoghena, C O; Emagbetere, J O; 1 Minna (Nigeria))" data-affiliation=" (Department of Telecommunications Engineering, Federal University of Techn.1 Minna (Nigeria))" >Aibinu, A M

    2013-01-01

    The increase of the base transceiver station (BTS) in most urban areas can be traced to the drive by network providers to meet demand for coverage and capacity. In traditional network planning, the final decision of BTS placement is taken by a team of radio planners, this decision is not fool proof against regulatory requirements. In this paper, an intelligent based algorithm for optimal BTS site placement has been proposed. The proposed technique takes into consideration neighbour and regulation considerations objectively while determining cell site. The application will lead to a quantitatively unbiased evaluated decision making process in BTS placement. An experimental data of a 2km by 3km territory was simulated for testing the new algorithm, results obtained show a 100% performance of the neighbour constrained algorithm in BTS placement optimization. Results on the application of GA with neighbourhood constraint indicate that the choices of location can be unbiased and optimization of facility placement for network design can be carried out

  16. AI-guided parameter optimization in inverse treatment planning

    International Nuclear Information System (INIS)

    Yan Hui; Yin Fangfang; Guan Huaiqun; Kim, Jae Ho

    2003-01-01

    An artificial intelligence (AI)-guided inverse planning system was developed to optimize the combination of parameters in the objective function for intensity-modulated radiation therapy (IMRT). In this system, the empirical knowledge of inverse planning was formulated with fuzzy if-then rules, which then guide the parameter modification based on the on-line calculated dose. Three kinds of parameters (weighting factor, dose specification, and dose prescription) were automatically modified using the fuzzy inference system (FIS). The performance of the AI-guided inverse planning system (AIGIPS) was examined using the simulated and clinical examples. Preliminary results indicate that the expected dose distribution was automatically achieved using the AI-guided inverse planning system, with the complicated compromising between different parameters accomplished by the fuzzy inference technique. The AIGIPS provides a highly promising method to replace the current trial-and-error approach

  17. Memory Based Machine Intelligence Techniques in VLSI hardware

    OpenAIRE

    James, Alex Pappachen

    2012-01-01

    We briefly introduce the memory based approaches to emulate machine intelligence in VLSI hardware, describing the challenges and advantages. Implementation of artificial intelligence techniques in VLSI hardware is a practical and difficult problem. Deep architectures, hierarchical temporal memories and memory networks are some of the contemporary approaches in this area of research. The techniques attempt to emulate low level intelligence tasks and aim at providing scalable solutions to high ...

  18. Recent advances in knowledge-based paradigms and applications enhanced applications using hybrid artificial intelligence techniques

    CERN Document Server

    Jain, Lakhmi

    2014-01-01

    This book presents carefully selected contributions devoted to the modern perspective of AI research and innovation. This collection covers several areas of applications and motivates new research directions. The theme across all chapters combines several domains of AI research , Computational Intelligence and Machine Intelligence including an introduction to  the recent research and models. Each of the subsequent chapters reveals leading edge research and innovative solution that employ AI techniques with an applied perspective. The problems include classification of spatial images, early smoke detection in outdoor space from video images, emergent segmentation from image analysis, intensity modification in images, multi-agent modeling and analysis of stress. They all are novel pieces of work and demonstrate how AI research contributes to solutions for difficult real world problems that benefit the research community, industry and society.

  19. Humans and Machines in the Evolution of AI in Korea

    OpenAIRE

    Zhang, Byoung-Tak

    2016-01-01

    Artificial intelligence in Korea is currently prospering. The media is regularly reporting AI-enabled products such as smart advisors, personal robots, autonomous cars, and human-level intelligence machines. The IT industry is investing in deep learning and AI to maintain the global competitive edge in their services and products. The Ministry of Science, ICT, and Future Planning (MSIP) has launched new funding programs in AI and cognitive science to implement the government’s newly adopted e...

  20. Artificial Intelligence and Information Management

    Science.gov (United States)

    Fukumura, Teruo

    After reviewing the recent popularization of the information transmission and processing technologies, which are supported by the progress of electronics, the authors describe that by the introduction of the opto-electronics into the information technology, the possibility of applying the artificial intelligence (AI) technique to the mechanization of the information management has emerged. It is pointed out that althuogh AI deals with problems in the mental world, its basic methodology relies upon the verification by evidence, so the experiment on computers become indispensable for the study of AI. The authors also describe that as computers operate by the program, the basic intelligence which is concerned in AI is that expressed by languages. This results in the fact that the main tool of AI is the logical proof and it involves an intrinsic limitation. To answer a question “Why do you employ AI in your problem solving”, one must have ill-structured problems and intend to conduct deep studies on the thinking and the inference, and the memory and the knowledge-representation. Finally the authors discuss the application of AI technique to the information management. The possibility of the expert-system, processing of the query, and the necessity of document knowledge-base are stated.

  1. Mathematics creative thinking levels based on interpersonal intelligence

    Science.gov (United States)

    Kuncorowati, R. H.; Mardiyana; Saputro, D. R. S.

    2017-12-01

    Creative thinking ability was one of student’s ability to determine various alternative solutions toward mathematics problem. One of indicators related to creative thinking ability was interpersonal intelligence. Student’s interpersonal intelligence would influence to student’s creativity. This research aimed to analyze creative thinking ability level of junior high school students in Karanganyar using descriptive method. Data was collected by test, questionnaire, interview, and documentation. The result showed that students with high interpersonal intelligence achieved third and fourth level in creative thinking ability. Students with moderate interpersonal intelligence achieved second level in creative thinking ability and students with low interpersonal intelligence achieved first and zero level in creative thinking ability. Hence, students with high, moderate, and low interpersonal intelligence could solve mathematics problem based on their mathematics creative thinking ability.

  2. Intelligent Tools for Planning Knowledge base Development and Verification

    Science.gov (United States)

    Chien, Steve A.

    1996-01-01

    A key obstacle hampering fielding of AI planning applications is the considerable expense of developing, verifying, updating, and maintaining the planning knowledge base (KB). Planning systems must be able to compare favorably in terms of software lifecycle costs to other means of automation such as scripts or rule-based expert systems.

  3. AI in space: Past, present, and possible futures

    Science.gov (United States)

    Rose, Donald D.; Post, Jonathan V.

    1992-01-01

    While artificial intelligence (AI) has become increasingly present in recent space applications, new missions being planned will require even more incorporation of AI techniques. In this paper, we survey some of the progress made to date in implementing such programs, some current directions and issues, and speculate about the future of AI in space scenarios. We also provide examples of how thinkers from the realm of science fiction have envisioned AI's role in various aspects of space exploration.

  4. PER Estimation of AIS in Inland Rivers based on Three Dimensional Ray Tracking

    Directory of Open Access Journals (Sweden)

    F. Ma

    2014-03-01

    Full Text Available The Automatic Identification System (AIS is an important maritime safety device, which is populous in inland rivers. Compared with that in open sea, the Package Error Rate (PER of AIS in inland river has increased sharply due to its complex environment. With the help of hardware in loop simulation, it is possible to make statistical calculation on the PER under a given field strength and describe the data by quadratic rational fraction. Meanwhile, in the three dimensional software environments, the signal field strength is able to be calculated by the ray tracking method, which exhausts all the possible propagation paths, including direct way, reflection, diffractions, and the other medium attenuation matters. Beyond that, in the model, the propagation geography information in inland rivers is required to be simplified in some way, or the computation of the ray tracking is too hard to get. The paper set the Changjiang Wuhan channel as the field testing region, and all the deviations are less than 5% in sunny weather, which proves the method accurate and effective.

  5. SDI satellite autonomy using AI and Ada

    Science.gov (United States)

    Fiala, Harvey E.

    1990-01-01

    The use of Artificial Intelligence (AI) and the programming language Ada to help a satellite recover from selected failures that could lead to mission failure are described. An unmanned satellite will have a separate AI subsystem running in parallel with the normal satellite subsystems. A satellite monitoring subsystem (SMS), under the control of a blackboard system, will continuously monitor selected satellite subsystems to become alert to any actual or potential problems. In the case of loss of communications with the earth or the home base, the satellite will go into a survival mode to reestablish communications with the earth. The use of an AI subsystem in this manner would have avoided the tragic loss of the two recent Soviet probes that were sent to investigate the planet Mars and its moons. The blackboard system works in conjunction with an SMS and a reconfiguration control subsystem (RCS). It can be shown to be an effective way for one central control subsystem to monitor and coordinate the activities and loads of many interacting subsystems that may or may not contain redundant and/or fault-tolerant elements. The blackboard system will be coded in Ada using tools such as the ABLE development system and the Ada Production system.

  6. Artificial intelligence applications in space and SDI: A survey

    Science.gov (United States)

    Fiala, Harvey E.

    1988-01-01

    The purpose of this paper is to survey existing and planned Artificial Intelligence (AI) applications to show that they are sufficiently advanced for 32 percent of all space applications and SDI (Space Defense Initiative) software to be AI-based software. To best define the needs that AI can fill in space and SDI programs, this paper enumerates primary areas of research and lists generic application areas. Current and planned NASA and military space projects in AI will be reviewed. This review will be largely in the selected area of expert systems. Finally, direct applications of AI to SDI will be treated. The conclusion covers the importance of AI to space and SDI applications, and conversely, their importance to AI.

  7. Feasibility of an AI-Based Measure of the Hand Motions of Expert and Novice Surgeons

    Directory of Open Access Journals (Sweden)

    Munenori Uemura

    2018-01-01

    Full Text Available This study investigated whether parameters derived from hand motions of expert and novice surgeons accurately and objectively reflect laparoscopic surgical skill levels using an artificial intelligence system consisting of a three-layer chaos neural network. Sixty-seven surgeons (23 experts and 44 novices performed a laparoscopic skill assessment task while their hand motions were recorded using a magnetic tracking sensor. Eight parameters evaluated as measures of skill in a previous study were used as inputs to the neural network. Optimization of the neural network was achieved after seven trials with a training dataset of 38 surgeons, with a correct judgment ratio of 0.99. The neural network that prospectively worked with the remaining 29 surgeons had a correct judgment rate of 79% for distinguishing between expert and novice surgeons. In conclusion, our artificial intelligence system distinguished between expert and novice surgeons among surgeons with unknown skill levels.

  8. Internet-based intelligent information processing systems

    CERN Document Server

    Tonfoni, G; Ichalkaranje, N S

    2003-01-01

    The Internet/WWW has made it possible to easily access quantities of information never available before. However, both the amount of information and the variation in quality pose obstacles to the efficient use of the medium. Artificial intelligence techniques can be useful tools in this context. Intelligent systems can be applied to searching the Internet and data-mining, interpreting Internet-derived material, the human-Web interface, remote condition monitoring and many other areas. This volume presents the latest research on the interaction between intelligent systems (neural networks, adap

  9. A Survey on Evolutionary Algorithm Based Hybrid Intelligence in Bioinformatics

    Directory of Open Access Journals (Sweden)

    Shan Li

    2014-01-01

    Full Text Available With the rapid advance in genomics, proteomics, metabolomics, and other types of omics technologies during the past decades, a tremendous amount of data related to molecular biology has been produced. It is becoming a big challenge for the bioinformatists to analyze and interpret these data with conventional intelligent techniques, for example, support vector machines. Recently, the hybrid intelligent methods, which integrate several standard intelligent approaches, are becoming more and more popular due to their robustness and efficiency. Specifically, the hybrid intelligent approaches based on evolutionary algorithms (EAs are widely used in various fields due to the efficiency and robustness of EAs. In this review, we give an introduction about the applications of hybrid intelligent methods, in particular those based on evolutionary algorithm, in bioinformatics. In particular, we focus on their applications to three common problems that arise in bioinformatics, that is, feature selection, parameter estimation, and reconstruction of biological networks.

  10. Ability-versus skill-based assessment of emotional intelligence.

    Science.gov (United States)

    Bradberry, Travis R; Su, Lac D

    2006-01-01

    Emotional intelligence has received an intense amount of attention in leadership circles during the last decade and continuing debate exists concerning the best method for measuring this construct. This study analyzed leader emotional intelligence scores, measured via skill and ability methodologies, against leader job performance. Two hundred twelve employees from three organizations participated in this study. Scores on the Emotional Intelligence Appraisal, a skill-based assessment, were positively, though not significantly, correlated with scores on the MSCEIT, an ability-based assessment of emotional intelligence. Scores on the MSCEIT did not have a significant relationship with job performance in this study, whereas, scores on the Emotional Intelligence Appraisal had a strong link to leader job performance. The four subcomponents of the Emotional Intelligence Appraisal were examined against job performance. Relationship management was a stronger predictor of leader job performance than the other three subcomponents. Social awareness was the single emotional intelligence skill that did not have a significant link to leader job performance. Factor analyses yielded a two-component model of emotional intelligence encompassing personal and social competence, rather than confirmation of a four-part taxonomy.

  11. Potential applications of artificial intelligence in computer-based management systems for mixed waste incinerator facility operation

    International Nuclear Information System (INIS)

    Rivera, A.L.; Singh, S.P.N.; Ferrada, J.J.

    1991-01-01

    The Department of Energy/Oak Ridge Field Office (DOE/OR) operates a mixed waste incinerator facility at the Oak Ridge K-25 Site, designed for the thermal treatment of incinerable liquid, sludge, and solid waste regulated under the Toxic Substances Control Act (TSCA) and the Resource Conversion and Recovery Act (RCRA). Operation of the TSCA Incinerator is highly constrained as a result of the regulatory, institutional, technical, and resource availability requirements. This presents an opportunity for applying computer technology as a technical resource for mixed waste incinerator operation to facilitate promoting and sustaining a continuous performance improvement process while demonstrating compliance. This paper describes mixed waste incinerator facility performance-oriented tasks that could be assisted by Artificial Intelligence (AI) and the requirements for AI tools that would implement these algorithms in a computer-based system. 4 figs., 1 tab

  12. Proceedings of conference on AI applications in physical sciences

    International Nuclear Information System (INIS)

    1993-01-01

    A Conference cum workshop on AI applications in Physical Sciences was organised by the Indian Physics Association at Bhabha Atomic Research Centre, Bombay during January 15-17, 1992. It was held in memory of Late Shri S.N. Seshadri, who was the moving spirit behind self reliance in instrumentation development for research and industry. The two day conference which was followed by one day workshop covered the following broad spectrum of topics in Artificial Intelligence: AI Tools and Techniques, Neural Networks, Robotics and Machine Vision, Fuzzy Control and Applications, Natural Language and Speech Processing, Knowledge based Systems, and AI and Allied applications. The conference dealt with recent advances and achievements in AI. It provided a forum for the exchange of valuable information and expertise in this fast emerging field. Over 200 scientists, engineers and computer professionals from various universities, R and D institutes and industries actively participated. 45 contributed papers and 8 invited talks were presented in the symposium. The volume contains selected papers which were contributed by the participants. Some of them dealt with AI applications in nuclear science and technology. (original)

  13. Artificial Intelligence and Science Education.

    Science.gov (United States)

    Good, Ron

    1987-01-01

    Defines artificial intelligence (AI) in relation to intelligent computer-assisted instruction (ICAI) and science education. Provides a brief background of AI work, examples of expert systems, examples of ICAI work, and addresses problems facing AI workers that have implications for science education. Proposes a revised model of the Karplus/Renner…

  14. The coming of age of artificial intelligence in medicine

    NARCIS (Netherlands)

    Patel, Vimla L.; Shortliffe, Edward H.; Stefanelli, Mario; Szolovits, Peter; Berthold, Michael R.; Bellazzi, Riccardo; Abu-Hanna, Ameen

    2009-01-01

    This paper is based on a panel discussion held at the Artificial Intelligence in Medicine Europe (AIME) conference in Amsterdam, The Netherlands, in July 2007. It had been more than 15 years since Edward Shortliffe gave a talk at AIME in which he characterized artificial intelligence (AI) in

  15. Active and intelligent food packaging: legal aspects and safety concerns

    NARCIS (Netherlands)

    Dainelli, D.; Gontard, N.; Spyropoulos, D.; Zondervan-van den Beuken, E.; Tobback, P.

    2008-01-01

    'Active and intelligent' (A&I) food packaging is based on a deliberate interaction of the packaging with the food and/or its direct environment. This article presents: (i) the main types of materials developed for food contact; (ii) the global market and the future trends of active and intelligent

  16. Beyond fluid intelligence and personality traits in social support: the role of ability based emotional intelligence.

    Science.gov (United States)

    Fabio, Annamaria Di

    2015-01-01

    Social support represents an important individual resource that has been associated with multiple indices of adaptive functioning and resiliency. Existing research has also identified an association between emotional intelligence (EI) and social support. The present study builds on prior research by investigating the contributions of ability based EI to social support, beyond the effects of fluid intelligence and personality traits. The Advanced Progressive Matrices, the Big Five Questionnaire, the Mayer Salovey Caruso EI test (MSCEIT), and the Multidimensional Scale of Perceived Social Support were administered to 149 Italian high school students. The results showed that ability based EI added significant incremental variance in explaining perceived social support, beyond the variance due to fluid intelligence and personality traits. The results underline the role of ability based EI in relation to perceived social support. Since ability based EI can be increased through specific training, the results of the present study highlight new possibilities for research and intervention in a preventive framework.

  17. Artificial intelligence executive summary

    International Nuclear Information System (INIS)

    Wamsley, S.J.; Purvis, E.E. III

    1984-01-01

    Artificial intelligence (AI) is a high technology field that can be used to provide problem solving diagnosis, guidance and for support resolution of problems. It is not a stand alone discipline, but can also be applied to develop data bases for retention of the expertise that is required for its own knowledge base. This provides a way to retain knowledge that otherwise may be lost. Artificial Intelligence Methodology can provide an automated construction management decision support system, thereby restoring the manager's emphasis to project management

  18. An Internet of Things Approach for Extracting Featured Data Using AIS Database: An Application Based on the Viewpoint of Connected Ships

    Directory of Open Access Journals (Sweden)

    Wei He

    2017-09-01

    Full Text Available Automatic Identification System (AIS, as a major data source of navigational data, is widely used in the application of connected ships for the purpose of implementing maritime situation awareness and evaluating maritime transportation. Efficiently extracting featured data from AIS database is always a challenge and time-consuming work for maritime administrators and researchers. In this paper, a novel approach was proposed to extract massive featured data from the AIS database. An Evidential Reasoning rule based methodology was proposed to simulate the procedure of extracting routes from AIS database artificially. First, the frequency distributions of ship dynamic attributes, such as the mean and variance of Speed over Ground, Course over Ground, are obtained, respectively, according to the verified AIS data samples. Subsequently, the correlations between the attributes and belief degrees of the categories are established based on likelihood modeling. In this case, the attributes were characterized into several pieces of evidence, and the evidence can be combined with the Evidential Reasoning rule. In addition, the weight coefficients were trained in a nonlinear optimization model to extract the AIS data more accurately. A real life case study was conducted at an intersection waterway, Yangtze River, Wuhan, China. The results show that the proposed methodology is able to extract data very precisely.

  19. Artificial Intelligence

    CERN Document Server

    Warwick, Kevin

    2011-01-01

    if AI is outside your field, or you know something of the subject and would like to know more then Artificial Intelligence: The Basics is a brilliant primer.' - Nick Smith, Engineering and Technology Magazine November 2011 Artificial Intelligence: The Basics is a concise and cutting-edge introduction to the fast moving world of AI. The author Kevin Warwick, a pioneer in the field, examines issues of what it means to be man or machine and looks at advances in robotics which have blurred the boundaries. Topics covered include: how intelligence can be defined whether machines can 'think' sensory

  20. Installation and evaluation of a nuclear power plant Operator Advisor based on artificial intelligence technology

    International Nuclear Information System (INIS)

    Hajek, B.K.; Miller, D.W.

    1993-02-01

    The Artificial Intelligence Group in the Nuclear Engineering Program has designed and built an Operator Advisor (OA), an AI system to monitor nuclear power plant parameters, detect component and system malfunctions, dispose their causes, and provide the plant operators with the correct procedures for mitigating the consequences of the malfunctions. It then monitors performance of the procedures, and provides backup steps when specific operator actions fail. The OA has been implemented on Sun 4 workstations in Common Lisp, and has been interfaced to run in real time on the Perry Nuclear Power Plant full-function simulator in the plant training department. The eventual goal for a fully functioning Operator Advisor would be to have reactor operators receive direction for all plant operations. Such a goal requires considerable testing of the system within limited malfunction boundaries, an extensive Verification ampersand Validation (V ampersand V) effort, a large knowledge base development effort, and development of tools as part of the system to automate its maintenance. Clearly, these efforts are beyond the scope of the feasibility effort expended during this project period. However, as a result of this project, we have an AI based platform upon which a complete system can be built

  1. Estimating ship emissions based on AIS data for port of Tianjin, China

    Science.gov (United States)

    Chen, Dongsheng; Zhao, Yuehua; Nelson, Peter; Li, Yue; Wang, Xiaotong; Zhou, Ying; Lang, Jianlei; Guo, Xiurui

    2016-11-01

    A detailed exhaust emission inventory of ships by using Automatic Identification System (AIS) data was developed for Tianjin Port, one of the top 10 world container ports and the largest port in North China. It was found that in 2014, ship emissions are 2.93 × 104, 4.13 × 104, 4.03 × 103, 3.72 × 103, 1.72 × 103 and 3.57 × 103 tonnes of SO2, NOx, PM10, PM2.5, NMVOC and CO respectively, which are equivalent to 11.07%, 9.40%, 2.43%, 3.10%, 0.43% and 0.16% respectively of the non-ship anthropogenic totals in Tianjin. The total CO2 emissions is approximately 1.97 × 106 tonnes. The container ships and dry bulk cargo ships contributed about 70% of the total ship emissions of NOx, SO2 and PM10. Pollutants were mainly emitted during cruise and hotelling modes, and the highest intensities of emissions located in the vicinity of fairways, berth and anchorage areas in Tianjin Port. Distinctive difference between the lowest (February) and the highest (September) monthly emissions is due to the adjustment of freight volume during the Chinese New Year and the months before and after it.

  2. An Artificial Intelligence-Based Environment Quality Analysis System

    OpenAIRE

    Oprea , Mihaela; Iliadis , Lazaros

    2011-01-01

    Part 20: Informatics and Intelligent Systems Applications for Quality of Life information Services (ISQLIS) Workshop; International audience; The paper describes an environment quality analysis system based on a combination of some artificial intelligence techniques, artificial neural networks and rule-based expert systems. Two case studies of the system use are discussed: air pollution analysis and flood forecasting with their impact on the environment and on the population health. The syste...

  3. Intelligent Traffic Light Based on PLC Control

    Science.gov (United States)

    Mei, Lin; Zhang, Lijian; Wang, Lingling

    2017-11-01

    The traditional traffic light system with a fixed control mode and single control function is contradicted with the current traffic section. The traditional one has been unable to meet the functional requirements of the existing flexible traffic control system. This paper research and develop an intelligent traffic light called PLC control system. It uses PLC as control core, using a sensor module for receiving real-time information of vehicles, traffic control mode for information to select the traffic lights. Of which control mode is flexible and changeable, and it also set the countdown reminder to improve the effectiveness of traffic lights, which can realize the goal of intelligent traffic diversion, intelligent traffic diversion.

  4. Artificial intelligence in process design and operation

    International Nuclear Information System (INIS)

    Sudduth, A.L.

    1988-01-01

    Artificial Intelligence (AI) has recently become prominent in the discussion of computer applications in the utility business. In order to assess this technology, a research project was performed to determine whether software development techniques based on AI could be used to facilitate management of information associated with the design of a generating station. The approach taken was the development of an expert system, using a relatively simple set of rules acting on a more complex knowledge base. A successful prototype for the application was developed and its potential extension to a production environment demonstrated. During the course of prototype development, other possible applications of AI in design engineering were discovered, and areas of particular interest selected for further investigation. A plan for AI R and D was formulated. That plan and other possible future work in AI are discussed

  5. Dicty_cDB: FC-AI04 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI04 (Link to dictyBase) - - - Contig-U15121-1 FC-AI04E (Li...nk to Original site) - - - - - - FC-AI04E 772 Show FC-AI04 Library FC (Link to library) Clone ID FC-AI04 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI04Q.Seq.d/ Representative seq. ID FC-AI...04E (Link to Original site) Representative DNA sequence >FC-AI04 (FC-AI04Q) /CSM/FC/FC-AI/FC-AI04Q.Seq....qvnkhqqvvtktvsd vlvphqvhnqvfphipqqmtlvnkhqpvvtktvsdvlvphqvhnqvfphtpqlkiqvylq vfqvvvvtiisai

  6. Dicty_cDB: FC-AI10 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI

  7. Dicty_cDB: FC-AI23 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI23 (Link to dictyBase) - - - Contig-U15308-1 FC-AI23Z (Li...nk to Original site) - - FC-AI23Z 603 - - - - Show FC-AI23 Library FC (Link to library) Clone ID FC-AI23 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI23Q.Seq.d/ Representative seq. ID FC-AI...23Z (Link to Original site) Representative DNA sequence >FC-AI23 (FC-AI23Q) /CSM/FC/FC-AI/FC-AI23Q.Seq....LNTLAKKNEQVVEGEILAKQLTGVTAEELSEFKACFSHFDKDN DNKLNRLEFSSCLKSIGDELTEEQLNQVISKIDTDGNGTISFEEFIDYMVSSRKGTDSVE STKAAFKVMAEDKDFITEAQIRAAI

  8. Dicty_cDB: FC-AI05 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI05 (Link to dictyBase) - - - Contig-U15516-1 FC-AI05E (Li...nk to Original site) - - - - - - FC-AI05E 1189 Show FC-AI05 Library FC (Link to library) Clone ID FC-AI05 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI05Q.Seq.d/ Representative seq. ID FC-AI...05E (Link to Original site) Representative DNA sequence >FC-AI05 (FC-AI05Q) /CSM/FC/FC-AI/FC-AI05Q.Seq...KIVGEASLKNKGKMSRVLAAKAALSARFD ALCEVSDTSYGIAYKGAVDRRAAAIEGREVRKSLNAVKPEKSGNVAKYDHTKSATTNTTR DVATKSSKESSIKQEKQ

  9. Dicty_cDB: FC-AI21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI21 (Link to dictyBase) - - - Contig-U16254-1 FC-AI21Z (Li...nk to Original site) - - FC-AI21Z 696 - - - - Show FC-AI21 Library FC (Link to library) Clone ID FC-AI21 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI21Q.Seq.d/ Representative seq. ID FC-AI...21Z (Link to Original site) Representative DNA sequence >FC-AI21 (FC-AI21Q) /CSM/FC/FC-AI/FC-AI21Q.Seq....YPGYMYTDLSTIYERAGRIQGRNGSITQI PILTMPNDDITHPIPDLTGYITEGQIFIDRQINNRQIYPPINVLPSLSRLMKSAI

  10. AI Researchers, Video Games Are Your Friends!

    OpenAIRE

    Togelius, Julian

    2016-01-01

    If you are an artificial intelligence researcher, you should look to video games as ideal testbeds for the work you do. If you are a video game developer, you should look to AI for the technology that makes completely new types of games possible. This chapter lays out the case for both of these propositions. It asks the question "what can video games do for AI", and discusses how in particular general video game playing is the ideal testbed for artificial general intelligence research. It the...

  11. Using Computer-Based Artificial Intelligence Technology to Help ESL Students.

    Science.gov (United States)

    Adams, Dennis M.

    This paper discusses ways in which artificial intelligence (AI) technologies may be used to aid students for whom English is a second language in the development of language and reading skills, and asserts that the coupling of technology with close adult-teacher contacts within a context of cultural precedents and social rewards is an important…

  12. Probability of Ship on Collision Courses Based on the New PAW Using MMG Model and AIS Data

    Directory of Open Access Journals (Sweden)

    I Putu Sindhu Asmara

    2015-03-01

    Full Text Available This paper proposes an estimation method for ships on collision courses taking crash astern maneuvers based on a new potential area of water (PAW for maneuvering. A crash astern maneuver is an emergency option a ship can take when exposed to the risk of a collision with other ships that have lost control. However, lateral forces and yaw moments exerted by the reversing propeller, as well as the uncertainty of the initial speed and initial yaw rate, will move the ship out of the intended stopping position landing it in a dangerous area. A new PAW for crash astern maneuvers is thus introduced. The PAW is developed based on a probability density function of the initial yaw rate. Distributions of the yaw rates and speeds are analyzed from automatic identification system (AIS data in Madura Strait, and estimated paths of the maneuvers are simulated using a mathematical maneuvering group model.

  13. FPGA Based Intelligent Co-operative Processor in Memory Architecture

    DEFF Research Database (Denmark)

    Ahmed, Zaki; Sotudeh, Reza; Hussain, Dil Muhammad Akbar

    2011-01-01

    benefits of PIM, a concept of Co-operative Intelligent Memory (CIM) was developed by the intelligent system group of University of Hertfordshire, based on the previously developed Co-operative Pseudo Intelligent Memory (CPIM). This paper provides an overview on previous works (CPIM, CIM) and realization......In a continuing effort to improve computer system performance, Processor-In-Memory (PIM) architecture has emerged as an alternative solution. PIM architecture incorporates computational units and control logic directly on the memory to provide immediate access to the data. To exploit the potential...

  14. Intelligent Transportation Control based on Proactive Complex Event Processing

    Directory of Open Access Journals (Sweden)

    Wang Yongheng

    2016-01-01

    Full Text Available Complex Event Processing (CEP has become the key part of Internet of Things (IoT. Proactive CEP can predict future system states and execute some actions to avoid unwanted states which brings new hope to intelligent transportation control. In this paper, we propose a proactive CEP architecture and method for intelligent transportation control. Based on basic CEP technology and predictive analytic technology, a networked distributed Markov decision processes model with predicting states is proposed as sequential decision model. A Q-learning method is proposed for this model. The experimental evaluations show that this method works well when used to control congestion in in intelligent transportation systems.

  15. [Artificial Intelligence in Drug Discovery].

    Science.gov (United States)

    Fujiwara, Takeshi; Kamada, Mayumi; Okuno, Yasushi

    2018-04-01

    According to the increase of data generated from analytical instruments, application of artificial intelligence(AI)technology in medical field is indispensable. In particular, practical application of AI technology is strongly required in "genomic medicine" and "genomic drug discovery" that conduct medical practice and novel drug development based on individual genomic information. In our laboratory, we have been developing a database to integrate genome data and clinical information obtained by clinical genome analysis and a computational support system for clinical interpretation of variants using AI. In addition, with the aim of creating new therapeutic targets in genomic drug discovery, we have been also working on the development of a binding affinity prediction system for mutated proteins and drugs by molecular dynamics simulation using supercomputer "Kei". We also have tackled for problems in a drug virtual screening. Our developed AI technology has successfully generated virtual compound library, and deep learning method has enabled us to predict interaction between compound and target protein.

  16. Artificial intelligence in radiology.

    Science.gov (United States)

    Hosny, Ahmed; Parmar, Chintan; Quackenbush, John; Schwartz, Lawrence H; Aerts, Hugo J W L

    2018-05-17

    Artificial intelligence (AI) algorithms, particularly deep learning, have demonstrated remarkable progress in image-recognition tasks. Methods ranging from convolutional neural networks to variational autoencoders have found myriad applications in the medical image analysis field, propelling it forward at a rapid pace. Historically, in radiology practice, trained physicians visually assessed medical images for the detection, characterization and monitoring of diseases. AI methods excel at automatically recognizing complex patterns in imaging data and providing quantitative, rather than qualitative, assessments of radiographic characteristics. In this Opinion article, we establish a general understanding of AI methods, particularly those pertaining to image-based tasks. We explore how these methods could impact multiple facets of radiology, with a general focus on applications in oncology, and demonstrate ways in which these methods are advancing the field. Finally, we discuss the challenges facing clinical implementation and provide our perspective on how the domain could be advanced.

  17. Intelligence

    Science.gov (United States)

    Sternberg, Robert J.

    2012-01-01

    Intelligence is the ability to learn from experience and to adapt to, shape, and select environments. Intelligence as measured by (raw scores on) conventional standardized tests varies across the lifespan, and also across generations. Intelligence can be understood in part in terms of the biology of the brain—especially with regard to the functioning in the prefrontal cortex—and also correlates with brain size, at least within humans. Studies of the effects of genes and environment suggest that the heritability coefficient (ratio of genetic to phenotypic variation) is between .4 and .8, although heritability varies as a function of socioeconomic status and other factors. Racial differences in measured intelligence have been observed, but race is a socially constructed rather than biological variable, so such differences are difficult to interpret. PMID:22577301

  18. Intelligence.

    Science.gov (United States)

    Sternberg, Robert J

    2012-03-01

    Intelligence is the ability to learn from experience and to adapt to, shape, and select environments. Intelligence as measured by (raw scores on) conventional standardized tests varies across the lifespan, and also across generations. Intelligence can be understood in part in terms of the biology of the brain-especially with regard to the functioning in the prefrontal cortex-and also correlates with brain size, at least within humans. Studies of the effects of genes and environment suggest that the heritability coefficient (ratio of genetic to phenotypic variation) is between .4 and .8, although heritability varies as a function of socioeconomic status and other factors. Racial differences in measured intelligence have been observed, but race is a socially constructed rather than biological variable, so such differences are difficult to interpret.

  19. Ada in AI or AI in Ada. On developing a rationale for integration

    Science.gov (United States)

    Collard, Philippe E.; Goforth, Andre

    1988-01-01

    The use of Ada as an Artificial Intelligence (AI) language is gaining interest in the NASA Community, i.e., by parties who have a need to deploy Knowledge Based-Systems (KBS) compatible with the use of Ada as the software standard for the Space Station. A fair number of KBS and pseudo-KBS implementations in Ada exist today. Currently, no widely used guidelines exist to compare and evaluate these with one another. The lack of guidelines illustrates a fundamental problem inherent in trying to compare and evaluate implementations of any sort in languages that are procedural or imperative in style, such as Ada, with those in languages that are functional in style, such as Lisp. Discussed are the strengths and weakness of using Ada as an AI language and a preliminary analysis provided of factors needed for the development of criteria for the integration of these two families of languages and the environments in which they are implemented. The intent for developing such criteria is to have a logical rationale that may be used to guide the development of Ada tools and methodology to support KBS requirements, and to identify those AI technology components that may most readily and effectively be deployed in Ada.

  20. Fixed Point Learning Based Intelligent Traffic Control System

    Science.gov (United States)

    Zongyao, Wang; Cong, Sui; Cheng, Shao

    2017-10-01

    Fixed point learning has become an important tool to analyse large scale distributed system such as urban traffic network. This paper presents a fixed point learning based intelligence traffic network control system. The system applies convergence property of fixed point theorem to optimize the traffic flow density. The intelligence traffic control system achieves maximum road resources usage by averaging traffic flow density among the traffic network. The intelligence traffic network control system is built based on decentralized structure and intelligence cooperation. No central control is needed to manage the system. The proposed system is simple, effective and feasible for practical use. The performance of the system is tested via theoretical proof and simulations. The results demonstrate that the system can effectively solve the traffic congestion problem and increase the vehicles average speed. It also proves that the system is flexible, reliable and feasible for practical use.

