Effective SIMD Vectorization for Intel Xeon Phi Coprocessors
Directory of Open Access Journals (Sweden)
Xinmin Tian
2015-01-01
Full Text Available Efficiently exploiting SIMD vector units is one of the most important aspects in achieving high performance of the application code running on Intel Xeon Phi coprocessors. In this paper, we present several effective SIMD vectorization techniques such as less-than-full-vector loop vectorization, Intel MIC specific alignment optimization, and small matrix transpose/multiplication 2D vectorization implemented in the Intel C/C++ and Fortran production compilers for Intel Xeon Phi coprocessors. A set of workloads from several application domains is employed to conduct the performance study of our SIMD vectorization techniques. The performance results show that we achieved up to 12.5x performance gain on the Intel Xeon Phi coprocessor. We also demonstrate a 2000x performance speedup from the seamless integration of SIMD vectorization and parallelization.
Directory of Open Access Journals (Sweden)
E. C. Muniz
2012-05-01
Full Text Available This work reports the preparation of hydrogels based on PVA-GMA, PVA-GMA is poly(vinyl alcohol (PVA functionalized with vinyl groups from glycidyl methacrylate (GMA, and on PVA-GMA with different content of chondroitin sulfate (CS. The degrees of swelling of PVA-GMA and PVA-GMA/CS hydrogels were evaluated in distilled water and the swelling kinetics was performed in simulated gastric and intestinal fluids (SGF and SIF. PVA-GMA and PVAGMA/CS hydrogels demonstrated to be resistant on SGF and SIF fluids. The elastic modulus, E, of swollen-hydrogels were determined through compressive tests and, according to the obtained results, the hydrogels presented good mechanical properties. At last, the presence of CS enhances the hydrogel cell compatibility as gathered by cytotoxicity assays. It was concluded that the hydrogels prepared through this work presented characteristics that allow them to be used as biomaterial, as a carrier in drug delivery system or to act as scaffolds in tissue engineering as well.
Comparison of Processor Performance of SPECint2006 Benchmarks of some Intel Xeon Processors
Directory of Open Access Journals (Sweden)
Abdul Kareem PARCHUR
2012-08-01
Full Text Available High performance is a critical requirement to all microprocessors manufacturers. The present paper describes the comparison of performance in two main Intel Xeon series processors (Type A: Intel Xeon X5260, X5460, E5450 and L5320 and Type B: Intel Xeon X5140, 5130, 5120 and E5310. The microarchitecture of these processors is implemented using the basis of a new family of processors from Intel starting with the Pentium 4 processor. These processors can provide a performance boost for many key application areas in modern generation. The scaling of performance in two major series of Intel Xeon processors (Type A: Intel Xeon X5260, X5460, E5450 and L5320 and Type B: Intel Xeon X5140, 5130, 5120 and E5310 has been analyzed using the performance numbers of 12 CPU2006 integer benchmarks, performance numbers that exhibit significant differences in performance. The results and analysis can be used by performance engineers, scientists and developers to better understand the performance scaling in modern generation processors.
Scientific Computing and Apple's Intel Transition
CERN. Geneva
2006-01-01
Intel's published processor roadmap and how it may affect the future of personal and scientific computing About the speaker: Eric Albert is Senior Software Engineer in Apple's Core Technologies group. During Mac OS X's transition to Intel processors he has worked on almost every part of the operating system, from the OS kernel and compiler tools to appli...
Comparison of Processor Performance of SPECint2006 Benchmarks of some Intel Xeon Processors
Abdul Kareem PARCHUR; Ram Asaray SINGH
2012-01-01
High performance is a critical requirement to all microprocessors manufacturers. The present paper describes the comparison of performance in two main Intel Xeon series processors (Type A: Intel Xeon X5260, X5460, E5450 and L5320 and Type B: Intel Xeon X5140, 5130, 5120 and E5310). The microarchitecture of these processors is implemented using the basis of a new family of processors from Intel starting with the Pentium 4 processor. These processors can provide a performance boost for many ke...
2002-01-01
"Intel Corporation today introduced updated tools to help software developers optimize applications for Intel's expanding family of architectures with key innovations such as Intel's Hyper Threading Technology (1 page).
Experience with Intel's Many Integrated Core Architecture in ATLAS Software
Fleischmann, S; The ATLAS collaboration; Lavrijsen, W; Neumann, M; Vitillo, R
2014-01-01
Intel recently released the first commercial boards of its Many Integrated Core (MIC) Architecture. MIC is Intel's solution for the domain of throughput computing, currently dominated by general purpose programming on graphics processors (GPGPU). MIC allows the use of the more familiar x86 programming model and supports standard technologies such as OpenMP, MPI, and Intel's Threading Building Blocks. This should make it possible to develop for both throughput and latency devices using a single code base.\
Experience with Intel's Many Integrated Core Architecture in ATLAS Software
Fleischmann, S; The ATLAS collaboration; Lavrijsen, W; Neumann, M; Vitillo, R
2013-01-01
Intel recently released the first commercial boards of its Many Integrated Core (MIC) Architecture. MIC is Intel's solution for the domain of throughput computing, currently dominated by general purpose programming on graphics processors (GPGPU). MIC allows the use of the more familiar x86 programming model and supports standard technologies such as OpenMP, MPI, and Intel's Threading Building Blocks. This should make it possible to develop for both throughput and latency devices using a single code base.\
Intel: High Throughput Computing Collaboration: A CERN openlab / Intel collaboration
CERN. Geneva
2015-01-01
The Intel/CERN High Throughput Computing Collaboration studies the application of upcoming Intel technologies to the very challenging environment of the LHC trigger and data-acquisition systems. These systems will need to transport and process many terabits of data every second, in some cases with tight latency constraints. Parallelisation and tight integration of accelerators and classical CPU via Intel's OmniPath fabric are the key elements in this project.
[Intel random number generator-based true random number generator].
Huang, Feng; Shen, Hong
2004-09-01
To establish a true random number generator on the basis of certain Intel chips. The random numbers were acquired by programming using Microsoft Visual C++ 6.0 via register reading from the random number generator (RNG) unit of an Intel 815 chipset-based computer with Intel Security Driver (ISD). We tested the generator with 500 random numbers in NIST FIPS 140-1 and X(2) R-Squared test, and the result showed that the random number it generated satisfied the demand of independence and uniform distribution. We also compared the random numbers generated by Intel RNG-based true random number generator and those from the random number table statistically, by using the same amount of 7500 random numbers in the same value domain, which showed that the SD, SE and CV of Intel RNG-based random number generator were less than those of the random number table. The result of u test of two CVs revealed no significant difference between the two methods. Intel RNG-based random number generator can produce high-quality random numbers with good independence and uniform distribution, and solves some problems with random number table in acquisition of the random numbers.
21 CFR 890.3100 - Mechanical chair.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Mechanical chair. 890.3100 Section 890.3100 Food... DEVICES PHYSICAL MEDICINE DEVICES Physical Medicine Prosthetic Devices § 890.3100 Mechanical chair. (a) Identification. A mechanical chair is a manually operated device intended for medical purposes that is used to...
Stabilitas emulsi kopolimer S-GMA (stirena – glisidil metakrilat
Directory of Open Access Journals (Sweden)
Isananto Winursito
1992-08-01
Full Text Available Epoxy groups in glycidyl methacrylate (GMA units have been available for the reaction with amine of proteins or other biological active substrates to prepare biomaterials and hybrid devices. Soap-soap copolymerization of GMA with styrene (S result the formation of stable latex. Hydrolysis of epoxy groups in copolymer particles increased emulsion stability. The effect of pH, temperature and reaction time in the hydrolysis of S-GMA copolymer have been investigated.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Counseling. 21.3100.... Chapter 35 Counseling § 21.3100 Counseling. (a) Purpose of counseling. The purpose of counseling is to...)) (b) Availability of counseling. Counseling assistance is available for— (1) Identifying and removing...
Ogasawara, Todd
2008-01-01
Even the most devoted Mac OS X user may need to use Windows XP, or may just be curious about XP and its applications. This Short Cut is a concise guide for OS X users who need to quickly get comfortable and become productive with Windows XP basics on their Macs. It covers: Security Networking ApplicationsMac users can easily install and use Windows thanks to Boot Camp and Parallels Desktop for Mac. Boot Camp lets an Intel-based Mac install and boot Windows XP on its own hard drive partition. Parallels Desktop for Mac uses virtualization technology to run Windows XP (or other operating systems
Grimmett, Richard
2015-01-01
This book is for anyone who has ever been curious about using the Intel Galileo to create electronics projects. Some programming background is useful, but if you know how to use a personal computer, with the aid of the step-by-step instructions in this book, you can construct complex electronics projects that use the Intel Galileo.
Accessing Intel FPGAs for Acceleration
CERN. Geneva
2018-01-01
In this presentation, we will discuss the latest tools and products from Intel that enables FPGAs to be deployed as Accelerators. We will first talk about the Acceleration Stack for Intel Xeon CPU with FPGAs which makes it easy to create, verify, and execute functions on the Intel Programmable Acceleration Card in a Data Center. We will then talk about the OpenCL flow which allows parallel software developers to create FPGA systems and deploy them using the OpenCL standard. Next, we will talk about the Intel High-Level Synthesis compiler which can convert C++ code into custom RTL code optimized for Intel FPGAs. Lastly, we will focus on the task of running Machine Learning inference on the FPGA leveraging some of the tools we discussed. About the speaker Karl Qi is Sr. Staff Applications Engineer, Technical Training. He has been with the Customer Training department at Altera/Intel for 8 years. Most recently, he is responsible for all training content relating to High-Level Design tools, including the OpenCL...
V3-independent competitive resistance of a dual-X4 HIV-1 to the CXCR4 inhibitor AMD3100.
Directory of Open Access Journals (Sweden)
Yosuke Maeda
Full Text Available A CXCR4 inhibitor-resistant HIV-1 was isolated from a dual-X4 HIV-1 in vitro. The resistant variant displayed competitive resistance to the CXCR4 inhibitor AMD3100, indicating that the resistant variant had a higher affinity for CXCR4 than that of the wild-type HIV-1. Amino acid sequence analyses revealed that the resistant variant harbored amino acid substitutions in the V2, C2, and C4 regions, but no remarkable changes in the V3 loop. Site-directed mutagenesis confirmed that the changes in the C2 and C4 regions were principally involved in the reduced sensitivity to AMD3100. Furthermore, the change in the C4 region was associated with increased sensitivity to soluble CD4, and profoundly enhanced the entry efficiency of the virus. Therefore, it is likely that the resistant variant acquired the higher affinity for CD4/CXCR4 by the changes in non-V3 regions. Taken together, a CXCR4 inhibitor-resistant HIV-1 can evolve using a non-V3 pathway.
Xue, Ping; Su, Weiguang; Gu, Yaohua; Liu, Haifeng; Wang, Julan
2015-03-01
Magnetic hydrophilic polymeric microspheres containing oxirane groups were prepared by inverse suspension polymerization of glycidyl methacrylate (GMA), N, N‧-methylene bisacrylamide (MBAA) and N-vinyl pyrrolidone (NVP) in the existence of formamide, which were denoted as magnetic poly(GMA-MBAA-NVP) microspheres. The magnetic poly(GMA-MBAA-NVP) microspheres were characterized by scanning electron microscopy (SEM), FT-IR spectroscopy, X-ray diffraction (XRD), vibrating sample magnetometer (VSM) and so on. The results showed that poly(GMA-MBAA-NVP) microspheres possessed well spherical shape, narrow size distribution, abundant porous structure, reactive oxirane groups and superparamagnetic properties. Formamide used in the present work served as a modifier, a dispersant and a porogen to form final porous polymer microspheres. The penicillin G acylase (PGA) was covalently immobilized onto the magnetic microspheres through the reaction between the amino groups of enzyme and the oxirane groups on the microspheres for producing 6-aminopenicillanic acid (6-APA). The effects of GMA/NVP ratio and crosslink density on the activity of immobilized PGA were investigated. The highest apparent activity, enzyme loading and coupling yield of immobilized PGA were 821 IU/g, 65.3 mg/g and 42.3% respectively when the mass ratio of GMA/NVP was 1:1 and crosslink density was 60%. Compared with the free PGA, immobilized PGA showed a wider range of pH value and reaction temperature. The relative activity and reaction rate of immobilized PGA remained almost constant after 20 recycles. The magnetic poly(GMA-MBAA-NVP) microspheres would be very promising carriers for immobilizing enzymes in industrial application.
Intel Xeon Phi coprocessor high performance programming
Jeffers, James
2013-01-01
Authors Jim Jeffers and James Reinders spent two years helping educate customers about the prototype and pre-production hardware before Intel introduced the first Intel Xeon Phi coprocessor. They have distilled their own experiences coupled with insights from many expert customers, Intel Field Engineers, Application Engineers and Technical Consulting Engineers, to create this authoritative first book on the essentials of programming for this new architecture and these new products. This book is useful even before you ever touch a system with an Intel Xeon Phi coprocessor. To ensure that your applications run at maximum efficiency, the authors emphasize key techniques for programming any modern parallel computing system whether based on Intel Xeon processors, Intel Xeon Phi coprocessors, or other high performance microprocessors. Applying these techniques will generally increase your program performance on any system, and better prepare you for Intel Xeon Phi coprocessors and the Intel MIC architecture. It off...
Energy Technology Data Exchange (ETDEWEB)
Xue, Ping; Su, Weiguang, E-mail: weiguangsu@nxu.edu.cn; Gu, Yaohua; Liu, Haifeng; Wang, Julan
2015-03-15
Magnetic hydrophilic polymeric microspheres containing oxirane groups were prepared by inverse suspension polymerization of glycidyl methacrylate (GMA), N, N′-methylene bisacrylamide (MBAA) and N-vinyl pyrrolidone (NVP) in the existence of formamide, which were denoted as magnetic poly(GMA-MBAA-NVP) microspheres. The magnetic poly(GMA-MBAA-NVP) microspheres were characterized by scanning electron microscopy (SEM), FT-IR spectroscopy, X-ray diffraction (XRD), vibrating sample magnetometer (VSM) and so on. The results showed that poly(GMA-MBAA-NVP) microspheres possessed well spherical shape, narrow size distribution, abundant porous structure, reactive oxirane groups and superparamagnetic properties. Formamide used in the present work served as a modifier, a dispersant and a porogen to form final porous polymer microspheres. The penicillin G acylase (PGA) was covalently immobilized onto the magnetic microspheres through the reaction between the amino groups of enzyme and the oxirane groups on the microspheres for producing 6-aminopenicillanic acid (6-APA). The effects of GMA/NVP ratio and crosslink density on the activity of immobilized PGA were investigated. The highest apparent activity, enzyme loading and coupling yield of immobilized PGA were 821 IU/g, 65.3 mg/g and 42.3% respectively when the mass ratio of GMA/NVP was 1:1 and crosslink density was 60%. Compared with the free PGA, immobilized PGA showed a wider range of pH value and reaction temperature. The relative activity and reaction rate of immobilized PGA remained almost constant after 20 recycles. The magnetic poly(GMA-MBAA-NVP) microspheres would be very promising carriers for immobilizing enzymes in industrial application. - Highlights: • The magnetic poly(GMA-MBAA-NVP) microspheres were successfully synthesized. • Formamide served as a modifier, a dispersant and a porogen to form microspheres. • The magnetic microspheres were highly efficient carriers for immobilizing PGA. • Immobilized PGA
MILC staggered conjugate gradient performance on Intel KNL
Energy Technology Data Exchange (ETDEWEB)
Li, Ruiz [Indiana Univ., Bloomington, IN (United States). Dept. of Physics; Detar, Carleton [Univ. of Utah, Salt Lake City, UT (United States). Dept. of Physics and Astronomy; Doerfler, Douglas W. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States). National Energy Research Scientific Computing Center (NERSC); Gottlieb, Steven [Indiana Univ., Bloomington, IN (United States). Dept. of Physics; Jha, Asish [Intel Corp., Hillsboro, OR (United States). Sofware and Services Group; Kalamkar, Dhiraj [Intel Labs., Bangalore (India). Parallel Computing Lab.; Toussaint, Doug [Univ. of Arizona, Tucson, AZ (United States). Physics Dept.