  1. Artificial Intelligence, Expert Systems, Natural Language Interfaces, Knowledge Engineering and the Librarian.

    Science.gov (United States)

    Davies, Jim

    This paper begins by examining concepts of artificial intelligence (AI) and discusses various definitions of the concept that have been suggested in the literature. The nesting relationship of expert systems within the broader framework of AI is described, and expert systems are characterized as knowledge-based systems (KBS) which attempt to solve…

  2. Artificial Intelligence and Expert Systems.

    Science.gov (United States)

    Wilson, Harold O.; Burford, Anna Marie

    1990-01-01

    Delineates artificial intelligence/expert systems (AI/ES) concepts; provides an exposition of some business application areas; relates progress; and creates an awareness of the benefits, limitations, and reservations of AI/ES. (Author)

  3. What Is Artificial Intelligence Anyway?

    Science.gov (United States)

    Kurzweil, Raymond

    1985-01-01

    Examines the past, present, and future status of Artificial Intelligence (AI). Acknowledges the limitations of AI but proposes possible areas of application and further development. Urges a concentration on the unique strengths of machine intelligence rather than a copying of human intelligence. (ML)

  4. Application of Artificial Intelligence Techniques in Uninhabited Aerial Vehicle Flight

    Science.gov (United States)

    Dufrene, Warren R., Jr.

    2004-01-01

    This paper describes the development of an application of Artificial Intelligence (AI) for Unmanned Aerial Vehicle (UAV) control. The project was done as part of the requirements for a class in AI at NOVA Southeastearn University and a beginning project at NASA Wallops Flight Facility for a resilient, robust, and intelligent UAV flight control system. A method is outlined which allows a base level application for applying an Artificial Intelligence method, Fuzzy Logic, to aspects of Control Logic for UAV flight. One element of UAV flight, automated altitude hold, has been implemented and preliminary results displayed.

  5. Application of Artificial Intelligence Techniques in Uninhabitated Aerial Vehicle Flight

    Science.gov (United States)

    Dufrene, Warren R., Jr.

    2003-01-01

    This paper describes the development of an application of Artificial Intelligence (AI) for Unmanned Aerial Vehicle (UAV) control. The project was done as part of the requirements for a class in AI at NOVA southeastern University and a beginning project at NASA Wallops Flight Facility for a resilient, robust, and intelligent UAV flight control system. A method is outlined which allows a base level application for applying an Artificial Intelligence method, Fuzzy Logic, to aspects of Control Logic for UAV flight. One element of UAV flight, automated altitude hold, has been implemented and preliminary results displayed.

  6. The coming of age of artificial intelligence in medicine

    OpenAIRE

    Patel, Vimla L.; Shortliffe, Edward H.; Stefanelli, Mario; Szolovits, Peter; Berthold, Michael R.; Bellazzi, Riccardo; Abu-Hanna, Ameen

    2009-01-01

    This paper is based on a panel discussion held at the Artificial Intelligence in Medicine Europe (AIME) conference in Amsterdam, The Netherlands, in July 2007. It had been more than 15 years since Edward Shortliffe gave a talk at AIME in which he characterized artificial intelligence (AI) in medicine as being in its “adolescence” (Shortliffe EH. The adolescence of AI in medicine: Will the field come of age in the ‘90s? Artificial Intelligence in Medicine 1993; 5:93–106). In this article, the ...

  7. Intelligent Transportation Control based on Proactive Complex Event Processing

    OpenAIRE

    Wang Yongheng; Geng Shaofeng; Li Qian

    2016-01-01

    Complex Event Processing (CEP) has become the key part of Internet of Things (IoT). Proactive CEP can predict future system states and execute some actions to avoid unwanted states which brings new hope to intelligent transportation control. In this paper, we propose a proactive CEP architecture and method for intelligent transportation control. Based on basic CEP technology and predictive analytic technology, a networked distributed Markov decision processes model with predicting states is p...

  8. Artificial intelligence for Space Station automation: Crew safety, productivity, autonomy, augmented capability

    Science.gov (United States)

    Firschein, O.; Georgeff, M. P.; Park, W.; Cheeseman, P. C.; Geldberg, J.

    1986-01-01

    Artificial intelligence (AI) R&D projects for the successful and efficient operation of the Space Station are described. The book explores the most advanced AI-based technologies, reviews the results of concept design studies to determine required AI capabilities, details demonstrations that would indicate the existence of these capabilities, and develops an R&D plan leading to such demonstrations. Particular attention is given to teleoperation and robotics, sensors, expert systems, computers, planning, and man-machine interface.

  9. Artificial Intelligence in Astronomy

    Science.gov (United States)

    Devinney, E. J.; Prša, A.; Guinan, E. F.; Degeorge, M.

    2010-12-01

    From the perspective (and bias) as Eclipsing Binary researchers, we give a brief overview of the development of Artificial Intelligence (AI) applications, describe major application areas of AI in astronomy, and illustrate the power of an AI approach in an application developed under the EBAI (Eclipsing Binaries via Artificial Intelligence) project, which employs Artificial Neural Network technology for estimating light curve solution parameters of eclipsing binary systems.

  10. Application of artificial intelligence in process control

    CERN Document Server

    Krijgsman, A

    1993-01-01

    This book is the result of a united effort of six European universities to create an overall course on the appplication of artificial intelligence (AI) in process control. The book includes an introduction to key areas including; knowledge representation, expert, logic, fuzzy logic, neural network, and object oriented-based approaches in AI. Part two covers the application to control engineering, part three: Real-Time Issues, part four: CAD Systems and Expert Systems, part five: Intelligent Control and part six: Supervisory Control, Monitoring and Optimization.

  11. Integrated Artificial Intelligence Approaches for Disease Diagnostics.

    Science.gov (United States)

    Vashistha, Rajat; Chhabra, Deepak; Shukla, Pratyoosh

    2018-06-01

    Mechanocomputational techniques in conjunction with artificial intelligence (AI) are revolutionizing the interpretations of the crucial information from the medical data and converting it into optimized and organized information for diagnostics. It is possible due to valuable perfection in artificial intelligence, computer aided diagnostics, virtual assistant, robotic surgery, augmented reality and genome editing (based on AI) technologies. Such techniques are serving as the products for diagnosing emerging microbial or non microbial diseases. This article represents a combinatory approach of using such approaches and providing therapeutic solutions towards utilizing these techniques in disease diagnostics.

  12. Imagining the thinking machine: technological myths and the rise of Artificial Intelligence

    OpenAIRE

    Natale, Simone; Ballatore, Andrea

    2017-01-01

    This article discusses the role of technological myths in the development of Artificial Intelligence (AI) technologies from 1950s to the early 1970s. It shows how the rise of AI was accompanied by the construction of a powerful cultural myth: the creation of a thinking machine, which would be able to perfectly simulate the cognitive faculties of the human mind. Based on a content analysis of articles on Artificial Intelligence published in two magazines, the Scientific American and the New Sc...

  13. Improved Fuzzy Logic based DTC of Induction machine for wide range of speed control using AI based controllers

    Directory of Open Access Journals (Sweden)

    H. Sudheer

    2016-06-01

    Full Text Available This paper presents improvements in Direct Torque control of induction motor using Fuzzy logic switching controller (FDTC. The conventional DTC (CDTC and FDTC drive performance is compared using Conventional PI, Fuzzy controller and Neural Network controllers. The major disadvantages of CDTC are high torque and flux ripples in steady state operation of the drive, inferior performance at low speed operation and variable switching frequency. The presence of hysteresis bands is the major reason for high torque and flux ripples in CDTC. In FDTC the hysteresis band and switching table are replaced by Fuzzy logic switching controller. Using fuzzy logic torque, stator flux space are divided into smaller subsections which results in precise and optimal selection of switching state to meet load torque. In high performance drives accurate tuning of PI speed controller is required. The conventional PI controller cannot adapt to the variation in model parameters. Artificial intelligence based fuzzy controller and neural network controller are compared with PI controller for both CDTC and FDTC of Induction machine. The proposed schemes are developed in Matlab/Simulink environment. Simulation results shows reduction in torque and flux ripples in FDTC and dynamic performance of the drive at low speeds and sudden change in load torque can be improved using Fuzzy logic controller compared to PI and neural network controller.

  14. Greenhouse intelligent control system based on microcontroller

    Science.gov (United States)

    Zhang, Congwei

    2018-04-01

    As one of the hallmarks of agricultural modernization, intelligent greenhouse has the advantages of high yield, excellent quality, no pollution and continuous planting. Taking AT89S52 microcontroller as the main controller, the greenhouse intelligent control system uses soil moisture sensor, temperature and humidity sensors, light intensity sensor and CO2 concentration sensor to collect measurements and display them on the 12864 LCD screen real-time. Meantime, climate parameter values can be manually set online. The collected measured values are compared with the set standard values, and then the lighting, ventilation fans, warming lamps, water pumps and other facilities automatically start to adjust the climate such as light intensity, CO2 concentration, temperature, air humidity and soil moisture of the greenhouse parameter. So, the state of the environment in the greenhouse Stabilizes and the crop grows in a suitable environment.

  15. Multiple intelligences and outcomes based education

    Directory of Open Access Journals (Sweden)

    Elaine Ridge

    2008-08-01

    Full Text Available This article explores the reasons that make it advantageous to develop learning programmes which draw on the theory of multiple intelligences (MI. A unitary view of intelligence privileges analytic/linguisticallygifted learners. The theory of MI, on the other hand, takes account of the diversity of learners and challenges educators to provide opportunities for them to use their varied intelligences.The outline of each of the eight intelligences demonstratesthe many ways in which learners can demonstrate their ability to excel. Application of these insights can complement the kind of transformatoryeducation envisaged in the Department of Education policy documents. MI translated into school practice has taken a variety of forms: project-basedapproaches, interdisciplinarycurriculums, entry points to lesson plans and complex assessments are only some of these. Ordinary classroom teachers can create diverse opportunities for all learners to enjoy a high measure of success.Hierdie artikel ondersoek die redes waarom dit voordelig is om leerprogramme te ontwikkel wal gebaseer is op idees uit die leorie van meervoudige intelligensies (MI.'n Unitêre siening van intelligensiebevoordeel analities- en taalbegaafde-leerders.Die MI-teorie, daarenleen neem die ongelyksoortigheidvan die leerders in ag en daag opvoeders uit om geleenthede te skep vir die leerlinge om verskeie van hulle intelligensies te gebruik. Die omskrywing van elk van die agt soorte intelligensies demonstreer die talryke-maniere waarop leerders hulle vermoë om uit te blink kan bewys.Die toepassing van hierdie insigte kan bydra tot die transformerendeaard van die opvoeding wat met die Departmentvan Opvoedkunde se beleidsdokumentebeoog word.MI toegepas in skoolpraktykneem verskillendevorms aan: projek-gebaseerdebenaderinge;interdissiplinêrekurrikulums; loelreepunte vir lesplanne en veelsydige assessering, om maar 'n paar te noem.Gewone klas-onderwysers kan 'n verskeidenheid geleenthede skep

  16. Energy Demand Forecasting: Combining Cointegration Analysis and Artificial Intelligence Algorithm

    OpenAIRE

    Huang, Junbing; Tang, Yuee; Chen, Shuxing

    2018-01-01

    Energy is vital for the sustainable development of China. Accurate forecasts of annual energy demand are essential to schedule energy supply and provide valuable suggestions for developing related industries. In the existing literature on energy use prediction, the artificial intelligence-based (AI-based) model has received considerable attention. However, few econometric and statistical evidences exist that can prove the reliability of the current AI-based model, an area that still needs to ...

  17. Web Intelligence and Artificial Intelligence in Education

    Science.gov (United States)

    Devedzic, Vladan

    2004-01-01

    This paper surveys important aspects of Web Intelligence (WI) in the context of Artificial Intelligence in Education (AIED) research. WI explores the fundamental roles as well as practical impacts of Artificial Intelligence (AI) and advanced Information Technology (IT) on the next generation of Web-related products, systems, services, and…

  18. 3rd Workshop on "Combinations of Intelligent Methods and Applications"

    CERN Document Server

    Palade, Vasile

    2013-01-01

    The combination of different intelligent methods is a very active research area in Artificial Intelligence (AI). The aim is to create integrated or hybrid methods that benefit from each of their components.  The 3rd Workshop on “Combinations of Intelligent Methods and Applications” (CIMA 2012) was intended to become a forum for exchanging experience and ideas among researchers and practitioners who are dealing with combining intelligent methods either based on first principles or in the context of specific applications. CIMA 2012 was held in conjunction with the 22nd European Conference on Artificial Intelligence (ECAI 2012).This volume includes revised versions of the papers presented at CIMA 2012.  .

  19. Alarm processing system using AI techniques for nuclear power plant

    International Nuclear Information System (INIS)

    Yang, Joon On; Chang, Soon Heung

    1990-01-01

    An alarm processing system (APS) has been developed using artificial intelligence (AI) techniques. The alarms of nuclear power plants (NPP's) are classified into the generalized and special alarms. The generalized alarms are also classified into the global and local alarms. For each type of alarms, the specific processing rules are applied to filter and suppress unnecessary and potentially misleading alarms. The local processing are based on 'model-based reasoning.' The global and special alarms are processed by using the general cause-consequence check rules. The priorities of alarms are determined according to the plant state and the consistencies between them

  20. Advances in Reasoning-Based Image Processing Intelligent Systems Conventional and Intelligent Paradigms

    CERN Document Server

    Nakamatsu, Kazumi

    2012-01-01

    The book puts special stress on the contemporary techniques for reasoning-based image processing and analysis: learning based image representation and advanced video coding; intelligent image processing and analysis in medical vision systems; similarity learning models for image reconstruction; visual perception for mobile robot motion control, simulation of human brain activity in the analysis of video sequences; shape-based invariant features extraction; essential of paraconsistent neural networks, creativity and intelligent representation in computational systems. The book comprises 14 chapters. Each chapter is a small monograph, representing resent investigations of authors in the area. The topics of the chapters cover wide scientific and application areas and complement each-other very well. The chapters’ content is based on fundamental theoretical presentations, followed by experimental results and comparison with similar techniques. The size of the chapters is well-ballanced which permits a thorough ...

  1. Dicty_cDB: FC-AI01 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI01 (Link to dictyBase) - - - Contig-U15592-1 FC-AI01E (Li...nk to Original site) - - - - - - FC-AI01E 307 Show FC-AI01 Library FC (Link to library) Clone ID FC-AI01 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI01Q.Seq.d/ Representative seq. ID FC-AI...01E (Link to Original site) Representative DNA sequence >FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq....uences producing significant alignments: (bits) Value FC-AI01 (FC-AI01Q) /CSM/FC/FC-AI/FC-AI01Q.Seq.d/ 68 8e

  2. Dicty_cDB: FC-AI13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

  3. APPROACH ON INTELLIGENT OPTIMIZATION DESIGN BASED ON COMPOUND KNOWLEDGE

    Institute of Scientific and Technical Information of China (English)

    Yao Jianchu; Zhou Ji; Yu Jun

    2003-01-01

    A concept of an intelligent optimal design approach is proposed, which is organized by a kind of compound knowledge model. The compound knowledge consists of modularized quantitative knowledge, inclusive experience knowledge and case-based sample knowledge. By using this compound knowledge model, the abundant quantity information of mathematical programming and the symbolic knowledge of artificial intelligence can be united together in this model. The intelligent optimal design model based on such a compound knowledge and the automatically generated decomposition principles based on it are also presented. Practically, it is applied to the production planning, process schedule and optimization of production process of a refining & chemical work and a great profit is achieved. Specially, the methods and principles are adaptable not only to continuous process industry, but also to discrete manufacturing one.

  4. AI mass spectrometers for space shuttle health monitoring

    Science.gov (United States)

    Adams, F. W.

    1991-01-01

    The facility Hazardous Gas Detection System (HGDS) at Kennedy Space Center (KSC) is a mass spectrometer based gas analyzer. Two instruments make up the HGDS, which is installed in a prime/backup arrangement, with the option of using both analyzers on the same sample line, or on two different lines simultaneously. It is used for monitoring the Shuttle during fuel loading, countdown, and drainback, if necessary. The use of complex instruments, operated over many shifts, has caused problems in tracking the status of the ground support equipment (GSE) and the vehicle. A requirement for overall system reliability has been a major force in the development of Shuttle GSE, and is the ultimate driver in the choice to pursue artificial intelligence (AI) techniques for Shuttle and Advanced Launch System (ALS) mass spectrometer systems. Shuttle applications of AI are detailed.

  5. Artificial intelligence in short term electric load forecasting: a state-of-the-art survey for the researcher

    Energy Technology Data Exchange (ETDEWEB)

    Metaxiotis, K.; Kagiannas, A.; Askounis, D.; Psarras, J. [National Technical University of Athens, Zografou (Turkey). Dept. of Electrical and Computer Engineering

    2003-06-01

    Intelligent solutions, based on artificial intelligence (AI) technologies, to solve complicated practical problems in various sectors are becoming more and more widespread nowadays. AI-based systems are being developed and deployed worldwide in myriad applications, mainly because of their symbolic reasoning, flexibility and explanation capabilities. This paper provides an overview for the researcher of AI technologies, as well as their current use in the field of short term electric load forecasting (STELF). The history of AI in STELF is outlined, leading to a discussion of the various approaches as well as the current research directions. The paper concludes by sharing thoughts and estimations on AI future prospects in this area. This review reveals that although still regarded as a novel methodology, AI technologies are shown to have matured to the point of offering real practical benefits in many of their applications. (Author)

  6. Implementasi Rule Base System dan Fuzzy Logic Artifical Intelligence pada Game Kartu Capsa

    OpenAIRE

    Pangkatodi, Edo; Liliana, Liliana; Budhi, Gregorius Satia

    2016-01-01

    In the era of globalization today, science and technology is developing very fast, particularly in entertainment media, specifically in the gaming world. Today, games are not only used as an entertainment, but also can be used as an alternative in the world of work, education, and even sports. In the world of gaming, artificial intelligence, or AI is a factor that cannot be separated. With the right methods and the specific rules of the AI can walk like a human being doing a job. So it is not...

  7. Epistasis analysis using artificial intelligence.

    Science.gov (United States)

    Moore, Jason H; Hill, Doug P

    2015-01-01

    Here we introduce artificial intelligence (AI) methodology for detecting and characterizing epistasis in genetic association studies. The ultimate goal of our AI strategy is to analyze genome-wide genetics data as a human would using sources of expert knowledge as a guide. The methodology presented here is based on computational evolution, which is a type of genetic programming. The ability to generate interesting solutions while at the same time learning how to solve the problem at hand distinguishes computational evolution from other genetic programming approaches. We provide a general overview of this approach and then present a few examples of its application to real data.

  8. A study on the applications of AI in finishing of additive manufacturing parts

    Science.gov (United States)

    Fathima Patham, K.

    2017-06-01

    Artificial intelligent and computer simulation are the technological powerful tools for solving complex problems in the manufacturing industries. Additive Manufacturing is one of the powerful manufacturing techniques that provide design flexibilities to the products. The products with complex shapes are directly manufactured without the need of any machining and tooling using Additive Manufacturing. However, the main drawback of the components produced using the Additive Manufacturing processes is the quality of the surfaces. This study aims to minimize the defects caused during Additive Manufacturing with the aid of Artificial Intelligence. The developed AI system has three layers, each layer is trying to eliminate or minimize the production errors. The first layer of the AI system optimizes the digitization of the 3D CAD model of the product and hence reduces the stair case errors. The second layer of the AI system optimizes the 3D printing machine parameters in order to eliminate the warping effect. The third layer of AI system helps to choose the surface finishing technique suitable for the printed component based on the Degree of Complexity of the product and the material. The efficiency of the developed AI system was examined on the functional parts such as gears.

  9. Metrological traceability in mass spectrometry-based targeted protein quantitation: a proof-of-principle study for serum apolipoproteins A-I and B100.

    Science.gov (United States)

    Smit, Nico P M; Romijn, Fred P H T M; van den Broek, Irene; Drijfhout, Jan W; Haex, Martin; van der Laarse, Arnoud; van der Burgt, Yuri E M; Cobbaert, Christa M

    2014-09-23

    In this study, we have followed up on previous liquid chromatography (LC) multiple reaction monitoring (MRM) mass spectrometry (MS) approaches for measurement of apolipoprotein (apo) A-I and apo B100 in serum aiming for implementation of a multiplexed assay in a clinical chemistry laboratory with full metrological traceability. Signature peptides were selected and detected by dynamic MRM, and stable isotope labeled (SIL)-peptides were used as internal standards. Five apo A-I and four apo B100 peptides were measured in serum digests with linearity (R(2)>0.992) in the physiologically relevant concentration ranges. Linearity with regard to protein concentration was ascertained at five concentration levels (R(2)>0.926 and R(2)>0.965, for the apo A-I and apo B100 peptides, respectively). Three native value-assigned sera were used as external calibrators for further method verification. Imprecision values on sample preparation and LC-MS/MS acquisition were below the established minimal specifications for apo A-I and apo B100 (5.0% and 5.3%, respectively). Correlation of LC-MS/MS results with immunoturbidimetric assay results, for normo- and hypertriglyceridemic samples, showed R(2)>0.944 for apo A-I and R(2)>0.964 for apo B100. This LC-MS/MS method has potential for clinical application in normo- and dyslipidemic patients. Measurement of apo A-I and apo B100 may offer an alternative to high and low density lipoprotein cholesterol (HDL-c and LDL-c) methods for cardiovascular disease risk assessment in dyslipidemic patients [1]. An LC-MS/MS method for apo A-I and apo B100 has the advantage of antibody independent and specific detection of protein signature peptides. The introduction of an LC-MS/MS method for apo A-I and apo B100 can serve as an example for many existing and newly developed (multiplex) biomarker methods in quantitative clinical chemistry proteomics (qCCP). Such LC-MS/MS methods should meet basic clinical chemistry principles with regard to test evaluation

  10. Melt-Dilute Form of AI-Based Spent Nuclear Fuel Disposal Criticality Summary Report

    International Nuclear Information System (INIS)

    D. Vinson; A. Serika

    2002-01-01

    Criticality analysis of the proposed melt-dilute (MD) form of aluminum-based spent nuclear fuel (SNF), under geologic repository conditions, was performed [1] following the methodology documented in the Disposal Criticality Analysis Methodology Topical Report [2]. This methodology evaluates the potential for nuclear criticality for a waste form in a waste package. Criticality calculations show that even with waste package failure, followed by degradation of material within the waste package and potential loss of neutron absorber materials, sub-critical conditions can be readily demonstrated for the MD form of aluminum-based SNF

  11. Adding Learning to Knowledge-Based Systems: Taking the "Artificial" Out of AI

    Science.gov (United States)

    Daniel L. Schmoldt

    1997-01-01

    Both, knowledge-based systems (KBS) development and maintenance require time-consuming analysis of domain knowledge. Where example cases exist, KBS can be built, and later updated, by incorporating learning capabilities into their architecture. This applies to both supervised and unsupervised learning scenarios. In this paper, the important issues for learning systems-...

  12. Behaviour based Mobile Robot Navigation Technique using AI System: Experimental Investigation on Active Media Pioneer Robot

    Directory of Open Access Journals (Sweden)

    S. Parasuraman, V.Ganapathy

    2012-10-01

    Full Text Available A key issue in the research of an autonomous robot is the design and development of the navigation technique that enables the robot to navigate in a real world environment. In this research, the issues investigated and methodologies established include (a Designing of the individual behavior and behavior rule selection using Alpha level fuzzy logic system  (b Designing of the controller, which maps the sensors input to the motor output through model based Fuzzy Logic Inference System and (c Formulation of the decision-making process by using Alpha-level fuzzy logic system. The proposed method is applied to Active Media Pioneer Robot and the results are discussed and compared with most accepted methods. This approach provides a formal methodology for representing and implementing the human expert heuristic knowledge and perception-based action in mobile robot navigation. In this approach, the operational strategies of the human expert driver are transferred via fuzzy logic to the robot navigation in the form of a set of simple conditional statements composed of linguistic variables.Keywards: Mobile robot, behavior based control, fuzzy logic, alpha level fuzzy logic, obstacle avoidance behavior and goal seek behavior

  13. UFC advisor: An AI-based system for the automatic test environment

    Science.gov (United States)

    Lincoln, David T.; Fink, Pamela K.

    1990-01-01

    The Air Logistics Command within the Air Force is responsible for maintaining a wide variety of aircraft fleets and weapon systems. To maintain these fleets and systems requires specialized test equipment that provides data concerning the behavior of a particular device. The test equipment is used to 'poke and prod' the device to determine its functionality. The data represent voltages, pressures, torques, temperatures, etc. and are called testpoints. These testpoints can be defined numerically as being in or out of limits/tolerance. Some test equipment is termed 'automatic' because it is computer-controlled. Due to the fact that effective maintenance in the test arena requires a significant amount of expertise, it is an ideal area for the application of knowledge-based system technology. Such a system would take testpoint data, identify values out-of-limits, and determine potential underlying problems based on what is out-of-limits and how far. This paper discusses the application of this technology to a device called the Unified Fuel Control (UFC) which is maintained in this manner.

  14. Design of intelligent house system based on Yeelink

    Directory of Open Access Journals (Sweden)

    Lin Zhi-Huang

    2016-01-01

    Full Text Available In order to monitor the security situation of house in real time, an intelligent house remote monitoring system is designed based on Yeelink cloud services and ZigBee wireless communication technology. This system includes three parts, ZigBee wireless sensor networks, intelligent house gateway and Yeelink Cloud Services. Users can access Yeelink website or APP to get real time information in the house, receiving information including gas concentration, temperature. Also, remote commands can be sent from mobile devices to control the household appliances. The user who can monitor and control the house effectively through a simple and convenient user interface, will feel much more safe and comfortable.

  15. Intelligent Shutter Speech Control System Based on DSP

    Directory of Open Access Journals (Sweden)

    Yonghong Deng

    2017-01-01

    Full Text Available Based on TMS320F28035 DSP, this paper designed a smart shutters voice control system, which realized the functions of opening and closing shutters, intelligent switching of lighting mode and solar power supply through voice control. The traditional control mode is converted to voice control at the same time with automatic lighting and solar power supply function. In the convenience of people’s lives at the same time more satisfied with today’s people on the intelligent and environmental protection of the two concepts of the pursuit. The whole system is simple, low cost, safe and reliable.

  16. Machine Learning-based Intelligent Formal Reasoning and Proving System

    Science.gov (United States)

    Chen, Shengqing; Huang, Xiaojian; Fang, Jiaze; Liang, Jia

    2018-03-01

    The reasoning system can be used in many fields. How to improve reasoning efficiency is the core of the design of system. Through the formal description of formal proof and the regular matching algorithm, after introducing the machine learning algorithm, the system of intelligent formal reasoning and verification has high efficiency. The experimental results show that the system can verify the correctness of propositional logic reasoning and reuse the propositional logical reasoning results, so as to obtain the implicit knowledge in the knowledge base and provide the basic reasoning model for the construction of intelligent system.

  17. Personalized E- learning System Based on Intelligent Agent

    Science.gov (United States)

    Duo, Sun; Ying, Zhou Cai

    Lack of personalized learning is the key shortcoming of traditional e-Learning system. This paper analyzes the personal characters in e-Learning activity. In order to meet the personalized e-learning, a personalized e-learning system based on intelligent agent was proposed and realized in the paper. The structure of system, work process, the design of intelligent agent and the realization of intelligent agent were introduced in the paper. After the test use of the system by certain network school, we found that the system could improve the learner's initiative participation, which can provide learners with personalized knowledge service. Thus, we thought it might be a practical solution to realize self- learning and self-promotion in the lifelong education age.

  18. Active Probing Feedback based Self Configurable Intelligent Distributed Antenna System

    DEFF Research Database (Denmark)

    Kumar, Ambuj

    collectively as Place Time Coverage & Capacity (PTC2). The dissertation proves through the concept of the PTC2 that the network performance can severely be degraded by the excessive and unrealistic site demands, the network management inefficiency, and the consequence of the accumulation of subscribers...... challenge through a viable solution that is based on injecting intelligence and services in parallel layers through a Distributed Antenna Systems (DAS) network. This approach would enable the remote sites to acquire intelligence and a resource pool at the same time, thereby managing the network dynamics...... promptly and aptly to absorb the PTC2 wobble. An Active Probing Management System (APMS) is proposed as a supporting architecture, to assist the intelligent system to keep a check on the variations at each and every site by either deploying the additional antenna or by utilising the service antenna...

  19. [Artificial intelligence--the knowledge base applied to nephrology].

    Science.gov (United States)

    Sancipriano, G P

    2005-01-01

    The idea that efficacy efficiency, and quality in medicine could not be reached without sorting the huge knowledge of medical and nursing science is very common. Engineers and computer scientists have developed medical software with great prospects for success, but currently these software applications are not so useful in clinical practice. The medical doctor and the trained nurse live the 'information age' in many daily activities, but the main benefits are not so widespread in working activities. Artificial intelligence and, particularly, export systems charm health staff because of their potential. The first part of this paper summarizes the characteristics of 'weak artificial intelligence' and of expert systems important in clinical practice. The second part discusses medical doctors' requirements and the current nephrologic knowledge bases available for artificial intelligence development.

  20. Artificial intelligence in nuclear engineering: developments, lesson learned and future directions

    Energy Technology Data Exchange (ETDEWEB)

    Ruan, Da [The Belgian Nuclear Research Centre (SCK.CEN), Mol (Belgium)]. E-mail: druan@sckcen.be

    2005-07-01

    Full text of publication follows: In this lecture, an overview on artificial intelligence (AI) from control to decision making in nuclear engineering will be given mainly based on the 10 years progress of the FLINS forum (Fuzzy Logic and Intelligent Technology in Nuclear Science). Some FLINS concrete examples on nuclear reactor operation, nuclear safeguards information management, and cost estimation under uncertainty for a large nuclear project will be illustrated for the potential use of AI in nuclear engineering. Recommendations and future research directions on AI in nuclear engineering will be suggested from a practical point of view. (author)

  1. Artificial intelligence in nuclear engineering: developments, lesson learned and future directions

    International Nuclear Information System (INIS)

    Ruan, Da

    2005-01-01

    Full text of publication follows: In this lecture, an overview on artificial intelligence (AI) from control to decision making in nuclear engineering will be given mainly based on the 10 years progress of the FLINS forum (Fuzzy Logic and Intelligent Technology in Nuclear Science). Some FLINS concrete examples on nuclear reactor operation, nuclear safeguards information management, and cost estimation under uncertainty for a large nuclear project will be illustrated for the potential use of AI in nuclear engineering. Recommendations and future research directions on AI in nuclear engineering will be suggested from a practical point of view. (author)

  2. Enhancing reliable online transaction with intelligent rule-based ...

    African Journals Online (AJOL)

    Enhancing reliable online transaction with intelligent rule-based fraud detection technique. ... These are with a bid to reducing amongst other things the cost of production and also dissuade the poor handling of Nigeria currency. The CBN pronouncement has necessitated the upsurge in transactions completed with credit ...

  3. Towards an Intelligent Planning Knowledge Base Development Environment

    Science.gov (United States)

    Chien, S.

    1994-01-01

    ract describes work in developing knowledge base editing and debugging tools for the Multimission VICAR Planner (MVP) system. MVP uses artificial intelligence planning techniques to automatically construct executable complex image processing procedures (using models of the smaller constituent image processing requests made to the JPL Multimission Image Processing Laboratory.

  4. A generic model for camera based intelligent road crowd control ...

    African Journals Online (AJOL)

    This research proposes a model for intelligent traffic flow control by implementing camera based surveillance and feedback system. A series of cameras are set minimum three signals ahead from the target junction. The complete software system is developed to help integrating the multiple camera on road as feedback to ...

  5. Intelligent Web-Based English Instruction in Middle Schools

    Science.gov (United States)

    Jia, Jiyou

    2015-01-01

    The integration of technology into educational environments has become more prominent over the years. The combination of technology and face-to-face interaction with instructors allows for a thorough, more valuable educational experience. "Intelligent Web-Based English Instruction in Middle Schools" addresses the concerns associated with…

  6. Ontology-based intelligent fuzzy agent for diabetes application

    NARCIS (Netherlands)

    Acampora, G.; Lee, C.-S.; Wang, M.-H.; Hsu, C.-Y.; Loia, V.

    2009-01-01

    It is widely pointed out that classical ontologies are not sufficient to deal with imprecise and vague knowledge for some real world applications, but the fuzzy ontology can effectively solve data and knowledge with uncertainty. In this paper, an ontology-based intelligent fuzzy agent (OIFA),

  7. An Artificial Intelligence-Based Distance Education System: Artimat

    Science.gov (United States)

    Nabiyev, Vasif; Karal, Hasan; Arslan, Selahattin; Erumit, Ali Kursat; Cebi, Ayca

    2013-01-01

    The purpose of this study is to evaluate the artificial intelligence-based distance education system called ARTIMAT, which has been prepared in order to improve mathematical problem solving skills of the students, in terms of conceptual proficiency and ease of use with the opinions of teachers and students. The implementation has been performed…

  8. Artificial Intelligence Applications for Education: Promise, ...Promises.

    Science.gov (United States)

    Adams, Dennis M.; Hamm, Mary

    1988-01-01

    Surveys the current status of artificial intelligence (AI) technology. Discusses intelligent tutoring systems, robotics, and applications for educators. Likens the status of AI at present to that of aviation in the very early 1900s. States that educators need to be involved in future debates concerning AI. (CW)

  9. Implementing embedded artificial intelligence rules within algorithmic programming languages

    Science.gov (United States)

    Feyock, Stefan

    1988-01-01

    Most integrations of artificial intelligence (AI) capabilities with non-AI (usually FORTRAN-based) application programs require the latter to execute separately to run as a subprogram or, at best, as a coroutine, of the AI system. In many cases, this organization is unacceptable; instead, the requirement is for an AI facility that runs in embedded mode; i.e., is called as subprogram by the application program. The design and implementation of a Prolog-based AI capability that can be invoked in embedded mode are described. The significance of this system is twofold: Provision of Prolog-based symbol-manipulation and deduction facilities makes a powerful symbolic reasoning mechanism available to applications programs written in non-AI languages. The power of the deductive and non-procedural descriptive capabilities of Prolog, which allow the user to describe the problem to be solved, rather than the solution, is to a large extent vitiated by the absence of the standard control structures provided by other languages. Embedding invocations of Prolog rule bases in programs written in non-AI languages makes it possible to put Prolog calls inside DO loops and similar control constructs. The resulting merger of non-AI and AI languages thus results in a symbiotic system in which the advantages of both programming systems are retained, and their deficiencies largely remedied.