2016-11-03
We review our work done to optimize the staggered conjugate gradient (CG) algorithm in the MILC code for use with the Intel Knights Landing (KNL) architecture. KNL is the second gener- ation Intel Xeon Phi processor. It is capable of massive thread parallelism, data parallelism, and high on-board memory bandwidth and is being adopted in supercomputing centers for scientific research. The CG solver consumes the majority of time in production running, so we have spent most of our effort on it. We compare performance of an MPI+OpenMP baseline version of the MILC code with a version incorporating the QPhiX staggered CG solver, for both one-node and multi-node runs.
Heterogeneous High Throughput Scientific Computing with APM X-Gene and Intel Xeon Phi
Abdurachmanov, David; Elmer, Peter; Eulisse, Giulio; Knight, Robert; Muzaffar, Shahzad
2014-01-01
Electrical power requirements will be a constraint on the future growth of Distributed High Throughput Computing (DHTC) as used by High Energy Physics. Performance-per-watt is a critical metric for the evaluation of computer architectures for cost- efficient computing. Additionally, future performance growth will come from heterogeneous, many-core, and high computing density platforms with specialized processors. In this paper, we examine the Intel Xeon Phi Many Integrated Cores (MIC) co-processor and Applied Micro X-Gene ARMv8 64-bit low-power server system-on-a-chip (SoC) solutions for scientific computing applications. We report our experience on software porting, performance and energy efficiency and evaluate the potential for use of such technologies in the context of distributed computing systems such as the Worldwide LHC Computing Grid (WLCG).
Heterogeneous High Throughput Scientific Computing with APM X-Gene and Intel Xeon Phi
Abdurachmanov, David; Bockelman, Brian; Elmer, Peter; Eulisse, Giulio; Knight, Robert; Muzaffar, Shahzad
2015-05-01
Electrical power requirements will be a constraint on the future growth of Distributed High Throughput Computing (DHTC) as used by High Energy Physics. Performance-per-watt is a critical metric for the evaluation of computer architectures for cost- efficient computing. Additionally, future performance growth will come from heterogeneous, many-core, and high computing density platforms with specialized processors. In this paper, we examine the Intel Xeon Phi Many Integrated Cores (MIC) co-processor and Applied Micro X-Gene ARMv8 64-bit low-power server system-on-a-chip (SoC) solutions for scientific computing applications. We report our experience on software porting, performance and energy efficiency and evaluate the potential for use of such technologies in the context of distributed computing systems such as the Worldwide LHC Computing Grid (WLCG).
Heterogeneous High Throughput Scientific Computing with APM X-Gene and Intel Xeon Phi
International Nuclear Information System (INIS)
Abdurachmanov, David; Bockelman, Brian; Elmer, Peter; Eulisse, Giulio; Muzaffar, Shahzad; Knight, Robert
2015-01-01
Electrical power requirements will be a constraint on the future growth of Distributed High Throughput Computing (DHTC) as used by High Energy Physics. Performance-per-watt is a critical metric for the evaluation of computer architectures for cost- efficient computing. Additionally, future performance growth will come from heterogeneous, many-core, and high computing density platforms with specialized processors. In this paper, we examine the Intel Xeon Phi Many Integrated Cores (MIC) co-processor and Applied Micro X-Gene ARMv8 64-bit low-power server system-on-a-chip (SoC) solutions for scientific computing applications. We report our experience on software porting, performance and energy efficiency and evaluate the potential for use of such technologies in the context of distributed computing systems such as the Worldwide LHC Computing Grid (WLCG). (paper)
Building a robust distributed system: some lessons from R-GMA
International Nuclear Information System (INIS)
Bhatti, P; Duncan, A; Fisher, S M; Jiang, M; Kuseju, A O; Paventhan, A; Wilson, A J
2008-01-01
R-GMA, as deployed by LCG, is a large distributed system. We are currently addressing some design issues to make it highly reliable, and fault tolerant. In validating the new design, there were two classes of problems to consider: one related to the flow of data and the other to the loss of control messages. R-GMA streams data from one place to another; there is a need to consider the behaviour when data is being inserted more rapidly into the system than taken out and more generally how to deal with bottlenecks. In the original R-GMA design the system tried hard to deliver all control messages; those messages that were not delivered quickly were queued for retry later. Badly configured firewalls, network problems or very slow machines could all lead to long queues of messages; many of the messages on the queue should have been replaced by later ones. In the new design no individual control message is critical; the system just needs to know if each message was received successfully. The system should also avoid single points of failure. However this can require complex code resulting in a system that is actually less reliable. We describe how we have dealt with bottlenecks in the flow of data, loss of control messages and the elimination of single points of failure to produce a robust R-GMA design. The work presented, though in the context of R-GMA, is applicable to any large distributed system
Home automation with Intel Galileo
Dundar, Onur
2015-01-01
This book is for anyone who wants to learn Intel Galileo for home automation and cross-platform software development. No knowledge of programming with Intel Galileo is assumed, but knowledge of the C programming language is essential.
45 CFR 310.0 - What does this part cover?
2010-10-01
... COMPUTERIZED TRIBAL IV-D SYSTEMS AND OFFICE AUTOMATION General Provisions § 310.0 What does this part cover... 45 Public Welfare 2 2010-10-01 2010-10-01 false What does this part cover? 310.0 Section 310.0... and Office Automation including: (a) The automated systems options for comprehensive Tribal IV-D...
Vectorization for Molecular Dynamics on Intel Xeon Phi Corpocessors
Yi, Hongsuk
2014-03-01
Many modern processors are capable of exploiting data-level parallelism through the use of single instruction multiple data (SIMD) execution. The new Intel Xeon Phi coprocessor supports 512 bit vector registers for the high performance computing. In this paper, we have developed a hierarchical parallelization scheme for accelerated molecular dynamics simulations with the Terfoff potentials for covalent bond solid crystals on Intel Xeon Phi coprocessor systems. The scheme exploits multi-level parallelism computing. We combine thread-level parallelism using a tightly coupled thread-level and task-level parallelism with 512-bit vector register. The simulation results show that the parallel performance of SIMD implementations on Xeon Phi is apparently superior to their x86 CPU architecture.
Unlock performance secrets of next-gen Intel hardware
CERN. Geneva
2015-01-01
Intel® Xeon Phi Product. About the speaker Zakhar is a software architect in Intel SSG group. His current role is Parallel Studio architect with focus on SIMD vector parallelism assistance tools. Before it he was working as Intel Advisor XE software architect and software development team-lead. Before joining Intel he was...
47 CFR 36.503 - Accumulated depreciation-Account 3100.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Accumulated depreciation-Account 3100. 36.503 Section 36.503 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES... Accumulated depreciation—Account 3100. (a) Amounts recorded in this account shall be separated on the basis of...
Effective SIMD Vectorization for Intel Xeon Phi Coprocessors
Tian, Xinmin; Saito, Hideki; Preis, Serguei V.; Garcia, Eric N.; Kozhukhov, Sergey S.; Masten, Matt; Cherkasov, Aleksei G.; Panchenko, Nikolay
2015-01-01
Efficiently exploiting SIMD vector units is one of the most important aspects in achieving high performance of the application code running on Intel Xeon Phi coprocessors. In this paper, we present several effective SIMD vectorization techniques such as less-than-full-vector loop vectorization, Intel MIC specific alignment optimization, and small matrix transpose/multiplication 2D vectorization implemented in the Intel C/C++ and Fortran production compilers for Intel Xeon Phi coprocessors. A ...
INTEL: Intel based systems move up in supercomputing ranks
2002-01-01
"The TOP500 supercomputer rankings released today at the Supercomputing 2002 conference show a dramatic increase in the number of Intel-based systems being deployed in high-performance computing (HPC) or supercomputing areas" (1/2 page).
DEFF Research Database (Denmark)
Hess, David A; Bonde, Jesper; Craft, Timothy P
2007-01-01
) or purified CD34(+) cells was compared at limiting dilution into NOD/SCID mice. Human AMD3100-mobilized MNC possessed enhanced repopulating frequency in comparison to G-CSF-mobilized MNC from paired donors, and purified CD34(+) progenitors were at least as efficient as the G-CSF mobilized cells....... The frequencies of NOD/SCID repopulating cells (SRC) were 1 SRC in 8.7 x 10(6) AMD3100-mobilized MNC compared to 1 SRC in 29.0 x 10(6) G-CSF-mobilized MNC, and 1 SRC in 1.2 x 10(5) AMD3100-mobilized CD34(+) cells compared to 1 SRC in 1.8 x 10(5) G-CSF-mobilized CD34(+) cells. Hematopoietic differentiation...
Implementation of an Agent-Based Parallel Tissue Modelling Framework for the Intel MIC Architecture
Directory of Open Access Journals (Sweden)
Maciej Cytowski
2017-01-01
Full Text Available Timothy is a novel large scale modelling framework that allows simulating of biological processes involving different cellular colonies growing and interacting with variable environment. Timothy was designed for execution on massively parallel High Performance Computing (HPC systems. The high parallel scalability of the implementation allows for simulations of up to 109 individual cells (i.e., simulations at tissue spatial scales of up to 1 cm3 in size. With the recent advancements of the Timothy model, it has become critical to ensure appropriate performance level on emerging HPC architectures. For instance, the introduction of blood vessels supplying nutrients to the tissue is a very important step towards realistic simulations of complex biological processes, but it greatly increased the computational complexity of the model. In this paper, we describe the process of modernization of the application in order to achieve high computational performance on HPC hybrid systems based on modern Intel® MIC architecture. Experimental results on the Intel Xeon Phi™ coprocessor x100 and the Intel Xeon Phi processor x200 are presented.
Grafting of GMA and some comonomers onto chitosan for controlled release of diclofenac sodium.
Sharma, Rajeev Kr; Lalita; Singh, Anirudh P; Chauhan, Ghanshyam S
2014-03-01
In order to develop pH sensitive hydrogels for controlled drug release we have graft copolymerized glycidyl methacrylate (GMA) with comonomers acrylic acid, acrylamide and acrylonitrile, onto chitosan (Ch) by using potassium persulphate (KPS) as free radical initiator in aqueous solution. The optimum percent grafting for GMA was recorded for 1g chitosan at [KPS]=25.00 × 10(-3)mol/L, [GMA]=0.756 × 10(-3)mol/L, reaction temperature=60 °C and reaction time=1h in 20 mL H2O. Binary monomers were grafted for five different concentrations at optimum grafting conditions evaluated for GMA alone onto chitosan. The graft copolymers were characterized by FTIR, XRD, TGA and SEM. The swelling properties of chitosan and graft copolymers were investigated at different pH to define their end uses in sustained release of an anti-inflammatory drug, diclofenac sodium. Percent drug release w.r.t. drug loaded in polymeric sample was studied as function of time in buffer solutions of pH 2.0 and 7.4. In vitro release data was analyzed using Fick's Law. Chitosan grafted with binary monomers, GMA-co-AAm and GMA-co-AN showed very good results for sustained release of drug at 7.4 pH. Copyright © 2014 Elsevier B.V. All rights reserved.
Mielikainen, Jarno; Huang, Bormin; Huang, Allen
2015-10-01
The Thompson cloud microphysics scheme is a sophisticated cloud microphysics scheme in the Weather Research and Forecasting (WRF) model. The scheme is very suitable for massively parallel computation as there are no interactions among horizontal grid points. Compared to the earlier microphysics schemes, the Thompson scheme incorporates a large number of improvements. Thus, we have optimized the speed of this important part of WRF. Intel Many Integrated Core (MIC) ushers in a new era of supercomputing speed, performance, and compatibility. It allows the developers to run code at trillions of calculations per second using the familiar programming model. In this paper, we present our results of optimizing the Thompson microphysics scheme on Intel Many Integrated Core Architecture (MIC) hardware. The Intel Xeon Phi coprocessor is the first product based on Intel MIC architecture, and it consists of up to 61 cores connected by a high performance on-die bidirectional interconnect. The coprocessor supports all important Intel development tools. Thus, the development environment is familiar one to a vast number of CPU developers. Although, getting a maximum performance out of MICs will require using some novel optimization techniques. New optimizations for an updated Thompson scheme are discusses in this paper. The optimizations improved the performance of the original Thompson code on Xeon Phi 7120P by a factor of 1.8x. Furthermore, the same optimizations improved the performance of the Thompson on a dual socket configuration of eight core Intel Xeon E5-2670 CPUs by a factor of 1.8x compared to the original Thompson code.
Koskela, TS; Lobet, M
2017-01-01
In this session we show, in two case studies, how the roofline feature of Intel Advisor has been utilized to optimize the performance of kernels of the XGC1 and PICSAR codes in preparation for Intel Knights Landing architecture. The impact of the implemented optimizations and the benefits of using the automatic roofline feature of Intel Advisor to study performance of large applications will be presented. This demonstrates an effective optimization strategy that has enabled these science appl...
Directory of Open Access Journals (Sweden)
Shuzhen Luo
2016-12-01
Full Text Available With the aim of reducing human exposure to Bisphenol A (BPA derivatives in dentistry, a fluorinated dimethacrylate monomer was synthesized to replace 2,2-bis[4-(2-hydroxy-3-methacryloy-loxypropyl-phenyl]propane (Bis-GMA as the base monomer of dental resin. After mixing with reactive diluent triethyleneglycol dimethacrylate (TEGDMA, fluorinated dimethacrylate (FDMA/TEGDMA was prepared and compared with Bis-GMA/TEGDMA in physicochemical properties, such as double bond conversion (DC, volumetric shrinkage (VS, water sorption (WS and solubility (WSL, flexural strength (FS and modulus (FM. The results showed that, when compared with Bis-GMA based resin, FDMA-based resin had several advantages, such as higher DC, lower VS, lower WS, and higher FS after water immersion. All of these revealed that FDMA had potential to be used as a substitute for Bis-GMA. Of course, many more studies, such as biocompatibility testing, should be undertaken to prove whether FDMA could be applied in clinic.
Mielikainen, Jarno; Huang, Bormin; Huang, Allen H.-L.
2015-05-01
Intel Many Integrated Core (MIC) ushers in a new era of supercomputing speed, performance, and compatibility. It allows the developers to run code at trillions of calculations per second using the familiar programming model. In this paper, we present our results of optimizing the updated Goddard shortwave radiation Weather Research and Forecasting (WRF) scheme on Intel Many Integrated Core Architecture (MIC) hardware. The Intel Xeon Phi coprocessor is the first product based on Intel MIC architecture, and it consists of up to 61 cores connected by a high performance on-die bidirectional interconnect. The co-processor supports all important Intel development tools. Thus, the development environment is familiar one to a vast number of CPU developers. Although, getting a maximum performance out of Xeon Phi will require using some novel optimization techniques. Those optimization techniques are discusses in this paper. The results show that the optimizations improved performance of the original code on Xeon Phi 7120P by a factor of 1.3x.