  10. An introduction to artificial intelligence and its potential use in space systems.

    OpenAIRE

    McDonald, Gary Wayne

    1986-01-01

    Approved for public release; distribution is unlimited This thesis provides an introduction to Artificial Intelligence and Space Systems, with comments regarding their integration. The survey of Artificial Intelligence (AI) is based upon a review of its history, its philosophical development, and subcategories of its current technologies. These subcategories are Expert Systems (ES), Natural Language Processing (NLP), Computer Vision and Pattern Recognition, and Robotic...

  11. Games and Machine Learning: A Powerful Combination in an Artificial Intelligence Course

    Science.gov (United States)

    Wallace, Scott A.; McCartney, Robert; Russell, Ingrid

    2010-01-01

    Project MLeXAI [Machine Learning eXperiences in Artificial Intelligence (AI)] seeks to build a set of reusable course curriculum and hands on laboratory projects for the artificial intelligence classroom. In this article, we describe two game-based projects from the second phase of project MLeXAI: Robot Defense--a simple real-time strategy game…

  12. Effects of different five-day progesterone-based fixed-time AI protocols on follicular/luteal dynamics and fertility in dairy cows

    Science.gov (United States)

    GARCIA-ISPIERTO, Irina; LÓPEZ-GATIUS, Fernando

    2014-01-01

    This study compares in two experiments the responses of lactating dairy cows to four different progesterone-based protocols for fixed-time artificial insemination (FTAI) in terms of their effects on follicular/luteal dynamics and fertility. The protocols consisted of a progesterone intravaginal device fitted for five days, along with the administration of different combinations of gonadotropin releasing hormone, equine chorionic gonadotropin and a single or double dose (24 h apart) of prostaglandin F2α. In Experiment I, the data were derived from 232 lactating cows. Binary logistic regression identified no effects of treatment on ovulation failure or multiple ovulation 10 days post artificial insemination (AI). Based on the odds ratio, the likelihood of ovulation failure was lower (by a factor of 0.1) in cows showing at least one corpus luteum (CL) upon treatment than in cows lacking a CL; repeat breeders (> 3 AI) and cows with multiple CLs at treatment showed lower (by a factor of 0.44) and higher (by a factor of 9.0) risks of multiple ovulation, respectively, than the remaining animals. In Experiment II, the data were derived from 5173 AIs. The independent variable treatment failed to affect the conception rate 28–34 days post AI, twin pregnancy or early fetal loss 58–64 days post AI. The results of this study demonstrate the efficacy of 5-day progesterone-based protocols for FTAI. All four protocols examined were able to induce ovulation in both cyclic and non-cyclic animals so that FTAI returned a similar pregnancy rate to spontaneous estrus. Our results suggest that the ovarian response and fertility resulting from each treatment are due more to the effect of ovarian structures at treatment than to the different combinations of hormones investigated. PMID:25196275

  13. Reflection on robotic intelligence

    NARCIS (Netherlands)

    Bartneck, C.

    2006-01-01

    This paper reflects on the development or robots, both their physical shape as well as their intelligence. The later strongly depends on the progress made in the artificial intelligence (AI) community which does not yet provide the models and tools necessary to create intelligent robots. It is time

  14. Brain Intelligence: Go Beyond Artificial Intelligence

    OpenAIRE

    Lu, Huimin; Li, Yujie; Chen, Min; Kim, Hyoungseop; Serikawa, Seiichi

    2017-01-01

    Artificial intelligence (AI) is an important technology that supports daily social life and economic activities. It contributes greatly to the sustainable growth of Japan's economy and solves various social problems. In recent years, AI has attracted attention as a key for growth in developed countries such as Europe and the United States and developing countries such as China and India. The attention has been focused mainly on developing new artificial intelligence information communication ...

  15. Discrete simulation system based on artificial intelligence methods

    Energy Technology Data Exchange (ETDEWEB)

    Futo, I; Szeredi, J

    1982-01-01

    A discrete event simulation system based on the AI language Prolog is presented. The system called t-Prolog extends the traditional possibilities of simulation languages toward automatic problem solving by using backtrack in time and automatic model modification depending on logical deductions. As t-Prolog is an interactive tool, the user has the possibility to interrupt the simulation run to modify the model or to force it to return to a previous state for trying possible alternatives. It admits the construction of goal-oriented or goal-seeking models with variable structure. Models are defined in a restricted version of the first order predicate calculus using Horn clauses. 21 references.

  16. Multisensor system and artificial intelligence in housing for the elderly.

    Science.gov (United States)

    Chan, M; Bocquet, H; Campo, E; Val, T; Estève, D; Pous, J

    1998-01-01

    To improve the safety of a growing proportion of elderly and disabled people in the developed countries, a multisensor system based on Artificial Intelligence (AI), Advanced Telecommunications (AT) and Information Technology (IT) has been devised and fabricated. Thus, the habits and behaviours of these populations will be recorded without disturbing their daily activities. AI will diagnose any abnormal behavior or change and the system will warn the professionals. Gerontology issues are presented together with the multisensor system, the AI-based learning and diagnosis methodology and the main functionalities.

  17. FRET-based biosensors for the detection and quantification of AI-2 class of quorum sensing compounds.

    Science.gov (United States)

    Rajamani, Sathish; Sayre, Richard

    2011-01-01

    Intercellular small molecular weight signaling molecules modulate a variety of biological functions in bacteria. One of the more complex behaviors mediated by intercellular signaling molecules is the suite of activities regulated by quorum sensing molecules. These molecules mediate a variety of population-dependent responses, including the expression of genes that regulate bioluminescence, type III secretion, siderophore production, colony morphology, biofilm formation, and metalloprotease production. Given their central role in regulating these responses, the detection and quantification of QS molecules has important practical implications. Until recently, the detection of QS molecules from Gram-negative bacteria has relied primarily on bacterial reporter systems. These bioassays though immensely useful are subject to interference by compounds that affect bacterial growth and metabolism. In addition, the reporter response is highly dependent on culture age and cell population density. To overcome such limitations, we developed an in vitro protein-based assay system for the rapid detection and quantification of the furanosyl borate diester (BAI-2) subclass of autoinducer-2 (AI-2) QS molecules. The biosensor is based on the interaction of BAI-2 with the Vibrio harveyi QS receptor LuxP. Conformation changes associated with BAI-2 binding to the LuxP receptor change the orientation of cyan and yellow variants of GFP (CFP and YFP) fused the N- and C-termini, respectively, of the LuxP receptor. LuxP-BAI2 binding induces changes in fluorescence resonance energy transfer (FRET) between CFP and YFP, whose magnitude of change is ligand concentration dependent. A set of ligand-insensitive LuxP-mutant FRET protein sensor was also developed for use as control biosensors. The FRET-based BAI-2 biosensor responds selectively to both synthetic and biologically derived BAI-2compounds. This report describes the use of the LuxP-FRET biosensor for the detection and quantification of

  18. Applications of artificial intelligence 1993: Knowledge-based systems in aerospace and industry; Proceedings of the Meeting, Orlando, FL, Apr. 13-15, 1993

    Science.gov (United States)

    Fayyad, Usama M. (Editor); Uthurusamy, Ramasamy (Editor)

    1993-01-01

    The present volume on applications of artificial intelligence with regard to knowledge-based systems in aerospace and industry discusses machine learning and clustering, expert systems and optimization techniques, monitoring and diagnosis, and automated design and expert systems. Attention is given to the integration of AI reasoning systems and hardware description languages, care-based reasoning, knowledge, retrieval, and training systems, and scheduling and planning. Topics addressed include the preprocessing of remotely sensed data for efficient analysis and classification, autonomous agents as air combat simulation adversaries, intelligent data presentation for real-time spacecraft monitoring, and an integrated reasoner for diagnosis in satellite control. Also discussed are a knowledge-based system for the design of heat exchangers, reuse of design information for model-based diagnosis, automatic compilation of expert systems, and a case-based approach to handling aircraft malfunctions.

  19. AI, automation and the Flight Telerobotic Servicer

    Science.gov (United States)

    Goforth, Andre; Dominy, Robert

    1988-01-01

    A NASA study for the preliminary definition of a teleoperated robotic device has been recently completed. The Fligt Telerobotic Servicer (FTS) will be used to assist astronauts in many of the on-board tasks of assembly, maintenance, servicing, and inspection of the Space Station. The role of artificial intelligence (AI) in furthering the FTS automation capabilities and, hence, extending its capacity for growth and evolution is discussed. Relevant system engineering issues are identified, and an approach for insertion of AI technology is presented in terms of the NASA/NBS Standard Reference Model control architecture NASREM.

  20. Design of an intelligent materials data base for the IFR

    International Nuclear Information System (INIS)

    Mikaili, R.; Lambert, J.D.B.; Orth, T.D.

    1992-01-01

    In the development of the integral fast reactor (IFR) concept, there is a consensus that materials considerations are an important part of the reactor design, operation, and maintenance and that materials performance is central to liquid-metal reactor reliability and safety. In the design of the IRF materials data base, artificial intelligence techniques are being used to ensure efficient control of information. Intelligent control will provide for the selection of menus to be displayed, efficient data-base searches, and application-dependent guidance through the data base. The development of the IRF data base has progressed to the point of (a) completing the design of the data-base architecture and tables, (b) installing computer hardware for storing large amounts of data, (c) outlining strategies for data transferal, and (d) identifying ways to validate and secure the integrity of data

  1. Artificial Intelligence Application in Power Generation Industry: Initial considerations

    Science.gov (United States)

    Ismail, Rahmat Izaizi B.; Ismail Alnaimi, Firas B.; AL-Qrimli, Haidar F.

    2016-03-01

    With increased competitiveness in power generation industries, more resources are directed in optimizing plant operation, including fault detection and diagnosis. One of the most powerful tools in faults detection and diagnosis is artificial intelligence (AI). Faults should be detected early so correct mitigation measures can be taken, whilst false alarms should be eschewed to avoid unnecessary interruption and downtime. For the last few decades there has been major interest towards intelligent condition monitoring system (ICMS) application in power plant especially with AI development particularly in artificial neural network (ANN). ANN is based on quite simple principles, but takes advantage of their mathematical nature, non-linear iteration to demonstrate powerful problem solving ability. With massive possibility and room for improvement in AI, the inspiration for researching them are apparent, and literally, hundreds of papers have been published, discussing the findings of hybrid AI for condition monitoring purposes. In this paper, the studies of ANN and genetic algorithm (GA) application will be presented.

  2. APPLYING ARTIFICIAL INTELLIGENCE TECHNIQUES TO HUMAN-COMPUTER INTERFACES

    DEFF Research Database (Denmark)

    Sonnenwald, Diane H.

    1988-01-01

    A description is given of UIMS (User Interface Management System), a system using a variety of artificial intelligence techniques to build knowledge-based user interfaces combining functionality and information from a variety of computer systems that maintain, test, and configure customer telephone...... and data networks. Three artificial intelligence (AI) techniques used in UIMS are discussed, namely, frame representation, object-oriented programming languages, and rule-based systems. The UIMS architecture is presented, and the structure of the UIMS is explained in terms of the AI techniques....

  3. Atom-type-based AI topological descriptors: application in structure-boiling point correlations of oxo organic compounds.

    Science.gov (United States)

    Ren, Biye

    2003-01-01

    Structure-boiling point relationships are studied for a series of oxo organic compounds by means of multiple linear regression (MLR) analysis. Excellent MLR models based on the recently introduced Xu index and the atom-type-based AI indices are obtained for the two subsets containing respectively 77 ethers and 107 carbonyl compounds and a combined set of 184 oxo compounds. The best models are tested using the leave-one-out cross-validation and an external test set, respectively. The MLR model produces a correlation coefficient of r = 0.9977 and a standard error of s = 3.99 degrees C for the training set of 184 compounds, and r(cv) = 0.9974 and s(cv) = 4.16 degrees C for the cross-validation set, and r(pred) = 0.9949 and s(pred) = 4.38 degrees C for the prediction set of 21 compounds. For the two subsets containing respectively 77 ethers and 107 carbonyl compounds, the quality of the models is further improved. The standard errors are reduced to 3.30 and 3.02 degrees C, respectively. Furthermore, the results obtained from this study indicate that the boiling points of the studied oxo compound dominantly depend on molecular size and also depend on individual atom types, especially oxygen heteroatoms in molecules due to strong polar interactions between molecules. These excellent structure-boiling point models not only provide profound insights into the role of structural features in a molecule but also illustrate the usefulness of these indices in QSPR/QSAR modeling of complex compounds.

  4. [Control of intelligent car based on electroencephalogram and neurofeedback].

    Science.gov (United States)

    Li, Song; Xiong, Xin; Fu, Yunfa

    2018-02-01

    To improve the performance of brain-controlled intelligent car based on motor imagery (MI), a method based on neurofeedback (NF) with electroencephalogram (EEG) for controlling intelligent car is proposed. A mental strategy of MI in which the energy column diagram of EEG features related to the mental activity is presented to subjects with visual feedback in real time to train them to quickly master the skills of MI and regulate their EEG activity, and combination of multi-features fusion of MI and multi-classifiers decision were used to control the intelligent car online. The average, maximum and minimum accuracy of identifying instructions achieved by the trained group (trained by the designed feedback system before the experiment) were 85.71%, 90.47% and 76.19%, respectively and the corresponding accuracy achieved by the control group (untrained) were 73.32%, 80.95% and 66.67%, respectively. For the trained group, the average, longest and shortest time consuming were 92 s, 101 s, and 85 s, respectively, while for the control group the corresponding time were 115.7 s, 120 s, and 110 s, respectively. According to the results described above, it is expected that this study may provide a new idea for the follow-up development of brain-controlled intelligent robot by the neurofeedback with EEG related to MI.

  5. A regulator's viewpoint on the use of AI in the nuclear industry

    International Nuclear Information System (INIS)

    Wainwright, N.

    1995-01-01

    The regulatory position within the UK places the responsibility for safety on a nuclear site with the licensee. The licensee must produce a safety case that demonstrates that the plant is safe. Assessment of this safety case is performed by the regulator in the Health and Safety Executive (HSE) using HSE's published Safety Assessment Principles. This paper presents the personal views of a regulator on the use of artificial intelligence (AI) in the nuclear industry. The AI-based system considered are restricted to expert systems, neural networks and fuzzy logic. Some of the safety issues are discussed. The particular concerns associated with software-based systems are compounded by some of the inherent problems of AI-based systems. Such is the nature of these concerns that an acceptable safety case will be difficult to mount for safety systems and post-accident monitoring systems. However, given the present maturity of the technology, acceptable safety cases might be formulated in the areas of operator advisory systems designed to reduce accident frequencies, and robotics where dose reduction is important. There are also arguments that suggests that suitable safety cases could be formulated for AI-based plant control systems. Nevertheless, AI-based systems should be treated with caution - further research is required into suitable designs and safety demonstration techniques. (author)

  6. Intelligent Transportation and Evacuation Planning A Modeling-Based Approach

    CERN Document Server

    Naser, Arab

    2012-01-01

    Intelligent Transportation and Evacuation Planning: A Modeling-Based Approach provides a new paradigm for evacuation planning strategies and techniques. Recently, evacuation planning and modeling have increasingly attracted interest among researchers as well as government officials. This interest stems from the recent catastrophic hurricanes and weather-related events that occurred in the southeastern United States (Hurricane Katrina and Rita). The evacuation methods that were in place before and during the hurricanes did not work well and resulted in thousands of deaths. This book offers insights into the methods and techniques that allow for implementing mathematical-based, simulation-based, and integrated optimization and simulation-based engineering approaches for evacuation planning. This book also: Comprehensively discusses the application of mathematical models for evacuation and intelligent transportation modeling Covers advanced methodologies in evacuation modeling and planning Discusses principles a...

  7. Artificial Intelligence: The Expert Way.

    Science.gov (United States)

    Bitter, Gary G.

    1989-01-01

    Discussion of artificial intelligence (AI) and expert systems focuses on their use in education. Characteristics of good expert systems are explained; computer software programs that contain applications of AI are described, highlighting one used to help educators identify learning-disabled students; and the future of AI is discussed. (LRW)

  8. An Intelligent Agent based Architecture for Visual Data Mining

    OpenAIRE

    Hamdi Ellouzi; Hela Ltifi; Mounir Ben Ayed

    2016-01-01

    the aim of this paper is to present an intelligent architecture of Decision Support System (DSS) based on visual data mining. This architecture applies the multi-agent technology to facilitate the design and development of DSS in complex and dynamic environment. Multi-Agent Systems add a high level of abstraction. To validate the proposed architecture, it is implemented to develop a distributed visual data mining based DSS to predict nosocomial infectionsoccurrence in intensive care units. Th...

  9. Study of intelligent building system based on the internet of things

    Science.gov (United States)

    Wan, Liyong; Xu, Renbo

    2017-03-01

    In accordance with the problem such as isolated subsystems, weak system linkage and expansibility of the bus type buildings management system, this paper based on the modern intelligent buildings has studied some related technologies of the intelligent buildings and internet of things, and designed system architecture of the intelligent buildings based on the Internet of Things. Meanwhile, this paper has also analyzed wireless networking modes, wireless communication protocol and wireless routing protocol of the intelligent buildings based on the Internet of Things.

  10. On how AI & Law can help autonomous systems obey the law: a position paper

    NARCIS (Netherlands)

    Prakken, Hendrik

    2016-01-01

    In this position paper I discuss to what extent current and past AI & law research is relevant for research on autonomous intelligent systems that exhibit legally relevant behaviour. After a brief review of the history of AI & law, I will compare the problems faced by autonomous intelligent systems

  11. In Silico Testing of an Artificial-Intelligence-Based Artificial Pancreas Designed for Use in the Intensive Care Unit Setting.

    Science.gov (United States)

    DeJournett, Leon; DeJournett, Jeremy

    2016-11-01

    Effective glucose control in the intensive care unit (ICU) setting has the potential to decrease morbidity and mortality rates which should in turn lead to decreased health care expenditures. Current ICU-based glucose controllers are mathematically derived, and tend to be based on proportional integral derivative (PID) or model predictive control (MPC). Artificial intelligence (AI)-based closed loop glucose controllers may have the ability to achieve control that improves on the results achieved by either PID or MPC controllers. We conducted an in silico analysis of an AI-based glucose controller designed for use in the ICU setting. This controller was tested using a mathematical model of the ICU patient's glucose-insulin system. A total of 126 000 unique 5-day simulations were carried out, resulting in 107 million glucose values for analysis. For the 7 control ranges tested, with a sensor error of ±10%, the following average results were achieved: (1) time in control range, 94.2%, (2) time in range 70-140 mg/dl, 97.8%, (3) time in hyperglycemic range (>140 mg/dl), 2.1%, and (4) time in hypoglycemic range (artificial pancreas system for use in the ICU setting. © 2016 Diabetes Technology Society.

  12. Development of intelligent interface for simulation execution by module-based simulation system

    International Nuclear Information System (INIS)

    Yoshikawa, Hidekazu; Mizutani, Naoki; Shimoda, Hiroshi; Wakabayashi, Jiro

    1988-01-01

    An intelligent user support for the two phases of simulation execution was newly developed for Module-based Simulation System (MSS). The MSS has been in development as a flexible simulation environment to improve software productivity in complex, large-scale dynamic simulation of nuclear power plant. The AI programing by Smalltalk-80 was applied to materialize the two user-interface programs for (i) semantic diagnosis of the simulation program generated automatically by MSS, and (ii) consultation system by which user can set up consistent numerical input data files necessary for executing a MSS-generated program. Frame theory was utilized in those interface programs to represent the four knowledge bases, which are (i) usage information on module library in MSS and MSS-generated program, and (ii) expertise knowledge on nuclear power plant analysis such as material properties and reactor system configuration. Capabilities of those interface programs were confirmed by some example practice on LMFBR reactor dynamic calculation, and it was demonstrated that the knowledge-based systemization was effective to improve software work environment. (author)

  13. Autonomously Generating Operations Sequences for a Mars Rover Using Artificial Intelligence-Based Planning

    Science.gov (United States)

    Sherwood, R.; Mutz, D.; Estlin, T.; Chien, S.; Backes, P.; Norris, J.; Tran, D.; Cooper, B.; Rabideau, G.; Mishkin, A.; Maxwell, S.

    2001-07-01

    This article discusses a proof-of-concept prototype for ground-based automatic generation of validated rover command sequences from high-level science and engineering activities. This prototype is based on ASPEN, the Automated Scheduling and Planning Environment. This artificial intelligence (AI)-based planning and scheduling system will automatically generate a command sequence that will execute within resource constraints and satisfy flight rules. An automated planning and scheduling system encodes rover design knowledge and uses search and reasoning techniques to automatically generate low-level command sequences while respecting rover operability constraints, science and engineering preferences, environmental predictions, and also adhering to hard temporal constraints. This prototype planning system has been field-tested using the Rocky 7 rover at JPL and will be field-tested on more complex rovers to prove its effectiveness before transferring the technology to flight operations for an upcoming NASA mission. Enabling goal-driven commanding of planetary rovers greatly reduces the requirements for highly skilled rover engineering personnel. This in turn greatly reduces mission operations costs. In addition, goal-driven commanding permits a faster response to changes in rover state (e.g., faults) or science discoveries by removing the time-consuming manual sequence validation process, allowing rapid "what-if" analyses, and thus reducing overall cycle times.

  14. A Review and Performance Investigation of NPCC Based UPQC by Using Various Artificial Intelligence Techniques

    Directory of Open Access Journals (Sweden)

    Venkata Rami Reddy K

    2017-03-01

    Full Text Available This paper presents a comprehensive review and performance investigation of Neutral Point Clamped Converter (NPCC based Unified Power Quality Conditioner (UPQC by using Artificial Intelligent (AI techniques. A Novel application of various levels of Diode Clamped Multi-Level Inverters [DCMLI] with Anti Phase Opposition and Disposition (APOD Pulse Width Modulation (PWM Scheme to Unified Power Quality Conditioner (UPQC. The Power Quality problem became a burning issues since the starting of high voltage AC transmission system. Hence, in this article it has been discussed to mitigate the PQ issues in high voltage AC systems through a three phase four wire Unified Power Quality Conditioner (UPQC under non-linear loads. The emphasised PQ problems such as voltage and current harmonics along with voltage sags and swells have also been discussed with improved performance. Also, it proposes to control the DCMLI based UPQC through conventional control schemes. Thus application of these control technique makes the system performance in par with the standards and also compared with existing system. The simulation results based on MATLAB/Simulink are discussed in detail to support the concept developed in the paper.

  15. The coming of age of artificial intelligence in medicine.

    Science.gov (United States)

    Patel, Vimla L; Shortliffe, Edward H; Stefanelli, Mario; Szolovits, Peter; Berthold, Michael R; Bellazzi, Riccardo; Abu-Hanna, Ameen

    2009-05-01

    This paper is based on a panel discussion held at the Artificial Intelligence in Medicine Europe (AIME) conference in Amsterdam, The Netherlands, in July 2007. It had been more than 15 years since Edward Shortliffe gave a talk at AIME in which he characterized artificial intelligence (AI) in medicine as being in its "adolescence" (Shortliffe EH. The adolescence of AI in medicine: will the field come of age in the '90s? Artificial Intelligence in Medicine 1993;5:93-106). In this article, the discussants reflect on medical AI research during the subsequent years and characterize the maturity and influence that has been achieved to date. Participants focus on their personal areas of expertise, ranging from clinical decision-making, reasoning under uncertainty, and knowledge representation to systems integration, translational bioinformatics, and cognitive issues in both the modeling of expertise and the creation of acceptable systems.

  16. The Coming of Age of Artificial Intelligence in Medicine*

    Science.gov (United States)

    Patel, Vimla L.; Shortliffe, Edward H.; Stefanelli, Mario; Szolovits, Peter; Berthold, Michael R.; Bellazzi, Riccardo; Abu-Hanna, Ameen

    2009-01-01

    Summary This paper is based on a panel discussion held at the Artificial Intelligence in Medicine Europe (AIME) conference in Amsterdam, The Netherlands, in July 2007. It had been more than 15 years since Edward Shortliffe gave a talk at AIME in which he characterized artificial intelligence (AI) in medicine as being in its “adolescence” (Shortliffe EH. The adolescence of AI in medicine: Will the field come of age in the ‘90s? Artificial Intelligence in Medicine 1993; 5:93–106). In this article, the discussants reflect on medical AI research during the subsequent years and attempt to characterize the maturity and influence that has been achieved to date. Participants focus on their personal areas of expertise, ranging from clinical decision making, reasoning under uncertainty, and knowledge representation to systems integration, translational bioinformatics, and cognitive issues in both the modeling of expertise and the creation of acceptable systems. PMID:18790621

  17. Artificial intelligence techniques in Prolog

    CERN Document Server

    Shoham, Yoav

    1993-01-01

    Artificial Intelligence Techniques in Prolog introduces the reader to the use of well-established algorithmic techniques in the field of artificial intelligence (AI), with Prolog as the implementation language. The techniques considered cover general areas such as search, rule-based systems, and truth maintenance, as well as constraint satisfaction and uncertainty management. Specific application domains such as temporal reasoning, machine learning, and natural language are also discussed.Comprised of 10 chapters, this book begins with an overview of Prolog, paying particular attention to Prol

  18. Dicty_cDB: FC-AI17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

  19. Dicty_cDB: FC-AI18 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI18 (Link to dictyBase) - - - Contig-U15590-1 FC-AI18P (Li...nk to Original site) FC-AI18F 621 FC-AI18Z 703 FC-AI18P 1324 - - Show FC-AI18 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI18Q.Seq.d/ Representative seq. ID FC-AI...18P (Link to Original site) Representative DNA sequence >FC-AI18 (FC-AI18Q) /CSM/FC/FC-AI/FC-AI...AVWPLIPGYERA DGEKQYPVAAMLCNFTKPTPTTPSLLTHDEVVTFFHEFGHVMHNMSTKVHYSMFSGTSVE RDFVECPSQLFEFWCWNKDVLVNKLSGHXKDHSKKLPTDLVERMIAAKNLNVAI

  20. Dicty_cDB: FC-AI03 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI03 (Link to dictyBase) - - - Contig-U15833-1 FC-AI03P (Li...nk to Original site) FC-AI03F 690 FC-AI03Z 651 FC-AI03P 1341 - - Show FC-AI03 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI03Q.Seq.d/ Representative seq. ID FC-AI...03P (Link to Original site) Representative DNA sequence >FC-AI03 (FC-AI03Q) /CSM/FC/FC-AI/FC-AI...li*l*ivtlskv*qswyqvfcslmrftcwi*nv fht*ivhwsqhwhql*flqpivaiv*skapitifnlhmaslwif*ivl*sfvpfhiitmk sfkfspfvpqlki

  1. Medical applications of artificial intelligence

    CERN Document Server

    Agah, Arvin

    2013-01-01

    Enhanced, more reliable, and better understood than in the past, artificial intelligence (AI) systems can make providing healthcare more accurate, affordable, accessible, consistent, and efficient. However, AI technologies have not been as well integrated into medicine as predicted. In order to succeed, medical and computational scientists must develop hybrid systems that can effectively and efficiently integrate the experience of medical care professionals with capabilities of AI systems. After providing a general overview of artificial intelligence concepts, tools, and techniques, Medical Ap

  2. Predicting adsorptive removal of chlorophenol from aqueous solution using artificial intelligence based modeling approaches.

    Science.gov (United States)

    Singh, Kunwar P; Gupta, Shikha; Ojha, Priyanka; Rai, Premanjali

    2013-04-01

    The research aims to develop artificial intelligence (AI)-based model to predict the adsorptive removal of 2-chlorophenol (CP) in aqueous solution by coconut shell carbon (CSC) using four operational variables (pH of solution, adsorbate concentration, temperature, and contact time), and to investigate their effects on the adsorption process. Accordingly, based on a factorial design, 640 batch experiments were conducted. Nonlinearities in experimental data were checked using Brock-Dechert-Scheimkman (BDS) statistics. Five nonlinear models were constructed to predict the adsorptive removal of CP in aqueous solution by CSC using four variables as input. Performances of the constructed models were evaluated and compared using statistical criteria. BDS statistics revealed strong nonlinearity in experimental data. Performance of all the models constructed here was satisfactory. Radial basis function network (RBFN) and multilayer perceptron network (MLPN) models performed better than generalized regression neural network, support vector machines, and gene expression programming models. Sensitivity analysis revealed that the contact time had highest effect on adsorption followed by the solution pH, temperature, and CP concentration. The study concluded that all the models constructed here were capable of capturing the nonlinearity in data. A better generalization and predictive performance of RBFN and MLPN models suggested that these can be used to predict the adsorption of CP in aqueous solution using CSC.

  3. Applications of artificial intelligence to reactor and plant control

    International Nuclear Information System (INIS)

    Bernard, J.A.

    1989-01-01

    Potential improvements in plant efficiency and reliability are often cited as reasons for developing and applying artificial intelligence (AI) techniques, principally expert systems, to the control and operation of nuclear reactors. Nevertheless, there have been few such applications and then mostly at the prototype level. Therefore, if AI techniques are to contribute to process control, methods must be identified by which rule-based and analytic approaches can be merged. This hypothesis is the basic premise of this article. Presented below are 1. a brief review of the human approach towards process control, 2. a discussion of the suitability of AI methodologies for the performance of control tasks, 3. examples of AI applications to both open- and closed-loop control, 4. an enumeration of unresolved issues associated with the use of AI for control, and 5. a discussion of the possible role of expert system techniques in process control. (orig./GL)

  4. Elementary epistemological features of machine intelligence

    OpenAIRE

    Horvat, Marko

    2008-01-01

    Theoretical analysis of machine intelligence (MI) is useful for defining a common platform in both theoretical and applied artificial intelligence (AI). The goal of this paper is to set canonical definitions that can assist pragmatic research in both strong and weak AI. Described epistemological features of machine intelligence include relationship between intelligent behavior, intelligent and unintelligent machine characteristics, observable and unobservable entities and classification of in...

  5. Intelligent Agent Based Semantic Web in Cloud Computing Environment

    OpenAIRE

    Mukhopadhyay, Debajyoti; Sharma, Manoj; Joshi, Gajanan; Pagare, Trupti; Palwe, Adarsha

    2013-01-01

    Considering today's web scenario, there is a need of effective and meaningful search over the web which is provided by Semantic Web. Existing search engines are keyword based. They are vulnerable in answering intelligent queries from the user due to the dependence of their results on information available in web pages. While semantic search engines provides efficient and relevant results as the semantic web is an extension of the current web in which information is given well defined meaning....

  6. S-aryl-L-cysteine sulphoxides and related organosulphur compounds alter oral biofilm development and AI-2-based cell-cell communication.

    Science.gov (United States)

    Kasper, S H; Samarian, D; Jadhav, A P; Rickard, A H; Musah, R A; Cady, N C

    2014-11-01

    To design and synthesize a library of structurally related, small molecules related to homologues of compounds produced by the plant Petiveria alliacea and determine their ability to interfere with AI-2 cell-cell communication and biofilm formation by oral bacteria. Many human diseases are associated with persistent bacterial biofilms. Oral biofilms (dental plaque) are problematic as they are often associated with tooth decay, periodontal disease and systemic disorders such as heart disease and diabetes. Using a microplate-based approach, a bio-inspired small molecule library was screened for anti-biofilm activity against the oral species Streptococcus mutans UA159, Streptococcus sanguis 10556 and Actinomyces oris MG1. To complement the static screen, a flow-based BioFlux microfluidic system screen was also performed under conditions representative of the human oral cavity. Several compounds were found to display biofilm inhibitory activity in all three of the oral bacteria tested. These compounds were also shown to inhibit bioluminescence by Vibrio harveyi and were thus inferred to be quorum sensing (QS) inhibitors. Due to the structural similarity of these compounds to each other, and to key molecules in AI-2 biosynthetic pathways, we propose that these molecules potentially reduce biofilm formation via antagonism of QS or QS-related pathways. This study highlights the potential for a non-antimicrobial-based strategy, focused on AI-2 cell-cell signalling, to control the development of dental plaque. Considering that many bacterial species use AI-2 cell-cell signalling, as well as the increased concern of the use of antimicrobials in healthcare products, such an anti-biofilm approach could also be used to control biofilms in environments beyond the human oral cavity. © 2014 The Society for Applied Microbiology.

  7. Cooperative research and development for artificial intelligence based reactor diagnostic system

    International Nuclear Information System (INIS)

    Reifman, J.; Wei, T.Y.C.; Abboud, R.G.; Chasensky, T.M.

    1994-01-01

    Artificial Intelligence (AI) techniques in the form of knowledge-based Expert Systems (ESs) have been proposed to provide on-line decision-making support for plant operators during both normal and emergency conditions. However, in spite of the great interest in these advanced techniques, their application in the diagnosis of large-scale processes has not yet reached its full potential because of limitations of the knowledge base. These limitations include problems with knowledge acquisition and the use of an event-oriented approach for process diagnosis. The knowledge base of process diagnosis ESs is generally acquired in a heuristic fashion through empirical associations between plant symptoms and component malfunctions with no reliance on fundamental physical principles. This nonsystematic construction of the knowledge base causes, among other problems, the encoded information to be biased and limited towards the developer's own experience and judgmental knowledge. The use of an event-oriented approach for process diagnosis requires the developer of the knowledge base to anticipate and formulate rules to cover every conceivable plant situation. In addition to yielding a large knowledge base, an undesirable characteristic for an on-line real-time advisory system, an event-oriented approach for diagnosis of large and complex thermal-hydraulic (T-H) based processes cannot guarantee functional completeness and is likely to fail under unanticipated circumstances. Hence, these limitations preclude an effective verification and validation of the knowledge base which is required in industrial applications. In contrast to the heuristic construction of a rigid knowledge base that uses an event-oriented approach for process diagnosis, the authors propose a different approach that involves the systematic construction of a hierarchical knowledge base with two levels

  8. Development and validity of mathematical learning assessment instruments based on multiple intelligence

    Directory of Open Access Journals (Sweden)

    Helmiah Suryani

    2017-06-01

    Full Text Available This study was aimed to develop and produce an assessment instrument of mathematical learning results based on multiple intelligence. The methods in this study used Borg & Gall-Research and Development approach (Research & Development. The subject of research was 289 students. The results of research: (1 Result of Aiken Analysis showed 58 valid items were between 0,714 to 0,952. (2 Result of the Exploratory on factor analysis indicated the instrument consist of three factors i.e. mathematical logical intelligence-spatial intelligence-and linguistic intelligence. KMO value was 0.661 df 0.780 sig. 0.000 with valid category. This research succeeded to developing the assessment instrument of mathematical learning results based on multiple intelligence of second grade in elementary school with characteristics of logical intelligence of mathematics, spatial intelligence, and linguistic intelligence.

  9. Ontology-Based Information Extraction for Business Intelligence

    Science.gov (United States)

    Saggion, Horacio; Funk, Adam; Maynard, Diana; Bontcheva, Kalina

    Business Intelligence (BI) requires the acquisition and aggregation of key pieces of knowledge from multiple sources in order to provide valuable information to customers or feed statistical BI models and tools. The massive amount of information available to business analysts makes information extraction and other natural language processing tools key enablers for the acquisition and use of that semantic information. We describe the application of ontology-based extraction and merging in the context of a practical e-business application for the EU MUSING Project where the goal is to gather international company intelligence and country/region information. The results of our experiments so far are very promising and we are now in the process of building a complete end-to-end solution.

  10. Evaluation of Artificial Intelligence Based Models for Chemical Biodegradability Prediction

    Directory of Open Access Journals (Sweden)

    Aleksandar Sabljic

    2004-12-01

    Full Text Available This study presents a review of biodegradability modeling efforts including a detailed assessment of two models developed using an artificial intelligence based methodology. Validation results for these models using an independent, quality reviewed database, demonstrate that the models perform well when compared to another commonly used biodegradability model, against the same data. The ability of models induced by an artificial intelligence methodology to accommodate complex interactions in detailed systems, and the demonstrated reliability of the approach evaluated by this study, indicate that the methodology may have application in broadening the scope of biodegradability models. Given adequate data for biodegradability of chemicals under environmental conditions, this may allow for the development of future models that include such things as surface interface impacts on biodegradability for example.

  11. An Innovative Thinking-Based Intelligent Information Fusion Algorithm

    Directory of Open Access Journals (Sweden)

    Huimin Lu

    2013-01-01

    Full Text Available This study proposes an intelligent algorithm that can realize information fusion in reference to the relative research achievements in brain cognitive theory and innovative computation. This algorithm treats knowledge as core and information fusion as a knowledge-based innovative thinking process. Furthermore, the five key parts of this algorithm including information sense and perception, memory storage, divergent thinking, convergent thinking, and evaluation system are simulated and modeled. This algorithm fully develops innovative thinking skills of knowledge in information fusion and is a try to converse the abstract conception of brain cognitive science to specific and operable research routes and strategies. Furthermore, the influences of each parameter of this algorithm on algorithm performance are analyzed and compared with those of classical intelligent algorithms trough test. Test results suggest that the algorithm proposed in this study can obtain the optimum problem solution by less target evaluation times, improve optimization effectiveness, and achieve the effective fusion of information.

  12. Autonomous entropy-based intelligent experimental design

    Science.gov (United States)

    Malakar, Nabin Kumar

    2011-07-01

    The aim of this thesis is to explore the application of probability and information theory in experimental design, and to do so in a way that combines what we know about inference and inquiry in a comprehensive and consistent manner. Present day scientific frontiers involve data collection at an ever-increasing rate. This requires that we find a way to collect the most relevant data in an automated fashion. By following the logic of the scientific method, we couple an inference engine with an inquiry engine to automate the iterative process of scientific learning. The inference engine involves Bayesian machine learning techniques to estimate model parameters based upon both prior information and previously collected data, while the inquiry engine implements data-driven exploration. By choosing an experiment whose distribution of expected results has the maximum entropy, the inquiry engine selects the experiment that maximizes the expected information gain. The coupled inference and inquiry engines constitute an autonomous learning method for scientific exploration. We apply it to a robotic arm to demonstrate the efficacy of the method. Optimizing inquiry involves searching for an experiment that promises, on average, to be maximally informative. If the set of potential experiments is described by many parameters, the search involves a high-dimensional entropy space. In such cases, a brute force search method will be slow and computationally expensive. We develop an entropy-based search algorithm, called nested entropy sampling, to select the most informative experiment. This helps to reduce the number of computations necessary to find the optimal experiment. We also extended the method of maximizing entropy, and developed a method of maximizing joint entropy so that it could be used as a principle of collaboration between two robots. This is a major achievement of this thesis, as it allows the information-based collaboration between two robotic units towards a same

  13. T'ai Chi

    Science.gov (United States)

    ... are different styles of t'ai chi, including: Chen style Hao (or Wu Shi) style Hu Lei ... medical advice, diagnoses, and treatment, consult your doctor. © 1995- The Nemours Foundation. All rights reserved. Images provided ...

  14. Intelligent image retrieval based on radiology reports

    Energy Technology Data Exchange (ETDEWEB)

    Gerstmair, Axel; Langer, Mathias; Kotter, Elmar [University Medical Center Freiburg, Department of Diagnostic Radiology, Freiburg (Germany); Daumke, Philipp; Simon, Kai [Averbis GmbH, Freiburg (Germany)

    2012-12-15

    To create an advanced image retrieval and data-mining system based on in-house radiology reports. Radiology reports are semantically analysed using natural language processing (NLP) techniques and stored in a state-of-the-art search engine. Images referenced by sequence and image number in the reports are retrieved from the picture archiving and communication system (PACS) and stored for later viewing. A web-based front end is used as an interface to query for images and show the results with the retrieved images and report text. Using a comprehensive radiological lexicon for the underlying terminology, the search algorithm also finds results for synonyms, abbreviations and related topics. The test set was 108 manually annotated reports analysed by different system configurations. Best results were achieved using full syntactic and semantic analysis with a precision of 0.929 and recall of 0.952. Operating successfully since October 2010, 258,824 reports have been indexed and a total of 405,146 preview images are stored in the database. Data-mining and NLP techniques provide quick access to a vast repository of images and radiology reports with both high precision and recall values. Consequently, the system has become a valuable tool in daily clinical routine, education and research. (orig.)

  15. Intelligent Adaptation Process for Case Based Systems

    International Nuclear Information System (INIS)

    Nassar, A.M.; Mohamed, A.H.; Mohamed, A.H.

    2014-01-01

    Case Based Reasoning (CBR) Systems is one of the important decision making systems applied in many fields all over the world. The effectiveness of any CBR system based on the quality of the storage cases in the case library. Similar cases can be retrieved and adapted to produce the solution for the new problem. One of the main issues faced the CBR systems is the difficulties of achieving the useful cases. The proposed system introduces a new approach that uses the genetic algorithm (GA) technique to automate constructing the cases into the case library. Also, it can optimize the best one to be stored in the library for the future uses. However, the proposed system can avoid the problems of the uncertain and noisy cases. Besides, it can simply the retrieving and adaptation processes. So, it can improve the performance of the CBR system. The suggested system can be applied for many real-time problems. It has been applied for diagnosis the faults of the wireless network, diagnosis of the cancer diseases, diagnosis of the debugging of a software as cases of study. The proposed system has proved its performance in this field

  16. Intelligent image retrieval based on radiology reports

    International Nuclear Information System (INIS)

    Gerstmair, Axel; Langer, Mathias; Kotter, Elmar; Daumke, Philipp; Simon, Kai

    2012-01-01

    To create an advanced image retrieval and data-mining system based on in-house radiology reports. Radiology reports are semantically analysed using natural language processing (NLP) techniques and stored in a state-of-the-art search engine. Images referenced by sequence and image number in the reports are retrieved from the picture archiving and communication system (PACS) and stored for later viewing. A web-based front end is used as an interface to query for images and show the results with the retrieved images and report text. Using a comprehensive radiological lexicon for the underlying terminology, the search algorithm also finds results for synonyms, abbreviations and related topics. The test set was 108 manually annotated reports analysed by different system configurations. Best results were achieved using full syntactic and semantic analysis with a precision of 0.929 and recall of 0.952. Operating successfully since October 2010, 258,824 reports have been indexed and a total of 405,146 preview images are stored in the database. Data-mining and NLP techniques provide quick access to a vast repository of images and radiology reports with both high precision and recall values. Consequently, the system has become a valuable tool in daily clinical routine, education and research. (orig.)

  17. Tablet based distributed intelligent load management

    Science.gov (United States)

    Lu, Yan; Zhou, Siyuan

    2018-01-09

    A facility is connected to an electricity utility and is responsive to Demand Response Events. A plurality of devices is each individually connected to the electricity grid via an addressable switch connected to a secure network that is enabled to be individually switched off by a server. An occupant of a room in control of the plurality of devices provides via a Human Machine Interface on a tablet a preferred order of switching off the plurality of devices in case of a Demand Response Event. A configuration file based at least partially on the preferred order and on a severity of the Demand Response Events determines which devices which of the plurality devices will be switched off. The server accesses the configuration file and switches off the devices included in the configuration file.

  18. Three IQs of AI Systems and their Testing Methods

    OpenAIRE

    Liu, Feng; Shi, Yong; Liu, Ying

    2017-01-01

    The rapid development of artificial intelligence has brought the artificial intelligence threat theory as well as the problem about how to evaluate the intelligence level of intelligent products. Both need to find a quantitative method to evaluate the intelligence level of intelligence systems, including human intelligence. Based on the standard intelligence system and the extended Von Neumann architecture, this paper proposes General IQ, Service IQ and Value IQ evaluation methods for intelli...

  19. Maritime Safety in Terms of the Availability for the AIS class B Binary Data Transmission, Based on Static Measurements, Performed on the VTS Zatoka Gdańska

    Directory of Open Access Journals (Sweden)

    Jaskólski Krzysztof

    2015-12-01

    Full Text Available The problem of the safety navigation considered only in terms of position error measurement, seems to be solved on a global scale. Thus, the operational characteristics of radio navigation systems such as availability are equally important. The integrated navigation system operate in a multi-sensor environment and it is important to determinate a temporal validity of data to make it usable in data fusion process. In the age of digital data processing, the requirements for continuity, availability, reliability and integrity information are already grown. This article analyses the problem of time stamp discrepancies of dynamic AIS class B position reports. For this purpose, the statistical summary of Latency Position Reports, derived from class B units has been presented. The navigation data recordings were conducted during 82 days of August, September and November 2014 from 20 vessels located in area of VTS ‘Zatoka Gdańska’. On the base of Latency Position Reports class B it is possible to designate the availability of AIS information system. For this purpose, the model of availability of AIS binary data transmission and research outcomes have been presented.

  20. Intelligent-based Structural Damage Detection Model

    International Nuclear Information System (INIS)

    Lee, Eric Wai Ming; Yu, K.F.

    2010-01-01

    This paper presents the application of a novel Artificial Neural Network (ANN) model for the diagnosis of structural damage. The ANN model, denoted as the GRNNFA, is a hybrid model combining the General Regression Neural Network Model (GRNN) and the Fuzzy ART (FA) model. It not only retains the important features of the GRNN and FA models (i.e. fast and stable network training and incremental growth of network structure) but also facilitates the removal of the noise embedded in the training samples. Structural damage alters the stiffness distribution of the structure and so as to change the natural frequencies and mode shapes of the system. The measured modal parameter changes due to a particular damage are treated as patterns for that damage. The proposed GRNNFA model was trained to learn those patterns in order to detect the possible damage location of the structure. Simulated data is employed to verify and illustrate the procedures of the proposed ANN-based damage diagnosis methodology. The results of this study have demonstrated the feasibility of applying the GRNNFA model to structural damage diagnosis even when the training samples were noise contaminated.

  1. Intelligent-based Structural Damage Detection Model

    Science.gov (United States)

    Lee, Eric Wai Ming; Yu, Kin Fung

    2010-05-01

    This paper presents the application of a novel Artificial Neural Network (ANN) model for the diagnosis of structural damage. The ANN model, denoted as the GRNNFA, is a hybrid model combining the General Regression Neural Network Model (GRNN) and the Fuzzy ART (FA) model. It not only retains the important features of the GRNN and FA models (i.e. fast and stable network training and incremental growth of network structure) but also facilitates the removal of the noise embedded in the training samples. Structural damage alters the stiffness distribution of the structure and so as to change the natural frequencies and mode shapes of the system. The measured modal parameter changes due to a particular damage are treated as patterns for that damage. The proposed GRNNFA model was trained to learn those patterns in order to detect the possible damage location of the structure. Simulated data is employed to verify and illustrate the procedures of the proposed ANN-based damage diagnosis methodology. The results of this study have demonstrated the feasibility of applying the GRNNFA model to structural damage diagnosis even when the training samples were noise contaminated.

  2. Knowledge in Artificial Intelligence Systems: Searching the Strategies for Application

    OpenAIRE

    Kornienko, Alla A.; Kornienko, Anatoly V.; Fofanov, Oleg B.; Chubik, Maxim P.

    2015-01-01

    The studies based on auto-epistemic logic are pointed out as an advanced direction for development of artificial intelligence (AI). Artificial intelligence is taken as a system that imitates the solution of complicated problems by human during the course of life. The structure of symbols and operations, by which intellectual solution is performed, as well as searching the strategic reference points for those solutions, which are caused by certain structures of symbols and operations, – are co...

  3. Intelligent system for lighting control in smart cities

    OpenAIRE

    de Paz Santana, Juan F.; Bajo Pérez, Javier; Rodríguez González, Sara; Villarrubia González, Gabriel; Corchado Rodríguez, Juan M.

    2017-01-01

    This paper presents an adaptive architecture that centralizes the control of public lighting and intelligent management to economize lighting and maintain maximum visual comfort in illuminated areas. To carry out this management, the architecture merges various techniques of artificial intelligence (AI) and statistics such as artificial neural networks (ANN), multi-agent systems (MAS), EM algorithm, methods based on ANOVA, and a Service Oriented Approach (SOA). It achieves optimization in ter...

  4. New trends in computational collective intelligence

    CERN Document Server

    Kim, Sang-Wook; Trawiński, Bogdan

    2015-01-01

    This book consists of 20 chapters in which the authors deal with different theoretical and practical aspects of new trends in Collective Computational Intelligence techniques. Computational Collective Intelligence methods and algorithms are one the current trending research topics from areas related to Artificial Intelligence, Soft Computing or Data Mining among others. Computational Collective Intelligence is a rapidly growing field that is most often understood as an AI sub-field dealing with soft computing methods which enable making group decisions and processing knowledge among autonomous units acting in distributed environments. Web-based Systems, Social Networks, and Multi-Agent Systems very often need these tools for working out consistent knowledge states, resolving conflicts and making decisions. The chapters included in this volume cover a selection of topics and new trends in several domains related to Collective Computational Intelligence: Language and Knowledge Processing, Data Mining Methods an...

  5. Intelligent Tutoring System: A Tool for Testing the Research Curiosities of Artificial Intelligence Researchers

    Science.gov (United States)

    Yaratan, Huseyin

    2003-01-01

    An ITS (Intelligent Tutoring System) is a teaching-learning medium that uses artificial intelligence (AI) technology for instruction. Roberts and Park (1983) defines AI as the attempt to get computers to perform tasks that if performed by a human-being, intelligence would be required to perform the task. The design of an ITS comprises two distinct…

  6. The First Workshop on Artificial Intelligence Techniques for Ambient Intelligence (AITAmI '06)

    OpenAIRE

    Augusto, Juan Carlos; Shapiro, Daniel

    2007-01-01

    The first annual workshop on the role of AI in ambient intelligence was held in Riva de Garda, Italy, on August 29, 2006. The workshop was colocated with the European Conference on Artificial Intelligence (ECAI 2006). It provided an opportunity for researchers in a variety of AI subfields together with representatives of commercial interests to explore ambient intelligence technology and applications.

  7. Automatic system for radar echoes filtering based on textural features and artificial intelligence

    Science.gov (United States)

    Hedir, Mehdia; Haddad, Boualem

    2017-10-01

    Among the very popular Artificial Intelligence (AI) techniques, Artificial Neural Network (ANN) and Support Vector Machine (SVM) have been retained to process Ground Echoes (GE) on meteorological radar images taken from Setif (Algeria) and Bordeaux (France) with different climates and topologies. To achieve this task, AI techniques were associated with textural approaches. We used Gray Level Co-occurrence Matrix (GLCM) and Completed Local Binary Pattern (CLBP); both methods were largely used in image analysis. The obtained results show the efficiency of texture to preserve precipitations forecast on both sites with the accuracy of 98% on Bordeaux and 95% on Setif despite the AI technique used. 98% of GE are suppressed with SVM, this rate is outperforming ANN skills. CLBP approach associated to SVM eliminates 98% of GE and preserves precipitations forecast on Bordeaux site better than on Setif's, while it exhibits lower accuracy with ANN. SVM classifier is well adapted to the proposed application since the average filtering rate is 95-98% with texture and 92-93% with CLBP. These approaches allow removing Anomalous Propagations (APs) too with a better accuracy of 97.15% with texture and SVM. In fact, textural features associated to AI techniques are an efficient tool for incoherent radars to surpass spurious echoes.

  8. Intelligent model-based diagnostics for vehicle health management

    Science.gov (United States)

    Luo, Jianhui; Tu, Fang; Azam, Mohammad S.; Pattipati, Krishna R.; Willett, Peter K.; Qiao, Liu; Kawamoto, Masayuki

    2003-08-01

    The recent advances in sensor technology, remote communication and computational capabilities, and standardized hardware/software interfaces are creating a dramatic shift in the way the health of vehicles is monitored and managed. These advances facilitate remote monitoring, diagnosis and condition-based maintenance of automotive systems. With the increased sophistication of electronic control systems in vehicles, there is a concomitant increased difficulty in the identification of the malfunction phenomena. Consequently, the current rule-based diagnostic systems are difficult to develop, validate and maintain. New intelligent model-based diagnostic methodologies that exploit the advances in sensor, telecommunications, computing and software technologies are needed. In this paper, we will investigate hybrid model-based techniques that seamlessly employ quantitative (analytical) models and graph-based dependency models for intelligent diagnosis. Automotive engineers have found quantitative simulation (e.g. MATLAB/SIMULINK) to be a vital tool in the development of advanced control systems. The hybrid method exploits this capability to improve the diagnostic system's accuracy and consistency, utilizes existing validated knowledge on rule-based methods, enables remote diagnosis, and responds to the challenges of increased system complexity. The solution is generic and has the potential for application in a wide range of systems.

  9. Dicty_cDB: FC-AI07 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI07 (Link to dictyBase) - - - Contig-U15296-1 | Contig-U15756-1 FC-AI...07P (Link to Original site) FC-AI07F 580 FC-AI07Z 723 FC-AI07P 1303 - - Show FC-AI07 Library FC (...Link to library) Clone ID FC-AI07 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15296-1 | Contig-U15756-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...07Q.Seq.d/ Representative seq. ID FC-AI07P (Link to Original site) Representative DNA sequence >FC-AI07 (FC-AI

  10. Dicty_cDB: FC-AI22 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI22 (Link to dictyBase) - - - Contig-U15369-1 | Contig-U15732-1 FC-AI...22P (Link to Original site) FC-AI22F 583 FC-AI22Z 683 FC-AI22P 1266 - - Show FC-AI22 Library FC (...Link to library) Clone ID FC-AI22 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Con...tig-U15369-1 | Contig-U15732-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...22Q.Seq.d/ Representative seq. ID FC-AI22P (Link to Original site) Representative DNA sequence >FC-AI22 (FC-AI

  11. Dicty_cDB: FC-AI08 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI08 (Link to dictyBase) - G01729 DDB0233148 Contig-U14939-1 FC-AI...08P (Link to Original site) FC-AI08F 654 FC-AI08Z 563 FC-AI08P 1217 - - Show FC-AI08 Library FC (Link... to library) Clone ID FC-AI08 (Link to dictyBase) Atlas ID - NBRP ID G01729 dictyBase ID DDB0233148 Link to ...Contig Contig-U14939-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...08Q.Seq.d/ Representative seq. ID FC-AI08P (Link to Original site) Representative DNA sequence >FC-AI08 (FC-AI

  12. It Takes Two to Tango: Towards Theory of AI's Mind

    OpenAIRE

    Chandrasekaran, Arjun; Yadav, Deshraj; Chattopadhyay, Prithvijit; Prabhu, Viraj; Parikh, Devi

    2017-01-01

    Theory of Mind is the ability to attribute mental states (beliefs, intents, knowledge, perspectives, etc.) to others and recognize that these mental states may differ from one's own. Theory of Mind is critical to effective communication and to teams demonstrating higher collective performance. To effectively leverage the progress in Artificial Intelligence (AI) to make our lives more productive, it is important for humans and AI to work well together in a team. Traditionally, there has been m...

  13. Approaches to the study of intelligence

    Science.gov (United States)

    Norman, Donald A.

    1991-01-01

    A survey and an evaluation are conducted for the Rosenbloom et al. (1991) 'SOAR' model of intelligence, both as found in humans and in prospective AI systems, which views it as a representational system for goal-oriented symbolic activity based on a physical symbol system. Attention is given to SOAR's implications for semantic and episodic memory, symbol processing, and search within a uniform problem space; also noted are the relationships of SOAR to competing AI schemes, and its potential usefulness as a theoretical tool for cognitive psychology.

  14. Cooperative research and development for artificial intelligence based reactor diagnostic system

    International Nuclear Information System (INIS)

    Reifman, J.; Wei, T.Y.C.; Abboud, R.G.; Chasensky, T.M.

    1994-01-01

    Artificial Intelligence (AI) techniques in the form of knowledge-based Expert Systems (ESs) have been proposed to provide on-line decision-making support for plant operators during both normal and emergency conditions. However, in spite of the great interest in these advanced techniques, their application in the diagnosis of large-scale processes has not yet reached its full potential because of limitations of the knowledge base. These limitations include problems with knowledge acquisition and the use of an event-oriented approach for process diagnosis. To investigate the capabilities of this two-level hierarchical knowledge structure, Commonwealth Research Corporation (CRC) and Argonne National Laboratory (ANL)are collaborating on a DOE-sponsored Cooperative Research and Development Agreement (CRADA) project to perform feasibility studies on the proposed diagnostic system. Investigations are being performed in the construction of a physics-based plant level process diagnostic ES and the characterization of component-level fault project is to develop a computer-based system using this Al approach to assist process plant operators during off-normal plant conditions. The proposed computer-based system will use T-H signals complemented by other non-T-H signals available in the data stream to provide the process operator with the component which most likely caused the observed process disturbance. To demonstrate the scale-up feasibility of the proposed diagnostic system it is being developed for use with the Chemical Volume Control System (CVCS) of a nuclear power plant. This is an ongoing multi-year project and the remainder of this paper presents a mid-term status report

  15. Automatic food detection in egocentric images using artificial intelligence technology

    Science.gov (United States)

    Our objective was to develop an artificial intelligence (AI)-based algorithm which can automatically detect food items from images acquired by an egocentric wearable camera for dietary assessment. To study human diet and lifestyle, large sets of egocentric images were acquired using a wearable devic...

  16. AIS Ship Traffic: Hawaii: 2011-2012

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Ship position data from a satellite-based Automatic Identification System (AIS) were obtained jointly by PacIOOS (J. Potemra), SOEST/ORE of the University of Hawaii...

  17. Simplifying Multiproject Scheduling Problem Based on Design Structure Matrix and Its Solution by an Improved aiNet Algorithm

    Directory of Open Access Journals (Sweden)

    Chunhua Ju

    2012-01-01

    Full Text Available Managing multiple project is a complex task involving the unrelenting pressures of time and cost. Many studies have proposed various tools and techniques for single-project scheduling; however, the literature further considering multimode or multiproject issues occurring in the real world is rather scarce. In this paper, design structure matrix (DSM and an improved artificial immune network algorithm (aiNet are developed to solve a multi-mode resource-constrained scheduling problem. Firstly, the DSM is used to simplify the mathematic model of multi-project scheduling problem. Subsequently, aiNet algorithm comprised of clonal selection, negative selection, and network suppression is adopted to realize the local searching and global searching, which will assure that it has a powerful searching ability and also avoids the possible combinatorial explosion. Finally, the approach is tested on a set of randomly cases generated from ProGen. The computational results validate the effectiveness of the proposed algorithm comparing with other famous metaheuristic algorithms such as genetic algorithm (GA, simulated annealing algorithm (SA, and ant colony optimization (ACO.

  18. Intelligent monitoring-based safety system of massage robot

    Institute of Scientific and Technical Information of China (English)

    胡宁; 李长胜; 王利峰; 胡磊; 徐晓军; 邹雲鹏; 胡玥; 沈晨

    2016-01-01

    As an important attribute of robots, safety is involved in each link of the full life cycle of robots, including the design, manufacturing, operation and maintenance. The present study on robot safety is a systematic project. Traditionally, robot safety is defined as follows: robots should not collide with humans, or robots should not harm humans when they collide. Based on this definition of robot safety, researchers have proposed ex ante and ex post safety standards and safety strategies and used the risk index and risk level as the evaluation indexes for safety methods. A massage robot realizes its massage therapy function through applying a rhythmic force on the massage object. Therefore, the traditional definition of safety, safety strategies, and safety realization methods cannot satisfy the function and safety requirements of massage robots. Based on the descriptions of the environment of massage robots and the tasks of massage robots, the present study analyzes the safety requirements of massage robots; analyzes the potential safety dangers of massage robots using the fault tree tool; proposes an error monitoring-based intelligent safety system for massage robots through monitoring and evaluating potential safety danger states, as well as decision making based on potential safety danger states; and verifies the feasibility of the intelligent safety system through an experiment.

  19. Dicty_cDB: FC-AI24 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI24 (Link to dictyBase) - - - - FC-AI24Z (Link to Original site) - - FC-AI...24Z 693 - - - - Show FC-AI24 Library FC (Link to library) Clone ID FC-AI24 (Link to dictyBas...e) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI...24Q.Seq.d/ Representative seq. ID FC-AI24Z (Link to Original s...ite) Representative DNA sequence >FC-AI24 (FC-AI24Q) /CSM/FC/FC-AI/FC-AI24Q.Seq.d/ XXXXXXXXXXAAATTAGAAAACAAA

  20. Hot complaint intelligent classification based on text mining

    Directory of Open Access Journals (Sweden)

    XIA Haifeng

    2013-10-01

    Full Text Available The complaint recognizer system plays an important role in making sure the correct classification of the hot complaint,improving the service quantity of telecommunications industry.The customers’ complaint in telecommunications industry has its special particularity which should be done in limited time,which cause the error in classification of hot complaint.The paper presents a model of complaint hot intelligent classification based on text mining,which can classify the hot complaint in the correct level of the complaint navigation.The examples show that the model can be efficient to classify the text of the complaint.

  1. Smart Waste Collection System Based on Location Intelligence

    DEFF Research Database (Denmark)

    Lopez, Jose Manuel Guterrez Lopez; Jensen, Michael; Andreasen, Morten Henius

    2015-01-01

    (IoT) integration with data access networks, Geographic Information Systems (GIS), combinatorial optimization, and electronic engineering can contribute to improve cities’ management systems. We present a waste collection solution based on providing intelligence to trashcans, by using an IoT prototype...... to contribute and develop Smart city solutions.......Cities around the world are on the run to become smarter. Some of these have seen an opportunity on deploying dedicated municipal access networks to support all types of city management and maintenance services requiring a data connection. This paper practically demonstrates how Internet of Things...

  2. ARTIFICIAL NEURAL NETWORKS BASED GEARS MATERIAL SELECTION HYBRID INTELLIGENT SYSTEM

    Institute of Scientific and Technical Information of China (English)

    X.C. Li; W.X. Zhu; G. Chen; D.S. Mei; J. Zhang; K.M. Chen

    2003-01-01

    An artificial neural networks(ANNs) based gear material selection hybrid intelligent system is established by analyzing the individual advantages and weakness of expert system (ES) and ANNs and the applications in material select of them. The system mainly consists of tow parts: ES and ANNs. By being trained with much data samples,the back propagation (BP) ANN gets the knowledge of gear materials selection, and is able to inference according to user input. The system realizes the complementing of ANNs and ES. Using this system, engineers without materials selection experience can conveniently deal with gear materials selection.

  3. Knowledge-based dialogue in Intelligent Decision Support Systems

    International Nuclear Information System (INIS)

    Hollnagel, E.

    1987-01-01

    The overall goal for the design of Intelligent Decision Support Systems (IDSS) is to enhance understanding of the process under all operating conditions. For an IDSS to be effective, it must: select or generate the right information; produce reliable and consistent information; allow flexible and effective operator interaction; relate information presentation to current plant status and problems; and make the presentation at the right time. Several ongoing R and D programs try to design and build IDSSs. A particular example is the ESPRIT project Graphics and Knowledge Based Diaglogue for Dynamic Systems (GRADIENT). This project, the problems it addresses, and its uses, are discussed here

  4. Areal Informations Systemet - AIS

    DEFF Research Database (Denmark)

    Nielsen, K.; Stjernholm, M.; Olsen, B. Ø.

    Forord: Denne rapport giver en kort beskrivelse af Areal Informations Systemet (AIS), som er et databasesystem med natur- og miljødata, som kan stedfæstes geografisk. Projektet er gennemført i perioden 1996-2000 som et samarbejdsprojekt mellem Danmarks Miljøundersøgelser (DMU), Danmarks og...... og enkeltpersoner med interesse for natur- og miljøforhold i Danmark. Yderligere oplysninger om Areal Informations Systemet, herunder adgangsforhold, kan fås på DMU's hjemmeside med følgende adresse: http://ais.dmu.dk/ Projektet er finansieret af Miljø- og Energiministeriet, mens en række...... (planlægning, beskyttelse), geologi (overfladegeologi og marin geologi), samt marin dybdemodel. # Etablering af dataadgang for Miljø- og Energiministeriets institutioner til AIS-data. # Afprøvning af systemet i forhold til konkrete projekter. # Formidling af produkterne til brugerkredsen....

  5. Intelligence and the brain: a model-based approach

    NARCIS (Netherlands)

    Kievit, R.A.; van Rooijen, H.; Wicherts, J.M.; Waldorp, L.J.; Kan, K.-J.; Scholte, H.S.; Borsboom, D.

    2012-01-01

    Various biological correlates of general intelligence (g) have been reported. Despite this, however, the relationship between neurological measurements and g is not fully clear. We use structural equation modeling to model the relationship between behavioral Wechsler Adult Intelligence Scale (WAIS)

  6. MassAI

    DEFF Research Database (Denmark)

    2011-01-01

    A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX.......A software tool for general analysis and data-mining of mass-spectrometric datasets. The program features a strong emphasis on scan-by-scan identification and results-transparency. MassAI also accommodates residue level analysis of labelled runs, e.g. HDX....

  7. Artificial intelligence in hematology.

    Science.gov (United States)

    Zini, Gina

    2005-10-01

    Artificial intelligence (AI) is a computer based science which aims to simulate human brain faculties using a computational system. A brief history of this new science goes from the creation of the first artificial neuron in 1943 to the first artificial neural network application to genetic algorithms. The potential for a similar technology in medicine has immediately been identified by scientists and researchers. The possibility to store and process all medical knowledge has made this technology very attractive to assist or even surpass clinicians in reaching a diagnosis. Applications of AI in medicine include devices applied to clinical diagnosis in neurology and cardiopulmonary diseases, as well as the use of expert or knowledge-based systems in routine clinical use for diagnosis, therapeutic management and for prognostic evaluation. Biological applications include genome sequencing or DNA gene expression microarrays, modeling gene networks, analysis and clustering of gene expression data, pattern recognition in DNA and proteins, protein structure prediction. In the field of hematology the first devices based on AI have been applied to the routine laboratory data management. New tools concern the differential diagnosis in specific diseases such as anemias, thalassemias and leukemias, based on neural networks trained with data from peripheral blood analysis. A revolution in cancer diagnosis, including the diagnosis of hematological malignancies, has been the introduction of the first microarray based and bioinformatic approach for molecular diagnosis: a systematic approach based on the monitoring of simultaneous expression of thousands of genes using DNA microarray, independently of previous biological knowledge, analysed using AI devices. Using gene profiling, the traditional diagnostic pathways move from clinical to molecular based diagnostic systems.

  8. ARTIFICIAL INTELLIGENCE: APPLICATIONS AND FUTURE

    OpenAIRE

    Ellur Anand; S. G. Varun Kumar

    2017-01-01

    Artificial Intelligence (AI) or Augmented Intelligence happens to be the most talked about technology that would have a major impact on the way the current day world functions. The next step in evolution of digital world is AI. The safety of the world with more and more use of AI also becomes necessity. Safety rules and regulations of the digital world need to be drafted and redrafted as AI evolves and becomes a new normal in every one’s life just as mobile phone has become in the current sce...

  9. Artificial Intelligence.

    Science.gov (United States)

    Lawrence, David R; Palacios-González, César; Harris, John

    2016-04-01

    It seems natural to think that the same prudential and ethical reasons for mutual respect and tolerance that one has vis-à-vis other human persons would hold toward newly encountered paradigmatic but nonhuman biological persons. One also tends to think that they would have similar reasons for treating we humans as creatures that count morally in our own right. This line of thought transcends biological boundaries-namely, with regard to artificially (super)intelligent persons-but is this a safe assumption? The issue concerns ultimate moral significance: the significance possessed by human persons, persons from other planets, and hypothetical nonorganic persons in the form of artificial intelligence (AI). This article investigates why our possible relations to AI persons could be more complicated than they first might appear, given that they might possess a radically different nature to us, to the point that civilized or peaceful coexistence in a determinate geographical space could be impossible to achieve.

  10. Dicty_cDB: FC-AI12 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI12 (Link to dictyBase) - - - Contig-U15484-1 FC-AI12Z (Li...nk to Original site) - - FC-AI12Z 614 - - - - Show FC-AI12 Library FC (Link to library) Clone ID FC-AI12 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI12Q.Seq.d/ Representative seq. ID FC-AI...12Z (Link to Original site) Representative DNA sequence >FC-AI12 (FC-AI12Q) /CSM/FC/FC-AI/FC-AI12Q.Seq....EKIVRRI ELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVSERNV LESN*in*riys

  11. Dicty_cDB: FC-AI19 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI19 (Link to dictyBase) - - - Contig-U15115-1 FC-AI19Z (Li...nk to Original site) - - FC-AI19Z 661 - - - - Show FC-AI19 Library FC (Link to library) Clone ID FC-AI19 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI19Q.Seq.d/ Representative seq. ID FC-AI...19Z (Link to Original site) Representative DNA sequence >FC-AI19 (FC-AI19Q) /CSM/FC/FC-AI/FC-AI19Q.Seq....lmrqswvkkiesi*lvl krrkkkknnkkkkkkkkkkklfn*lvnkkn*ik*kkllcnqkk Frame B: ---*ekaieilsklfsin*kfn**ysiiigkkstkyq

  12. Dicty_cDB: FC-AI14 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI14 (Link to dictyBase) - - - Contig-U16280-1 FC-AI14Z (Li...nk to Original site) - - FC-AI14Z 671 - - - - Show FC-AI14 Library FC (Link to library) Clone ID FC-AI14 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI14Q.Seq.d/ Representative seq. ID FC-AI...14Z (Link to Original site) Representative DNA sequence >FC-AI14 (FC-AI14Q) /CSM/FC/FC-AI/FC-AI14Q.Seq....nqrllv*lvvlskklqllnsnqsfkfkkvq rmkknsvkntkn*rfvllt*nlkslkrmpksknsptkliifilkly Frame B: ---lkdl*krtphl*stcfhhptlcssrrfclwslnai

  13. Dicty_cDB: FC-AI15 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV

  14. Dicty_cDB: FC-AI06 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI06 (Link to dictyBase) - - - Contig-U16465-1 FC-AI06E (Li...nk to Original site) - - - - - - FC-AI06E 1138 Show FC-AI06 Library FC (Link to library) Clone ID FC-AI06 (L...//dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI06Q.Seq.d/ Representative seq. ID FC-AI...06E (Link to Original site) Representative DNA sequence >FC-AI06 (FC-AI06Q) /CSM/FC/FC-AI/FC-AI06Q.Seq...FGRGIDIERVNVVINYDMAESADTYLHRVGRAGRFGTK GLAISFVPSKEDPVLEQVQSKFVVSIKELVATPDPSTYMSG*kkkkkkkknlfvlksikk k*kkk*in

  15. Dicty_cDB: FC-AI09 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI09 (Link to dictyBase) - - - Contig-U16149-1 FC-AI09Z (Li...nk to Original site) - - FC-AI09Z 591 - - - - Show FC-AI09 Library FC (Link to library) Clone ID FC-AI09 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI09Q.Seq.d/ Representative seq. ID FC-AI...09Z (Link to Original site) Representative DNA sequence >FC-AI09 (FC-AI09Q) /CSM/FC/FC-AI/FC-AI09Q.Seq....*tkl ik*ilifykiknnkkkkkk Frame B: ---gt*kvpeflailfkrmasrsvlwy*rcltkakkglkapqtltik

  16. Development of Android Based Powered Intelligent Wheelchair for Quadriplegic Persons

    Science.gov (United States)

    Gupta, Ashutosh; Ghosh, Tathagata; Kumar, Pradeep; Bhawna, Shruthi. S.