Experience with Intel's many integrated core architecture in ATLAS software
International Nuclear Information System (INIS)
Fleischmann, S; Neumann, M; Kama, S; Lavrijsen, W; Vitillo, R
2014-01-01
Intel recently released the first commercial boards of its Many Integrated Core (MIC) Architecture. MIC is Intel's solution for the domain of throughput computing, currently dominated by general purpose programming on graphics processors (GPGPU). MIC allows the use of the more familiar x86 programming model and supports standard technologies such as OpenMP, MPI, and Intel's Threading Building Blocks (TBB). This should make it possible to develop for both throughput and latency devices using a single code base. In ATLAS Software, track reconstruction has been shown to be a good candidate for throughput computing on GPGPU devices. In addition, the newly proposed offline parallel event-processing framework, GaudiHive, uses TBB for task scheduling. The MIC is thus, in principle, a good fit for this domain. In this paper, we report our experiences of porting to and optimizing ATLAS tracking algorithms for the MIC, comparing the programmability and relative cost/performance of the MIC against those of current GPGPUs and latency-optimized CPUs.
Synthesis of AMD3100 for antagonist of CXCR4 and labeled with 99Tcm
International Nuclear Information System (INIS)
Gui Yuan; Xu Zhihong; Zhang Xiaojun; Zhang Shuwen; Liu Jian; Tian Jiahe; Zhang Jinming
2013-01-01
Most of human tumors over-express CXCR4. AMD3100, a nonpeptide antagonist for CXCR4 receptor, can be used for therapy of those tumors. It was found that metal ion complex, such as Cu 2+ , with AMD3100 enhanced its binding affinity to the receptor 10-fold higher as compared to AMD3100 alone. AMD3100 was synthesis from 3-aminopropyl ethylene diamine. 99 Tc m -AMD3100 was labeled directly. Biodistribution studies were carried out in NH mice. SPECT imaging was performed in Hep-G2 tumor bearing mouse. The synthetic yield was 5.8% from 3-aminopropyl ethylene diamine to AMD3100. The labeling yield of 99 Tc m -AMD3100 was over 98%. Biodistribution studies showed high accumulation of radio- tracer in liver which had high-expression of CXCR4. SPECT imaging results showed that uptake in Hep-G2 tumor was high. The results showed that 99 Tc m -AMD3100 was an attractive candidate for further development of SPECT radiotracer potentially suitable for CXCR4. (authors)
Evaluation of the Intel Westmere-EX server processor
Jarp, S; Leduc, J; Nowak, A; CERN. Geneva. IT Department
2011-01-01
One year after the arrival of the Intel Xeon 7500 systems (“Nehalem-EX”), CERN openlab is presenting a set of benchmark results obtained when running on the new Xeon E7-4870 Processors, representing the “Westmere-EX” family. A modern 4-socket, 40-core system is confronted with the previous generation of expandable (“EX”) platforms, represented by a 4-socket, 32-core Intel Xeon X7560 based system – both being “top of the line” systems. Benchmarking of modern processors is a very complex affair. One has to control (at least) the following features: processor frequency, overclocking via Turbo mode, the number of physical cores in use, the use of logical cores via Symmetric MultiThreading (SMT), the cache sizes available, the configured memory topology, as well as the power configuration if throughput per watt is to be measured. As in previous activities, we have tried to do a good job of comparing like with like. In a “top of the line” comparison based on the HEPSPEC06 benchmark, the “We...
7 CFR 3100.46 - Responsibilities of the Department of Agriculture.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Responsibilities of the Department of Agriculture. 3100.46 Section 3100.46 Agriculture Regulations of the Department of Agriculture (Continued) OFFICE OF ENVIRONMENTAL QUALITY, DEPARTMENT OF AGRICULTURE CULTURAL AND ENVIRONMENTAL QUALITY Enhancement, Protection, and...
Investigating the Use of the Intel Xeon Phi for Event Reconstruction
Sherman, Keegan; Gilfoyle, Gerard
2014-09-01
The physics goal of Jefferson Lab is to understand how quarks and gluons form nuclei and it is being upgraded to a higher, 12-GeV beam energy. The new CLAS12 detector in Hall B will collect 5-10 terabytes of data per day and will require considerable computing resources. We are investigating tools, such as the Intel Xeon Phi, to speed up the event reconstruction. The Kalman Filter is one of the methods being studied. It is a linear algebra algorithm that estimates the state of a system by combining existing data and predictions of those measurements. The tools required to apply this technique (i.e. matrix multiplication, matrix inversion) are being written using C++ intrinsics for Intel's Xeon Phi Coprocessor, which uses the Many Integrated Cores (MIC) architecture. The Intel MIC is a new high-performance chip that connects to a host machine through the PCIe bus and is built to run highly vectorized and parallelized code making it a well-suited device for applications such as the Kalman Filter. Our tests of the MIC optimized algorithms needed for the filter show significant increases in speed. For example, matrix multiplication of 5x5 matrices on the MIC was able to run up to 69 times faster than the host core. The physics goal of Jefferson Lab is to understand how quarks and gluons form nuclei and it is being upgraded to a higher, 12-GeV beam energy. The new CLAS12 detector in Hall B will collect 5-10 terabytes of data per day and will require considerable computing resources. We are investigating tools, such as the Intel Xeon Phi, to speed up the event reconstruction. The Kalman Filter is one of the methods being studied. It is a linear algebra algorithm that estimates the state of a system by combining existing data and predictions of those measurements. The tools required to apply this technique (i.e. matrix multiplication, matrix inversion) are being written using C++ intrinsics for Intel's Xeon Phi Coprocessor, which uses the Many Integrated Cores (MIC
Mielikainen, Jarno; Huang, Bormin; Huang, Allen H.
2014-10-01
The Goddard cloud microphysics scheme is a sophisticated cloud microphysics scheme in the Weather Research and Forecasting (WRF) model. The WRF is a widely used weather prediction system in the world. It development is a done in collaborative around the globe. The Goddard microphysics scheme is very suitable for massively parallel computation as there are no interactions among horizontal grid points. Compared to the earlier microphysics schemes, the Goddard scheme incorporates a large number of improvements. Thus, we have optimized the code of this important part of WRF. In this paper, we present our results of optimizing the Goddard microphysics scheme on Intel Many Integrated Core Architecture (MIC) hardware. The Intel Xeon Phi coprocessor is the first product based on Intel MIC architecture, and it consists of up to 61 cores connected by a high performance on-die bidirectional interconnect. The Intel MIC is capable of executing a full operating system and entire programs rather than just kernels as the GPU do. The MIC coprocessor supports all important Intel development tools. Thus, the development environment is familiar one to a vast number of CPU developers. Although, getting a maximum performance out of MICs will require using some novel optimization techniques. Those optimization techniques are discusses in this paper. The results show that the optimizations improved performance of the original code on Xeon Phi 7120P by a factor of 4.7x. Furthermore, the same optimizations improved performance on a dual socket Intel Xeon E5-2670 system by a factor of 2.8x compared to the original code.
Using the Intel Math Kernel Library on Peregrine | High-Performance
Computing | NREL the Intel Math Kernel Library on Peregrine Using the Intel Math Kernel Library on Peregrine Learn how to use the Intel Math Kernel Library (MKL) with Peregrine system software. MKL architectures. Core math functions in MKL include BLAS, LAPACK, ScaLAPACK, sparse solvers, fast Fourier
Directory of Open Access Journals (Sweden)
Omar Yesid Flórez-Prada
2001-01-01
Full Text Available In our environment we are surrounded by a number of electronic systems that perform automatic operations according to a number of parameters previously programmed by the operator. This paper presents the prototype of a table of two coordinates (Cartesian plane (X, Y, which uses a development system based on the 8051 microcontroller INTEL (R (computer system, making the system function sending the respective control commands to locate the tool at different points of the work area of the table, the points are previously programmed by the operator, interacting with the keyboard. To make the movements of the table (X, Y, actuator devices responsible for carrying out a linear movement that moves the tool to the specified distance are used.
Mielikainen, Jarno; Huang, Bormin; Huang, Allen H.
2015-10-01
Next-generation mesoscale numerical weather prediction system, the Weather Research and Forecasting (WRF) model, is a designed for dual use for forecasting and research. WRF offers multiple physics options that can be combined in any way. One of the physics options is radiance computation. The major source for energy for the earth's climate is solar radiation. Thus, it is imperative to accurately model horizontal and vertical distribution of the heating. Goddard solar radiative transfer model includes the absorption duo to water vapor,ozone, ozygen, carbon dioxide, clouds and aerosols. The model computes the interactions among the absorption and scattering by clouds, aerosols, molecules and surface. Finally, fluxes are integrated over the entire longwave spectrum.In this paper, we present our results of optimizing the Goddard longwave radiative transfer scheme on Intel Many Integrated Core Architecture (MIC) hardware. The Intel Xeon Phi coprocessor is the first product based on Intel MIC architecture, and it consists of up to 61 cores connected by a high performance on-die bidirectional interconnect. The coprocessor supports all important Intel development tools. Thus, the development environment is familiar one to a vast number of CPU developers. Although, getting a maximum performance out of MICs will require using some novel optimization techniques. Those optimization techniques are discusses in this paper. The optimizations improved the performance of the original Goddard longwave radiative transfer scheme on Xeon Phi 7120P by a factor of 2.2x. Furthermore, the same optimizations improved the performance of the Goddard longwave radiative transfer scheme on a dual socket configuration of eight core Intel Xeon E5-2670 CPUs by a factor of 2.1x compared to the original Goddard longwave radiative transfer scheme code.
GMA200 ATEGG Digital Controls Demonstration.
1979-10-01
radial and axial loads into the air inlet housing and forward frame. c. Combustor/Diffuser The GMA200 combustor/diffuser section consists of an annular...transition flow path of a turbofan engine. 6 IT U’~ --sa b. Compressor A six-stage axial flow compressor assembly consists of subassemblies of the...savings in the highly loaded , high speed unit. The blade is cooled by the application of a variety of cooling techniques including a film-cooled leading
Comparative VME Performance Tests for MEN A20 Intel-L865 and RIO-3 PPC-LynxOS platforms
Andersen, M; CERN. Geneva. BE Department
2009-01-01
This benchmark note presents test results from reading values over VME using different methods and different sizes of data registers, running on two different platforms Intel-L865 and PPC-LynxOS. We find that the PowerPC is a factor 3 faster in accessing an array of contiguous VME memory locations. Block transfer and DMA read accesses are also tested and compared with conventional single access reads.
CERN welcomes Intel Science Fair winners
Katarina Anthony
2012-01-01
This June, CERN welcomed twelve gifted young scientists aged 15-18 for a week-long visit of the Laboratory. These talented students were the winners of a special award co-funded by CERN and Intel, given yearly at the Intel International Science and Engineering Fair (ISEF). The CERN award winners at the Intel ISEF 2012 Special Awards Ceremony. © Society for Science & the Public (SSP). The CERN award was set up back in 2009 as an opportunity to bring some of the best and brightest young minds to the Laboratory. The award winners are selected from among 1,500 talented students participating in ISEF – the world's largest pre-university science competition, in which students compete for more than €3 million in awards. “CERN gave an award – which was obviously this trip – to students studying physics, maths, electrical engineering and computer science,” says Benjamin Craig Bartlett, 17, from South Carolina, USA, wh...
47 CFR 32.3100 - Accumulated depreciation.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Accumulated depreciation. 32.3100 Section 32... Accumulated depreciation. (a) This account shall include the accumulated depreciation associated with the... with depreciation amounts concurrently charged to Account 6561, Depreciation expense—telecommunications...
Sproll, Véronique; Schmidt, Thomas J.; Gubler, Lorenz
2018-03-01
The aim of this work was to investigate how hygroscopic moieties like hydrolyzed glycidyl methacrylate (GMA) influence the properties of sulfonated polysytrene based proton exchange membranes (PEM). Therefore, several membranes were synthesized by electron beam treatment of the ETFE (ethylene-alt-tetrafluoroethylene) base film with a subsequent co-grafting of styrene and GMA at different ratios. The obtained membranes were sulfonated to introduce proton conducting groups and the epoxide moiety of the GMA unit was hydrolyzed for a better water absorption. The PEM was investigated regarding its structural composition, water uptake and through-plane conductivity. It could be shown that the density of sulfonic acid groups has a higher influence on the proton conductivity of the PEM than an increased water uptake.
Reversible adsorption of catalase onto Fe(3+) chelated poly(AAm-GMA)-IDA cryogels.
Aktaş Uygun, Deniz; Uygun, Murat; Akgöl, Sinan; Denizli, Adil
2015-05-01
In this presented study, poly(acrylamide-glycidyl methacrylate) [poly(AAm-GMA)] cryogels were synthesized by cryopolymerization technique at sub-zero temperature. Prepared cryogels were then functionalized with iminodiacetic acid (IDA) and chelated with Fe(3+) ions in order produce the metal chelate affinity matrix. Synthesized cryogels were characterized with FTIR, ESEM and EDX analysis, and it was found that the cryogel had sponge like structure with interconnected pores and their pore diameter was about 200 μm. Fe(3+) chelated poly(AAm-GMA)-IDA cryogels were used for the adsorption of catalase and optimum adsorption conditions were determined by varying the medium pH, initial catalase concentration, temperature and ionic strength. Maximum catalase adsorption onto Fe(3+) chelated poly(AAm-GMA)-IDA cryogel was found to be 12.99 mg/g cryogel at 25 °C, by using pH 5.0 acetate buffer. Adsorbed catalase was removed from the cryogel by using 1.0M of NaCl solution and desorption yield was found to be 96%. Additionally, reusability profile of the Fe(3+) chelated poly(AAm-GMA)-IDA cryogel was also investigated and it was found that, adsorption capacity of the cryogels didn't decrease significantly at the end of the 40 reuses. Catalase activity studies were also tested and it was demonstrated that desorbed catalase retained 70% of its initial activity. Copyright © 2015 Elsevier B.V. All rights reserved.
Özden-Yenigün, Elif; Menceloğlu, Yusuf Z; Papila, Melih
2012-02-01
Strengthened nanofiber-reinforced epoxy matrix composites are demonstrated by engineering composite electrospun fibers of multi-walled carbon nanotubes (MWCNTs) and reactive P(St-co-GMA). MWCNTs are incorporated into surface-modified, reactive P(St-co-GMA) nanofibers by electrospinning; functionalization of these MWCNT/P(St-co-GMA) composite nanofibers with epoxide moieties facilitates bonding at the interface of the cross-linked fibers and the epoxy matrix, effectively reinforcing and toughening the epoxy resin. Rheological properties are determined and thermodynamic stabilization is demonstrated for MWCNTs in the P(St-co-GMA)-DMF polymer solution. Homogeneity and uniformity of the fiber formation within the electrospun mats are achieved at polymer concentration of 30 wt %. Results show that the MWCNT fraction decreases the polymer solution viscosity, yielding a narrower fiber diameter. The fiber diameter drops from an average of 630 nm to 460 nm, as the MWCNTs wt fraction (1, 1.5, and 2%) is increased. The electrospun nanofibers of the MWCNTs/P(St-co-GMA) composite are also embedded into an epoxy resin to investigate their reinforcing abilities. A significant increase in the mechanical response is observed, up to >20% in flexural modulus, when compared to neat epoxy, despite a very low composite fiber weight fraction (at about 0.2% by a single-layer fibrous mat). The increase is attributed to the combined effect of the two factors the inherent strength of the well-dispersed MWCNTs and the surface chemistry of the electrospun fibers that have been modified with epoxide to enable cross-linking between the polymer matrix and the nanofibers.
2015-12-10
Laboratory (Ret.), private communication. 33. S. Kou, Welding Metallurgy , 2nd Ed., John Wiley & Sons, Inc., 2003. DOI: 10.1002/0471434027. 34. J. K...Naval Research Laboratory Washington, DC 20375-5320 NRL/MR/6390--15-9665 Temperature Histories of Structural Steel Laser and Hybrid Laser-GMA Welds ...NUMBER OF PAGES 17. LIMITATION OF ABSTRACT Temperature Histories of Structural Steel Laser and Hybrid Laser-GMA Welds Calculated Using Multiple
Evaluation of the Intel Nehalem-EX server processor
Jarp, S; Leduc, J; Nowak, A; CERN. Geneva. IT Department
2010-01-01
In this paper we report on a set of benchmark results recently obtained by the CERN openlab by comparing the 4-socket, 32-core Intel Xeon X7560 server with the previous generation 4-socket server, based on the Xeon X7460 processor. The Xeon X7560 processor represents a major change in many respects, especially the memory sub-system, so it was important to make multiple comparisons. In most benchmarks the two 4-socket servers were compared. It should be underlined that both servers represent the “top of the line” in terms of frequency. However, in some cases, it was important to compare systems that integrated the latest processor features, such as QPI links, Symmetric multithreading and over-clocking via Turbo mode, and in such situations the X7560 server was compared to a dual socket L5520 based system with an identical frequency of 2.26 GHz. Before summarizing the results we must stress the fact that benchmarking of modern processors is a very complex affair. One has to control (at least) the following ...
Performance of Artificial Intelligence Workloads on the Intel Core 2 Duo Series Desktop Processors
Abdul Kareem PARCHUR; Kuppangari Krishna RAO; Fazal NOORBASHA; Ram Asaray SINGH
2010-01-01
As the processor architecture becomes more advanced, Intel introduced its Intel Core 2 Duo series processors. Performance impact on Intel Core 2 Duo processors are analyzed using SPEC CPU INT 2006 performance numbers. This paper studied the behavior of Artificial Intelligence (AI) benchmarks on Intel Core 2 Duo series processors. Moreover, we estimated the task completion time (TCT) @1 GHz, @2 GHz and @3 GHz Intel Core 2 Duo series processors frequency. Our results show the performance scalab...
40 CFR 721.3100 - Oligomeric silicic acid ester compound with a hy-droxyl-al-kyla-mine.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Oligomeric silicic acid ester compound with a hy-droxyl-al-kyla-mine. 721.3100 Section 721.3100 Protection of Environment ENVIRONMENTAL... Significant New Uses for Specific Chemical Substances § 721.3100 Oligomeric silicic acid ester compound with a...
[99mTc]O2-AMD3100 as a SPECT tracer for CXCR4 receptor imaging
International Nuclear Information System (INIS)
Hartimath, Siddesh V.; Domanska, Urszula M.; Walenkamp, Annemiek M.E.; Dierckx, Rudi A.J.O.; Vries, Erik F.J. de
2013-01-01
Purpose: CXCR4 plays an important role in HIV infection, tumor progression, neurogenesis, and inflammation. In-vivo imaging of CXCR4 could provide more insight in the role of this receptor in health and disease. The aim of this study was to investigate [ 99m Tc]O 2 -AMD3100 as a potential SPECT tracer for imaging of CXCR4. Method: AMD3100 was labelled with [ 99m Tc]pertechnetate. A cysteine challenge assay was performed to test the tracer stability. Heterologous and homologous receptor binding assay and internalization assay were performed in CXCR4 expressing Jurkat-T cells. Ex vivo biodistribution was studied in healthy mice at 30, 60, and 120 min after tracer injection. Tumor uptake of the tracer was determined by microSPECT imaging in nude mice xenografted with human PC-3 prostate tumor. Specificity of tracer uptake was determined by blocking studies using an excess of unlabelled AMD3100. Results: AMD3100 was labelled with technetium-99 m with a radiochemical yield of > 98%. The tracer was stable in PBS and mouse plasma for at least 6 h at 37 °C. Heterologous and homologous binding assays with AMD3100 showed IC 50 values of 240 ± 10 μM, and 92 ± 5 μM for [ 125 I]SDF-1α and [ 99m Tc]O 2 -AMD3100 respectively, with negligible receptor internalisation. The tracer showed high uptake in liver, lungs, spleen, thymus, intestine and bone. Blocking dose of AMD3100.8HCl (20 mg/kg) decreased the uptake in these organs (p 99m Tc]O 2 -AMD3100 showed specific tumor accumulation in mice bearing PC-3 xenografts model. Time activity curves (TAC) in AMD3100 pre-treated animals tracer showed 1.7 times less tumor uptake as compared to control animals (p 99m Tc]O 2 -AMD3100 is readily labelled, is stable in plasma and displays a favourable binding affinity for the CXCR4 receptors. [ 99m Tc O 2 -AMD3100 shows specific binding in organs with high CXCR4 expression and in CXCR4 positive tumors. These results justify further evaluation of this radiopharmaceutical as a potential
Theorem Proving in Intel Hardware Design
O'Leary, John
2009-01-01
For the past decade, a framework combining model checking (symbolic trajectory evaluation) and higher-order logic theorem proving has been in production use at Intel. Our tools and methodology have been used to formally verify execution cluster functionality (including floating-point operations) for a number of Intel products, including the Pentium(Registered TradeMark)4 and Core(TradeMark)i7 processors. Hardware verification in 2009 is much more challenging than it was in 1999 - today s CPU chip designs contain many processor cores and significant firmware content. This talk will attempt to distill the lessons learned over the past ten years, discuss how they apply to today s problems, outline some future directions.
Adaptation of MPDATA Heterogeneous Stencil Computation to Intel Xeon Phi Coprocessor
Directory of Open Access Journals (Sweden)
Lukasz Szustak
2015-01-01
Full Text Available The multidimensional positive definite advection transport algorithm (MPDATA belongs to the group of nonoscillatory forward-in-time algorithms and performs a sequence of stencil computations. MPDATA is one of the major parts of the dynamic core of the EULAG geophysical model. In this work, we outline an approach to adaptation of the 3D MPDATA algorithm to the Intel MIC architecture. In order to utilize available computing resources, we propose the (3 + 1D decomposition of MPDATA heterogeneous stencil computations. This approach is based on combination of the loop tiling and fusion techniques. It allows us to ease memory/communication bounds and better exploit the theoretical floating point efficiency of target computing platforms. An important method of improving the efficiency of the (3 + 1D decomposition is partitioning of available cores/threads into work teams. It permits for reducing inter-cache communication overheads. This method also increases opportunities for the efficient distribution of MPDATA computation onto available resources of the Intel MIC architecture, as well as Intel CPUs. We discuss preliminary performance results obtained on two hybrid platforms, containing two CPUs and Intel Xeon Phi. The top-of-the-line Intel Xeon Phi 7120P gives the best performance results, and executes MPDATA almost 2 times faster than two Intel Xeon E5-2697v2 CPUs.
Application of Intel Many Integrated Core (MIC) accelerators to the Pleim-Xiu land surface scheme
Huang, Melin; Huang, Bormin; Huang, Allen H.
2015-10-01
The land-surface model (LSM) is one physics process in the weather research and forecast (WRF) model. The LSM includes atmospheric information from the surface layer scheme, radiative forcing from the radiation scheme, and precipitation forcing from the microphysics and convective schemes, together with internal information on the land's state variables and land-surface properties. The LSM is to provide heat and moisture fluxes over land points and sea-ice points. The Pleim-Xiu (PX) scheme is one LSM. The PX LSM features three pathways for moisture fluxes: evapotranspiration, soil evaporation, and evaporation from wet canopies. To accelerate the computation process of this scheme, we employ Intel Xeon Phi Many Integrated Core (MIC) Architecture as it is a multiprocessor computer structure with merits of efficient parallelization and vectorization essentials. Our results show that the MIC-based optimization of this scheme running on Xeon Phi coprocessor 7120P improves the performance by 2.3x and 11.7x as compared to the original code respectively running on one CPU socket (eight cores) and on one CPU core with Intel Xeon E5-2670.
21 CFR 886.3100 - Ophthalmic tantalum clip.
2010-04-01
... blood vessels in the eye. (b) Classification. Class II (special controls). The device is exempt from the...) MEDICAL DEVICES OPHTHALMIC DEVICES Prosthetic Devices § 886.3100 Ophthalmic tantalum clip. (a) Identification. An ophthalmic tantalum clip is a malleable metallic device intended to be implanted permanently...
Gao, Baojiao; Lei, Haibo; Jiang, Liding; Zhu, Yong
2007-06-15
Crosslinking copolymer microbeads with a diameter range of 100-150 microm were synthesized by suspension copolymerization of glycidyl methacrylate (GMA), acrylamide (AM) and N,N'-methylene bisacrylamide (MBA). Subsequently, polyethyleneimine (PEI) was grafted on the surfaces of the terpolymer microbeads GMA/AM/MBA via the ring-opening reaction of the epoxy groups, and the grafting microbeads PEI-GMA/AM/MBA were prepared. In this paper, the adsorption property of the grafting microbeads for bilirubin was mainly investigated, and the effects of various factors, such as pH value, ionic strength and grafting degree of PEI on the surface of grafting microbeads and the adsorption capacity of the grafting microbeads for bilirubin were examined. The batch adsorption experiment results show that by right of the action of grafted polyamine macromolecules PEI, the grafting microbeads PEI-GMA/AM/MBA have quite strong adsorption ability for bilirubin; the isotherm adsorption conforms to Freundlich equation. The pH value of the medium affects the adsorption capacity greatly, As in the nearly neutral solutions with pH 6, the grafting microbeads have the strongest adsorption ability for bilirubin, whereas in acidic and basic solutions their adsorption ability is weak. The ionic strength hardly affects the adsorption ability of the grafting microbeads. The grafting degree of PEI on the surfaces of the grafting microbeads also has a great effect on the adsorption capacity, and higher the grafting degree of PEI on the surface of the microbead PEI-GMA/AM/MBA, the stronger is the adsorption ability of the microbeads.
MILC staggered conjugate gradient performance on Intel KNL
DeTar, Carleton; Doerfler, Douglas; Gottlieb, Steven; Jha, Ashish; Kalamkar, Dhiraj; Li, Ruizi; Toussaint, Doug
2016-01-01
We review our work done to optimize the staggered conjugate gradient (CG) algorithm in the MILC code for use with the Intel Knights Landing (KNL) architecture. KNL is the second gener- ation Intel Xeon Phi processor. It is capable of massive thread parallelism, data parallelism, and high on-board memory bandwidth and is being adopted in supercomputing centers for scientific research. The CG solver consumes the majority of time in production running, so we have spent most of our effort on it. ...
Huang, Melin; Huang, Bormin; Huang, Allen H.-L.
2015-10-01
The schemes of cumulus parameterization are responsible for the sub-grid-scale effects of convective and/or shallow clouds, and intended to represent vertical fluxes due to unresolved updrafts and downdrafts and compensating motion outside the clouds. Some schemes additionally provide cloud and precipitation field tendencies in the convective column, and momentum tendencies due to convective transport of momentum. The schemes all provide the convective component of surface rainfall. Betts-Miller-Janjic (BMJ) is one scheme to fulfill such purposes in the weather research and forecast (WRF) model. National Centers for Environmental Prediction (NCEP) has tried to optimize the BMJ scheme for operational application. As there are no interactions among horizontal grid points, this scheme is very suitable for parallel computation. With the advantage of Intel Xeon Phi Many Integrated Core (MIC) architecture, efficient parallelization and vectorization essentials, it allows us to optimize the BMJ scheme. If compared to the original code respectively running on one CPU socket (eight cores) and on one CPU core with Intel Xeon E5-2670, the MIC-based optimization of this scheme running on Xeon Phi coprocessor 7120P improves the performance by 2.4x and 17.0x, respectively.
Structure and properties of GMA surfaced armour plates
A. Klimpel; K. Luksa; M. Burda
2010-01-01
Purpose: In the combat vehicles many materials can be used for the armour. Application of the monolithic armour plates in light combat vehicles is limited by the high armour weigh. Introduction of the layered armour plates is a way to limit the vehicle weight. In the paper test results of graded and nanostructural GMA surfaced armour plates are presented.Design/methodology/approach: Metallographic structure, chemical composition and hardness of surfaced layers were investigated in order to ex...
Energy Technology Data Exchange (ETDEWEB)
Koskela, Tuomas S.; Lobet, Mathieu; Deslippe, Jack; Matveev, Zakhar
2017-05-23
In this session we show, in two case studies, how the roofline feature of Intel Advisor has been utilized to optimize the performance of kernels of the XGC1 and PICSAR codes in preparation for Intel Knights Landing architecture. The impact of the implemented optimizations and the benefits of using the automatic roofline feature of Intel Advisor to study performance of large applications will be presented. This demonstrates an effective optimization strategy that has enabled these science applications to achieve up to 4.6 times speed-up and prepare for future exascale architectures. # Goal/Relevance of Session The roofline model [1,2] is a powerful tool for analyzing the performance of applications with respect to the theoretical peak achievable on a given computer architecture. It allows one to graphically represent the performance of an application in terms of operational intensity, i.e. the ratio of flops performed and bytes moved from memory in order to guide optimization efforts. Given the scale and complexity of modern science applications, it can often be a tedious task for the user to perform the analysis on the level of functions or loops to identify where performance gains can be made. With new Intel tools, it is now possible to automate this task, as well as base the estimates of peak performance on measurements rather than vendor specifications. The goal of this session is to demonstrate how the roofline feature of Intel Advisor can be used to balance memory vs. computation related optimization efforts and effectively identify performance bottlenecks. A series of typical optimization techniques: cache blocking, structure refactoring, data alignment, and vectorization illustrated by the kernel cases will be addressed. # Description of the codes ## XGC1 The XGC1 code [3] is a magnetic fusion Particle-In-Cell code that uses an unstructured mesh for its Poisson solver that allows it to accurately resolve the edge plasma of a magnetic fusion device. After
Destructive Testing of an ES-3100 Shipping Container at the Savannah River National Laboratory
Energy Technology Data Exchange (ETDEWEB)
Loftin, B. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Abramczyk, G. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2015-06-09
Destructive testing of an ES-3100 Shipping Container was completed by the Packaging Technology and Pressurized Systems organization within the Savannah River National Laboratory in order to qualify the ES-3100 as a candidate storage and transport package for applications at various facilities at the Savannah River Site. The testing consisted of the detonation of three explosive charges at separate locations on a single ES-3100. The locations for the placement were chosen based the design of the ES-3100 as well as the most likely places for the package to incur damage as a result of the detonation. The testing was completed at an offsite location, which raised challenges as well as allowed for development of new partnerships for this testing and for potential future testing. The results of the testing, the methods used to complete the testing, and similar, potential future work will be discussed.