    2017-08-01

    Several surveys give us the view that both children and adults benefit substantially from access towards independent mobility. With the inventions of technology, no individuals are satisfied with traditional manual operated machines. To accommodate population, researchers are using technology, originally developed for mobile robots to create ‘intelligent wheelchairs’. It’s a major challenge for quadriplegic persons as they really find it difficult to manipulate powered wheelchair during the activities of their daily living. As the Smartphone era has evolved with innovative android based applications, engineers are improving and trying to make such machines simple and cheap to the next level. In this paper, we present a development of android based powered intelligent wheelchair to assist the quadriplegic person by making them self sufficient in controlling the wheelchair. The wheels of the chair can be controlled by the voice or gesture movement or by touching the screen of the android app by the challenged persons. The system uses the Bluetooth communication to interface the microcontroller and the inbuilt sensors in the android Smartphone. According to the commands received from android phone, the kinematics of the wheels are controlled.

  17. An Ai Chi-based aquatic group improves balance and reduces falls in community-dwelling adults: A pilot observational cohort study.

    Science.gov (United States)

    Skinner, Elizabeth H; Dinh, Tammy; Hewitt, Melissa; Piper, Ross; Thwaites, Claire

    2016-11-01

    Falls are associated with morbidity, loss of independence, and mortality. While land-based group exercise and Tai Chi programs reduce the risk of falls, aquatic therapy may allow patients to complete balance exercises with less pain and fear of falling; however, limited data exist. The objective of the study was to pilot the implementation of an aquatic group based on Ai Chi principles (Aquabalance) and to evaluate the safety, intervention acceptability, and intervention effect sizes. Pilot observational cohort study. Forty-two outpatients underwent a single 45-minute weekly group aquatic Ai Chi-based session for eight weeks (Aquabalance). Safety was monitored using organizational reporting systems. Patient attendance, satisfaction, and self-reported falls were also recorded. Balance measures included the Timed Up and Go (TUG) test, the Four Square Step Test (FSST), and the unilateral Step Tests. Forty-two patients completed the program. It was feasible to deliver Aquabalance, as evidenced by the median (IQR) attendance rate of 8.0 (7.8, 8.0) out of 8. No adverse events occurred and participants reported high satisfaction levels. Improvements were noted on the TUG, 10-meter walk test, the Functional Reach Test, the FSST, and the unilateral step tests (p falls risk reduced from 38% to 21%. The study was limited by its small sample size, single-center nature, and the absence of a control group. Aquabalance was safe, well-attended, and acceptable to participants. A randomized controlled assessor-blinded trial is required.

  18. The Construction of Intelligent English Teaching Model Based on Artificial Intelligence

    Directory of Open Access Journals (Sweden)

    Xiaoguang Li

    2017-12-01

    Full Text Available In order to build a modernized tool platform that can help students improve their English learning efficiency according to their mastery of knowledge and personality, this paper develops an online intelligent English learning system that uses Java and artificial intelligence language Prolog as the software system. This system is a creative reflection of the thoughts of expert system in artificial intelligence. Established on the Struts Spring Hibernate lightweight JavaEE framework, the system modules are coupled with each other in a much lower degree, which is convenient to future function extension. Combined with the idea of expert system in artificial intelligence, the system developed appropriate learning strategies to help students double the learning effect with half the effort; Finally, the system takes into account the forgetting curve of memory, on which basis the knowledge that has been learned will be tested periodically, intending to spare students’ efforts to do a sea of exercises and obtain better learning results.

  19. Quo vadis, Intelligent Machine?

    Directory of Open Access Journals (Sweden)

    Rosemarie Velik

    2010-09-01

    Full Text Available Artificial Intelligence (AI is a branch of computer science concerned with making computers behave like humans. At least this was the original idea. However, it turned out that this is no task easy to be solved. This article aims to give a comprehensible review on the last 60 years of artificial intelligence taking a philosophical viewpoint. It is outlined what happened so far in AI, what is currently going on in this research area, and what can be expected in future. The goal is to mediate an understanding for the developments and changes in thinking in course of time about how to achieve machine intelligence. The clear message is that AI has to join forces with neuroscience and other brain disciplines in order to make a step towards the development of truly intelligent machines.

  20. On Intelligent Design and Planning Method of Process Route Based on Gun Breech Machining Process

    Science.gov (United States)

    Hongzhi, Zhao; Jian, Zhang

    2018-03-01

    The paper states an approach of intelligent design and planning of process route based on gun breech machining process, against several problems, such as complex machining process of gun breech, tedious route design and long period of its traditional unmanageable process route. Based on gun breech machining process, intelligent design and planning system of process route are developed by virtue of DEST and VC++. The system includes two functional modules--process route intelligent design and its planning. The process route intelligent design module, through the analysis of gun breech machining process, summarizes breech process knowledge so as to complete the design of knowledge base and inference engine. And then gun breech process route intelligently output. On the basis of intelligent route design module, the final process route is made, edited and managed in the process route planning module.

  1. AN ARTIFICIAL INTELLIGENCE-BASED DISTANCE EDUCATION SYSTEM: Artimat

    Directory of Open Access Journals (Sweden)

    Vasif NABIYEV

    2013-04-01

    Full Text Available The purpose of this study is to evaluate the artificial intelligence-based distance education system called as ARTIMAT, which has been prepared in order to improve mathematical problem solving skills of the students, in terms of conceptual proficiency and ease of use with the opinions of teachers and students. The implementation has been performed with 4 teachers and 59 students in 10th grade in an Anatolian High School in Trabzon. Many institutions and organizations in the world approach seriously to distance education besides traditional education. It is inevitable to use the distance education in teaching the problem solving skills in this different dimension of the education. In the studies in Turkey and abroad in the field of mathematics teaching, problem solving skills are generally stated not to be at the desired level and often expressed to have difficulty in teaching. For this reason, difficulties of the students in problem solving have initially been evaluated and the system has been prepared utilizing artificial intelligence algorithms according to the obtained results. In the evaluation of the findings obtained from the application, it has been concluded that the system is responsive to the needs of the students and is successful in general, but that conceptual changes should be made in order that students adapt to the system quickly.

  2. Intelligent community management system based on the devicenet fieldbus

    Science.gov (United States)

    Wang, Yulan; Wang, Jianxiong; Liu, Jiwen

    2013-03-01

    With the rapid development of the national economy and the improvement of people's living standards, people are making higher demands on the living environment. And the estate management content, management efficiency and service quality have been higher required. This paper in-depth analyzes about the intelligent community of the structure and composition. According to the users' requirements and related specifications, it achieves the district management systems, which includes Basic Information Management: the management level of housing, household information management, administrator-level management, password management, etc. Service Management: standard property costs, property charges collecting, the history of arrears and other property expenses. Security Management: household gas, water, electricity and security and other security management, security management district and other public places. Systems Management: backup database, restore database, log management. This article also carries out on the Intelligent Community System analysis, proposes an architecture which is based on B / S technology system. And it has achieved a global network device management with friendly, easy to use, unified human - machine interface.

  3. Intelligent Chiral Sensing Based on Supramolecular and Interfacial Concepts

    Directory of Open Access Journals (Sweden)

    Hironori Izawa

    2010-07-01

    Full Text Available Of the known intelligently-operating systems, the majority can undoubtedly be classed as being of biological origin. One of the notable differences between biological and artificial systems is the important fact that biological materials consist mostly of chiral molecules. While most biochemical processes routinely discriminate chiral molecules, differentiation between chiral molecules in artificial systems is currently one of the challenging subjects in the field of molecular recognition. Therefore, one of the important challenges for intelligent man-made sensors is to prepare a sensing system that can discriminate chiral molecules. Because intermolecular interactions and detection at surfaces are respectively parts of supramolecular chemistry and interfacial science, chiral sensing based on supramolecular and interfacial concepts is a significant topic. In this review, we briefly summarize recent advances in these fields, including supramolecular hosts for color detection on chiral sensing, indicator-displacement assays, kinetic resolution in supramolecular reactions with analyses by mass spectrometry, use of chiral shape-defined polymers, such as dynamic helical polymers, molecular imprinting, thin films on surfaces of devices such as QCM, functional electrodes, FET, and SPR, the combined technique of magnetic resonance imaging and immunoassay, and chiral detection using scanning tunneling microscopy and cantilever technology. In addition, we will discuss novel concepts in recent research including the use of achiral reagents for chiral sensing with NMR, and mechanical control of chiral sensing. The importance of integration of chiral sensing systems with rapidly developing nanotechnology and nanomaterials is also emphasized.

  4. Application of Artificial Intelligence Techniques in Unmanned Aerial Vehicle Flight

    Science.gov (United States)

    Bauer, Frank H. (Technical Monitor); Dufrene, Warren R., Jr.

    2003-01-01

    This paper describes the development of an application of Artificial Intelligence for Unmanned Aerial Vehicle (UAV) control. The project was done as part of the requirements for a class in Artificial Intelligence (AI) at Nova southeastern University and as an adjunct to a project at NASA Goddard Space Flight Center's Wallops Flight Facility for a resilient, robust, and intelligent UAV flight control system. A method is outlined which allows a base level application for applying an AI method, Fuzzy Logic, to aspects of Control Logic for UAV flight. One element of UAV flight, automated altitude hold, has been implemented and preliminary results displayed. A low cost approach was taken using freeware, gnu, software, and demo programs. The focus of this research has been to outline some of the AI techniques used for UAV flight control and discuss some of the tools used to apply AI techniques. The intent is to succeed with the implementation of applying AI techniques to actually control different aspects of the flight of an UAV.

  5. Robust Bio-Signal Based Control of an Intelligent Wheelchair

    Directory of Open Access Journals (Sweden)

    Dongyi Chen

    2013-09-01

    Full Text Available In this paper, an adaptive human-machine interaction (HMI method that is based on surface electromyography (sEMG signals is proposed for the hands-free control of an intelligent wheelchair. sEMG signals generated by the facial movements are obtained by a convenient dry electrodes sensing device. After the signals features are extracted from the autoregressive model, control data samples are updated and trained by an incremental online learning algorithm in real-time. Experimental results show that the proposed method can significantly improve the classification accuracy and training speed. Moreover, this method can effectively reduce the influence of muscle fatigue during a long time operation of sEMG-based HMI.

  6. Price Comparisons on the Internet Based on Computational Intelligence

    Science.gov (United States)

    Kim, Jun Woo; Ha, Sung Ho

    2014-01-01

    Information-intensive Web services such as price comparison sites have recently been gaining popularity. However, most users including novice shoppers have difficulty in browsing such sites because of the massive amount of information gathered and the uncertainty surrounding Web environments. Even conventional price comparison sites face various problems, which suggests the necessity of a new approach to address these problems. Therefore, for this study, an intelligent product search system was developed that enables price comparisons for online shoppers in a more effective manner. In particular, the developed system adopts linguistic price ratings based on fuzzy logic to accommodate user-defined price ranges, and personalizes product recommendations based on linguistic product clusters, which help online shoppers find desired items in a convenient manner. PMID:25268901

  7. Intelligent Home Control System Based on Single Chip Microcomputer

    Science.gov (United States)

    Yang, Libo

    2017-12-01

    Intelligent home as a way to achieve the realization of the family information has become an important part of the development of social information, Internet of Things because of its huge application prospects, will be smart home industry in the development process of a more realistic breakthrough in the smart home industry development has great significance. This article is based on easy to implement, easy to operate, close to the use of the design concept, the use of STC89C52 microcontroller as the control core for the control terminal, and including infrared remote control, buttons, Web interface, including multiple control sources to control household appliances. The second chapter of this paper describes the design of the hardware and software part of the specific implementation, the fifth chapter is based on the design of a good function to build a specific example of the environment.

  8. Principles of artificial intelligence

    CERN Document Server

    Nilsson, Nils J

    1980-01-01

    A classic introduction to artificial intelligence intended to bridge the gap between theory and practice, Principles of Artificial Intelligence describes fundamental AI ideas that underlie applications such as natural language processing, automatic programming, robotics, machine vision, automatic theorem proving, and intelligent data retrieval. Rather than focusing on the subject matter of the applications, the book is organized around general computational concepts involving the kinds of data structures used, the types of operations performed on the data structures, and the properties of th

  9. General Video Game AI: Learning from Screen Capture

    OpenAIRE

    Kunanusont, Kamolwan; Lucas, Simon M.; Perez-Liebana, Diego

    2017-01-01

    General Video Game Artificial Intelligence is a general game playing framework for Artificial General Intelligence research in the video-games domain. In this paper, we propose for the first time a screen capture learning agent for General Video Game AI framework. A Deep Q-Network algorithm was applied and improved to develop an agent capable of learning to play different games in the framework. After testing this algorithm using various games of different categories and difficulty levels, th...

  10. AI systems approach in particle accelerators

    International Nuclear Information System (INIS)

    Kataria, S.K.; Bhagwat, P.V.; Kori, S.A.

    1992-01-01

    The large particle accelerators machines like pelletron accelerator at Tata Institute of Fundamental Research (T.I.F.R) have several levels of controls with operators responsible for overall global control decisions and closed loop feedback controllers for relatively small subsystems of the machines. As the accelerator machines are becoming more complicated and the requirements more stringent, there is a need to provide the operators with an artificial intelligence (AI) system to aid in the tuning the machine and in failure diagnosis. There are few major areas in the pelletron operation, which can be done more efficiently using AI systems approach so that useful beam is available for much more time: 1) Accelerator Conditioning, 2) Accelerator Tuning, and 3) Maintaining the Tune beams. The feasibility study for using expert system for above areas and also for safety evaluation of the various subsystems is carried out. (author). 10 refs., 4 figs

  11. Managing bioengineering complexity with AI techniques.

    Science.gov (United States)

    Beal, Jacob; Adler, Aaron; Yaman, Fusun

    2016-10-01

    Our capabilities for systematic design and engineering of biological systems are rapidly increasing. Effectively engineering such systems, however, requires the synthesis of a rapidly expanding and changing complex body of knowledge, protocols, and methodologies. Many of the problems in managing this complexity, however, appear susceptible to being addressed by artificial intelligence (AI) techniques, i.e., methods enabling computers to represent, acquire, and employ knowledge. Such methods can be employed to automate physical and informational "routine" work and thus better allow humans to focus their attention on the deeper scientific and engineering issues. This paper examines the potential impact of AI on the engineering of biological organisms through the lens of a typical organism engineering workflow. We identify a number of key opportunities for significant impact, as well as challenges that must be overcome. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  12. Artificial Intelligence, Counseling, and Cognitive Psychology.

    Science.gov (United States)

    Brack, Greg; And Others

    With the exception of a few key writers, counselors largely ignore the benefits that Artificial Intelligence (AI) and Cognitive Psychology (CP) can bring to counseling. It is demonstrated that AI and CP can be integrated into the counseling literature. How AI and CP can offer new perspectives on information processing, cognition, and helping is…

  13. Intelligent personal navigator supported by knowledge-based systems for estimating dead reckoning navigation parameters

    Science.gov (United States)

    Moafipoor, Shahram

    Personal navigators (PN) have been studied for about a decade in different fields and applications, such as safety and rescue operations, security and emergency services, and police and military applications. The common goal of all these applications is to provide precise and reliable position, velocity, and heading information of each individual in various environments. In the PN system developed in this dissertation, the underlying assumption is that the system does not require pre-existing infrastructure to enable pedestrian navigation. To facilitate this capability, a multisensor system concept, based on the Global Positioning System (GPS), inertial navigation, barometer, magnetometer, and a human pedometry model has been developed. An important aspect of this design is to use the human body as navigation sensor to facilitate Dead Reckoning (DR) navigation in GPS-challenged environments. The system is designed predominantly for outdoor environments, where occasional loss of GPS lock may happen; however, testing and performance demonstration have been extended to indoor environments. DR navigation is based on a relative-measurement approach, with the key idea of integrating the incremental motion information in the form of step direction (SD) and step length (SL) over time. The foundation of the intelligent navigation system concept proposed here rests in exploiting the human locomotion pattern, as well as change of locomotion in varying environments. In this context, the term intelligent navigation represents the transition from the conventional point-to-point DR to dynamic navigation using the knowledge about the mechanism of the moving person. This approach increasingly relies on integrating knowledge-based systems (KBS) and artificial intelligence (AI) methodologies, including artificial neural networks (ANN) and fuzzy logic (FL). In addition, a general framework of the quality control for the real-time validation of the DR processing is proposed, based on a

  14. Intelligent Aggregation Based on Content Routing Scheme for Cloud Computing

    Directory of Open Access Journals (Sweden)

    Jiachen Xu

    2017-10-01

    Full Text Available Cloud computing has emerged as today’s most exciting computing paradigm for providing services using a shared framework, which opens a new door for solving the problems of the explosive growth of digital resource demands and their corresponding convenience. With the exponential growth of the number of data types and data size in so-called big data work, the backbone network is under great pressure due to its transmission capacity, which is lower than the growth of the data size and would seriously hinder the development of the network without an effective approach to solve this problem. In this paper, an Intelligent Aggregation based on a Content Routing (IACR scheme for cloud computing, which could reduce the amount of data in the network effectively and play a basic supporting role in the development of cloud computing, is first put forward. All in all, the main innovations in this paper are: (1 A framework for intelligent aggregation based on content routing is proposed, which can support aggregation based content routing; (2 The proposed IACR scheme could effectively route the high aggregation ratio data to the data center through the same routing path so as to effectively reduce the amount of data that the network transmits. The theoretical analyses experiments and results show that, compared with the previous original routing scheme, the IACR scheme can balance the load of the whole network, reduce the amount of data transmitted in the network by 41.8%, and reduce the transmission time by 31.6% in the same network with a more balanced network load.

  15. SII-Based Speech Prepocessing for Intelligibility Improvement in Noise

    DEFF Research Database (Denmark)

    Taal, Cees H.; Jensen, Jesper

    2013-01-01

    filter sets certain frequency bands to zero when they do not contribute to intelligibility anymore. Experiments show large intelligibility improvements with the proposed method when used in stationary speech-shaped noise. However, it was also found that the method does not perform well for speech...... corrupted by a competing speaker. This is due to the fact that the SII is not a reliable intelligibility predictor for fluctuating noise sources. MATLAB code is provided....

  16. An Integrated Conceptual Environment based on Collective Intelligence and Distributed Artificial Intelligence for Connecting People on Problem Solving

    Directory of Open Access Journals (Sweden)

    Vasile MAZILESCU

    2012-12-01

    Full Text Available This paper aims to analyze the different forms of intelligence within organizations in a systemic and inclusive vision, in order to conceptualize an integrated environment based on Distributed Artificial Intelligence (DAI and Collective Intelligence (CI. In this way we effectively shift the classical approaches of connecting people with people using collaboration tools (which allow people to work together, such as videoconferencing or email, groupware in virtual space, forums, workflow, of connecting people with a series of content management knowledge (taxonomies and documents classification, ontologies or thesauri, search engines, portals, to the current approaches of connecting people on the use (automatic of operational knowledge to solve problems and make decisions based on intellectual cooperation. The best way to use collective intelligence is based on knowledge mobilization and semantic technologies. We must not let computers to imitate people but to support people think and develop their ideas within a group. CI helps people to think together, while DAI tries to support people so as to limit human error. Within an organization, to manage CI is to combine instruments like Semantic Technologies (STs, knowledge mobilization methods for developing Knowledge Management (KM strategies, and the processes that promote connection and collaboration between individual minds in order to achieve collective objectives, to perform a task or to solve increasingly economic complex problems.

  17. Data driven model generation based on computational intelligence

    Science.gov (United States)

    Gemmar, Peter; Gronz, Oliver; Faust, Christophe; Casper, Markus

    2010-05-01

    The simulation of discharges at a local gauge or the modeling of large scale river catchments are effectively involved in estimation and decision tasks of hydrological research and practical applications like flood prediction or water resource management. However, modeling such processes using analytical or conceptual approaches is made difficult by both complexity of process relations and heterogeneity of processes. It was shown manifold that unknown or assumed process relations can principally be described by computational methods, and that system models can automatically be derived from observed behavior or measured process data. This study describes the development of hydrological process models using computational methods including Fuzzy logic and artificial neural networks (ANN) in a comprehensive and automated manner. Methods We consider a closed concept for data driven development of hydrological models based on measured (experimental) data. The concept is centered on a Fuzzy system using rules of Takagi-Sugeno-Kang type which formulate the input-output relation in a generic structure like Ri : IFq(t) = lowAND...THENq(t+Δt) = ai0 +ai1q(t)+ai2p(t-Δti1)+ai3p(t+Δti2)+.... The rule's premise part (IF) describes process states involving available process information, e.g. actual outlet q(t) is low where low is one of several Fuzzy sets defined over variable q(t). The rule's conclusion (THEN) estimates expected outlet q(t + Δt) by a linear function over selected system variables, e.g. actual outlet q(t), previous and/or forecasted precipitation p(t ?Δtik). In case of river catchment modeling we use head gauges, tributary and upriver gauges in the conclusion part as well. In addition, we consider temperature and temporal (season) information in the premise part. By creating a set of rules R = {Ri|(i = 1,...,N)} the space of process states can be covered as concise as necessary. Model adaptation is achieved by finding on optimal set A = (aij) of conclusion

  18. Evaluation of Intelligent Grouping Based on Learners' Collaboration Competence Level in Online Collaborative Learning Environment

    Science.gov (United States)

    Muuro, Maina Elizaphan; Oboko, Robert; Wagacha, Waiganjo Peter

    2016-01-01

    In this paper we explore the impact of an intelligent grouping algorithm based on learners' collaborative competency when compared with (a) instructor based Grade Point Average (GPA) method level and (b) random method, on group outcomes and group collaboration problems in an online collaborative learning environment. An intelligent grouping…

  19. Implementation of Multiple Intelligences Supported Project-Based Learning in EFL/ESL Classrooms

    Science.gov (United States)

    Bas, Gokhan

    2008-01-01

    This article deals with the implementation of Multiple Intelligences supported Project-Based learning in EFL/ESL Classrooms. In this study, after Multiple Intelligences supported Project-based learning was presented shortly, the implementation of this learning method into English classrooms. Implementation process of MI supported Project-based…

  20. A review of European applications of artificial intelligence to space

    Science.gov (United States)

    Drummond, Mark (Editor); Stewart, Helen (Editor)

    1993-01-01

    The purpose is to describe the applications of Artificial Intelligence (AI) to the European Space program that are being developed or have been developed. The results of a study sponsored by the Artificial Intelligence Research and Development program of NASA's Office of Advanced Concepts and Technology (OACT) are described. The report is divided into two sections. The first consists of site reports, which are descriptions of the AI applications seen at each place visited. The second section consists of two summaries which synthesize the information in the site reports by organizing this information in two different ways. The first organizes the material in terms of the type of application, e.g., data analysis, planning and scheduling, and procedure management. The second organizes the material in terms of the component technologies of Artificial Intelligence which the applications used, e.g., knowledge based systems, model based reasoning, procedural reasoning, etc.

  1. Methods for Model-Based Reasoning within Agent-Based Ambient Intelligence Applications

    NARCIS (Netherlands)

    Bosse, T.; Both, F.; Gerritsen, C.; Hoogendoorn, M.; Treur, J.

    2012-01-01

    Within agent-based Ambient Intelligence applications agents react to humans based on information obtained by sensoring and their knowledge about human functioning. Appropriate types of reactions depend on the extent to which an agent understands the human and is able to interpret the available

  2. Planning chemical syntheses with deep neural networks and symbolic AI

    Science.gov (United States)

    Segler, Marwin H. S.; Preuss, Mike; Waller, Mark P.

    2018-03-01

    To plan the syntheses of small organic molecules, chemists use retrosynthesis, a problem-solving technique in which target molecules are recursively transformed into increasingly simpler precursors. Computer-aided retrosynthesis would be a valuable tool but at present it is slow and provides results of unsatisfactory quality. Here we use Monte Carlo tree search and symbolic artificial intelligence (AI) to discover retrosynthetic routes. We combined Monte Carlo tree search with an expansion policy network that guides the search, and a filter network to pre-select the most promising retrosynthetic steps. These deep neural networks were trained on essentially all reactions ever published in organic chemistry. Our system solves for almost twice as many molecules, thirty times faster than the traditional computer-aided search method, which is based on extracted rules and hand-designed heuristics. In a double-blind AB test, chemists on average considered our computer-generated routes to be equivalent to reported literature routes.

  3. Applying AI techniques to improve alarm display effectiveness

    International Nuclear Information System (INIS)

    Gross, J.M.; Birrer, S.A.; Crosberg, D.R.

    1987-01-01

    The Alarm Filtering System (AFS) addresses the problem of information overload in a control room during abnormal operations. Since operators can miss vital information during these periods, systems which emphasize important messages are beneficial. AFS uses the artificial intelligence (AI) technique of object-oriented programming to filter and dynamically prioritize alarm messages. When an alarm's status changes, AFS determines the relative importance of that change according to the current process state. AFS bases that relative importance on relationships the newly changed alarm has with other activated alarms. Evaluations of a alarm importance take place without regard to the activation sequence of alarm signals. The United States Department of Energy has applied for a patent on the approach used in this software. The approach was originally developed by EG and G Idaho for a nuclear reactor control room

  4. Intelligent Growth Automaton of Virtual Plant Based on Physiological Engine

    Science.gov (United States)

    Zhu, Qingsheng; Guo, Mingwei; Qu, Hongchun; Deng, Qingqing

    In this paper, a novel intelligent growth automaton of virtual plant is proposed. Initially, this intelligent growth automaton analyzes the branching pattern which is controlled by genes and then builds plant; moreover, it stores the information of plant growth, provides the interface between virtual plant and environment, and controls the growth and development of plant on the basis of environment and the function of plant organs. This intelligent growth automaton can simulate that the plant growth is controlled by genetic information system, and the information of environment and the function of plant organs. The experimental results show that the intelligent growth automaton can simulate the growth of plant conveniently and vividly.

  5. Seventh Scandinavian Conference on Artificial Intelligence

    DEFF Research Database (Denmark)

    Lund, Henrik Hautop; Mayoh, Brian Henry; Perram, John

    2001-01-01

    The book covers the seventh Scandinavian Conference on Artificial Intelligence, held at the Maersk Mc-Kinney Moller Institute for Production Technology at the University of Southern Denmark during the period 20-21 February, 2001. It continues the tradition established by SCAI of being one...... of the most important regional AI conferences in Europe, attracting high quality submissions from Scandinavia and the rest of the world, including the Baltic countries. The contents include robotics, sensor/motor intelligence, evolutionary robotics, behaviour-based systems, multi-agent systems, applications...

  6. AIS ASM Operational Integration Plan

    Science.gov (United States)

    2013-08-01

    Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary AIS ASM Operational... AIS ASM Operational Integration Plan Distribution Statement A: Approved for public release; distribution is unlimited. August 2013 Report No...CD-D-07-15 AIS ASM Operational Integration Plan ii UNCLAS//Public | CG-926 R&DC | I. Gonin, et al. | Public August 2013 N O T I C

  7. Intelligent perception control based on a blackboard architecture

    International Nuclear Information System (INIS)

    Taibi, I.; Koenig, A.; Vacherand, F.

    1991-01-01

    In this paper, is described the intelligent perception control system GESPER which is presently equipped with a set of three cameras, a telemeter and a camera associated with a structured strip light. This system is of great interest for all our robotic applications as it is capable of autonomously planning, triggering acquisitions, integrating and interpreting multisensory data. The GESPER architecture, based on the blackboard model, provides a generic development method for indoor and outdoor perception. The modularity and the independence of the knowledge sources make the software evolving easily without breaking down the architecture. New sensors and/or new data processing can be integrated by the addition of new knowledge sources that modelize them. At present, first results are obtained in our testbed hall which simulates the nuclear plant as gives similar experimental conditions. Our ongoing research concerns the improvement of fusion algorithms and the embedding of the whole system (hardware and software) on target robots and distributed architecture

  8. Machine learning based Intelligent cognitive network using fog computing

    Science.gov (United States)

    Lu, Jingyang; Li, Lun; Chen, Genshe; Shen, Dan; Pham, Khanh; Blasch, Erik

    2017-05-01

    In this paper, a Cognitive Radio Network (CRN) based on artificial intelligence is proposed to distribute the limited radio spectrum resources more efficiently. The CRN framework can analyze the time-sensitive signal data close to the signal source using fog computing with different types of machine learning techniques. Depending on the computational capabilities of the fog nodes, different features and machine learning techniques are chosen to optimize spectrum allocation. Also, the computing nodes send the periodic signal summary which is much smaller than the original signal to the cloud so that the overall system spectrum source allocation strategies are dynamically updated. Applying fog computing, the system is more adaptive to the local environment and robust to spectrum changes. As most of the signal data is processed at the fog level, it further strengthens the system security by reducing the communication burden of the communications network.

  9. Management Intelligent Systems : First International Symposium

    CERN Document Server

    Martínez-López, Francisco; Rodríguez, Juan

    2012-01-01

    The 2012 International Symposium on Management Intelligent Systems is believed to be the first international forum to present and discuss original, rigorous and significant contributions on Artificial Intelligence-based (AI) solutions—with a strong, practical logic and, preferably, with empirical applications—developed to aid the management of organizations in multiple areas, activities, processes and problem-solving; i.e., what we propose to be named as Management Intelligent Systems (MiS). The three-day event aimed to bring together researchers interested in this promising interdisciplinary field who came from areas as varied as management, marketing, and business in general, computer science, artificial intelligence, statistics, etc. This volume presents the proceedings of these activities in a collection of contributions with many original approaches. They address diverse Management and Business areas of application such as decision support, segmentation of markets, CRM, product design, service person...

  10. Artificial intelligence techniques for sizing photovoltaic systems. A review

    Energy Technology Data Exchange (ETDEWEB)

    Mellit, A. [Department of Electronics, Faculty of Science Engineering, LAMEL Laboratory, Jijel University, P.O. Box 98, Oulad Aissa, Jijel 18000 (Algeria); Kalogirou, S.A. [Department of Mechanical Engineering and Materials Science and Engineering, Cyprus University of Technology, P.O. Box 50329, Limassol 3603 (Cyprus); Hontoria, L. [Grupo Investigacion y Desarrollo en Energia Solar y Automatica, Dpto. de Electronica, E.P.S. Jaen, Universidad de Jaen, Avda., Madrid, 35, 23071 Jaen (Spain); Shaari, S. [Faculty of Applied Sciences, Universiti Teknologi MARA 40450 Shah Alam, Selangor (Malaysia)

    2009-02-15

    Artificial intelligence (AI) techniques are becoming useful as alternate approaches to conventional techniques or as components of integrated systems. They have been used to solve complicated practical problems in various areas and are becoming more and more popular nowadays. AI-techniques have the following features: can learn from examples; are fault tolerant in the sense that they are able to handle noisy and incomplete data; are able to deal with non-linear problems; and once trained can perform prediction and generalization at high speed. AI-based systems are being developed and deployed worldwide in a myriad of applications, mainly because of their symbolic reasoning, flexibility and explanation capabilities. AI have been used and applied in different sectors, such as engineering, economics, medicine, military, marine, etc. They have also been applied for modeling, identification, optimization, prediction, forecasting, and control of complex systems. The main objective of this paper is to present an overview of the AI-techniques for sizing photovoltaic (PV) systems: stand-alone PVs, grid-connected PV systems, PV-wind hybrid systems, etc. Published literature presented in this paper show the potential of AI as a design tool for the optimal sizing of PV systems. Additionally, the advantage of using an AI-based sizing of PV systems is that it provides good optimization, especially in isolated areas, where the weather data are not always available. (author)

  11. The National Artificial Intelligence Research And Development Strategic Plan

    Data.gov (United States)

    Networking and Information Technology Research and Development, Executive Office of the President — Executive Summary: Artificial intelligence (AI) is a transformative technology that holds promise for tremendous societal and economic benefit. AI has the potential...

  12. JOYO operation support system 'JOYCAT' based on intelligent alarm handling

    International Nuclear Information System (INIS)

    Tamaoki, Tetsuo; Yamamoto, Hiroki; Sato, Masuo; Yoshida, Megumu; Kaneko, Tomoko; Terunuma, Seiichi; Takatsuto, Hiroshi; Morimoto, Makoto.

    1992-01-01

    An operation support system for the experimental fast reactor 'JOYO' was developed based on an intelligent alarm-handling. A specific feature of this system, called JOYCAT (JOYO Consulting and Analyzing Tool), is in its sequential processing structure that a uniform treatment by using design knowledge base is firstly applied for all activated alarms, and an exceptional treatment by using heuristic knowledge base is then applied only for the former results. This enables us to achieve real-time and flexible alarm-handling. The first alarm-handling determines the candidates of causal alarms, important alarms with which the operator should firstly cope, through identifying the cause-consequence relations among alarms based on the design knowledge base in which importance and activating conditions are described for each of 640 alarms in a frame format. The second alarm-handling makes the final judgement with the candidates by using the heuristic knowledge base described as production rules. Then, operation manuals concerning the most important alarms are displayed to operators. JOYCAT has been in commission since September of 1990, after a wide scope of validation tests by using an on-site full-scope training simulator. (author)

  13. Management Intelligent Systems : 2nd International Symposium

    CERN Document Server

    Martínez-López, Francisco; Vicari, Rosa; Prieta, Fernando

    2013-01-01

    This symposium was born as a research forum to present and discuss original, rigorous and significant contributions on Artificial Intelligence-based (AI) solutions—with a strong, practical logic and, preferably, with empirical applications—developed to aid the management of organizations in multiple areas, activities, processes and problem-solving; what we call Management Intelligent Systems (MiS).   This volume presents the proceedings of these activities in a collection of contributions with many original approaches. They address diverse Management and Business areas of application such as decision support, segmentation of markets, CRM, product design, service personalization, organizational design, e-commerce, credit scoring, workplace integration, innovation management, business database analysis, workflow management, location of stores, etc. A wide variety of AI techniques have been applied to these areas such as multi-objective optimization and evolutionary algorithms, classification algorithms, an...