Performance of Artificial Intelligence Workloads on the Intel Core 2 Duo Series Desktop Processors
Directory of Open Access Journals (Sweden)
Abdul Kareem PARCHUR
2010-12-01
Full Text Available As the processor architecture becomes more advanced, Intel introduced its Intel Core 2 Duo series processors. Performance impact on Intel Core 2 Duo processors are analyzed using SPEC CPU INT 2006 performance numbers. This paper studied the behavior of Artificial Intelligence (AI benchmarks on Intel Core 2 Duo series processors. Moreover, we estimated the task completion time (TCT @1 GHz, @2 GHz and @3 GHz Intel Core 2 Duo series processors frequency. Our results show the performance scalability in Intel Core 2 Duo series processors. Even though AI benchmarks have similar execution time, they have dissimilar characteristics which are identified using principal component analysis and dendogram. As the processor frequency increased from 1.8 GHz to 3.167 GHz the execution time is decreased by ~370 sec for AI workloads. In the case of Physics/Quantum Computing programs it was ~940 sec.
Parallelization of particle transport using Intel® TBB
International Nuclear Information System (INIS)
Apostolakis, J; Brun, R; Carminati, F; Gheata, A; Wenzel, S; Belogurov, S; Ovcharenko, E
2014-01-01
One of the current challenges in HEP computing is the development of particle propagation algorithms capable of efficiently use all performance aspects of modern computing devices. The Geant-Vector project at CERN has recently introduced an approach in this direction. This paper describes the implementation of a similar workflow using the Intel(r) Threading Building Blocks (Intel(r) TBB) library. This approach is intended to overcome the potential bottleneck of having a single dispatcher on many-core architectures and to result in better scalability compared to the initial pthreads-based version.
Performance of a plasma fluid code on the Intel parallel computers
International Nuclear Information System (INIS)
Lynch, V.E.; Carreras, B.A.; Drake, J.B.; Leboeuf, J.N.; Liewer, P.
1992-01-01
One approach to improving the real-time efficiency of plasma turbulence calculations is to use a parallel algorithm. A parallel algorithm for plasma turbulence calculations was tested on the Intel iPSC/860 hypercube and the Touchtone Delta machine. Using the 128 processors of the Intel iPSC/860 hypercube, a factor of 5 improvement over a single-processor CRAY-2 is obtained. For the Touchtone Delta machine, the corresponding improvement factor is 16. For plasma edge turbulence calculations, an extrapolation of the present results to the Intel σ machine gives an improvement factor close to 64 over the single-processor CRAY-2
Performance of a plasma fluid code on the Intel parallel computers
Lynch, V. E.; Carreras, B. A.; Drake, J. B.; Leboeuf, J. N.; Liewer, P.
1992-01-01
One approach to improving the real-time efficiency of plasma turbulence calculations is to use a parallel algorithm. A parallel algorithm for plasma turbulence calculations was tested on the Intel iPSC/860 hypercube and the Touchtone Delta machine. Using the 128 processors of the Intel iPSC/860 hypercube, a factor of 5 improvement over a single-processor CRAY-2 is obtained. For the Touchtone Delta machine, the corresponding improvement factor is 16. For plasma edge turbulence calculations, an extrapolation of the present results to the Intel (sigma) machine gives an improvement factor close to 64 over the single-processor CRAY-2.
Multi-Kepler GPU vs. multi-Intel MIC for spin systems simulations
Bernaschi, M.; Bisson, M.; Salvadore, F.
2014-10-01
We present and compare the performances of two many-core architectures: the Nvidia Kepler and the Intel MIC both in a single system and in cluster configuration for the simulation of spin systems. As a benchmark we consider the time required to update a single spin of the 3D Heisenberg spin glass model by using the Over-relaxation algorithm. We present data also for a traditional high-end multi-core architecture: the Intel Sandy Bridge. The results show that although on the two Intel architectures it is possible to use basically the same code, the performances of a Intel MIC change dramatically depending on (apparently) minor details. Another issue is that to obtain a reasonable scalability with the Intel Phi coprocessor (Phi is the coprocessor that implements the MIC architecture) in a cluster configuration it is necessary to use the so-called offload mode which reduces the performances of the single system. As to the GPU, the Kepler architecture offers a clear advantage with respect to the previous Fermi architecture maintaining exactly the same source code. Scalability of the multi-GPU implementation remains very good by using the CPU as a communication co-processor of the GPU. All source codes are provided for inspection and for double-checking the results.
Performance of a plasma fluid code on the Intel parallel computers
International Nuclear Information System (INIS)
Lynch, V.E.; Carreras, B.A.; Drake, J.B.; Leboeuf, J.N.; Liewer, P.
1992-01-01
One approach to improving the real-time efficiency of plasma turbulence calculations is to use a parallel algorithm. A parallel algorithm for plasma turbulence calculations was tested on the Intel iPSC/860 hypercube and the Touchtone Delta machine. Using the 128 processors of the Intel iPSC/860 hypercube, a factor of 5 improvement over a single-processor CRAY-2 is obtained. For the Touchtone Delta machine, the corresponding improvement factor is 16. For plasma edge turbulence calculations, an extrapolation of the present results to the Intel (sigma) machine gives an improvement factor close to 64 over the single-processor CRAY-2. 12 refs
Huang, Melin; Huang, Bormin; Huang, Allen H.
2014-10-01
For weather forecasting and research, the Weather Research and Forecasting (WRF) model has been developed, consisting of several components such as dynamic solvers and physical simulation modules. WRF includes several Land- Surface Models (LSMs). The LSMs use atmospheric information, the radiative and precipitation forcing from the surface layer scheme, the radiation scheme, and the microphysics/convective scheme all together with the land's state variables and land-surface properties, to provide heat and moisture fluxes over land and sea-ice points. The WRF 5-layer thermal diffusion simulation is an LSM based on the MM5 5-layer soil temperature model with an energy budget that includes radiation, sensible, and latent heat flux. The WRF LSMs are very suitable for massively parallel computation as there are no interactions among horizontal grid points. The features, efficient parallelization and vectorization essentials, of Intel Many Integrated Core (MIC) architecture allow us to optimize this WRF 5-layer thermal diffusion scheme. In this work, we present the results of the computing performance on this scheme with Intel MIC architecture. Our results show that the MIC-based optimization improved the performance of the first version of multi-threaded code on Xeon Phi 5110P by a factor of 2.1x. Accordingly, the same CPU-based optimizations improved the performance on Intel Xeon E5- 2603 by a factor of 1.6x as compared to the first version of multi-threaded code.
Analysis OpenMP performance of AMD and Intel architecture for breaking waves simulation using MPS
Alamsyah, M. N. A.; Utomo, A.; Gunawan, P. H.
2018-03-01
Simulation of breaking waves by using Navier-Stokes equation via moving particle semi-implicit method (MPS) over close domain is given. The results show the parallel computing on multicore architecture using OpenMP platform can reduce the computational time almost half of the serial time. Here, the comparison using two computer architectures (AMD and Intel) are performed. The results using Intel architecture is shown better than AMD architecture in CPU time. However, in efficiency, the computer with AMD architecture gives slightly higher than the Intel. For the simulation by 1512 number of particles, the CPU time using Intel and AMD are 12662.47 and 28282.30 respectively. Moreover, the efficiency using similar number of particles, AMD obtains 50.09 % and Intel up to 49.42 %.
Efficient Implementation of Many-body Quantum Chemical Methods on the Intel Xeon Phi Coprocessor
Energy Technology Data Exchange (ETDEWEB)
Apra, Edoardo; Klemm, Michael; Kowalski, Karol
2014-12-01
This paper presents the implementation and performance of the highly accurate CCSD(T) quantum chemistry method on the Intel Xeon Phi coprocessor within the context of the NWChem computational chemistry package. The widespread use of highly correlated methods in electronic structure calculations is contingent upon the interplay between advances in theory and the possibility of utilizing the ever-growing computer power of emerging heterogeneous architectures. We discuss the design decisions of our implementation as well as the optimizations applied to the compute kernels and data transfers between host and coprocessor. We show the feasibility of adopting the Intel Many Integrated Core Architecture and the Intel Xeon Phi coprocessor for developing efficient computational chemistry modeling tools. Remarkable scalability is demonstrated by benchmarks. Our solution scales up to a total of 62560 cores with the concurrent utilization of Intel Xeon processors and Intel Xeon Phi coprocessors.
Intel Corporation osaleb Eesti koolitusprogrammis / Raivo Juurak
Juurak, Raivo, 1949-
2001-01-01
Haridusministeeriumis tutvustati infotehnoloogiaalast koolitusprogrammi, milles osaleb maailma suuremaid arvutifirmasid Intel Corporation. Koolituskursuse käigus õpetatakse aineõpetajaid oma ainetundides interneti võimalusi kasutama. 50-tunnised kursused viiakse läbi kõigis maakondades
Mielikainen, Jarno; Huang, Bormin; Huang, Allen H.
2014-10-01
Purdue-Lin scheme is a relatively sophisticated microphysics scheme in the Weather Research and Forecasting (WRF) model. The scheme includes six classes of hydro meteors: water vapor, cloud water, raid, cloud ice, snow and graupel. The scheme is very suitable for massively parallel computation as there are no interactions among horizontal grid points. In this paper, we accelerate the Purdue Lin scheme using Intel Many Integrated Core Architecture (MIC) hardware. The Intel Xeon Phi is a high performance coprocessor consists of up to 61 cores. The Xeon Phi is connected to a CPU via the PCI Express (PICe) bus. In this paper, we will discuss in detail the code optimization issues encountered while tuning the Purdue-Lin microphysics Fortran code for Xeon Phi. In particularly, getting a good performance required utilizing multiple cores, the wide vector operations and make efficient use of memory. The results show that the optimizations improved performance of the original code on Xeon Phi 5110P by a factor of 4.2x. Furthermore, the same optimizations improved performance on Intel Xeon E5-2603 CPU by a factor of 1.2x compared to the original code.
International Nuclear Information System (INIS)
Mironov, Vladimir; Moskovsky, Alexander; D’Mello, Michael; Alexeev, Yuri
2017-01-01
The Hartree-Fock (HF) method in the quantum chemistry package GAMESS represents one of the most irregular algorithms in computation today. Major steps in the calculation are the irregular computation of electron repulsion integrals (ERIs) and the building of the Fock matrix. These are the central components of the main Self Consistent Field (SCF) loop, the key hotspot in Electronic Structure (ES) codes. By threading the MPI ranks in the official release of the GAMESS code, we not only speed up the main SCF loop (4x to 6x for large systems), but also achieve a significant (>2x) reduction in the overall memory footprint. These improvements are a direct consequence of memory access optimizations within the MPI ranks. We benchmark our implementation against the official release of the GAMESS code on the Intel R Xeon PhiTM supercomputer. Here, scaling numbers are reported on up to 7,680 cores on Intel Xeon Phi coprocessors.
2010-04-23
... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-73,642] Intel Corporation, Fab 20... of Intel Corporation, Fab 20 Division, including on-site leased workers of Volt Technical Resources... Precision, Inc. were employed on-site at the Hillsboro, Oregon location of Intel Corporation, Fab 20...
International Nuclear Information System (INIS)
Pronyaev, V.G.
2003-01-01
Data fitting with GMA and GLUCS gives consistent results. Difference in the evaluated central values obtained with different formalisms can be related to the general accuracy with which fits could be done in different formalisms. It has stochastic nature and should be accounted in the final results of the data evaluation as small SERC uncertainty. Some shift in central values of data evaluated with GLUCS and GMA relative the central values evaluated with the R-matrix model code RAC is observed for cases of fitting strongly varying data and is related to the PPP. The procedure of evaluation, free from PPP, should be elaborated. (author)
Directory of Open Access Journals (Sweden)
Weih, Markus
2013-05-01
Full Text Available [english] The German graduate medical education system is going through an important phase of changes. Besides the ongoing reform of the national guidelines for graduate medical education (Musterweiterbildungsordnung, other factors like societal and demographic changes, health and research policy reforms also play a central role for the future and competitiveness of graduate medical education.With this position paper, the committee on graduate medical education of the Society for Medical Education (GMA would like to point out some central questions for this process and support the current discourse.As an interprofessional and interdisciplinary scientific society, the GMA has the resources to contribute in a meaningful way to an evidence-based and future-oriented graduate medical education strategy.In this position paper, we use four key questions with regards to educational goals, quality assurance, teaching competence and policy requirements to address the core issues for the future of graduate medical education in Germany. The GMA sees its task in contributing to the necessary reform processes as the only German speaking scientific society in the field of medical education.[german] Die ärztliche Weiterbildung in Deutschland befindet sich im Umbruch. Neben der aktuellen Reform der Musterweiterbildungsordnung spielen gesellschaftliche, demographische, gesundheits- und forschungspolitische Faktoren eine wichtige Rolle für die Zukunft und Konkurrenzfähigkeit der ärztlichen Weiterbildung.Der Ausschuss für Weiterbildung der Gesellschaft für Medizinische Ausbildung (GMA möchte mit diesem Positionspapier auf zentrale Fragen in diesem Prozess aufmerksam machen und Impulse für den aktuellen Diskurs geben.Dabei kann die GMA als interdisziplinäre und interprofessionelle Fachgesellschaft wichtige Beiträge zu einer evidenzbasierten und zukunftsorientierten Weiterbildungsstrategie liefern.Im vorliegenden Papier werden anhand von vier Leitfragen zu
Directory of Open Access Journals (Sweden)
Ayub Irmadani Anwar
2016-06-01
Full Text Available Pit and fissure sealant applications is one way to prevent caries. One of the effective ingredient as a pit and fissure sealant is a Bis-GMA resin. One of the active components of Bis-GMA resin is sodium fluoride, which is capable of releasing fluoride ions to the tooth surface and able to improve the repair and remineralization process through the replacement of calcium and phosphate ions found in saliva to increase the pH of saliva. This study was to determine the effect of pit and fissure sealant applications made from Bis-GMA resin to pH of saliva in children aged 6-12 years. The study design is pre and post test with control group design. Saliva samples were derived from 15 pediatric patients has met the criteria. The pH of saliva were taken before and after the application of pit and fissure sealant made from Bis-GMA and measured with pH meter. This study used a non-parametric test, the Wilcoxon Signed Rank test. The results of this study are also supported by the results of statistical tests showed p-: 0.005 (p<0.05 value, which means that there are significant differences in pH of saliva before and after the application of pit and fissure sealant made from Bis-GMA resin.
Optimizing zonal advection of the Advanced Research WRF (ARW) dynamics for Intel MIC
Mielikainen, Jarno; Huang, Bormin; Huang, Allen H.
2014-10-01
The Weather Research and Forecast (WRF) model is the most widely used community weather forecast and research model in the world. There are two distinct varieties of WRF. The Advanced Research WRF (ARW) is an experimental, advanced research version featuring very high resolution. The WRF Nonhydrostatic Mesoscale Model (WRF-NMM) has been designed for forecasting operations. WRF consists of dynamics code and several physics modules. The WRF-ARW core is based on an Eulerian solver for the fully compressible nonhydrostatic equations. In the paper, we will use Intel Intel Many Integrated Core (MIC) architecture to substantially increase the performance of a zonal advection subroutine for optimization. It is of the most time consuming routines in the ARW dynamics core. Advection advances the explicit perturbation horizontal momentum equations by adding in the large-timestep tendency along with the small timestep pressure gradient tendency. We will describe the challenges we met during the development of a high-speed dynamics code subroutine for MIC architecture. Furthermore, lessons learned from the code optimization process will be discussed. The results show that the optimizations improved performance of the original code on Xeon Phi 5110P by a factor of 2.4x.
An INTEL 8080 microprocessor development system
International Nuclear Information System (INIS)
Horne, P.J.
1977-01-01
The INTEL 8080 has become one of the two most widely used microprocessors at CERN, the other being the MOTOROLA 6800. Even thouth this is the case, there have been, to date, only rudimentary facilities available for aiding the development of application programs for this microprocessor. An ideal development system is one which has a sophisticated editing and filing system, an assembler/compiler, and access to the microprocessor application. In many instances access to a PROM programmer is also required, as the application may utilize only PROMs for program storage. With these thoughts in mind, an INTEL 8080 microprocessor development system was implemented in the Proton Synchrotron (PS) Division. This system utilizes a PDP 11/45 as the editing and file-handling machine, and an MSC 8/MOD 80 microcomputer for assembling, PROM programming and debugging user programs at run time. The two machines are linked by an existing CAMAC crate system which will also provide the means of access to microprocessor applications in CAMAC and the interface of the development system to any other application. (Auth.)
Kiesewetter, Jan; Drossard, Sabine; Gaupp, Rainer; Baschnegger, Heiko; Kiesewetter, Isabel; Hoffmann, Susanne
2018-01-01
The topic of patient safety is of fundamental interest for the health care sector. In view of the realisation of the National Competence-Based Learning Objectives Catalogue for Undergraduate Medical Education (NKLM) this topic now has to be prepared for medical education. For a disciplinary and content-related orientation the GMA Committee developed the Learning Objectives Catalogue Patient Safety for Undergraduate Medical Education (GMA-LZK). To ensure an optimal implementation of the GMA-LZK we recommend a longitudinal embedding into the existing curriculum. This position paper supports the implementation of the GMA-LZK and is aimed at everyone who wants to establish teaching courses on the topic patient safety and embed them in the curriculum. In light of this, we will initially describe the key features for a structured analysis of the current situation. Based on three best-practice-examples, as seen in the faculties of Freiburg, Bonn and Munich, different approaches to the implementation of the GMA-LZK will be illustrated. Lastly, we will outline the methodical requirements regarding the curriculum development as well as the disciplinary and methodical competences that the lecturers will have to hold or develop to fulfil the requirements.
Using Intel Xeon Phi to accelerate the WRF TEMF planetary boundary layer scheme
Mielikainen, Jarno; Huang, Bormin; Huang, Allen
2014-05-01
The Weather Research and Forecasting (WRF) model is designed for numerical weather prediction and atmospheric research. The WRF software infrastructure consists of several components such as dynamic solvers and physics schemes. Numerical models are used to resolve the large-scale flow. However, subgrid-scale parameterizations are for an estimation of small-scale properties (e.g., boundary layer turbulence and convection, clouds, radiation). Those have a significant influence on the resolved scale due to the complex nonlinear nature of the atmosphere. For the cloudy planetary boundary layer (PBL), it is fundamental to parameterize vertical turbulent fluxes and subgrid-scale condensation in a realistic manner. A parameterization based on the Total Energy - Mass Flux (TEMF) that unifies turbulence and moist convection components produces a better result that the other PBL schemes. For that reason, the TEMF scheme is chosen as the PBL scheme we optimized for Intel Many Integrated Core (MIC), which ushers in a new era of supercomputing speed, performance, and compatibility. It allows the developers to run code at trillions of calculations per second using the familiar programming model. In this paper, we present our optimization results for TEMF planetary boundary layer scheme. The optimizations that were performed were quite generic in nature. Those optimizations included vectorization of the code to utilize vector units inside each CPU. Furthermore, memory access was improved by scalarizing some of the intermediate arrays. The results show that the optimization improved MIC performance by 14.8x. Furthermore, the optimizations increased CPU performance by 2.6x compared to the original multi-threaded code on quad core Intel Xeon E5-2603 running at 1.8 GHz. Compared to the optimized code running on a single CPU socket the optimized MIC code is 6.2x faster.
High-throughput sockets over RDMA for the Intel Xeon Phi coprocessor
Santogidis, Aram
2017-01-01
In this paper we describe the design, implementation and performance of Trans4SCIF, a user-level socket-like transport library for the Intel Xeon Phi coprocessor. Trans4SCIF library is primarily intended for high-throughput applications. It uses RDMA transfers over the native SCIF support, in a way that is transparent for the application, which has the illusion of using conventional stream sockets. We also discuss the integration of Trans4SCIF with the ZeroMQ messaging library, used extensively by several applications running at CERN. We show that this can lead to a substantial, up to 3x, increase of application throughput compared to the default TCP/IP transport option.
Intel Xeon Phi accelerated Weather Research and Forecasting (WRF) Goddard microphysics scheme
Mielikainen, J.; Huang, B.; Huang, A. H.-L.
2014-12-01
The Weather Research and Forecasting (WRF) model is a numerical weather prediction system designed to serve both atmospheric research and operational forecasting needs. The WRF development is a done in collaboration around the globe. Furthermore, the WRF is used by academic atmospheric scientists, weather forecasters at the operational centers and so on. The WRF contains several physics components. The most time consuming one is the microphysics. One microphysics scheme is the Goddard cloud microphysics scheme. It is a sophisticated cloud microphysics scheme in the Weather Research and Forecasting (WRF) model. The Goddard microphysics scheme is very suitable for massively parallel computation as there are no interactions among horizontal grid points. Compared to the earlier microphysics schemes, the Goddard scheme incorporates a large number of improvements. Thus, we have optimized the Goddard scheme code. In this paper, we present our results of optimizing the Goddard microphysics scheme on Intel Many Integrated Core Architecture (MIC) hardware. The Intel Xeon Phi coprocessor is the first product based on Intel MIC architecture, and it consists of up to 61 cores connected by a high performance on-die bidirectional interconnect. The Intel MIC is capable of executing a full operating system and entire programs rather than just kernels as the GPU does. The MIC coprocessor supports all important Intel development tools. Thus, the development environment is one familiar to a vast number of CPU developers. Although, getting a maximum performance out of MICs will require using some novel optimization techniques. Those optimization techniques are discussed in this paper. The results show that the optimizations improved performance of Goddard microphysics scheme on Xeon Phi 7120P by a factor of 4.7×. In addition, the optimizations reduced the Goddard microphysics scheme's share of the total WRF processing time from 20.0 to 7.5%. Furthermore, the same optimizations
75 FR 48338 - Intel Corporation; Analysis of Proposed Consent Order to Aid Public Comment
2010-08-10
... product road maps, its compilers, and product benchmarking (Sections VI, VII, and VIII). The Proposed... alleges that Intel's failure to fully disclose the changes it made to its compilers and libraries... benchmarking organizations the effects of its compiler redesign on non-Intel CPUs. Several benchmarking...
Energy Technology Data Exchange (ETDEWEB)
Sitaraman, Hariswaran [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Grout, Ray W [National Renewable Energy Laboratory (NREL), Golden, CO (United States)
2017-06-09
This work investigates novel algorithm designs and optimization techniques for restructuring chemistry integrators in zero and multidimensional combustion solvers, which can then be effectively used on the emerging generation of Intel's Many Integrated Core/Xeon Phi processors. These processors offer increased computing performance via large number of lightweight cores at relatively lower clock speeds compared to traditional processors (e.g. Intel Sandybridge/Ivybridge) used in current supercomputers. This style of processor can be productively used for chemistry integrators that form a costly part of computational combustion codes, in spite of their relatively lower clock speeds. Performance commensurate with traditional processors is achieved here through the combination of careful memory layout, exposing multiple levels of fine grain parallelism and through extensive use of vendor supported libraries (Cilk Plus and Math Kernel Libraries). Important optimization techniques for efficient memory usage and vectorization have been identified and quantified. These optimizations resulted in a factor of ~ 3 speed-up using Intel 2013 compiler and ~ 1.5 using Intel 2017 compiler for large chemical mechanisms compared to the unoptimized version on the Intel Xeon Phi. The strategies, especially with respect to memory usage and vectorization, should also be beneficial for general purpose computational fluid dynamics codes.
Towards Porting a Real-World Seismological Application to the Intel MIC Architecture
V. Weinberg
2014-01-01
This whitepaper aims to discuss first experiences with porting an MPI-based real-world geophysical application to the new Intel Many Integrated Core (MIC) architecture. The selected code SeisSol is an application written in Fortran that can be used to simulate earthquake rupture and radiating seismic wave propagation in complex 3-D heterogeneous materials. The PRACE prototype cluster EURORA at CINECA, Italy, was accessed to analyse the MPI-performance of SeisSol on Intel Xeon Phi on both sing...
Connecting Effective Instruction and Technology. Intel-elebration: Safari.
Burton, Larry D.; Prest, Sharon
Intel-ebration is an attempt to integrate the following research-based instructional frameworks and strategies: (1) dimensions of learning; (2) multiple intelligences; (3) thematic instruction; (4) cooperative learning; (5) project-based learning; and (6) instructional technology. This paper presents a thematic unit on safari, using the…
CAMSHIFT Tracker Design Experiments With Intel OpenCV and SAI
National Research Council Canada - National Science Library
Francois, Alexandre R
2004-01-01
... (including multi-modal) systems, must be specifically addressed. This report describes design and implementation experiments for CAMSHIFT-based tracking systems using Intel's Open Computer Vision library and SAI...
Full cycle trigonometric function on Intel Quartus II Verilog
Mustapha, Muhazam; Zulkarnain, Nur Antasha
2018-02-01
This paper discusses about an improvement of a previous research on hardware based trigonometric calculations. Tangent function will also be implemented to get a complete set. The functions have been simulated using Quartus II where the result will be compared to the previous work. The number of bits has also been extended for each trigonometric function. The design is based on RTL due to its resource efficient nature. At earlier stage, a technology independent test bench simulation was conducted on ModelSim due to its convenience in capturing simulation data so that accuracy information can be obtained. On second stage, Intel/Altera Quartus II will be used to simulate on technology dependent platform, particularly on the one belonging to Intel/Altera itself. Real data on no. logic elements used and propagation delay have also been obtained.
Accelerating the Pace of Protein Functional Annotation With Intel Xeon Phi Coprocessors.
Feinstein, Wei P; Moreno, Juana; Jarrell, Mark; Brylinski, Michal
2015-06-01
Intel Xeon Phi is a new addition to the family of powerful parallel accelerators. The range of its potential applications in computationally driven research is broad; however, at present, the repository of scientific codes is still relatively limited. In this study, we describe the development and benchmarking of a parallel version of eFindSite, a structural bioinformatics algorithm for the prediction of ligand-binding sites in proteins. Implemented for the Intel Xeon Phi platform, the parallelization of the structure alignment portion of eFindSite using pragma-based OpenMP brings about the desired performance improvements, which scale well with the number of computing cores. Compared to a serial version, the parallel code runs 11.8 and 10.1 times faster on the CPU and the coprocessor, respectively; when both resources are utilized simultaneously, the speedup is 17.6. For example, ligand-binding predictions for 501 benchmarking proteins are completed in 2.1 hours on a single Stampede node equipped with the Intel Xeon Phi card compared to 3.1 hours without the accelerator and 36.8 hours required by a serial version. In addition to the satisfactory parallel performance, porting existing scientific codes to the Intel Xeon Phi architecture is relatively straightforward with a short development time due to the support of common parallel programming models by the coprocessor. The parallel version of eFindSite is freely available to the academic community at www.brylinski.org/efindsite.
Needham, Perri J.; Bhuiyan, Ashraf; Walker, Ross C.
2016-04-01
We present an implementation of explicit solvent particle mesh Ewald (PME) classical molecular dynamics (MD) within the PMEMD molecular dynamics engine, that forms part of the AMBER v14 MD software package, that makes use of Intel Xeon Phi coprocessors by offloading portions of the PME direct summation and neighbor list build to the coprocessor. We refer to this implementation as pmemd MIC offload and in this paper present the technical details of the algorithm, including basic models for MPI and OpenMP configuration, and analyze the resultant performance. The algorithm provides the best performance improvement for large systems (>400,000 atoms), achieving a ∼35% performance improvement for satellite tobacco mosaic virus (1,067,095 atoms) when 2 Intel E5-2697 v2 processors (2 ×12 cores, 30M cache, 2.7 GHz) are coupled to an Intel Xeon Phi coprocessor (Model 7120P-1.238/1.333 GHz, 61 cores). The implementation utilizes a two-fold decomposition strategy: spatial decomposition using an MPI library and thread-based decomposition using OpenMP. We also present compiler optimization settings that improve the performance on Intel Xeon processors, while retaining simulation accuracy.
Trusted Computing Technologies, Intel Trusted Execution Technology.
Energy Technology Data Exchange (ETDEWEB)
Guise, Max Joseph; Wendt, Jeremy Daniel
2011-01-01
We describe the current state-of-the-art in Trusted Computing Technologies - focusing mainly on Intel's Trusted Execution Technology (TXT). This document is based on existing documentation and tests of two existing TXT-based systems: Intel's Trusted Boot and Invisible Things Lab's Qubes OS. We describe what features are lacking in current implementations, describe what a mature system could provide, and present a list of developments to watch. Critical systems perform operation-critical computations on high importance data. In such systems, the inputs, computation steps, and outputs may be highly sensitive. Sensitive components must be protected from both unauthorized release, and unauthorized alteration: Unauthorized users should not access the sensitive input and sensitive output data, nor be able to alter them; the computation contains intermediate data with the same requirements, and executes algorithms that the unauthorized should not be able to know or alter. Due to various system requirements, such critical systems are frequently built from commercial hardware, employ commercial software, and require network access. These hardware, software, and network system components increase the risk that sensitive input data, computation, and output data may be compromised.
Radiation Failures in Intel 14nm Microprocessors
Bossev, Dobrin P.; Duncan, Adam R.; Gadlage, Matthew J.; Roach, Austin H.; Kay, Matthew J.; Szabo, Carl; Berger, Tammy J.; York, Darin A.; Williams, Aaron; LaBel, K.;
2016-01-01
In this study the 14 nm Intel Broadwell 5th generation core series 5005U-i3 and 5200U-i5 was mounted on Dell Inspiron laptops, MSI Cubi and Gigabyte Brix barebones and tested with Windows 8 and CentOS7 at idle. Heavy-ion-induced hard- and catastrophic failures do not appear to be related to the Intel 14nm Tri-Gate FinFET process. They originate from a small (9 m 140 m) area on the 32nm planar PCH die (not the CPU) as initially speculated. The hard failures seem to be due to a SEE but the exact physical mechanism has yet to be identified. Some possibilities include latch-ups, charge ion trapping or implantation, ion channels, or a combination of those (in biased conditions). The mechanism of the catastrophic failures seems related to the presence of electric power (1.05V core voltage). The 1064 nm laser mimics ionization radiation and induces soft- and hard failures as a direct result of electron-hole pair production, not heat. The 14nm FinFET processes continue to look promising for space radiation environments.
Balazs, G; Nowak, A; CERN. Geneva. IT Department
2009-01-01
In this paper we compare a system based on an Intel Atom N330 low-power processor to a modern Intel Xeon® dual-socket server using CERN IT’s standard criteria for comparing price-performance and performance per watt. The Xeon server corresponds to what is typically acquired as servers in the LHC Computing Grid. The comparisons used public pricing information from November 2008. After the introduction in section 1, section 2 describes the hardware and software setup. In section 3 we describe the power measurements we did and in section 4 we discuss the throughput performance results. In section 5 we summarize our initial conclusions. We then go on to describe our long term vision and possible future scenarios for using such low-power processors, and finally we list interesting development directions.