  14. Exploring AI Language Assistants with Primary EFL Students

    Science.gov (United States)

    Underwood, Joshua

    2017-01-01

    The main objective of this study was to identify ways to incorporate voice-driven Artificial Intelligence (AI) effectively in classroom language learning. This nine month teacher-led design research study employed technology probes (Amazon's Alexa, Apple's Siri, Google voice search) and co-design methods with a class of primary age English as a…

  15. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Erickson, S.A.

    1984-04-25

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project.

  16. AI/Simulation Fusion Project at Lawrence Livermore National Laboratory

    International Nuclear Information System (INIS)

    Erickson, S.A.

    1984-01-01

    This presentation first discusses the motivation for the AI Simulation Fusion project. After discussing very briefly what expert systems are in general, what object oriented languages are in general, and some observed features of typical combat simulations, it discusses why putting together artificial intelligence and combat simulation makes sense. We then talk about the first demonstration goal for this fusion project

  17. AI AND SAR APPROACHES FOR PREDICTING CHEMICAL CARCINOGENICITY: SURVEY AND STATUS REPORT

    Science.gov (United States)

    A wide variety of artificial intelligence (AI) and structure-activity relationship (SAR approaches have been applied to tackling the general problem of predicting rodent chemical carcinogenicity. Given the diversity of chemical structures and mechanisms relative to this endpoin...

  18. Cyclotron operating mode determination based on intelligent methods

    International Nuclear Information System (INIS)

    Ouda, M.M.E.M.

    2011-01-01

    Particle accelerators are generators that produce beams of charged particles with energies depending on the accelerator type. The MGC-20 cyclotron is a cyclic particle accelerator used for accelerating protons, deuterons, alpha particles, and helium-3 to different energies. Main applications are isotopes production, nuclear reactions studies, and mass spectroscopy studies and other industrial applications. The cyclotron is a complicated machine depends on using a strong magnetic field and high frequency-high voltage electric field together to accelerate and bend charged particles inside the accelerating chamber. It consists of the following main parts, the radio frequency system, the main magnet with the auxiliary concentric and harmonic coils, the electrostatic deflector, and the ion source, the beam transport system, and high precision and high stability DC power supplies.To accelerate a particle to certain energy, one has to adjust the cyclotron operating parameters to be suitable to accelerate this particle to that energy. If the cyclotron operating parameters together are adjusted to accelerate a charged particle to certain energy, then these parameters together are named the operating mode to accelerate this particle to that energy. For example the operating mode to accelerate protons to 18 MeV is named the (18 MeV protons operating mode). The operating mode includes many parameters that must be adjusted together to be successful to accelerate, extract, focus, steer a particle from the ion source to the experiment. Due to the big number of parameters in the operating modes, 19 parameters have been selected in this thesis to be used in an intelligent system based on feed forward back propagation neural network to determine the parameters for new operating modes. The new intelligent system depends on the available information about the currently used operating modes.The classic way to determine a new operating mode was depending on trial and error method to

  19. Building Explainable Artificial Intelligence Systems

    National Research Council Canada - National Science Library

    Core, Mark G; Lane, H. Chad; van Lent, Michael; Gomboc, Dave; Solomon, Steve; Rosenberg, Milton

    2006-01-01

    As artificial intelligence (AI) systems and behavior models in military simulations become increasingly complex, it has been difficult for users to understand the activities of computer-controlled entities...

  20. Sustainable Technology Analysis of Artificial Intelligence Using Bayesian and Social Network Models

    Directory of Open Access Journals (Sweden)

    Juhwan Kim

    2018-01-01

    Full Text Available Recent developments in artificial intelligence (AI have led to a significant increase in the use of AI technologies. Many experts are researching and developing AI technologies in their respective fields, often submitting papers and patent applications as a result. In particular, owing to the characteristics of the patent system that is used to protect the exclusive rights to registered technology, patent documents contain detailed information on the developed technology. Therefore, in this study, we propose a statistical method for analyzing patent data on AI technology to improve our understanding of sustainable technology in the field of AI. We collect patent documents that are related to AI technology, and then analyze the patent data to identify sustainable AI technology. In our analysis, we develop a statistical method that combines social network analysis and Bayesian modeling. Based on the results of the proposed method, we provide a technological structure that can be applied to understand the sustainability of AI technology. To show how the proposed method can be applied to a practical problem, we apply the technological structure to a case study in order to analyze sustainable AI technology.

  1. AI in medical education--another grand challenge for medical informatics.

    Science.gov (United States)

    Lillehaug, S I; Lajoie, S P

    1998-03-01

    The potential benefits of artificial intelligence in medicine (AIM) were never realized as anticipated. This paper addresses ways in which such potential can be achieved. Recent discussions of this topic have proposed a stronger integration between AIM applications and health information systems, and emphasize computer guidelines to support the new health care paradigms of evidence-based medicine and cost-effectiveness. These proposals, however, promote the initial definition of AIM applications as being AI systems that can perform or aid in diagnoses. We challenge this traditional philosophy of AIM and propose a new approach aiming at empowering health care workers to become independent self-sufficient problem solvers and decision makers. Our philosophy is based on findings from a review of empirical research that examines the relationship between the health care personnel's level of knowledge and skills, their job satisfaction, and the quality of the health care they provide. This review supports addressing the quality of health care by empowering health care workers to reach their full potential. As an aid in this empowerment process we argue for reviving a long forgotten AIM research area, namely, AI based applications for medical education and training. There is a growing body of research in artificial intelligence in education that demonstrates that the use of artificial intelligence can enhance learning in numerous domains. By examining the strengths of these educational applications and the results from previous AIM research we derive a framework for empowering medical personnel and consequently raising the quality of health care through the use of advanced AI based technology.

  2. An Intelligent Fleet Condition-Based Maintenance Decision Making Method Based on Multi-Agent

    OpenAIRE

    Bo Sun; Qiang Feng; Songjie Li

    2012-01-01

    According to the demand for condition-based maintenance online decision making among a mission oriented fleet, an intelligent maintenance decision making method based on Multi-agent and heuristic rules is proposed. The process of condition-based maintenance within an aircraft fleet (each containing one or more Line Replaceable Modules) based on multiple maintenance thresholds is analyzed. Then the process is abstracted into a Multi-Agent Model, a 2-layer model structure containing host negoti...

  3. Artificial Intelligence, Employment, and Income

    OpenAIRE

    Nilsson, Nils J.

    1984-01-01

    Artificial intelligence (AI) will have profound societal effects. It promises potential benefits (and may also pose risks) in education, defense, business, law and science. In this article we explore how AI is likely to affect employment and the distribution of income. We argue that AI will indeed reduce drastically the need of human toil. We also note that some people fear the automation of work by machines and the resulting of unemployment. Yet, since the majority of us probably would rathe...

  4. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    2010-01-01

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, the goal of

  5. Explanation and trust: what to tell the user in security and AI?

    NARCIS (Netherlands)

    Pieters, Wolter

    There is a common problem in artificial intelligence (AI) and information security. In AI, an expert system needs to be able to justify and explain a decision to the user. In information security, experts need to be able to explain to the public why a system is secure. In both cases, an important

  6. Development and application of AI technology to plant operation and support

    International Nuclear Information System (INIS)

    Sackett, J.I.; Mott, J.E.

    1989-01-01

    This paper discusses a framework for the development and application of artificial intelligence (AI) technology in existing nuclear facilities and reviews the status of development. We consider those areas best addressed by AI technology, e.g., equipment diagnostics, sensor validation, and expert systems for procedural response or planning. A brief discussion of work in computer displays is also given. (orig./GL)

  7. Feature-based tolerancing for intelligent inspection process definition

    International Nuclear Information System (INIS)

    Brown, C.W.

    1993-07-01

    This paper describes a feature-based tolerancing capability that complements a geometric solid model with an explicit representation of conventional and geometric tolerances. This capability is focused on supporting an intelligent inspection process definition system. The feature-based tolerance model's benefits include advancing complete product definition initiatives (e.g., STEP -- Standard for Exchange of Product model dam), suppling computer-integrated manufacturing applications (e.g., generative process planning and automated part programming) with product definition information, and assisting in the solution of measurement performance issues. A feature-based tolerance information model was developed based upon the notion of a feature's toleranceable aspects and describes an object-oriented scheme for representing and relating tolerance features, tolerances, and datum reference frames. For easy incorporation, the tolerance feature entities are interconnected with STEP solid model entities. This schema will explicitly represent the tolerance specification for mechanical products, support advanced dimensional measurement applications, and assist in tolerance-related methods divergence issues

  8. An Empirical Study of AI Population Dynamics with Million-agent Reinforcement Learning

    OpenAIRE

    Yang, Yaodong; Yu, Lantao; Bai, Yiwei; Wang, Jun; Zhang, Weinan; Wen, Ying; Yu, Yong

    2017-01-01

    In this paper, we conduct an empirical study on discovering the ordered collective dynamics obtained by a population of artificial intelligence (AI) agents. Our intention is to put AI agents into a simulated natural context, and then to understand their induced dynamics at the population level. In particular, we aim to verify if the principles developed in the real world could also be used in understanding an artificially-created intelligent population. To achieve this, we simulate a large-sc...

  9. Artificial Intelligence: A Selected Bibliography.

    Science.gov (United States)

    Smith, Linda C., Comp.

    1984-01-01

    This 19-item annotated bibliography introducing the literature of artificial intelligence (AI) is arranged by type of material--handbook, books (general interest, textbooks, collected readings), journals and newsletters, and conferences and workshops. The availability of technical reports from AI laboratories at universities and private companies…

  10. Pavlovian, Skinner, and Other Behaviourists' Contributions to AI. Chapter 9

    Science.gov (United States)

    Kosinski, Withold; Zaczek-Chrzanowska, Dominika

    2007-01-01

    A version of the definition of intelligent behaviour will be supplied in the context of real and artificial systems. Short presentation of principles of learning, starting with Pavlovian s classical conditioning through reinforced response and operant conditioning of Thorndike and Skinner and finishing with cognitive learning of Tolman and Bandura will be given. The most important figures within behaviourism, especially those with contribution to AI, will be described. Some tools of artificial intelligence that act according to those principles will be presented. An attempt will be made to show when some simple rules for behaviour modifications can lead to a complex intelligent behaviour.

  11. The Actualization of Literary Learning Model Based on Verbal-Linguistic Intelligence

    Science.gov (United States)

    Hali, Nur Ihsan

    2017-01-01

    This article is inspired by Howard Gardner's concept of linguistic intelligence and also from some authors' previous writings. All of them became the authors' reference in developing ideas on constructing a literary learning model based on linguistic intelligence. The writing of this article is not done by collecting data empirically, but by…

  12. The Relationship between Emotional Intelligence and Attitudes toward Computer-Based Instruction of Postsecondary Hospitality Students

    Science.gov (United States)

    Behnke, Carl; Greenan, James P.

    2011-01-01

    This study examined the relationship between postsecondary students' emotional-social intelligence and attitudes toward computer-based instructional materials. Research indicated that emotions and emotional intelligence directly impact motivation, while instructional design has been shown to impact student attitudes and subsequent engagement with…

  13. Artificial Intelligence for the Bang! Game

    OpenAIRE

    Daniláková, Monika

    2017-01-01

    This work explores artificial intelligence (AI) algorithms for the game Bang!, a Wild West-themed card game created by Italian game designer Emiliano Sciarra. The aim of this work was to design three different AIs for this game and to compare them theoretically and experimentally. First, we analyzed game Bang! with regards to game theory, and researched some of the AI algorithms used in similar games. We then designed three different AIs algorithms and compared their advantages and disadvanta...

  14. Artificial Intelligence Research in Australia -- A Profile

    OpenAIRE

    Smith, Elizabeth; Whitelaw, John

    1987-01-01

    Does the United States have a 51st state called Australia? A superficial look at the artificial intelligence (AI) research being done here could give that impression. A look beneath the surface, though, indicates some fundamental differences and reveals a dynamic and rapidly expanding AI community. General awareness of the Australian AI research community has been growing slowly for some time. AI was once considered a bit esoteric -- the domain of an almost lunatic fringe- but the large gover...

  15. Improvement of Base and Soil Construction Quality by Using Intelligent Compaction Technology : Final Report.

    Science.gov (United States)

    2017-08-01

    Intelligent Compaction (IC) technique is a fast-developing technology for base and soil compaction quality control. Proof-rolling subgrades and bases using IC rollers upon completion of compaction can identify the less stiff spots and significantly i...

  16. Artificial intelligence in medicine

    OpenAIRE

    Scerri, Mariella; Grech, Victor E.

    2016-01-01

    Various types of artificial intelligence programs are already available as consultants to physicians, and these help in medical diagnostics and treatment. At the time of writing, extant programs constitute “weak” AI—lacking in consciousness and intentionality. With AI currently making rapid progress in all domains, including those of healthcare, physicians face possible competitors—or worse, claims that doctors may become obsolete. We will explore the development of AI and robotics in medicin...

  17. CHALLENGES OF THE NOT-SO-FAR FUTURE: EU ROBOTICS AND AI LAW IN BUSINESS

    Directory of Open Access Journals (Sweden)

    Roxana Mihaela CATEA

    2018-05-01

    Full Text Available The paper focuses on the emerging European legislation in the area of artificial intelligence and robotics, based on the currently fast developing technical procedures for the manufacture of products characterized by autonomy. The importance of having a clear and stable legislation for the production and spread of technical devices has been under discussion for some time now and member states have reached preliminary conclusions regarding the definition and criteria by which one can identify artificial intelligence. Also, continuous innovation lead to the necessity of integrating these AI products in common household economy and therefore, the need for a proper legal framework addressing both liability and limits for creating and operating machines for civil use arose. This article shall review the measures already taken by the European Parliament and the European Commission for the establishment of a standardized legal framework related to robotic and artificial intelligence products. The objectives of this study are to analyze the general guidelines available as created by the EU legislator which shall ultimately be transposed in national legislation, in order to supersede the current lack of regulations for companies developing and selling AI products nation-wide.

  18. Predicting Couples’ Happiness Based on Spiritual Intelligence and Lovemaking Styles: The Mediating Role of Marital adjustment

    Directory of Open Access Journals (Sweden)

    ZAHRA KERMANI MAMAZANDI

    2017-02-01

    Full Text Available The purpose of this study was to predict couples’ happiness based on spiritual intelligence and lovemaking styles with the mediating role of marital adjustment. Therefore 360 male and female, married students living in Tehran University dormitory were randomly selected and were asked to answer the items of Sternberg’s Love Questionnaire, King’s Spiritual Intelligence Scale, Oxford’s Happiness Questionnaire and Spanier’s Marital Adjustment Questionnaire. Structural equation modeling (path analysis was used for data analysis. The results  of path analysis showed  that spiritual intelligence and lovemaking styles have direct effects on couples’ happiness, and the spiritual intelligence did not have an indirect effect on couples’ happiness whereas lovemaking styles had indirect effects on couples’ happiness through martial satisfaction. Altogether the results of this research show that marital adjustment has a mediating role in predicting couples’ happiness based on spiritual intelligence and lovemaking styles.

  19. Crack identification based on synthetic artificial intelligent technique

    International Nuclear Information System (INIS)

    Shim, Mun Bo; Suh, Myung Won

    2001-01-01

    It has been established that a crack has an important effect on the dynamic behavior of a structure. This effect depends mainly on the location and depth of the crack. To identify the location and depth of a crack in a structure, a method is presented in this paper which uses synthetic artificial intelligent technique, that is, Adaptive-Network-based Fuzzy Inference System(ANFIS) solved via hybrid learning algorithm(the back-propagation gradient descent and the least-squares method) are used to learn the input(the location and depth of a crack)-output(the structural eigenfrequencies) relation of the structural system. With this ANFIS and a Continuous Evolutionary Algorithm(CEA), it is possible to formulate the inverse problem. CEAs based on genetic algorithms work efficiently for continuous search space optimization problems like a parameter identification problem. With this ANFIS, CEAs are used to identify the crack location and depth minimizing the difference from the measured frequencies. We have tried this new idea on a simple beam structure and the results are promising

  20. Home Automation System Based on Intelligent Transducer Enablers

    Science.gov (United States)

    Suárez-Albela, Manuel; Fraga-Lamas, Paula; Fernández-Caramés, Tiago M.; Dapena, Adriana; González-López, Miguel

    2016-01-01

    This paper presents a novel home automation system named HASITE (Home Automation System based on Intelligent Transducer Enablers), which has been specifically designed to identify and configure transducers easily and quickly. These features are especially useful in situations where many transducers are deployed, since their setup becomes a cumbersome task that consumes a significant amount of time and human resources. HASITE simplifies the deployment of a home automation system by using wireless networks and both self-configuration and self-registration protocols. Thanks to the application of these three elements, HASITE is able to add new transducers by just powering them up. According to the tests performed in different realistic scenarios, a transducer is ready to be used in less than 13 s. Moreover, all HASITE functionalities can be accessed through an API, which also allows for the integration of third-party systems. As an example, an Android application based on the API is presented. Remote users can use it to interact with transducers by just using a regular smartphone or a tablet. PMID:27690031

  1. Home Automation System Based on Intelligent Transducer Enablers.

    Science.gov (United States)

    Suárez-Albela, Manuel; Fraga-Lamas, Paula; Fernández-Caramés, Tiago M; Dapena, Adriana; González-López, Miguel

    2016-09-28

    This paper presents a novel home automation system named HASITE (Home Automation System based on Intelligent Transducer Enablers), which has been specifically designed to identify and configure transducers easily and quickly. These features are especially useful in situations where many transducers are deployed, since their setup becomes a cumbersome task that consumes a significant amount of time and human resources. HASITE simplifies the deployment of a home automation system by using wireless networks and both self-configuration and self-registration protocols. Thanks to the application of these three elements, HASITE is able to add new transducers by just powering them up. According to the tests performed in different realistic scenarios, a transducer is ready to be used in less than 13 s. Moreover, all HASITE functionalities can be accessed through an API, which also allows for the integration of third-party systems. As an example, an Android application based on the API is presented. Remote users can use it to interact with transducers by just using a regular smartphone or a tablet.

  2. Home Automation System Based on Intelligent Transducer Enablers

    Directory of Open Access Journals (Sweden)

    Manuel Suárez-Albela

    2016-09-01

    Full Text Available This paper presents a novel home automation system named HASITE (Home Automation System based on Intelligent Transducer Enablers, which has been specifically designed to identify and configure transducers easily and quickly. These features are especially useful in situations where many transducers are deployed, since their setup becomes a cumbersome task that consumes a significant amount of time and human resources. HASITE simplifies the deployment of a home automation system by using wireless networks and both self-configuration and self-registration protocols. Thanks to the application of these three elements, HASITE is able to add new transducers by just powering them up. According to the tests performed in different realistic scenarios, a transducer is ready to be used in less than 13 s. Moreover, all HASITE functionalities can be accessed through an API, which also allows for the integration of third-party systems. As an example, an Android application based on the API is presented. Remote users can use it to interact with transducers by just using a regular smartphone or a tablet.

  3. Predicting chick body mass by artificial intelligence-based models

    Directory of Open Access Journals (Sweden)

    Patricia Ferreira Ponciano Ferraz

    2014-07-01

    Full Text Available The objective of this work was to develop, validate, and compare 190 artificial intelligence-based models for predicting the body mass of chicks from 2 to 21 days of age subjected to different duration and intensities of thermal challenge. The experiment was conducted inside four climate-controlled wind tunnels using 210 chicks. A database containing 840 datasets (from 2 to 21-day-old chicks - with the variables dry-bulb air temperature, duration of thermal stress (days, chick age (days, and the daily body mass of chicks - was used for network training, validation, and tests of models based on artificial neural networks (ANNs and neuro-fuzzy networks (NFNs. The ANNs were most accurate in predicting the body mass of chicks from 2 to 21 days of age after they were subjected to the input variables, and they showed an R² of 0.9993 and a standard error of 4.62 g. The ANNs enable the simulation of different scenarios, which can assist in managerial decision-making, and they can be embedded in the heating control systems.

  4. Solar-Based Fuzzy Intelligent Water Sprinkle System

    Directory of Open Access Journals (Sweden)

    Riza Muhida

    2012-03-01

    Full Text Available A solar-based intelligent water sprinkler system project that has been developed to ensure the effectiveness in watering the plant is improved by making the system automated. The control system consists of an electrical capacitance soil moisture sensor installed into the ground which is interfaced to a controller unit of Motorola 68HC11 Handy board microcontroller. The microcontroller was programmed based on the decision rules made using fuzzy logic approach on when to water the lawn. The whole system is powered up by the solar energy which is then interfaced to a particular type of irrigation timer for plant fertilizing schedule and rain detector through a simple design of rain dual-collector tipping bucket. The controller unit automatically disrupted voltage signals sent to the control valves whenever irrigation was not needed. Using this system we combined the logic implementation in the area of irrigation and weather sensing equipment, and more efficient water delivery can be made possible. 

  5. Monitoring severe accidents using AI techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Ahn, Kwang Il; Kim, Ju Hyun; Na, Man Gyun; Lim, Dong Hyuk

    2012-01-01

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  6. Monitoring severe accidents using AI techniques

    Energy Technology Data Exchange (ETDEWEB)

    No, Young Gyu; Ahn, Kwang Il [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Ju Hyun; Na, Man Gyun [Dept. of Nuclear Engineering, Chosun University, Gwangju (Korea, Republic of); Lim, Dong Hyuk [Korea Institute of Nuclear Nonproliferation and Control, Daejon (Korea, Republic of)

    2012-05-15

    After the Fukushima nuclear accident in 2011, there has been increasing concern regarding severe accidents in nuclear facilities. Severe accident scenarios are difficult for operators to monitor and identify. Therefore, accurate prediction of a severe accident is important in order to manage it appropriately in the unfavorable conditions. In this study, artificial intelligence (AI) techniques, such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH), and fuzzy neural network (FNN), were used to monitor the major transient scenarios of a severe accident caused by three different initiating events, the hot-leg loss of coolant accident (LOCA), the cold-leg LOCA, and the steam generator tube rupture in pressurized water reactors (PWRs). The SVC and PNN models were used for the event classification. The GMDH and FNN models were employed to accurately predict the important timing representing severe accident scenarios. In addition, in order to verify the proposed algorithm, data from a number of numerical simulations were required in order to train the AI techniques due to the shortage of real LOCA data. The data was acquired by performing simulations using the MAAP4 code. The prediction accuracy of the three types of initiating events was sufficiently high to predict severe accident scenarios. Therefore, the AI techniques can be applied successfully in the identification and monitoring of severe accident scenarios in real PWRs.

  7. Applying AI tools to operational space environmental analysis

    Science.gov (United States)

    Krajnak, Mike; Jesse, Lisa; Mucks, John

    1995-01-01

    The U.S. Air Force and National Oceanic Atmospheric Agency (NOAA) space environmental operations centers are facing increasingly complex challenges meeting the needs of their growing user community. These centers provide current space environmental information and short term forecasts of geomagnetic activity. Recent advances in modeling and data access have provided sophisticated tools for making accurate and timely forecasts, but have introduced new problems associated with handling and analyzing large quantities of complex data. AI (Artificial Intelligence) techniques have been considered as potential solutions to some of these problems. Fielding AI systems has proven more difficult than expected, in part because of operational constraints. Using systems which have been demonstrated successfully in the operational environment will provide a basis for a useful data fusion and analysis capability. Our approach uses a general purpose AI system already in operational use within the military intelligence community, called the Temporal Analysis System (TAS). TAS is an operational suite of tools supporting data processing, data visualization, historical analysis, situation assessment and predictive analysis. TAS includes expert system tools to analyze incoming events for indications of particular situations and predicts future activity. The expert system operates on a knowledge base of temporal patterns encoded using a knowledge representation called Temporal Transition Models (TTM's) and an event database maintained by the other TAS tools. The system also includes a robust knowledge acquisition and maintenance tool for creating TTM's using a graphical specification language. The ability to manipulate TTM's in a graphical format gives non-computer specialists an intuitive way of accessing and editing the knowledge base. To support space environmental analyses, we used TAS's ability to define domain specific event analysis abstractions. The prototype system defines

  8. An intelligent clustering based methodology for confusable diseases ...

    African Journals Online (AJOL)

    Journal of Computer Science and Its Application ... In this paper, an intelligent system driven by fuzzy clustering algorithm and Adaptive Neuro-Fuzzy Inference System for ... Data on patients diagnosed and confirmed by laboratory tests of viral ...

  9. AI techniques in geomagnetic storm forecasting

    Science.gov (United States)

    Lundstedt, Henrik

    This review deals with how geomagnetic storms can be predicted with the use of Artificial Intelligence (AI) techniques. Today many different Al techniques have been developed, such as symbolic systems (expert and fuzzy systems) and connectionism systems (neural networks). Even integrations of AI techniques exist, so called Intelligent Hybrid Systems (IHS). These systems are capable of learning the mathematical functions underlying the operation of non-linear dynamic systems and also to explain the knowledge they have learned. Very few such powerful systems exist at present. Two such examples are the Magnetospheric Specification Forecast Model of Rice University and the Lund Space Weather Model of Lund University. Various attempts to predict geomagnetic storms on long to short-term are reviewed in this article. Predictions of a month to days ahead most often use solar data as input. The first SOHO data are now available. Due to the high temporal and spatial resolution new solar physics have been revealed. These SOHO data might lead to a breakthrough in these predictions. Predictions hours ahead and shorter rely on real-time solar wind data. WIND gives us real-time data for only part of the day. However, with the launch of the ACE spacecraft in 1997, real-time data during 24 hours will be available. That might lead to the second breakthrough for predictions of geomagnetic storms.

  10. Artificial intelligence, expert systems, computer vision, and natural language processing

    Science.gov (United States)

    Gevarter, W. B.

    1984-01-01

    An overview of artificial intelligence (AI), its core ingredients, and its applications is presented. The knowledge representation, logic, problem solving approaches, languages, and computers pertaining to AI are examined, and the state of the art in AI is reviewed. The use of AI in expert systems, computer vision, natural language processing, speech recognition and understanding, speech synthesis, problem solving, and planning is examined. Basic AI topics, including automation, search-oriented problem solving, knowledge representation, and computational logic, are discussed.

  11. TOWARDS MEASURES OF INTELLIGENCE BASED ON SEMIOTIC CONTROL

    Energy Technology Data Exchange (ETDEWEB)

    C. JOSLYN

    2000-08-01

    We address the question of how to identify and measure the degree of intelligence in systems. We define the presence of intelligence as equivalent to the presence of a control relation. We contrast the distinct atomic semioic definitions of models and controls, and discuss hierarchical and anticipatory control. We conclude with a suggestion about moving towards quantitative measures of the degree of such control in systems.

  12. The design of remote intelligent terminal based on ARM

    International Nuclear Information System (INIS)

    Zhang Bin; Liu Zixin

    2014-01-01

    This paper introduces the function and principle of the remote intelligent terminal. It was designed on SmartARM 2200, uses uC/OS-II operating system and MiniGUI. And then,it gives a method to realize it. Introduces the work flow of remote intelligent terminal, and the function module of the system are analyzed in detail, and then the terminal of the principle has carried on the preliminary study. (authors)

  13. Social Intelligence Design in Ambient Intelligence

    NARCIS (Netherlands)

    Nijholt, Antinus; Stock, Oliviero; Stock, O.; Nishida, T.; Nishida, Toyoaki

    2009-01-01

    This Special Issue of AI and Society contains a selection of papers presented at the 6th Social Intelligence Design Workshop held at ITC-irst, Povo (Trento, Italy) in July 2007. Being the 6th in a series means that there now is a well-established and also a growing research area. The interest in

  14. Intelligent Home Control System Based on ARM10

    Science.gov (United States)

    Chen, G. X.; Jiang, J.; Zhong, L. H.

    2017-10-01

    Intelligent home is becoming the hot spot of social attention in the 21st century. When it is in China, it is a really new industry. However, there is no doubt that Intelligent home will become a new economic growth point of social development; it will change the life-style of human being. To develop the intelligent home, we should keep up with the development trend of technology. This is the reason why I talk about the intelligent home control system here. In this paper, intelligent home control system is designed for alarm and remote control on gas- leaking, fire disaster, earthquake prediction, etc., by examining environmental changes around house. When the Intelligent home control system has detected an accident occurs, the processor will communicate with the GSM module, informing the house keeper the occurrence of accident. User can receive and send the message to the system to cut the power by mobile phone. The system can get access to DCCthrough ARM10 JTAG interface, using DCC to send and receive messages. At the same time, the debugger on the host is mainly used to receive the user’s command and send it to the debug component in the target system. The data that returned from the target system is received and displayed to the user in a certain format.

  15. Uncertainty in artificial intelligence

    CERN Document Server

    Levitt, TS; Lemmer, JF; Shachter, RD

    1990-01-01

    Clearly illustrated in this volume is the current relationship between Uncertainty and AI.It has been said that research in AI revolves around five basic questions asked relative to some particular domain: What knowledge is required? How can this knowledge be acquired? How can it be represented in a system? How should this knowledge be manipulated in order to provide intelligent behavior? How can the behavior be explained? In this volume, all of these questions are addressed. From the perspective of the relationship of uncertainty to the basic questions of AI, the book divides naturally i

  16. The Actualization of Literary Learning Model Based on Verbal-Linguistic Intelligence

    Directory of Open Access Journals (Sweden)

    Nur Ihsan Halil

    2017-10-01

    Full Text Available This article is inspired by Howard Gardner's concept of linguistic intelligence and also from some authors' previous writings. All of them became the authors' reference in developing ideas on constructing a literary learning model based on linguistic intelligence. The writing of this article is not done by collecting data empirically, but by developing and constructing an existing concept, namely the concept of linguistic intelligence, which is disseminated into a literature-based learning of verbal-linguistic intelligence. The purpose of this paper is to answer the question of how to apply the literary learning model based on the verbal-linguistic intelligence. Then, regarding Gardner's concept, the author formulated a literary learning model based on the verbal-linguistic intelligence through a story-telling learning model with five steps namely arguing, discussing, interpreting, speaking, and writing about literary works. In short, the writer draw a conclusion that learning-based models of verbal-linguistic intelligence can be designed with attention into five components namely (1 definition, (2 characteristics, (3 teaching strategy, (4 final learning outcomes, and (5 figures.

  17. New development thoughts on the bio-inspired intelligence based control for unmanned combat aerial vehicle

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    Bio-inspired intelligence is in the spotlight in the field of international artificial intelligence,and unmanned combat aerial vehicle(UCAV),owing to its potential to perform dangerous,repetitive tasks in remote and hazardous,is very promising for the technological leadership of the nation and essential for improving the security of society.On the basis of introduction of bioinspired intelligence and UCAV,a series of new development thoughts on UCAV control are proposed,including artificial brain based high-level autonomous control for UCAV,swarm intelligence based cooperative control for multiple UCAVs,hy-brid swarm intelligence and Bayesian network based situation assessment under complicated combating environments, bio-inspired hardware based high-level autonomous control for UCAV,and meta-heuristic intelligence based heterogeneous cooperative control for multiple UCAVs and unmanned combat ground vehicles(UCGVs).The exact realization of the proposed new development thoughts can enhance the effectiveness of combat,while provide a series of novel breakthroughs for the intelligence,integration and advancement of future UCAV systems.

  18. Intelligent Search Method Based ACO Techniques for a Multistage Decision Problem EDP/LFP

    Directory of Open Access Journals (Sweden)

    Mostefa RAHLI

    2006-07-01

    Full Text Available The implementation of a numerical library of calculation based optimization in electrical supply networks area is in the centre of the current research orientations, thus, our project in a form given is centred on the development of platform NMSS1. It's a software environment which will preserve many efforts as regards calculations of charge, smoothing curves, losses calculation and economic planning of the generated powers [23].The operational research [17] in a hand and the industrial practice in the other, prove that the means and processes of simulation reached a level of very appreciable reliability and mathematical confidence [4, 5, 14]. It is of this expert observation that many processes make confidence to the results of simulation.The handicaps of this approach or methodology are that it makes base its judgments and handling on simplified assumptions and constraints whose influence was deliberately neglected to be added to the cost to spend [14].By juxtaposing the methods of simulation with artificial intelligence techniques, gathering set of numerical methods acquires an optimal reliability whose assurance can not leave doubt.Software environment NMSS [23] can be a in the field of the rallying techniques of simulation and electric network calculation via a graphic interface. In the same software integrate an AI capability via a module expert system.Our problem is a multistage case where are completely dependant and can't be performed separately.For a multistage problem [21, 22], the results obtained from a credible (large size problem calculation, makes the following question: Could choice of numerical methods set make the calculation of a complete problem using more than two treatments levels, a total error which will be the weakest one possible? It is well-known according to algorithmic policy; each treatment can be characterized by a function called mathematical complexity. This complexity is in fact a coast (a weight overloading

  19. Development of hybrid artificial intelligent based handover decision algorithm

    Directory of Open Access Journals (Sweden)

    A.M. Aibinu

    2017-04-01

    Full Text Available The possibility of seamless handover remains a mirage despite the plethora of existing handover algorithms. The underlying factor responsible for this has been traced to the Handover decision module in the Handover process. Hence, in this paper, the development of novel hybrid artificial intelligent handover decision algorithm has been developed. The developed model is made up of hybrid of Artificial Neural Network (ANN based prediction model and Fuzzy Logic. On accessing the network, the Received Signal Strength (RSS was acquired over a period of time to form a time series data. The data was then fed to the newly proposed k-step ahead ANN-based RSS prediction system for estimation of prediction model coefficients. The synaptic weights and adaptive coefficients of the trained ANN was then used to compute the k-step ahead ANN based RSS prediction model coefficients. The predicted RSS value was later codified as Fuzzy sets and in conjunction with other measured network parameters were fed into the Fuzzy logic controller in order to finalize handover decision process. The performance of the newly developed k-step ahead ANN based RSS prediction algorithm was evaluated using simulated and real data acquired from available mobile communication networks. Results obtained in both cases shows that the proposed algorithm is capable of predicting ahead the RSS value to about ±0.0002 dB. Also, the cascaded effect of the complete handover decision module was also evaluated. Results obtained show that the newly proposed hybrid approach was able to reduce ping-pong effect associated with other handover techniques.

  20. Automatic Identification System (AIS) Transmit Testing in Louisville Phase 2

    Science.gov (United States)

    2014-08-01

    Firewall Louisville QM 65.206.28.x NAIS Site Controller PC RS232 Serial cable TV32 Computer Cmd Center Serial splitter SAAB R40 AIS Base Station...172.17.14.6 Rack mount computer AIS Radio Interface Ethernet Switch 192.168.0.x Firewall Cable Modem 192.168.0.1 VTS Accred. Boundary serial connection...Automatic Identification System ( AIS ) Transmit Testing in Louisville Phase 2 Distribution Statement A: Approved for public release

  1. Implementation Of CAN Based Intelligent Driver Alert System

    Directory of Open Access Journals (Sweden)

    Yin Mar Win Kyaw Myo Maung Maung

    2015-08-01

    Full Text Available This system is an attempt to analyze Intelligent Driver Alert System Using CAN Protocol. CAN Controller Area Network offer an efficient communication protocol among sensors actuators controllers and other nodes in real-time applications and is known for its simplicity reliability and high performance. It has given an effective way by which can increase the car and driver safety. This system presents the development and implementation of a digital driving system for a semi-autonomous vehicle to improve the driver-vehicle interface using microcontroller based data acquisition system that uses ADC to bring all control data from analog to digital format. In this system the signal information like temperature LM35 sensor if the temperature increase above the 60 o C and ultrasonic sensor is adapted to measure the distance between the object and vehicle if obstacle is detected within 75cm from the vehicle the controller gives buzzer to the driver speed measure using RPM sensor if revolution increase up to 1200 per minute controller act and to avoid the maximum revolution and to check the fuel level continuously and display in the percentage if fuel level below 20 percent the controller also gives buzzer to the driver and distance fuel level and temperature continuously display on the LCD.

  2. a New Architecture for Intelligent Systems with Logic Based Languages

    Science.gov (United States)

    Saini, K. K.; Saini, Sanju

    2008-10-01

    People communicate with each other in sentences that incorporate two kinds of information: propositions about some subject, and metalevel speech acts that specify how the propositional information is used—as an assertion, a command, a question, or a promise. By means of speech acts, a group of people who have different areas of expertise can cooperate and dynamically reconfigure their social interactions to perform tasks and solve problems that would be difficult or impossible for any single individual. This paper proposes a framework for intelligent systems that consist of a variety of specialized components together with logic-based languages that can express propositions and speech acts about those propositions. The result is a system with a dynamically changing architecture that can be reconfigured in various ways: by a human knowledge engineer who specifies a script of speech acts that determine how the components interact; by a planning component that generates the speech acts to redirect the other components; or by a committee of components, which might include human assistants, whose speech acts serve to redirect one another. The components communicate by sending messages to a Linda-like blackboard, in which components accept messages that are either directed to them or that they consider themselves competent to handle.

  3. Domain-based Teaching Strategy for Intelligent Tutoring System Based on Generic Rules

    Science.gov (United States)

    Kseibat, Dawod; Mansour, Ali; Adjei, Osei; Phillips, Paul

    In this paper we present a framework for selecting the proper instructional strategy for a given teaching material based on its attributes. The new approach is based on a flexible design by means of generic rules. The framework was adapted in an Intelligent Tutoring System to teach Modern Standard Arabic language to adult English-speaking learners with no pre-knowledge of Arabic language is required.

  4. [Artificial intelligence in medicine: limits and obstacles.

    Science.gov (United States)

    Santoro, Eugenio

    2017-12-01

    Data scientists and physicians are starting to use artificial intelligence (AI) even in the medical field in order to better understand the relationships among the huge amount of data coming from the great number of sources today available. Through the data interpretation methods made available by the recent AI tools, researchers and AI companies have focused on the development of models allowing to predict the risk of suffering from a specific disease, to make a diagnosis, and to recommend a treatment that is based on the best and most updated scientific evidence. Even if AI is used to perform unimaginable tasks until a few years ago, the awareness about the ongoing revolution has not yet spread through the medical community for several reasons including the lack of evidence about safety, reliability and effectiveness of these tools, the lack of regulation accompanying hospitals in the use of AI by health care providers, the difficult attribution of liability in case of errors and malfunctions of these systems, and the ethical and privacy questions that they raise and that, as of today, are still unanswered.

  5. Industrial Internet of Things-Based Collaborative Sensing Intelligence: Framework and Research Challenges

    Science.gov (United States)

    Chen, Yuanfang; Lee, Gyu Myoung; Shu, Lei; Crespi, Noel

    2016-01-01

    The development of an efficient and cost-effective solution to solve a complex problem (e.g., dynamic detection of toxic gases) is an important research issue in the industrial applications of the Internet of Things (IoT). An industrial intelligent ecosystem enables the collection of massive data from the various devices (e.g., sensor-embedded wireless devices) dynamically collaborating with humans. Effectively collaborative analytics based on the collected massive data from humans and devices is quite essential to improve the efficiency of industrial production/service. In this study, we propose a collaborative sensing intelligence (CSI) framework, combining collaborative intelligence and industrial sensing intelligence. The proposed CSI facilitates the cooperativity of analytics with integrating massive spatio-temporal data from different sources and time points. To deploy the CSI for achieving intelligent and efficient industrial production/service, the key challenges and open issues are discussed, as well. PMID:26861345

  6. Industrial Internet of Things-Based Collaborative Sensing Intelligence: Framework and Research Challenges.

    Science.gov (United States)

    Chen, Yuanfang; Lee, Gyu Myoung; Shu, Lei; Crespi, Noel

    2016-02-06

    The development of an efficient and cost-effective solution to solve a complex problem (e.g., dynamic detection of toxic gases) is an important research issue in the industrial applications of the Internet of Things (IoT). An industrial intelligent ecosystem enables the collection of massive data from the various devices (e.g., sensor-embedded wireless devices) dynamically collaborating with humans. Effectively collaborative analytics based on the collected massive data from humans and devices is quite essential to improve the efficiency of industrial production/service. In this study, we propose a collaborative sensing intelligence (CSI) framework, combining collaborative intelligence and industrial sensing intelligence. The proposed CSI facilitates the cooperativity of analytics with integrating massive spatio-temporal data from different sources and time points. To deploy the CSI for achieving intelligent and efficient industrial production/service, the key challenges and open issues are discussed, as well.

  7. Industrial Internet of Things-Based Collaborative Sensing Intelligence: Framework and Research Challenges

    Directory of Open Access Journals (Sweden)

    Yuanfang Chen

    2016-02-01

    Full Text Available The development of an efficient and cost-effective solution to solve a complex problem (e.g., dynamic detection of toxic gases is an important research issue in the industrial applications of the Internet of Things (IoT. An industrial intelligent ecosystem enables the collection of massive data from the various devices (e.g., sensor-embedded wireless devices dynamically collaborating with humans. Effectively collaborative analytics based on the collected massive data from humans and devices is quite essential to improve the efficiency of industrial production/service. In this study, we propose a collaborative sensing intelligence (CSI framework, combining collaborative intelligence and industrial sensing intelligence. The proposed CSI facilitates the cooperativity of analytics with integrating massive spatio-temporal data from different sources and time points. To deploy the CSI for achieving intelligent and efficient industrial production/service, the key challenges and open issues are discussed, as well.

  8. Neuroscience-Inspired Artificial Intelligence.

    Science.gov (United States)

    Hassabis, Demis; Kumaran, Dharshan; Summerfield, Christopher; Botvinick, Matthew

    2017-07-19

    The fields of neuroscience and artificial intelligence (AI) have a long and intertwined history. In more recent times, however, communication and collaboration between the two fields has become less commonplace. In this article, we argue that better understanding biological brains could play a vital role in building intelligent machines. We survey historical interactions between the AI and neuroscience fields and emphasize current advances in AI that have been inspired by the study of neural computation in humans and other animals. We conclude by highlighting shared themes that may be key for advancing future research in both fields. Copyright © 2017. Published by Elsevier Inc.

  9. AI technology and automobile. ; Toward vehicle autonomy. AI gijutsu to jidosha. ; Sharyo no jiritsuka ni mukatte

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, A. (Mazda Motor Corp., Hiroshima (Japan))

    1991-01-01

    This report describes the vehicle autonomy by using artificial intelligence (AI) technology. Owing to a remarkable progress of AI technology, it is forecasted that driving support system will be introduced into the market till 2000, and higher autonomous navigation system will be introduced since about 2010. Autonomous vehicles have capacities of recognizing the outside world and of navigating roads by themselves, and with their enfanced environment adaptability the road transportation in the future is expected to be much more safer than in the present. The autonomous vehicle can warn its driver of potential dangers and correct operational errors of the driver. In order to realize such autonomous vehicles, extensive researches on perception systems, decision making systems and driving support systems are needed. 9 refs., 10 figs., 1 tab.

  10. Risk Reducing Effect of AIS Implementation on Collision Risk

    DEFF Research Database (Denmark)

    Lützen, Marie; Friis-Hansen, Peter

    2003-01-01

    AIS (Automatic Identification System) is a transponder system developed for sea traffic purposes. The system sends and receives important ship information and other safety-related information between other ships and shore-based AIS stations. The implementation of AIS has now been initiated and......, as a result, the community will undoubtedly observe an increase in navigational safety. However, to the authors? knowledge, no study has so far rigorously quantified the risk reducing effect of using AIS as an integrated part of the navigational system. The objective of this study is to fill this gap....... The risk reducing effect of AIS is quantified by building a Bayesian network facilitating an evaluation of the effect of AIS on the navigational officer?s reaction ability in a potential, critical collision situation. The time-dependent change in the risk reducing effect on ship collisions is analysed...

  11. Continuous surveillance of transformers using artificial intelligence methods; Surveillance continue des transformateurs: application des methodes d'intelligence artificielle

    Energy Technology Data Exchange (ETDEWEB)

    Schenk, A.; Germond, A. [Ecole Polytechnique Federale de Lausanne, Lausanne (Switzerland); Boss, P.; Lorin, P. [ABB Secheron SA, Geneve (Switzerland)

    2000-07-01

    The article describes a new method for the continuous surveillance of power transformers based on the application of artificial intelligence (AI) techniques. An experimental pilot project on a specially equipped, strategically important power transformer is described. Traditional surveillance methods and the use of mathematical models for the prediction of faults are described. The article describes the monitoring equipment used in the pilot project and the AI principles such as self-organising maps that are applied. The results obtained from the pilot project and methods for their graphical representation are discussed.

  12. Intelligent IPv6 based iot network monitoring and altering system on ...

    African Journals Online (AJOL)

    Intelligent IPv6 based iot network monitoring and altering system on Cooja framework. ... Journal of Fundamental and Applied Sciences. Journal Home · ABOUT THIS ... Keywords: IoT; Cooja framework; Contiki OS; packet monitoring.

  13. Intelligent vehicle based traffic monitoring – exploring application in South Africa

    CSIR Research Space (South Africa)

    Labuschagne, FJJ

    2010-08-01

    Full Text Available The paper details the anticipated benefits of an intelligent vehicle based traffic monitoring approach holds. The approach utilises advanced technology with the potential to reduce crashes and includes the monitor of vehicle speeds and flows...

  14. Feasibility and patient acceptability of a novel artificial intelligence-based screening model for diabetic retinopathy at endocrinology outpatient services: a pilot study.

    Science.gov (United States)

    Keel, Stuart; Lee, Pei Ying; Scheetz, Jane; Li, Zhixi; Kotowicz, Mark A; MacIsaac, Richard J; He, Mingguang

    2018-03-12

    The purpose of this study is to evaluate the feasibility and patient acceptability of a novel artificial intelligence (AI)-based diabetic retinopathy (DR) screening model within endocrinology outpatient settings. Adults with diabetes were recruited from two urban endocrinology outpatient clinics and single-field, non-mydriatic fundus photographs were taken and graded for referable DR ( ≥ pre-proliferative DR). Each participant underwent; (1) automated screening model; where a deep learning algorithm (DLA) provided real-time reporting of results; and (2) manual model where retinal images were transferred to a retinal grading centre and manual grading outcomes were distributed to the patient within 2 weeks of assessment. Participants completed a questionnaire on the day of examination and 1-month following assessment to determine overall satisfaction and the preferred model of care. In total, 96 participants were screened for DR and the mean assessment time for automated screening was 6.9 minutes. Ninety-six percent of participants reported that they were either satisfied or very satisfied with the automated screening model and 78% reported that they preferred the automated model over manual. The sensitivity and specificity of the DLA for correct referral was 92.3% and 93.7%, respectively. AI-based DR screening in endocrinology outpatient settings appears to be feasible and well accepted by patients.

  15. Progress and Challenge of Artificial Intelligence

    Institute of Scientific and Technical Information of China (English)

    Zhong-Zhi Shi; Nan-Ning Zheng

    2006-01-01

    Artificial Intelligence (AI) is generally considered to be a subfield of computer science, that is concerned to attempt simulation, extension and expansion of human intelligence. Artificial intelligence has enjoyed tremendous success over the last fifty years. In this paper we only focus on visual perception, granular computing, agent computing, semantic grid. Human-level intelligence is the long-term goal of artificial intelligence. We should do joint research on basic theory and technology of intelligence by brain science, cognitive science, artificial intelligence and others. A new cross discipline intelligence science is undergoing a rapid development. Future challenges are given in final section.

  16. Challenges facing the distribution of an artificial-intelligence-based system for nursing.

    Science.gov (United States)

    Evans, S

    1985-04-01

    The marketing and successful distribution of artificial-intelligence-based decision-support systems for nursing face special barriers and challenges. Issues that must be confronted arise particularly from the present culture of the nursing profession as well as the typical organizational structures in which nurses predominantly work. Generalizations in the literature based on the limited experience of physician-oriented artificial intelligence applications (predominantly in diagnosis and pharmacologic treatment) must be modified for applicability to other health professions.

  17. Artificial intelligence and engineering curricula - are changes needed?

    International Nuclear Information System (INIS)

    Jenkins, J.P.

    1988-01-01

    The purpose of this paper is to identify the expected impact of artificial intelligence (AI) on curricula and training courses. From this examination, new elements are proposed for the academic preparation and training of engineers who will evaluate and use these systems and capabilities. Artificial intelligence, from an operational viewpoint, begins with a set of rules governing the operation of logic, implemented via computer software and userware. These systems apply logic and experience to handling problems in an intelligent approach, especially when the number of alternatives to problem solution is beyond the scope of the human user. Usually, AI applications take the form of expert systems. An expert system embodies in the computer the knowledge-based component of an expert, such as domain knowledge and reasoning techniques, in such a form that the system can offer intelligent advice and, on demand, justify its own line of reasoning. Two languages predominate, LISP and Prolog. The AI user may interface with the knowledge base via one of these languages or by means of menu displays, cursor selections, or other conventional user interface methods

  18. Future and Feature of Intelligent Systems and Their Societies

    African Journals Online (AJOL)

    2012-12-01

    Dec 1, 2012 ... work covered the consequences of having artificial intelligent systems with us in the near future. Keywords: intelligence, systems, artificial ... AI as science and technology to develop computers that can think and function in.

  19. An application of artificial intelligence for rainfall–runoff modeling

    Indian Academy of Sciences (India)

    This study proposes an application of two techniques of artificial intelligence (AI) ... (2006) applied rainfall–runoff modeling using ANN ... in artificial intelligence, engineering and science .... usually be estimated from a sample of observations.

  20. Application of AI methods to aircraft guidance and control

    Science.gov (United States)

    Hueschen, Richard M.; Mcmanus, John W.

    1988-01-01

    A research program for integrating artificial intelligence (AI) techniques with tools and methods used for aircraft flight control system design, development, and implementation is discussed. The application of the AI methods for the development and implementation of the logic software which operates with the control mode panel (CMP) of an aircraft is presented. The CMP is the pilot control panel for the automatic flight control system of a commercial-type research aircraft of Langley Research Center's Advanced Transport Operating Systems (ATOPS) program. A mouse-driven color-display emulation of the CMP, which was developed with AI methods and used to test the AI software logic implementation, is discussed. The operation of the CMP was enhanced with the addition of a display which was quickly developed with AI methods. The display advises the pilot of conditions not satisfied when a mode does not arm or engage. The implementation of the CMP software logic has shown that the time required to develop, implement, and modify software systems can be significantly reduced with the use of the AI methods.

  1. A novel modification of the Turing test for artificial intelligence and robotics in healthcare.

    Science.gov (United States)

    Ashrafian, Hutan; Darzi, Ara; Athanasiou, Thanos

    2015-03-01

    The increasing demands of delivering higher quality global healthcare has resulted in a corresponding expansion in the development of computer-based and robotic healthcare tools that rely on artificially intelligent technologies. The Turing test was designed to assess artificial intelligence (AI) in computer technology. It remains an important qualitative tool for testing the next generation of medical diagnostics and medical robotics. Development of quantifiable diagnostic accuracy meta-analytical evaluative techniques for the Turing test paradigm. Modification of the Turing test to offer quantifiable diagnostic precision and statistical effect-size robustness in the assessment of AI for computer-based and robotic healthcare technologies. Modification of the Turing test to offer robust diagnostic scores for AI can contribute to enhancing and refining the next generation of digital diagnostic technologies and healthcare robotics. Copyright © 2014 John Wiley & Sons, Ltd.

  2. Artificial intelligence approaches in statistics

    International Nuclear Information System (INIS)

    Phelps, R.I.; Musgrove, P.B.

    1986-01-01

    The role of pattern recognition and knowledge representation methods from Artificial Intelligence within statistics is considered. Two areas of potential use are identified and one, data exploration, is used to illustrate the possibilities. A method is presented to identify and separate overlapping groups within cluster analysis, using an AI approach. The potential of such ''intelligent'' approaches is stressed

  3. Decadal evolution of ship emissions in China from 2004 to 2013 by using an integrated AIS-based approach and projection to 2040

    Science.gov (United States)

    Li, Cheng; Borken-Kleefeld, Jens; Zheng, Junyu; Yuan, Zibing; Ou, Jiamin; Li, Yue; Wang, Yanlong; Xu, Yuanqian

    2018-05-01

    Ship emissions contribute significantly to air pollution and pose health risks to residents of coastal areas in China, but the current research remains incomplete and coarse due to data availability and inaccuracy in estimation methods. In this study, an integrated approach based on the Automatic Identification System (AIS) was developed to address this problem. This approach utilized detailed information from AIS and cargo turnover and the vessel calling number information and is thereby capable of quantifying sectoral contributions by fuel types and emissions from ports, rivers, coastal traffic and over-the-horizon ship traffic. Based upon the established methodology, ship emissions in China from 2004 to 2013 were estimated, and those to 2040 at 5-year intervals under different control scenarios were projected. Results showed that for the area within 200 nautical miles (Nm) of the Chinese coast, SO2, NOx, CO, PM10, PM2.5, hydrocarbon (HC), black carbon (BC) and organic carbon (OC) emissions in 2013 were 1010, 1443, 118, 107, 87, 67, 29 and 21 kt yr-1, respectively, which doubled over these 10 years. Ship sources contributed ˜ 10 % to the total SO2 and NOx emissions in the coastal provinces of China. Emissions from the proposed Domestic Emission Control Areas (DECAs) within 12 Nm constituted approximately 40 % of the all ship emissions along the Chinese coast, and this percentage would double when the DECA boundary is extended to 100 Nm. Ship emissions in ports accounted for about one-quarter of the total emissions within 200 Nm, within which nearly 80 % of the emissions were concentrated in the top 10 busiest ports of China. SO2 emissions could be reduced by 80 % in 2020 under a 0.5 % global sulfur cap policy. In comparison, a similar reduction of NOx emissions would require significant technological change and would likely take several decades. This study provides solid scientific support for ship emissions control policy making in China. It is suggested to

  4. Decadal evolution of ship emissions in China from 2004 to 2013 by using an integrated AIS-based approach and projection to 2040

    Directory of Open Access Journals (Sweden)

    C. Li

    2018-05-01

    Full Text Available Ship emissions contribute significantly to air pollution and pose health risks to residents of coastal areas in China, but the current research remains incomplete and coarse due to data availability and inaccuracy in estimation methods. In this study, an integrated approach based on the Automatic Identification System (AIS was developed to address this problem. This approach utilized detailed information from AIS and cargo turnover and the vessel calling number information and is thereby capable of quantifying sectoral contributions by fuel types and emissions from ports, rivers, coastal traffic and over-the-horizon ship traffic. Based upon the established methodology, ship emissions in China from 2004 to 2013 were estimated, and those to 2040 at 5-year intervals under different control scenarios were projected. Results showed that for the area within 200 nautical miles (Nm of the Chinese coast, SO2, NOx, CO, PM10, PM2.5, hydrocarbon (HC, black carbon (BC and organic carbon (OC emissions in 2013 were 1010, 1443, 118, 107, 87, 67, 29 and 21 kt yr−1, respectively, which doubled over these 10 years. Ship sources contributed  ∼ 10 % to the total SO2 and NOx emissions in the coastal provinces of China. Emissions from the proposed Domestic Emission Control Areas (DECAs within 12 Nm constituted approximately 40 % of the all ship emissions along the Chinese coast, and this percentage would double when the DECA boundary is extended to 100 Nm. Ship emissions in ports accounted for about one-quarter of the total emissions within 200 Nm, within which nearly 80 % of the emissions were concentrated in the top 10 busiest ports of China. SO2 emissions could be reduced by 80 % in 2020 under a 0.5 % global sulfur cap policy. In comparison, a similar reduction of NOx emissions would require significant technological change and would likely take several decades. This study provides solid scientific support for ship emissions control

  5. AI its nature and future

    CERN Document Server

    Boden, Margaret A

    2016-01-01

    least - on the Internet. Margaret Boden considers the realistic and unrealistic expectations we have placed on AI, analyses its progress, and considers the value of its byproducts. ations we have placed on AI, analyses its progress, and considers the value of its byproducts.

  6. Design and realization of intelligent tourism service system based on voice interaction

    Science.gov (United States)

    Hu, Lei-di; Long, Yi; Qian, Cheng-yang; Zhang, Ling; Lv, Guo-nian

    2008-10-01

    Voice technology is one of the important contents to improve the intelligence and humanization of tourism service system. Combining voice technology, the paper concentrates on application needs and the composition of system to present an overall intelligent tourism service system's framework consisting of presentation layer, Web services layer, and tourism application service layer. On the basis, the paper further elaborated the implementation of the system and its key technologies, including intelligent voice interactive technology, seamless integration technology of multiple data sources, location-perception-based guides' services technology, and tourism safety control technology. Finally, according to the situation of Nanjing tourism, a prototype of Tourism Services System is realized.

  7. Advances in Intelligent Modelling and Simulation Artificial Intelligence-Based Models and Techniques in Scalable Computing

    CERN Document Server

    Khan, Samee; Burczy´nski, Tadeusz

    2012-01-01

    One of the most challenging issues in today’s large-scale computational modeling and design is to effectively manage the complex distributed environments, such as computational clouds, grids, ad hoc, and P2P networks operating under  various  types of users with evolving relationships fraught with  uncertainties. In this context, the IT resources and services usually belong to different owners (institutions, enterprises, or individuals) and are managed by different administrators. Moreover, uncertainties are presented to the system at hand in various forms of information that are incomplete, imprecise, fragmentary, or overloading, which hinders in the full and precise resolve of the evaluation criteria, subsequencing and selection, and the assignment scores. Intelligent scalable systems enable the flexible routing and charging, advanced user interactions and the aggregation and sharing of geographically-distributed resources in modern large-scale systems.   This book presents new ideas, theories, models...

  8. Simulation Study of Swarm Intelligence Based on Life Evolution Behavior

    Directory of Open Access Journals (Sweden)

    Yanmin Liu

    2015-01-01

    Full Text Available Swarm intelligence (SI is a new evolutionary computation technology, and its performance efficacy is usually affected by each individual behavior in the swarm. According to the genetic and sociological theory, the life evolution behavior process is influenced by the external and internal factors, so the mechanisms of external and internal environment change must be analyzed and explored. Therefore, in this paper, we used the thought of the famous American genetic biologist Morgan, “life = DNA + environment + interaction of environment + gene,” to propose the mutation and crossover operation of DNA fragments by the environmental change to improve the performance efficiency of intelligence algorithms. Additionally, PSO is a random swarm intelligence algorithm with the genetic and sociological property, so we embed the improved mutation and crossover operation to particle swarm optimization (PSO and designed DNA-PSO algorithm to optimize single and multiobjective optimization problems. Simulation experiments in single and multiobjective optimization problems show that the proposed strategies can effectively improve the performance of swarm intelligence.

  9. Improving General Intelligence with a Nutrient-Based Pharmacological Intervention

    Science.gov (United States)

    Stough, Con; Camfield, David; Kure, Christina; Tarasuik, Joanne; Downey, Luke; Lloyd, Jenny; Zangara, Andrea; Scholey, Andrew; Reynolds, Josh

    2011-01-01

    Cognitive enhancing substances such as amphetamine and modafinil have become popular in recent years to improve acute cognitive performance particularly in environments in which enhanced cognition or intelligence is required. Nutraceutical nootropics, which are natural substances that have the ability to bring about acute or chronic changes in…

  10. Artificial intelligence based decision support for trumpeter swan management

    Science.gov (United States)

    Sojda, Richard S.

    2002-01-01

    The number of trumpeter swans (Cygnus buccinator) breeding in the Tri-State area where Montana, Idaho, and Wyoming come together has declined to just a few hundred pairs. However, these birds are part of the Rocky Mountain Population which additionally has over 3,500 birds breeding in Alberta, British Columbia, Northwest Territories, and Yukon Territory. To a large degree, these birds seem to have abandoned traditional migratory pathways in the flyway. Waterfowl managers have been interested in decision support tools that would help them explore simulated management scenarios in their quest towards reaching population recovery and the reestablishment of traditional migratory pathways. I have developed a decision support system to assist biologists with such management, especially related to wetland ecology. Decision support systems use a combination of models, analytical techniques, and information retrieval to help develop and evaluate appropriate alternatives. Swan management is a domain that is ecologically complex, and this complexity is compounded by spatial and temporal issues. As such, swan management is an inherently distributed problem. Therefore, the ecological context for modeling swan movements in response to management actions was built as a multiagent system of interacting intelligent agents that implements a queuing model representing swan migration. These agents accessed ecological knowledge about swans, their habitats, and flyway management principles from three independent expert systems. The agents were autonomous, had some sensory capability, and could respond to changing conditions. A key problem when developing ecological decision support systems is empirically determining that the recommendations provided are valid. Because Rocky Mountain trumpeter swans have been surveyed for a long period of time, I was able to compare simulated distributions provided by the system with actual field observations across 20 areas for the period 1988

  11. Computational Foundations of Natural Intelligence.

    Science.gov (United States)

    van Gerven, Marcel

    2017-01-01

    New developments in AI and neuroscience are revitalizing the quest to understanding natural intelligence, offering insight about how to equip machines with human-like capabilities. This paper reviews some of the computational principles relevant for understanding natural intelligence and, ultimately, achieving strong AI. After reviewing basic principles, a variety of computational modeling approaches is discussed. Subsequently, I concentrate on the use of artificial neural networks as a framework for modeling cognitive processes. This paper ends by outlining some of the challenges that remain to fulfill the promise of machines that show human-like intelligence.

  12. Computational Foundations of Natural Intelligence

    Directory of Open Access Journals (Sweden)

    Marcel van Gerven

    2017-12-01

    Full Text Available New developments in AI and neuroscience are revitalizing the quest to understanding natural intelligence, offering insight about how to equip machines with human-like capabilities. This paper reviews some of the computational principles relevant for understanding natural intelligence and, ultimately, achieving strong AI. After reviewing basic principles, a variety of computational modeling approaches is discussed. Subsequently, I concentrate on the use of artificial neural networks as a framework for modeling cognitive processes. This paper ends by outlining some of the challenges that remain to fulfill the promise of machines that show human-like intelligence.

  13. Enabling Autonomous Space Mission Operations with Artificial Intelligence

    Science.gov (United States)

    Frank, Jeremy

    2017-01-01

    For over 50 years, NASA's crewed missions have been confined to the Earth-Moon system, where speed-of-light communications delays between crew and ground are practically nonexistent. This ground-centered mode of operations, with a large, ground-based support team, is not sustainable for NASAs future human exploration missions to Mars. Future astronauts will need smarter tools employing Artificial Intelligence (AI) techniques make decisions without inefficient communication back and forth with ground-based mission control. In this talk we will describe several demonstrations of astronaut decision support tools using AI techniques as a foundation. These demonstrations show that astronauts tasks ranging from living and working to piloting can benefit from AI technology development.

  14. Assessing the accuracy of perceptions of intelligence based on heritable facial features

    OpenAIRE

    Lee, Anthony J.; Hibbs, Courtney; Wright, Margaret J.; Martin, Nicholas G.; Keller, Matthew C.; Zietsch, Brendan P.

    2017-01-01

    Perceptions of intelligence based on facial features can have a profound impact on many social situations, but findings have been mixed as to whether these judgements are accurate. Even if such perceptions were accurate, the underlying mechanism is unclear. Several possibilities have been proposed, including evolutionary explanations where certain morphological facial features are associated with fitness-related traits (including cognitive development), or that intelligence judgements are ove...

  15. An FEM-based AI approach to model parameter identification for low vibration modes of wind turbine composite rotor blades

    Science.gov (United States)

    Navadeh, N.; Goroshko, I. O.; Zhuk, Y. A.; Fallah, A. S.

    2017-11-01

    An approach to construction of a beam-type simplified model of a horizontal axis wind turbine composite blade based on the finite element method is proposed. The model allows effective and accurate description of low vibration bending modes taking into account the effects of coupling between flapwise and lead-lag modes of vibration transpiring due to the non-uniform distribution of twist angle in the blade geometry along its length. The identification of model parameters is carried out on the basis of modal data obtained by more detailed finite element simulations and subsequent adoption of the 'DIRECT' optimisation algorithm. Stable identification results were obtained using absolute deviations in frequencies and in modal displacements in the objective function and additional a priori information (boundedness and monotony) on the solution properties.

  16. Intelligent and Evolutionary Systems : the 20th Asia Pacific Symposium

    CERN Document Server

    Singh, Hemant; Elsayed, Saber

    2017-01-01

    Over the last two decades the field of Intelligent Systems delivered to human kind significant achievements, while also facing major transformations. 20 years ago, automation and knowledge-based AI were still the dominant paradigms fueling the efforts of both researchers and practitioners. Later, 10 years ago, statistical machine intelligence was on the rise, heavily supported by the digital computing, and led to the unprecedented advances in and dependence on digital technology. However, the resultant intelligent systems remained designer-based endeavors and thus, were limited in their true learning and development abilities. Today, the challenge is to have in place intelligent systems that can develop themselves on behalf of their creators, and gain abilities with no or limited supervision in the tasks they are meant to perform. Cognitive development systems, and the supporting cognitive computing are on the rise today, promising yet other significant achievements for the future of human kind. This book cap...

  17. Mapping change in scientific specialties: a scientometric case study of the development or artificial intelligence

    NARCIS (Netherlands)

    van den Besselaar, P.; Leydesdorff, L.

    1996-01-01

    Has an identifiable core of activities called AI been established, during the AI-boom in the eighties? Is AI already in a “paradigmatic” phase? There has been a lot of disagreement among commentators and specialists about the nature of Artificial Intelligence as a specialty. This makes AI an

  18. Preparation of mucosal nanoparticles and polymer-based inactivated vaccine for Newcastle disease and H9N2 AI viruses

    Directory of Open Access Journals (Sweden)

    Heba M. El Naggar

    2017-02-01

    Full Text Available Aim: To develop a mucosal inactivated vaccines for Newcastle disease (ND and H9N2 viruses to protect against these viruses at sites of infections through mucosal immunity. Materials and Methods: In this study, we prepared two new formulations for mucosal bivalent inactivated vaccine formulations for Newcastle and Avian Influenza (H9N2 based on the use of nanoparticles and polymer adjuvants. The prepared vaccines were delivered via intranasal and spray routes of administration in specific pathogen-free chickens. Cell-mediated and humoral immune response was measured as well as challenge trial was carried out. In addition, ISA71 water in oil was also evaluated. Results: Our results showed that the use of spray route as vaccination delivery method of polymer and nanoparticles MontanideTM adjuvants revealed that it enhanced the cell mediated immune response as indicated by phagocytic activity, gamma interferon and interleukin 6 responses and induced protection against challenge with Newcastle and Avian Influenza (H9N2 viruses. Conclusion: The results of this study demonstrate the potentiality of polymer compared to nanoparticles adjuvantes when used via spray route. Mass application of such vaccines will add value to improve the vaccination strategies against ND virus and Avian influenza viruses.

  19. Towards AI-powered personalization in MOOC learning

    Science.gov (United States)

    Yu, Han; Miao, Chunyan; Leung, Cyril; White, Timothy John

    2017-12-01

    Massive Open Online Courses (MOOCs) represent a form of large-scale learning that is changing the landscape of higher education. In this paper, we offer a perspective on how advances in artificial intelligence (AI) may enhance learning and research on MOOCs. We focus on emerging AI techniques including how knowledge representation tools can enable students to adjust the sequence of learning to fit their own needs; how optimization techniques can efficiently match community teaching assistants to MOOC mediation tasks to offer personal attention to learners; and how virtual learning companions with human traits such as curiosity and emotions can enhance learning experience on a large scale. These new capabilities will also bring opportunities for educational researchers to analyse students' learning skills and uncover points along learning paths where students with different backgrounds may require different help. Ethical considerations related to the application of AI in MOOC education research are also discussed.

  20. Distributed artificial intelligence, diversity and information literacy

    Directory of Open Access Journals (Sweden)

    Peter Kåhre

    2010-09-01

    Full Text Available My proposal is based on my doctoral dissertation On the Shoulders of AI-technology : Sociology of Knowledge and Strong Artificial Intelligence which I succesfully defended on May 29th 2009. E-published http://www.lu.se/o.o.i.s?id=12588&postid=1389611 The dissertation is concerned with Sociology’s stance in the debate on Strong Artificial Intelligence,.i.e. AI-systems that is able to shape knowledge on their own. There is a need for sociologists to realize the difference between two approaches to constructing AI systems: Symbolic AI (or Classic AI and Connectionistic AI in a distributed model – DAI. Sociological literature shows a largely critical attitude towards Symbolic AI, an attitude that is justified. The main theme of the dissertation is that DAI is not only compatible with Sociology’s approach to what is social, but also constitutes an apt model of how a social system functions. This is consolidated with help from german sociologist Niklas Luhmann’s social systems theory. A lot of sociologists criticize AI because they think that diversity is important and can only be comprehended in informal circumstances that only humans interacting together can handle. They mean that social intelligence is needed to make something out of diversity and informalism. Luhmann´s systems theory gives the opposite perspective. It tells us that it is social systems that communicate and produce new knowledge structures out of contincency. Psychological systems, i.e. humans, can only think within the circumstances the social system offer. In that way human thoughts are bound by formalism. Diversity is constructed when the social systems interact with complexity in their environments. They reduce the complexity and try to present it as meaningful diversity. Today when most of academic literature is electronically stored and is accessible through the Internet from al over the world, DAI can help social systems to observe and reduce complexity in this

  1. Non-Newtonian Aspects of Artificial Intelligence

    Science.gov (United States)

    Zak, Michail

    2016-05-01

    The challenge of this work is to connect physics with the concept of intelligence. By intelligence we understand a capability to move from disorder to order without external resources, i.e., in violation of the second law of thermodynamics. The objective is to find such a mathematical object described by ODE that possesses such a capability. The proposed approach is based upon modification of the Madelung version of the Schrodinger equation by replacing the force following from quantum potential with non-conservative forces that link to the concept of information. A mathematical formalism suggests that a hypothetical intelligent particle, besides the capability to move against the second law of thermodynamics, acquires such properties like self-image, self-awareness, self-supervision, etc. that are typical for Livings. However since this particle being a quantum-classical hybrid acquires non-Newtonian and non-quantum properties, it does not belong to the physics matter as we know it: the modern physics should be complemented with the concept of the information force that represents a bridge to intelligent particle. As a follow-up of the proposed concept, the following question is addressed: can artificial intelligence (AI) system composed only of physical components compete with a human? The answer is proven to be negative if the AI system is based only on simulations, and positive if digital devices are included. It has been demonstrated that there exists such a quantum neural net that performs simulations combined with digital punctuations. The universality of this quantum-classical hybrid is in capability to violate the second law of thermodynamics by moving from disorder to order without external resources. This advanced capability is illustrated by examples. In conclusion, a mathematical machinery of the perception that is the fundamental part of a cognition process as well as intelligence is introduced and discussed.