Real-time data acquisition and feedback control using Linux Intel computers
International Nuclear Information System (INIS)
Penaflor, B.G.; Ferron, J.R.; Piglowski, D.A.; Johnson, R.D.; Walker, M.L.
2006-01-01
This paper describes the experiences of the DIII-D programming staff in adapting Linux based Intel computing hardware for use in real-time data acquisition and feedback control systems. Due to the highly dynamic and unstable nature of magnetically confined plasmas in tokamak fusion experiments, real-time data acquisition and feedback control systems are in routine use with all major tokamaks. At DIII-D, plasmas are created and sustained using a real-time application known as the digital plasma control system (PCS). During each experiment, the PCS periodically samples data from hundreds of diagnostic signals and provides these data to control algorithms implemented in software. These algorithms compute the necessary commands to send to various actuators that affect plasma performance. The PCS consists of a group of rack mounted Intel Xeon computer systems running an in-house customized version of the Linux operating system tailored specifically to meet the real-time performance needs of the plasma experiments. This paper provides a more detailed description of the real-time computing hardware and custom developed software, including recent work to utilize dual Intel Xeon equipped computers within the PCS
Analysis of Intel IA-64 Processor Support for Secure Systems
National Research Council Canada - National Science Library
Unalmis, Bugra
2001-01-01
.... Systems could be constructed for which serious security threats would be eliminated. This thesis explores the Intel IA-64 processor's hardware support and its relationship to software for building a secure system...
2003-01-01
"Intel Corporation, system manufacturer California Digital and the University of California at Lawrence Livermore National Laboratory (LLNL) today announced they are building one of the world's most powerful supercomputers. The supercomputer project, codenamed "Thunder," uses nearly 4,000 Intel® Itanium® 2 processors... is expected to be complete in January 2004" (1 page).
Scaling Deep Learning Workloads: NVIDIA DGX-1/Pascal and Intel Knights Landing
Energy Technology Data Exchange (ETDEWEB)
Gawande, Nitin A.; Landwehr, Joshua B.; Daily, Jeffrey A.; Tallent, Nathan R.; Vishnu, Abhinav; Kerbyson, Darren J.
2017-07-03
Deep Learning (DL) algorithms have become ubiquitous in data analytics. As a result, major computing vendors --- including NVIDIA, Intel, AMD and IBM --- have architectural road-maps influenced by DL workloads. Furthermore, several vendors have recently advertised new computing products as accelerating DL workloads. Unfortunately, it is difficult for data scientists to quantify the potential of these different products. This paper provides a performance and power analysis of important DL workloads on two major parallel architectures: NVIDIA DGX-1 (eight Pascal P100 GPUs interconnected with NVLink) and Intel Knights Landing (KNL) CPUs interconnected with Intel Omni-Path. Our evaluation consists of a cross section of convolutional neural net workloads: CifarNet, CaffeNet, AlexNet and GoogleNet topologies using the Cifar10 and ImageNet datasets. The workloads are vendor optimized for each architecture. GPUs provide the highest overall raw performance. Our analysis indicates that although GPUs provide the highest overall performance, the gap can close for some convolutional networks; and KNL can be competitive when considering performance/watt. Furthermore, NVLink is critical to GPU scaling.
Scalability tests of R-GMA based Grid job monitoring system for CMS Monte Carlo data production
Bonacorsi, D; Field, L; Fisher, S; Grandi, C; Hobson, P R; Kyberd, P; MacEvoy, B; Nebrensky, J J; Tallini, H; Traylen, S
2004-01-01
High Energy Physics experiments such as CMS (Compact Muon Solenoid) at the Large Hadron Collider have unprecedented, large-scale data processing computing requirements, with data accumulating at around 1 Gbyte/s. The Grid distributed computing paradigm has been chosen as the solution to provide the requisite computing power. The demanding nature of CMS software and computing requirements, such as the production of large quantities of Monte Carlo simulated data, makes them an ideal test case for the Grid and a major driver for the development of Grid technologies. One important challenge when using the Grid for large-scale data analysis is the ability to monitor the large numbers of jobs that are being executed simultaneously at multiple remote sites. R-GMA is a monitoring and information management service for distributed resources based on the Grid Monitoring Architecture of the Global Grid Forum. In this paper we report on the first measurements of R-GMA as part of a monitoring architecture to be used for b...
Chen, Liang; Xu, Changqi; Wang, Yong; Shi, Jian; Yu, Qingsong
2012-01-01
The purpose of this research was to investigate the influence of the glyoxylic acid (GA) modification of hydroxyapatite (HAP) nanofibers on their dispersion in bisphenol A glycidyl methacrylate (BisGMA)/triethylene glycol dimethacrylate (TEGDMA) dental composites and also investigate the mechanical properties, water absorption, and water solubility of the resulting dental resins and composites. Scanning/Transmission electron microscopy (STEM) images showed that microsized HAP nanofiber bundles could be effectively broken down to individual HAP nanofibers with an average length of ~15 μm after the surface modification process. Fourier transform infrared spectroscopy (FT-IR), X-ray photoelectron spectroscopy (XPS) and thermal gravimetric analysis (TGA) characterization confirmed glyoxylic acid was chemically grafted on the HAP nanofiber surface, hypothetically by reacting with the amine group on HAP nanofiber surface. The enhanced dispersion of HAP nanofibers in dental matrix led to increased biaxial flexural strength (BFS) compared with the corresponding dental resins and composites filled with untreated HAP nanofibers. In addition, impregnation of small mass fractions of the glyoxylic acid modified HAP nanofibers into the BisGMA/TEGDMA dental resins (5wt%, 10wt%) or composites (2wt%, 3wt%) could also substantially improve the BFS in comparison with the controls(pure resins or dental composites filled with silica particles alone). Larger mass fractions could not further increase the mechanical property or even degrade the BFS values. Water behavior testing results indicated that the addition of glyoxylic acid modified HAP nanofibers resulted in higher water absorption and water solubility values which is not preferred for clinical application. In summary, well dispersed HAP nanofibers and their dental composites with enhanced mechanical property have been successfully fabricated but the water absorption and water solubility of such dental composites need to be
International Nuclear Information System (INIS)
Chen Liang; Yu Qingsong; Li Hao; Xu Changqi; Wang Yong; Shi Jian
2012-01-01
The purpose of this research was to investigate the influence of the glyoxylic acid (GA) modification of hydroxyapatite (HAP) nanofibers on their dispersion in bisphenol A glycidyl methacrylate (BisGMA)/triethylene glycol dimethacrylate (TEGDMA) dental composites and also to investigate the mechanical properties, water absorption and water solubility of the resulting dental resins and composites. Scanning/transmission electron microscopy images showed that microsized HAP nanofiber bundles could be effectively broken down into individual HAP nanofibers with an average length of ∼15 µm after the surface modification process. Fourier transform infrared spectroscopy, x-ray photoelectron spectroscopy and thermal gravimetric analysis characterization confirmed that GA was chemically grafted on the HAP nanofiber surface, hypothetically by reacting with the amine group on the HAP nanofiber surface. The enhanced dispersion of HAP nanofibers in the dental matrix led to increased biaxial flexural strength (BFS) compared with the corresponding dental resins and composites filled with untreated HAP nanofibers. In addition, impregnation of small mass fractions of the GA-modified HAP nanofibers into the BisGMA/TEGDMA dental resins (5 wt%, 10 wt%) or composites (2 wt%, 3 wt%) could also substantially improve the BFS in comparison with the controls (pure resins or dental composites filled with silica particles alone). Larger mass fractions could not increase the mechanical property further or even degraded the BFS values. Water behavior testing results indicated that the addition of the GA-modified HAP nanofibers resulted in higher water absorption and water solubility values, which are not preferred for clinical application. In summary, well-dispersed HAP nanofibers and their dental composites with enhanced mechanical properties have been successfully fabricated, but the water absorption and water solubility of such dental composites need to be further improved. (paper)
In vitro blood and fibroblast responses to BisGMA-TEGDMA/bioactive glass composite implants.
Abdulmajeed, Aous A; Kokkari, Anne K; Käpylä, Jarmo; Massera, Jonathan; Hupa, Leena; Vallittu, Pekka K; Närhi, Timo O
2014-01-01
This in vitro study was designed to evaluate both blood and human gingival fibroblast responses to bisphenol A-glycidyl methacrylate-triethyleneglycol dimethacrylate (BisGMA-TEGDMA)/bioactive glass (BAG) composite, aimed to be used as composite implant abutment surface modifier. Three different types of substrates were investigated: (a) plain polymer (BisGMA 50 wt%-TEGDMA 50 wt%), (b) BAG-composite (50 wt% polymer + 50 wt% fraction of BAG-particles, <50 μm), and (c) plain BAG plates (100 wt% BAG). The blood response, including the blood-clotting ability and platelet adhesion morphology were evaluated. Human gingival fibroblasts were plated and cultured on the experimental substrates for up to 10 days, then the cell proliferation rate was assessed using AlamarBlue assay™. The BAG-composite and plain BAG substrates had a shorter clotting time than plain polymer substrates. Platelet activation and aggregation were most extensive, qualitatively, on BAG-composite. Analysis of the normalized cell proliferation rate on the different surfaces showed some variations throughout the experiment, however, by day 10 the BAG-composite substrate showed the highest (P < 0.001) cell proliferation rate. In conclusion, the presence of exposed BAG-particles enhances fibroblast and blood responses on composite surfaces in vitro.
Vaidyanathan, Tritala K; Vaidyanathan, Jayalakshmi
2015-12-01
Objective : The goal of this study was to characterize the light curing characteristics of a new oligomer PEM-665 designed to be used as an alternative monomer to BisGMA. Materials and methods : PEM-665 (P) and BisGMA (B) solutions were prepared with triethylene glycol dimethacrylate (T) diluent in different weight proportions (70/30 and 50/50). Solutions containing 70% P and 30% T were designated as 70PT, 70%B and 30%T as 70BT, 50%P and 50%T as 50PT and 50%B and 50%T as 50BT. The initiators were CQ (EDMAB was used as amine accelerator for CQ) and DPO in 1% concentration. Eight solutions were prepared in a factorial design: 70PT/DPO; 70PT/CQ; 50PT/DPO; 50PT/CQ; 70BT/DPO; 70BT/CQ; 50BT/DPO; 50BT/CQ. BISCO VIP visible light was used to cure the monomer solutions using 30 s exposure time and 400 W power setting. TA Instruments Differential Scanning Calorimeter (DSC 2910) was used to determine the heat of cure (J/g) during polymerization at 37 °C, from which molar heat of cure (kJ/mole) and %Conversion values were estimated. Results : Range of mean values as a function monomer selections were: heat of cure (J/g): 161.7 for 70PT/DPO system to 198.6 for 50BT/CQ system; molar heat of cure (kJ/mole): 67.3 for 70BT/DPO to 78.86 for 50PT/CQ; % conversion: 59.9 for 70BT/DPO to 70.3 for 50PT/CQ. Analysis of variance and Tukey HSD pairwise contrast showed statistically significant differences between % conversion means of PEM and BisGMA mixtures, with PEM mixtures showing significantly higher mean values. Conclusions : The results suggest that PEM-665 is a promising candidate material for dental polymer applications.
DEFF Research Database (Denmark)
Rosenkilde, Mette M; Gerlach, Lars-Ole; Jakobsen, Janus S
2004-01-01
, respectively. Metal ion binding in the cyclam rings of AMD3100 increased its dependence on Asp(262) and provided a tighter molecular map of the binding site, where borderline mutational hits became clear hits for the Zn(II)-loaded analog. The proposed binding site for AMD3100 was confirmed by a gradual build......-up in the rather distinct CXCR3 receptor, for which the compound normally had no effect. Introduction of only a Glu at position VII:06 and the removal of a neutralizing Lys residue at position VII:02 resulted in a 1000-fold increase in affinity of AMD3100 to within 10-fold of its affinity in CXCR4. We conclude...
Liu, Xu; Chen, Langshi; Firoz, Jesun S.; Qiu, Judy; Jiang, Lei
2017-01-01
Intel Xeon Phi many-integrated-core (MIC) architectures usher in a new era of terascale integration. Among emerging killer applications, parallel graph processing has been a critical technique to analyze connected data. In this paper, we empirically evaluate various computing platforms including an Intel Xeon E5 CPU, a Nvidia Geforce GTX1070 GPU and an Xeon Phi 7210 processor codenamed Knights Landing (KNL) in the domain of parallel graph processing. We show that the KNL gains encouraging per...
Directory of Open Access Journals (Sweden)
Izabela Barszczewska-Rybarek
2015-03-01
Full Text Available The effect of various dimethacrylates on the structure and properties of homo- and copolymer networks was studied. The 2,2-bis-[4-(2-hydroxy-3- methacryloyloxypropoxyphenyl]-propane (Bis-GMA, triethylene glycol dimethacrylate (TEGDMA and 1,6-bis-(methacryloyloxy-2-ethoxycarbonylamino-2,4,4-trimethylhexane (HEMA/TMDI, all popular in dentistry, as well as five urethane-dimethacrylate (UDMA alternatives of HEMA/TMDI were used as monomers. UDMAs were obtained from mono-, di- and tri(ethylene glycol monomethacrylates and various commercial diisocyanates. The chemical structure, degree of conversion (DC and scanning electron microscopy (SEM fracture morphology were related to the mechanical properties of the polymers: flexural strength and modulus, hardness, as well as impact strength. Impact resistance was widely discussed, being lower than expected in the case of poly(UDMAs. It was caused by the heterogeneous morphology of these polymers and only moderate strength of hydrogen bonds between urethane groups, which was not high enough to withstand high impact energy. Bis-GMA, despite having the highest polymer morphological heterogeneity, ensured fair impact resistance, due to having the strongest hydrogen bonds between hydroxyl groups. The TEGDMA homopolymer, despite being heterogeneous, produced the smoothest morphology, which resulted in the lowest brittleness. The UDMA monomer, having diethylene glycol monomethacrylate wings and the isophorone core, could be the most suitable HEMA/TMDI alternative. Its copolymer with Bis-GMA and TEGDMA had improved DC as well as all the mechanical properties.
Intel Legend and CERN would build up high speed Internet
2002-01-01
Intel, Legend and China Education and Research Network jointly announced on the 25th of April that they will be cooperating with each other to build up the new generation high speed internet, over the next three years (1/2 page).
Staggered Dslash Performance on Intel Xeon Phi Architecture
Li, Ruizi; Gottlieb, Steven
2014-01-01
The conjugate gradient (CG) algorithm is among the most essential and time consuming parts of lattice calculations with staggered quarks. We test the performance of CG and dslash, the key step in the CG algorithm, on the Intel Xeon Phi, also known as the Many Integrated Core (MIC) architecture. We try different parallelization strategies using MPI, OpenMP, and the vector processing units (VPUs).
International Nuclear Information System (INIS)
Liu, T.; Xu, X.G.; Carothers, C.D.