  2. Application of artificial intelligence in Geodesy - A review of theoretical foundations and practical examples

    Science.gov (United States)

    Reiterer, Alexander; Egly, Uwe; Vicovac, Tanja; Mai, Enrico; Moafipoor, Shahram; Grejner-Brzezinska, Dorota A.; Toth, Charles K.

    2010-12-01

    Artificial Intelligence (AI) is one of the key technologies in many of today's novel applications. It is used to add knowledge and reasoning to systems. This paper illustrates a review of AI methods including examples of their practical application in Geodesy like data analysis, deformation analysis, navigation, network adjustment, and optimization of complex measurement procedures. We focus on three examples, namely, a geo-risk assessment system supported by a knowledge-base, an intelligent dead reckoning personal navigator, and evolutionary strategies for the determination of Earth gravity field parameters. Some of the authors are members of IAG Sub-Commission 4.2 - Working Group 4.2.3, which has the main goal to study and report on the application of AI in Engineering Geodesy.

  3. Artificial intelligence costs, benefits, and risks for selected spacecraft ground system automation scenarios

    Science.gov (United States)

    Truszkowski, Walter F.; Silverman, Barry G.; Kahn, Martha; Hexmoor, Henry

    1988-01-01

    In response to a number of high-level strategy studies in the early 1980s, expert systems and artificial intelligence (AI/ES) efforts for spacecraft ground systems have proliferated in the past several years primarily as individual small to medium scale applications. It is useful to stop and assess the impact of this technology in view of lessons learned to date, and hopefully, to determine if the overall strategies of some of the earlier studies both are being followed and still seem relevant. To achieve that end four idealized ground system automation scenarios and their attendant AI architecture are postulated and benefits, risks, and lessons learned are examined and compared. These architectures encompass: (1) no AI (baseline); (2) standalone expert systems; (3) standardized, reusable knowledge base management systems (KBMS); and (4) a futuristic unattended automation scenario. The resulting artificial intelligence lessons learned, benefits, and risks for spacecraft ground system automation scenarios are described.

  4. Artificial intelligence costs, benefits, risks for selected spacecraft ground system automation scenarios

    Science.gov (United States)

    Truszkowski, Walter F.; Silverman, Barry G.; Kahn, Martha; Hexmoor, Henry

    1988-01-01

    In response to a number of high-level strategy studies in the early 1980s, expert systems and artificial intelligence (AI/ES) efforts for spacecraft ground systems have proliferated in the past several years primarily as individual small to medium scale applications. It is useful to stop and assess the impact of this technology in view of lessons learned to date, and hopefully, to determine if the overall strategies of some of the earlier studies both are being followed and still seem relevant. To achieve that end four idealized ground system automation scenarios and their attendant AI architecture are postulated and benefits, risks, and lessons learned are examined and compared. These architectures encompass: (1) no AI (baseline), (2) standalone expert systems, (3) standardized, reusable knowledge base management systems (KBMS), and (4) a futuristic unattended automation scenario. The resulting artificial intelligence lessons learned, benefits, and risks for spacecraft ground system automation scenarios are described.

  5. Short term protein supplementation during a long interval prostaglandin-based protocol for timed AI in sheep.

    Science.gov (United States)

    Errandonea, N; Fierro, S; Viñoles, C; Gil, J; Banchero, G; Olivera-Muzante, J

    2018-03-21

    The aim of this study was to evaluate the reproductive impact of a short-term protein supplementation on a long interval prostaglandin-based protocol (two PG injections 15 d apart; PG15) for timed artificial insemination in sheep. During the breeding season, 437 multiparous Merino ewes grazing native pastures (forage allowance of 6 kg of dry matter/100 kg of live weight; crude protein: 10.8%, metabolic energy: 2.1 Mcal/kg of dry matter) were selected. Ewes were allocated, according to body condition score (3.2 ± 0.2) and body weight (40.6 ± 4.9 kg, mean ± SD), to a 2 × 2 factorial design: type of estrus -spontaneous estrus (SE) or induced with PG15 (PG15)-, and supplementation (yes or no) before insemination (+FF; soybean meal at Days -10 to -3; crude protein: 51.9%, metabolic energy: 2.8 Mcal/kg of dry matter; average consumption 0.9% live weight/ewe/day of dry matter). All ewes were cervically artificial inseminated (Day -2 to -3 in SE ewes at estrus detection; Day 0 = timed artificial insemination in PG15 ewes). Ovulation rate on Day 7, non-return to service on Day 23, conception, fertility, prolificacy and fecundity on Day 60 were evaluated. Ovulation rate (1.17 ± 0.40 vs. 1.06 ± 0.25), non-return to service at Day 23 (81.7 vs. 64.2%), conception (78.8 vs. 61.5%), fertility (75.2 vs. 61.5%) and fecundity (0.77 vs. 0.62) were higher in ewes from SE than PG15 group (P  0.05). Protein supplementation increased ovulation rate (1.30 ± 0.45 vs. 1.17 ± 0.40), prolificacy (1.18 ± 0.39 vs. 1.02 ± 0.16) and fecundity (0.94 vs. 0.77%; P conception (82.9 vs. 78.8%) or fertility (79.1 vs. 75.2%; P > 0.05) in SE group. The supplement feed to PG15 ewes increased ovulation rate (1.35 ± 0.45 vs. 1.06 ± 0.25), prolificacy (1.25 ± 0.43 vs. 1.01 ± 0.12) and fecundity (0.79 vs. 0.62%; P  0.05). The magnitude of the increase in ovulation rate in PG15 was greater than in the SE group (27 vs. 11%; P conception (63.3 vs 61

  6. Artificial Intelligence approaches in hematopoietic cell transplant: A review of the current status and future directions.

    Science.gov (United States)

    Muhsen, Ibrahim N; ElHassan, Tusneem; Hashmi, Shahrukh K

    2018-06-08

    Currently, the evidence-based literature on healthcare is expanding exponentially. The opportunities provided by the advancement in artificial intelligence (AI) tools i.e. machine learning are appealing in tackling many of the current healthcare challenges. Thus, AI integration is expanding in most fields of healthcare, including the field of hematology. This study aims to review the current applications of AI in the field hematopoietic cell transplant (HCT). Literature search was done involving the following databases: Ovid-Medline including in-Process and Other Non-Indexed Citations and google scholar. The abstracts of the following professional societies: American Society of Haematology (ASH), American Society for Blood and Marrow Transplantation (ASBMT) and European Society for Blood and Marrow Transplantation (EBMT) were also screened. Literature review showed that the integration of AI in the field of HCT has grown remarkably in the last decade and confers promising avenues in diagnosis and prognosis within HCT populations targeting both pre and post-transplant challenges. Studies on AI integration in HCT have many limitations that include poorly tested algorithms, lack of generalizability and limited use of different AI tools. Machine learning techniques in HCT is an intense area of research that needs a lot of development and needs extensive support from hematology and HCT societies / organizations globally since we believe that this would be the future practice paradigm. Key words: Artificial intelligence, machine learning, hematopoietic cell transplant.

  7. Multimodal Detection of Music Performances for Intelligent Emotion Based Lighting

    DEFF Research Database (Denmark)

    Bonde, Esben Oxholm Skjødt; Hansen, Ellen Kathrine; Triantafyllidis, Georgios

    2016-01-01

    Playing music is about conveying emotions and the lighting at a concert can help do that. However, new and unknown bands that play at smaller venues and bands that don’t have the budget to hire a dedicated light technician have to miss out on lighting that will help them to convey the emotions...... of what they play. In this paper it is investigated whether it is possible or not to develop an intelligent system that through a multimodal input detects the intended emotions of the played music and in realtime adjusts the lighting accordingly. A concept for such an intelligent lighting system...... is developed and described. Through existing research on music and emotion, as well as on musicians’ body movements related to the emotion they want to convey, a row of cues is defined. This includes amount, speed, fluency and regularity for the visual and level, tempo, articulation and timbre for the auditory...

  8. Research Algorithm on Building Intelligent Transportation System based on RFID Technology

    Directory of Open Access Journals (Sweden)

    Chuanqi Chen

    2013-05-01

    Full Text Available Intelligent transportation system to all aspects of organic integration of human, vehicle, road and environment of the transport system, so that the operation of functional integration and intelligent vehicle, road. Intelligent transportation system (ITS to improve the efficiency of traffic system by increasing the effective use and management of traffic information is mainly composed of information collection and input, output, control strategy, implementation of the subsystems of data transmission and communication subsystem. The RFID reader to wireless communication through the antenna and RFID tag can achieve a write operation on the tag identification codes and memory read data. The paper proposes research on building intelligent transportation system based on RFID technology. Experimental results show that ITS system can effectively improve the traffic situation, improve the utilization rate of the existing road resource and save social cost.

  9. Activity-Based Intelligence prevedere il futuro osservando il presente con gli strumenti Hexagon Geospatial

    Directory of Open Access Journals (Sweden)

    Massimo Zotti

    2015-06-01

    Full Text Available The intelligence of human activities on the earth's surface, obtained through the analysis of earth observation data and other geospatial information, is vital for the planning and execution of any military action, for peacekeeping or for humanitarian emergencies. The success of these actions largely depends on the ability to analyze timely data from multiple sources. However, the proliferation of new sources of intelligence in a Geospatial big data scenario increasingly complicate the analysis of such activities by human analysts. Modern technologies solve these problems by enabling the Activity Based Intelligence, a methodology that improves the efficiency and timeliness of intelligence through the analysis of historical, current and future activity, to identify patterns, trends and relationships hidden in large data collections from different sources.

  10. First steps in translating human cognitive processes of cane pruning grapevines into AI rules for automated robotic pruning

    Directory of Open Access Journals (Sweden)

    Saxton Valerie

    2014-01-01

    Full Text Available Cane pruning of grapevines is a skilled task for which, internationally, there is a dire shortage of human pruners. As part of a larger project developing an automated robotic pruner, we have used artificial intelligence (AI algorithms to create an expert system for selecting new canes and cutting off unwanted canes. A domain and ontology has been created for AI, which reflects the expertise of expert human pruners. The first step in the creation of an expert system was to generate virtual vines, which were then ‘pruned’ by human pruners and also by the expert system in its infancy. Here we examined the decisions of 12 human pruners, for consistency of decision, on 60 virtual vines. 96.7% of the 12 pruners agreed on at least one cane choice after which there was diminishing agreement on which further canes to select for laying. Our results indicate that techniques developed in computational intelligence can be used to co-ordinate and synthesise the expertise of human pruners into a best practice format. This paper describes first steps in this knowledge elicitation process, and discusses the fit between cane pruning expertise and the expertise that can be elicited using AI based expert system techniques.

  11. How AI turned the chess world upside down

    KAUST Repository

    Polgar, Susan

    2018-01-22

    Man vs. Machine! In 1977 an IBM supercomputer \\'Deep Blue\\' beat the reigning World Chess Champion Gary Kasparov in a 6 game chess match played under tournament conditions. This was the first time a machine beat a human at chess. It symbolized the emergence of Artificial Intelligence (AI) and the potential for great good (and great harm) from machines that have aspects of human intelligence. During this lecture Susan Polgar, a pioneer for Women in Chess, will share her remarkable story as well as how technology has changed the world of chess.

  12. Simulation Study of Swarm Intelligence Based on Life Evolution Behavior

    OpenAIRE

    Yanmin Liu; Ying Bi; Changling Sui; Yuanfeng Luo; Zhuanzhou Zhang; Rui Liu

    2015-01-01

    Swarm intelligence (SI) is a new evolutionary computation technology, and its performance efficacy is usually affected by each individual behavior in the swarm. According to the genetic and sociological theory, the life evolution behavior process is influenced by the external and internal factors, so the mechanisms of external and internal environment change must be analyzed and explored. Therefore, in this paper, we used the thought of the famous American genetic biologist Morgan, “life = DN...

  13. Neuro-Based Artificial Intelligence Model for Loan Decisions

    OpenAIRE

    Shorouq F. Eletter; Saad G. Yaseen; Ghaleb A. Elrefae

    2010-01-01

    Problem statement: Despite the increase in consumer loans defaults and competition in the banking market, most of the Jordanian commercial banks are reluctant to use artificial intelligence software systems for supporting loan decisions. Approach: This study developed a proposed model that identifies artificial neural network as an enabling tool for evaluating credit applications to support loan decisions in the Jordanian Commercial banks. A multi-layer feed-forward neural network with backpr...

  14. A novel AIDS/HIV intelligent medical consulting system based on expert systems.

    Science.gov (United States)

    Ebrahimi, Alireza Pour; Toloui Ashlaghi, Abbas; Mahdavy Rad, Maryam

    2013-01-01

    The purpose of this paper is to propose a novel intelligent model for AIDS/HIV data based on expert system and using it for developing an intelligent medical consulting system for AIDS/HIV. In this descriptive research, 752 frequently asked questions (FAQs) about AIDS/HIV are gathered from numerous websites about this disease. To perform the data mining and extracting the intelligent model, the 6 stages of Crisp method has been completed for FAQs. The 6 stages include: Business understanding, data understanding, data preparation, modelling, evaluation and deployment. C5.0 Tree classification algorithm is used for modelling. Also, rational unified process (RUP) is used to develop the web-based medical consulting software. Stages of RUP are as follows: Inception, elaboration, construction and transition. The intelligent developed model has been used in the infrastructure of the software and based on client's inquiry and keywords related FAQs are displayed to the client, according to the rank. FAQs' ranks are gradually determined considering clients reading it. Based on displayed FAQs, test and entertainment links are also displayed. The accuracy of the AIDS/HIV intelligent web-based medical consulting system is estimated to be 78.76%. AIDS/HIV medical consulting systems have been developed using intelligent infrastructure. Being equipped with an intelligent model, providing consulting services on systematic textual data and providing side services based on client's activities causes the implemented system to be unique. The research has been approved by Iranian Ministry of Health and Medical Education for being practical.

  15. Little AI: Playing a constructivist robot

    Science.gov (United States)

    Georgeon, Olivier L.

    Little AI is a pedagogical game aimed at presenting the founding concepts of constructivist learning and developmental Artificial Intelligence. It primarily targets students in computer science and cognitive science but it can also interest the general public curious about these topics. It requires no particular scientific background; even children can find it entertaining. Professors can use it as a pedagogical resource in class or in online courses. The player presses buttons to control a simulated "baby robot". The player cannot see the robot and its environment, and initially ignores the effects of the commands. The only information received by the player is feedback from the player's commands. The player must learn, at the same time, the functioning of the robot's body and the structure of the environment from patterns in the stream of commands and feedback. We argue that this situation is analogous to how infants engage in early-stage developmental learning (e.g., Piaget (1937), [1]).

  16. Probabilistic reasoning in intelligent systems networks of plausible inference

    CERN Document Server

    Pearl, Judea

    1988-01-01

    Probabilistic Reasoning in Intelligent Systems is a complete and accessible account of the theoretical foundations and computational methods that underlie plausible reasoning under uncertainty. The author provides a coherent explication of probability as a language for reasoning with partial belief and offers a unifying perspective on other AI approaches to uncertainty, such as the Dempster-Shafer formalism, truth maintenance systems, and nonmonotonic logic. The author distinguishes syntactic and semantic approaches to uncertainty--and offers techniques, based on belief networks, that provid

  17. Future applications of artificial intelligence to Mission Control Centers

    Science.gov (United States)

    Friedland, Peter

    1991-01-01

    Future applications of artificial intelligence to Mission Control Centers are presented in the form of the viewgraphs. The following subject areas are covered: basic objectives of the NASA-wide AI program; inhouse research program; constraint-based scheduling; learning and performance improvement for scheduling; GEMPLAN multi-agent planner; planning, scheduling, and control; Bayesian learning; efficient learning algorithms; ICARUS (an integrated architecture for learning); design knowledge acquisition and retention; computer-integrated documentation; and some speculation on future applications.

  18. How Artificial Intelligence May Be Applied in Real World Situations

    OpenAIRE

    Michalewicz , Zbigniew

    2010-01-01

    International audience; In the modern information era, managers must recognize the competitive opportunities represented by decision-support tools. New family of such systems, based on recent advances in Artificial Intelligence, combine prediction and optimization techniques to assist decision makers in complex, rapidly changing environments. These systems address the fundamental questions: What is likely to happen in the future? and what is the best course of action? These modern AI systems ...

  19. Monitoring Severe Accidents Using AI Techniques

    International Nuclear Information System (INIS)

    No, Young Gyu; Kim, Ju Hyun; Na, Man Gyun; Ahn, Kwang Il

    2011-01-01

    It is very difficult for nuclear power plant operators to monitor and identify the major severe accident scenarios following an initiating event by staring at temporal trends of important parameters. The objective of this study is to develop and verify the monitoring for severe accidents using artificial intelligence (AI) techniques such as support vector classification (SVC), probabilistic neural network (PNN), group method of data handling (GMDH) and fuzzy neural network (FNN). The SVC and PNN are used for event classification among the severe accidents. Also, GMDH and FNN are used to monitor for severe accidents. The inputs to AI techniques are initial time-integrated values obtained by integrating measurement signals during a short time interval after reactor scram. In this study, 3 types of initiating events such as the hot-leg LOCA, the cold-leg LOCA and SGTR are considered and it is verified how well the proposed scenario identification algorithm using the GMDH and FNN models identifies the timings when the reactor core will be uncovered, when CET will exceed 1200 .deg. F and when the reactor vessel will fail. In cases that an initiating event develops into a severe accident, the proposed algorithm showed accurate classification of initiating events. Also, it well predicted timings for important occurrences during severe accident progression scenarios, which is very helpful for operators to perform severe accident management

  20. Intelligent fault diagnosis and failure management of flight control actuation systems

    Science.gov (United States)

    Bonnice, William F.; Baker, Walter

    1988-01-01

    The real-time fault diagnosis and failure management (FDFM) of current operational and experimental dual tandem aircraft flight control system actuators was investigated. Dual tandem actuators were studied because of the active FDFM capability required to manage the redundancy of these actuators. The FDFM methods used on current dual tandem actuators were determined by examining six specific actuators. The FDFM capability on these six actuators was also evaluated. One approach for improving the FDFM capability on dual tandem actuators may be through the application of artificial intelligence (AI) technology. Existing AI approaches and applications of FDFM were examined and evaluated. Based on the general survey of AI FDFM approaches, the potential role of AI technology for real-time actuator FDFM was determined. Finally, FDFM and maintainability improvements for dual tandem actuators were recommended.

  1. State-of-the-art review of some artificial intelligence applications in pile foundations

    Directory of Open Access Journals (Sweden)

    Mohamed A. Shahin

    2016-01-01

    Full Text Available Geotechnical engineering deals with materials (e.g. soil and rock that, by their very nature, exhibit varied and uncertain behavior due to the imprecise physical processes associated with the formation of these materials. Modeling the behavior of such materials in geotechnical engineering applications is complex and sometimes beyond the ability of most traditional forms of physically-based engineering methods. Artificial intelligence (AI is becoming more popular and particularly amenable to modeling the complex behavior of most geotechnical engineering applications because it has demonstrated superior predictive ability compared to traditional methods. This paper provides state-of-the-art review of some selected AI techniques and their applications in pile foundations, and presents the salient features associated with the modeling development of these AI techniques. The paper also discusses the strength and limitations of the selected AI techniques compared to other available modeling approaches.

  2. Artificial intelligence technology assessment for the US Army Depot System Command

    Energy Technology Data Exchange (ETDEWEB)

    Pennock, K A

    1991-07-01

    This assessment of artificial intelligence (AI) has been prepared for the US Army's Depot System Command (DESCOM) by Pacific Northwest Laboratory. The report describes several of the more promising AI technologies, focusing primarily on knowledge-based systems because they have been more successful in commercial applications than any other AI technique. The report also identifies potential Depot applications in the areas of procedural support, scheduling and planning, automated inspection, training, diagnostics, and robotic systems. One of the principal objectives of the report is to help decisionmakers within DESCOM to evaluate AI as a possible tool for solving individual depot problems. The report identifies a number of factors that should be considered in such evaluations. 22 refs.

  3. State-of-the-art review of some artificial intelligence applications in pile foundations

    Institute of Scientific and Technical Information of China (English)

    Mohamed A. Shahin

    2016-01-01

    Geotechnical engineering deals with materials (e.g. soil and rock) that, by their very nature, exhibit varied and uncertain behavior due to the imprecise physical processes associated with the formation of these materials. Modeling the behavior of such materials in geotechnical engineering applications is complex and sometimes beyond the ability of most traditional forms of physically-based engineering methods. Artificial intelligence (AI) is becoming more popular and particularly amenable to modeling the complex behavior of most geotechnical engineering applications because it has demonstrated superior predictive ability compared to traditional methods. This paper provides state-of-the-art review of some selected AI techniques and their applications in pile foundations, and presents the salient features associated with the modeling development of these AI techniques. The paper also discusses the strength and limitations of the selected AI techniques compared to other available modeling approaches.

  4. Artificial Intelligence Support for Computational Chemistry

    Science.gov (United States)

    Duch, Wlodzislaw

    Possible forms of artificial intelligence (AI) support for quantum chemistry are discussed. Questions addressed include: what kind of support is desirable, what kind of support is feasible, what can we expect in the coming years. Advantages and disadvantages of current AI techniques are presented and it is argued that at present the memory-based systems are the most effective for large scale applications. Such systems may be used to predict the accuracy of calculations and to select the least expensive methods and basis sets belonging to the same accuracy class. Advantages of the Feature Space Mapping as an improvement on the memory based systems are outlined and some results obtained in classification problems given. Relevance of such classification systems to computational chemistry is illustrated with two examples showing similarity of results obtained by different methods that take electron correlation into account.

  5. Paraconsistent intelligent-based systems new trends in the applications of paraconsistency

    CERN Document Server

    2015-01-01

    This book presents some of the latest applications of new theories based on the concept of paraconsistency and correlated topics in informatics, such as pattern recognition (bioinformatics), robotics, decision-making themes, and sample size. Each chapter is self-contained, and an introductory chapter covering the logic theoretical basis is also included. The aim of the text is twofold: to serve as an introductory text on the theories and applications of new logic, and as a textbook for undergraduate or graduate-level courses in AI. Today AI frequently has to cope with problems of vagueness, incomplete and conflicting (inconsistent) information. One of the most notable formal theories for addressing them is paraconsistent (paracomplete and non-alethic) logic. .

  6. Is Intelligence Artificial?

    OpenAIRE

    Greer, Kieran

    2014-01-01

    Our understanding of intelligence is directed primarily at the level of human beings. This paper attempts to give a more unifying definition that can be applied to the natural world in general. The definition would be used more to verify a degree of intelligence, not to quantify it and might help when making judgements on the matter. A version of an accepted test for AI is then put forward as the 'acid test' for Artificial Intelligence itself. It might be what a free-thinking program or robot...

  7. Application of artificial intelligence to pharmacy and medicine.

    Science.gov (United States)

    Dasta, J F

    1992-04-01

    Artificial intelligence (AI) is a branch of computer science dealing with solving problems using symbolic programming. It has evolved into a problem solving science with applications in business, engineering, and health care. One application of AI is expert system development. An expert system consists of a knowledge base and inference engine, coupled with a user interface. A crucial aspect of expert system development is knowledge acquisition and implementing computable ways to solve problems. There have been several expert systems developed in medicine to assist physicians with medical diagnosis. Recently, several programs focusing on drug therapy have been described. They provide guidance on drug interactions, drug therapy monitoring, and drug formulary selection. There are many aspects of pharmacy that AI can have an impact on and the reader is challenged to consider these possibilities because they may some day become a reality in pharmacy.

  8. Code AI Personal Web Pages

    Science.gov (United States)

    Garcia, Joseph A.; Smith, Charles A. (Technical Monitor)

    1998-01-01

    The document consists of a publicly available web site (george.arc.nasa.gov) for Joseph A. Garcia's personal web pages in the AI division. Only general information will be posted and no technical material. All the information is unclassified.

  9. Prediction of speech intelligibility based on a correlation metric in the envelope power spectrum domain

    DEFF Research Database (Denmark)

    Relano-Iborra, Helia; May, Tobias; Zaar, Johannes

    A powerful tool to investigate speech perception is the use of speech intelligibility prediction models. Recently, a model was presented, termed correlation-based speechbased envelope power spectrum model (sEPSMcorr) [1], based on the auditory processing of the multi-resolution speech-based Envel...

  10. Integrated human-machine intelligence in space systems

    Science.gov (United States)

    Boy, Guy A.

    1992-01-01

    The integration of human and machine intelligence in space systems is outlined with respect to the contributions of artificial intelligence. The current state-of-the-art in intelligent assistant systems (IASs) is reviewed, and the requirements of some real-world applications of the technologies are discussed. A concept of integrated human-machine intelligence is examined in the contexts of: (1) interactive systems that tolerate human errors; (2) systems for the relief of workloads; and (3) interactive systems for solving problems in abnormal situations. Key issues in the development of IASs include the compatibility of the systems with astronauts in terms of inputs/outputs, processing, real-time AI, and knowledge-based system validation. Real-world applications are suggested such as the diagnosis, planning, and control of enginnered systems.

  11. Making Computers Smarter: A Look At the Controversial Field of Artificial Intelligence.

    Science.gov (United States)

    Green, John O.

    1984-01-01

    Defines artificial intelligence (AI) and discusses its history; the current state of the art, research, experimentation, and practical applications; and probable future developments. Key dates in the history of AI and eight references are provided. (MBR)

  12. Present status of application of AI in nuclear industry

    International Nuclear Information System (INIS)

    Kitamura, Masaharu

    1989-01-01

    Artificial intelligence (AL) techniques have been introduced actively in the nuclear industry in pursuit of increased safety and efficiency. The present report outlines some AI techniques currently used in nuclear facilities. This type of techniques have increasingly been introduced to such areas as design, construction, operation, maintenance, quality control and analysis. Most of them use knowledge engineering techniques including expert systems. Positive efforts at research and application of various more advance AI techniaues have started recently. For application of AI techniques, activities in nuclear power plants can be divided into two groups. One includes 'analytical' activities such as operation, maintenance and analysis, while the other includes 'synthetic' activities such as design, construction and fuel control. The most important AI technology for the analytical activities is diagnosis. Thus the report outlines major processes to which diagnostic techniques are applicable, and knowledge description and inference methods used for diagnosis. For AI techniques for synthetic activities, some problems and possible solutions are addressed. Development efforts in and outside Japan are also outlined. (Nogami, K.)

  13. Discovering Knowledge from AIS Database for Application in VTS

    Science.gov (United States)

    Tsou, Ming-Cheng

    The widespread use of the Automatic Identification System (AIS) has had a significant impact on maritime technology. AIS enables the Vessel Traffic Service (VTS) not only to offer commonly known functions such as identification, tracking and monitoring of vessels, but also to provide rich real-time information that is useful for marine traffic investigation, statistical analysis and theoretical research. However, due to the rapid accumulation of AIS observation data, the VTS platform is often unable quickly and effectively to absorb and analyze it. Traditional observation and analysis methods are becoming less suitable for the modern AIS generation of VTS. In view of this, we applied the same data mining technique used for business intelligence discovery (in Customer Relation Management (CRM) business marketing) to the analysis of AIS observation data. This recasts the marine traffic problem as a business-marketing problem and integrates technologies such as Geographic Information Systems (GIS), database management systems, data warehousing and data mining to facilitate the discovery of hidden and valuable information in a huge amount of observation data. Consequently, this provides the marine traffic managers with a useful strategic planning resource.

  14. Intelligence Control System for Landfills Based on Wireless Sensor Network

    Science.gov (United States)

    Zhang, Qian; Huang, Chuan; Gong, Jian

    2018-06-01

    This paper put forward an intelligence system for controlling the landfill gas in landfills to make the landfill gas (LFG) exhaust controllably and actively. The system, which is assigned by the wireless sensor network, were developed and supervised by remote applications in workshop instead of manual work. An automatic valve control depending on the sensor units embedded is installed in tube, the air pressure and concentration of LFG are detected to decide the level of the valve switch. The paper also proposed a modified algorithm to solve transmission problem, so that the system can keep a high efficiency and long service life.

  15. Intelligent Agent Based Traffic Signal Control on Isolated Intersections

    Directory of Open Access Journals (Sweden)

    Daniela Koltovska

    2014-08-01

    Full Text Available The purpose of this paper is to develop an adaptive signal control strategy on isolated urban intersections. An innovative approach to defining the set of states dependent on the actual and primarily observed parameters has been introduced. ?he Q–learning algorithm has been applied. The developed self-learning adaptive signal strategy has been tested on a re?l intersection. The intelligent agent results have been compared to those in cases of fixed-time and actuated control. Regarding the average total delay, the total number of stops and the total throughput, the best results have been obtained for unknown traffic demand and over-capacity.

  16. Intelligence Control System for Landfills Based on Wireless Sensor Network

    Directory of Open Access Journals (Sweden)

    Zhang Qian

    2018-01-01

    Full Text Available This paper put forward an intelligence system for controlling the landfill gas in landfills to make the landfill gas (LFG exhaust controllably and actively. The system, which is assigned by the wireless sensor network, were developed and supervised by remote applications in workshop instead of manual work. An automatic valve control depending on the sensor units embedded is installed in tube, the air pressure and concentration of LFG are detected to decide the level of the valve switch. The paper also proposed a modified algorithm to solve transmission problem, so that the system can keep a high efficiency and long service life.

  17. Artificial Intelligence and Public Healthcare Service Innovation

    DEFF Research Database (Denmark)

    Sun, Tara Qian; Medaglia, Rony

    Public healthcare ecosystems are complex networks of diverse actors that are subject to pressures to innovate, also a result of technological advancements. Artificial Intelligence (AI), in particular, has the potential to transform the way hospitals, doctors, patients, government agencies...

  18. Conjunction of wavelet transform and SOM-mutual information data pre-processing approach for AI-based Multi-Station nitrate modeling of watersheds

    Science.gov (United States)

    Nourani, Vahid; Andalib, Gholamreza; Dąbrowska, Dominika

    2017-05-01

    Accurate nitrate load predictions can elevate decision management of water quality of watersheds which affects to environment and drinking water. In this paper, two scenarios were considered for Multi-Station (MS) nitrate load modeling of the Little River watershed. In the first scenario, Markovian characteristics of streamflow-nitrate time series were proposed for the MS modeling. For this purpose, feature extraction criterion of Mutual Information (MI) was employed for input selection of artificial intelligence models (Feed Forward Neural Network, FFNN and least square support vector machine). In the second scenario for considering seasonality-based characteristics of the time series, wavelet transform was used to extract multi-scale features of streamflow-nitrate time series of the watershed's sub-basins to model MS nitrate loads. Self-Organizing Map (SOM) clustering technique which finds homogeneous sub-series clusters was also linked to MI for proper cluster agent choice to be imposed into the models for predicting the nitrate loads of the watershed's sub-basins. The proposed MS method not only considers the prediction of the outlet nitrate but also covers predictions of interior sub-basins nitrate load values. The results indicated that the proposed FFNN model coupled with the SOM-MI improved the performance of MS nitrate predictions compared to the Markovian-based models up to 39%. Overall, accurate selection of dominant inputs which consider seasonality-based characteristics of streamflow-nitrate process could enhance the efficiency of nitrate load predictions.

  19. Providing Evidence-Based, Intelligent Support for Flood Resilient Planning and Policy: The PEARL Knowledge Base

    Directory of Open Access Journals (Sweden)

    George Karavokiros

    2016-09-01

    Full Text Available While flood risk is evolving as one of the most imminent natural hazards and the shift from a reactive decision environment to a proactive one sets the basis of the latest thinking in flood management, the need to equip decision makers with necessary tools to think about and intelligently select options and strategies for flood management is becoming ever more pressing. Within this context, the Preparing for Extreme and Rare Events in Coastal Regions (PEARL intelligent knowledge-base (PEARL KB of resilience strategies is presented here as an environment that allows end-users to navigate from their observed problem to a selection of possible options and interventions worth considering within an intuitive visual web interface assisting advanced interactivity. Incorporation of real case studies within the PEARL KB enables the extraction of (evidence-based lessons from all over the word, while the KB’s collection of methods and tools directly supports the optimal selection of suitable interventions. The Knowledge-Base also gives access to the PEARL KB Flood Resilience Index (FRI tool, which is an online tool for resilience assessment at a city level available to authorities and citizens. We argue that the PEARL KB equips authorities with tangible and operational tools that can improve strategic and operational flood risk management by assessing and eventually increasing resilience, while building towards the strengthening of risk governance. The online tools that the PEARL KB gives access to were demonstrated and tested in the city of Rethymno, Greece.

  20. Fault diagnosis of an intelligent hydraulic pump based on a nonlinear unknown input observer

    Directory of Open Access Journals (Sweden)

    Zhonghai MA

    2018-02-01

    Full Text Available Hydraulic piston pumps are commonly used in aircraft. In order to improve the viability of aircraft and energy efficiency, intelligent variable pressure pump systems have been used in aircraft hydraulic systems more and more widely. Efficient fault diagnosis plays an important role in improving the reliability and performance of hydraulic systems. In this paper, a fault diagnosis method of an intelligent hydraulic pump system (IHPS based on a nonlinear unknown input observer (NUIO is proposed. Different from factors of a full-order Luenberger-type unknown input observer, nonlinear factors of the IHPS are considered in the NUIO. Firstly, a new type of intelligent pump is presented, the mathematical model of which is established to describe the IHPS. Taking into account the real-time requirements of the IHPS and the special structure of the pump, the mechanism of the intelligent pump and failure modes are analyzed and two typical failure modes are obtained. Furthermore, a NUIO of the IHPS is performed based on the output pressure and swashplate angle signals. With the residual error signals produced by the NUIO, online intelligent pump failure occurring in real-time can be detected. Lastly, through analysis and simulation, it is confirmed that this diagnostic method could accurately diagnose and isolate those typical failure modes of the nonlinear IHPS. The method proposed in this paper is of great significance in improving the reliability of the IHPS. Keywords: Fault diagnosis, Hydraulic piston pump, Model-based, Nonlinear unknown input observer (NUIO, Residual error