2015-01-01
Highlights: • A new Monte Carlo photon transport code ARCHER-CT for CT dose calculations is developed to execute on the GPU and coprocessor. • ARCHER-CT is verified against MCNP. • The GPU code on an Nvidia M2090 GPU is 5.15–5.81 times faster than the parallel CPU code on an Intel X5650 6-core CPU. • The coprocessor code on an Intel Xeon Phi 5110p coprocessor is 3.30–3.38 times faster than the CPU code. - Abstract: Hardware accelerators are currently becoming increasingly important in boosting high performance computing systems. In this study, we tested the performance of two accelerator models, Nvidia Tesla M2090 GPU and Intel Xeon Phi 5110p coprocessor, using a new Monte Carlo photon transport package called ARCHER-CT we have developed for fast CT imaging dose calculation. The package contains three components, ARCHER-CT CPU , ARCHER-CT GPU and ARCHER-CT COP designed to be run on the multi-core CPU, GPU and coprocessor architectures respectively. A detailed GE LightSpeed Multi-Detector Computed Tomography (MDCT) scanner model and a family of voxel patient phantoms are included in the code to calculate absorbed dose to radiosensitive organs under user-specified scan protocols. The results from ARCHER agree well with those from the production code Monte Carlo N-Particle eXtended (MCNPX). It is found that all the code components are significantly faster than the parallel MCNPX run on 12 MPI processes, and that the GPU and coprocessor codes are 5.15–5.81 and 3.30–3.38 times faster than the parallel ARCHER-CT CPU , respectively. The M2090 GPU performs better than the 5110p coprocessor in our specific test. Besides, the heterogeneous computation mode in which the CPU and the hardware accelerator work concurrently can increase the overall performance by 13–18%
Global synchronization algorithms for the Intel iPSC/860
Seidel, Steven R.; Davis, Mark A.
1992-01-01
In a distributed memory multicomputer that has no global clock, global processor synchronization can only be achieved through software. Global synchronization algorithms are used in tridiagonal systems solvers, CFD codes, sequence comparison algorithms, and sorting algorithms. They are also useful for event simulation, debugging, and for solving mutual exclusion problems. For the Intel iPSC/860 in particular, global synchronization can be used to ensure the most effective use of the communication network for operations such as the shift, where each processor in a one-dimensional array or ring concurrently sends a message to its right (or left) neighbor. Three global synchronization algorithms are considered for the iPSC/860: the gysnc() primitive provided by Intel, the PICL primitive sync0(), and a new recursive doubling synchronization (RDS) algorithm. The performance of these algorithms is compared to the performance predicted by communication models of both the long and forced message protocols. Measurements of the cost of shift operations preceded by global synchronization show that the RDS algorithm always synchronizes the nodes more precisely and costs only slightly more than the other two algorithms.
Scaling deep learning workloads: NVIDIA DGX-1/Pascal and Intel Knights Landing
Energy Technology Data Exchange (ETDEWEB)
Gawande, Nitin A.; Landwehr, Joshua B.; Daily, Jeffrey A.; Tallent, Nathan R.; Vishnu, Abhinav; Kerbyson, Darren J.
2017-08-24
Deep Learning (DL) algorithms have become ubiquitous in data analytics. As a result, major computing vendors --- including NVIDIA, Intel, AMD, and IBM --- have architectural road-maps influenced by DL workloads. Furthermore, several vendors have recently advertised new computing products as accelerating large DL workloads. Unfortunately, it is difficult for data scientists to quantify the potential of these different products. This paper provides a performance and power analysis of important DL workloads on two major parallel architectures: NVIDIA DGX-1 (eight Pascal P100 GPUs interconnected with NVLink) and Intel Knights Landing (KNL) CPUs interconnected with Intel Omni-Path or Cray Aries. Our evaluation consists of a cross section of convolutional neural net workloads: CifarNet, AlexNet, GoogLeNet, and ResNet50 topologies using the Cifar10 and ImageNet datasets. The workloads are vendor-optimized for each architecture. Our analysis indicates that although GPUs provide the highest overall performance, the gap can close for some convolutional networks; and the KNL can be competitive in performance/watt. We find that NVLink facilitates scaling efficiency on GPUs. However, its importance is heavily dependent on neural network architecture. Furthermore, for weak-scaling --- sometimes encouraged by restricted GPU memory --- NVLink is less important.
Huang, Melin; Huang, Bormin; Huang, Allen H.
2014-10-01
The Weather Research and Forecasting (WRF) model provided operational services worldwide in many areas and has linked to our daily activity, in particular during severe weather events. The scheme of Yonsei University (YSU) is one of planetary boundary layer (PBL) models in WRF. The PBL is responsible for vertical sub-grid-scale fluxes due to eddy transports in the whole atmospheric column, determines the flux profiles within the well-mixed boundary layer and the stable layer, and thus provide atmospheric tendencies of temperature, moisture (including clouds), and horizontal momentum in the entire atmospheric column. The YSU scheme is very suitable for massively parallel computation as there are no interactions among horizontal grid points. To accelerate the computation process of the YSU scheme, we employ Intel Many Integrated Core (MIC) Architecture as it is a multiprocessor computer structure with merits of efficient parallelization and vectorization essentials. Our results show that the MIC-based optimization improved the performance of the first version of multi-threaded code on Xeon Phi 5110P by a factor of 2.4x. Furthermore, the same CPU-based optimizations improved the performance on Intel Xeon E5-2603 by a factor of 1.6x as compared to the first version of multi-threaded code.
High-performance computing on the Intel Xeon Phi how to fully exploit MIC architectures
Wang, Endong; Shen, Bo; Zhang, Guangyong; Lu, Xiaowei; Wu, Qing; Wang, Yajuan
2014-01-01
The aim of this book is to explain to high-performance computing (HPC) developers how to utilize the Intel® Xeon Phi™ series products efficiently. To that end, it introduces some computing grammar, programming technology and optimization methods for using many-integrated-core (MIC) platforms and also offers tips and tricks for actual use, based on the authors' first-hand optimization experience.The material is organized in three sections. The first section, "Basics of MIC", introduces the fundamentals of MIC architecture and programming, including the specific Intel MIC programming environment
Directory of Open Access Journals (Sweden)
Matthew P Morrow
2016-01-01
Full Text Available We have previously demonstrated the immunogenicity of VGX-3100, a multicomponent DNA immunotherapy for the treatment of Human Papillomavirus (HPV16/18-positive CIN2/3 in a phase 1 clinical trial. Here, we report on the ability to boost immune responses with an additional dose of VGX-3100. Patients completing our initial phase 1 trial were offered enrollment into a follow on trial consisting of a single boost dose of VGX-3100. Data show both cellular and humoral immune responses could be augmented above pre-boost levels, including the induction of interferon (IFNγ production, tumor necrosis factor (TNFα production, CD8+ T cell activation and the synthesis of lytic proteins. Moreover, observation of antigen-specific regulation of immune-related gene transcripts suggests the induction of a proinflammatory response following the boost. Analysis of T cell receptor (TCR sequencing suggests the localization of putative HPV-specific T cell clones to the cervical mucosa, which underscores the putative mechanism of action of lesion regression and HPV16/18 elimination noted in our double-blind placebo-controlled phase 2B trial. Taken together, these data indicate that VGX-3100 drives the induction of robust cellular and humoral immune responses that can be augmented by a fourth “booster” dose. These data could be important in the scope of increasing the clinical efficacy rate of VGX-3100.
Effects of hydration and oxygen vacancy on CO2 adsorption and activation on beta-Ga2O3(100).
Pan, Yun-xiang; Liu, Chang-jun; Mei, Donghai; Ge, Qingfeng
2010-04-20
The effects of hydration and oxygen vacancy on CO(2) adsorption on the beta-Ga(2)O(3)(100) surface have been studied using density functional theory slab calculations. Adsorbed CO(2) is activated on the dry perfect beta-Ga(2)O(3)(100) surface, resulting in a carbonate species. This adsorption is slightly endothermic, with an adsorption energy of 0.07 eV. Water is preferably adsorbed molecularly on the dry perfect beta-Ga(2)O(3)(100) surface with an adsorption energy of -0.56 eV, producing a hydrated perfect beta-Ga(2)O(3)(100) surface. Adsorption of CO(2) on the hydrated surface as a carbonate species is also endothermic, with an adsorption energy of 0.14 eV, indicating a slightly repulsive interaction when H(2)O and CO(2) are coadsorbed. The carbonate species on the hydrated perfect surface can be protonated by the coadsorbed H(2)O to a bicarbonate species, making the CO(2) adsorption exothermic, with an adsorption energy of -0.13 eV. The effect of defects on CO(2) adsorption and activation has been examined by creating an oxygen vacancy on the dry beta-Ga(2)O(3)(100) surface. The formation of an oxygen vacancy is endothermic, by 0.34 eV, with respect to a free O(2) molecule in the gas phase. Presence of the oxygen vacancy promoted the adsorption and activation of CO(2). In the most stable CO(2) adsorption configuration on the dry defective beta-Ga(2)O(3)(100) surface with an oxygen vacancy, one of the oxygen atoms of the adsorbed CO(2) occupies the oxygen vacancy site, and the CO(2) adsorption energy is -0.31 eV. Water favors dissociative adsorption at the oxygen vacancy site on the defective surface. This process is spontaneous, with a reaction energy of -0.62 eV. These results indicate that, when water and CO(2) are present in the adsorption system simultaneously, water will compete with CO(2) for the oxygen vacancy sites and impact CO(2) adsorption and conversion negatively.
David, Dagmar M; Euteneier, Alexander; Fischer, Martin R; Hahn, Eckhart G; Johannink, Jonas; Kulike, Katharina; Lauch, Robert; Lindhorst, Elmar; Noll-Hussong, Michael; Pinilla, Severin; Weih, Markus; Wennekes, Vanessa
2013-01-01
The German graduate medical education system is going through an important phase of changes. Besides the ongoing reform of the national guidelines for graduate medical education (Musterweiterbildungsordnung), other factors like societal and demographic changes, health and research policy reforms also play a central role for the future and competitiveness of graduate medical education. With this position paper, the committee on graduate medical education of the Society for Medical Education (GMA) would like to point out some central questions for this process and support the current discourse. As an interprofessional and interdisciplinary scientific society, the GMA has the resources to contribute in a meaningful way to an evidence-based and future-oriented graduate medical education strategy. In this position paper, we use four key questions with regards to educational goals, quality assurance, teaching competence and policy requirements to address the core issues for the future of graduate medical education in Germany. The GMA sees its task in contributing to the necessary reform processes as the only German speaking scientific society in the field of medical education.
Exploring synchrotron radiation capabilities: The ALS-Intel CRADA
International Nuclear Information System (INIS)
Gozzo, F.; Cossy-Favre, A.; Padmore, H.
1997-01-01
Synchrotron radiation spectroscopy and spectromicroscopy were applied, at the Advanced Light Source, to the analysis of materials and problems of interest to the commercial semiconductor industry. The authors discuss some of the results obtained at the ALS using existing capabilities, in particular the small spot ultra-ESCA instrument on beamline 7.0 and the AMS (Applied Material Science) endstation on beamline 9.3.2. The continuing trend towards smaller feature size and increased performance for semiconductor components has driven the semiconductor industry to invest in the development of sophisticated and complex instrumentation for the characterization of microstructures. Among the crucial milestones established by the Semiconductor Industry Association are the needs for high quality, defect free and extremely clean silicon wafers, very thin gate oxides, lithographies near 0.1 micron and advanced material interconnect structures. The requirements of future generations cannot be met with current industrial technologies. The purpose of the ALS-Intel CRADA (Cooperative Research And Development Agreement) is to explore, compare and improve the utility of synchrotron-based techniques for practical analysis of substrates of interest to semiconductor chip manufacturing. The first phase of the CRADA project consisted in exploring existing ALS capabilities and techniques on some problems of interest. Some of the preliminary results obtained on Intel samples are discussed here
Poly(GMA/MA/MBAA) Copolymer Beads: a Highly Efficient Support Immobilizing Penicillin G Acylase
Institute of Scientific and Technical Information of China (English)
Ping XUE; Guan Zhong LU; Wan Yi LIU
2006-01-01
The hydrophilic, macroporous and beaded ternary copolymer of glycidyl methacrylate (GMA)/methacrylamide(MA)/N,N'-methylene-bis(acrylamide)(MBAA)was synthesized using the industrial agents by inverse suspension polymerization. The apparent activity of the immobilized penicillin G acylase reached 1096 IU/g for hydrolysis penicillin G on the beads with diameter of 0.11-0.13 mm, and it changed hardly after 50 cycles. It can be expected to be a good potential in industrial application.
Protein Alignment on the Intel Xeon Phi Coprocessor
Ramstad, Jorun
2015-01-01
There is an increasing need for sensitive, high perfomance sequence alignemnet tools. With the growing databases of scientificly analyzed protein sequences, more compute power is necessary. Specialized architectures arise, and a transition from serial to specialized implementationsis is required. This thesis is a study of whether Intel 60's cores Xeon Phi coprocessor is a suitable architecture for implementation of a sequence alignment tool. The performance relative to existing tools are eval...
Intel·ligència emocional a maternal
Missé Cortina, Jordi
2015-01-01
Inclusió d'activitats d'intel·ligència emocional a maternal A i B per al treball de l'adquisició de valors com l'autoestima, el respecte, la tolerància, etc. Inclusión de actividades de inteligencia emocional en maternal A y B para el trabajo de la adquisición de valores como la autoestima, el respeto, la tolerancia, etc. Practicum for the Psychology program on Educational Psychology.
Communication overhead on the Intel iPSC-860 hypercube
Bokhari, Shahid H.
1990-01-01
Experiments were conducted on the Intel iPSC-860 hypercube in order to evaluate the overhead of interprocessor communication. It is demonstrated that: (1) contrary to popular belief, the distance between two communicating processors has a significant impact on communication time, (2) edge contention can increase communication time by a factor of more than 7, and (3) node contention has no measurable impact.
Parallel Programming with Intel Parallel Studio XE
Blair-Chappell , Stephen
2012-01-01
Optimize code for multi-core processors with Intel's Parallel Studio Parallel programming is rapidly becoming a "must-know" skill for developers. Yet, where to start? This teach-yourself tutorial is an ideal starting point for developers who already know Windows C and C++ and are eager to add parallelism to their code. With a focus on applying tools, techniques, and language extensions to implement parallelism, this essential resource teaches you how to write programs for multicore and leverage the power of multicore in your programs. Sharing hands-on case studies and real-world examples, the
Evaluating the transport layer of the ALFA framework for the Intel® Xeon Phi™ Coprocessor
Santogidis, Aram; Hirstius, Andreas; Lalis, Spyros
2015-12-01
The ALFA framework supports the software development of major High Energy Physics experiments. As part of our research effort to optimize the transport layer of ALFA, we focus on profiling its data transfer performance for inter-node communication on the Intel Xeon Phi Coprocessor. In this article we present the collected performance measurements with the related analysis of the results. The optimization opportunities that are discovered, help us to formulate the future plans of enabling high performance data transfer for ALFA on the Intel Xeon Phi architecture.
MicroRNA-146a and AMD3100, two ways to control CXCR4 expression in acute myeloid leukemias
Energy Technology Data Exchange (ETDEWEB)
Spinello, I; Quaranta, M T; Riccioni, R; Riti, V; Pasquini, L; Boe, A; Pelosi, E [Department of Hematology, Oncology and Molecular Medicine, Istituto Superiore di Sanità, Rome (Italy); Vitale, A; Foà, R [Department of Cellular Biotechnologies and Hematology, Division of Hematology, ‘Sapienza' University, Rome (Italy); Testa, U; Labbaye, C [Department of Hematology, Oncology and Molecular Medicine, Istituto Superiore di Sanità, Rome (Italy)
2011-06-01
CXCR4 is a negative prognostic marker in acute myeloid leukemias (AMLs). Therefore, it is necessary to develop novel ways to inhibit CXCR4 expression in leukemia. AMD3100 is an inhibitor of CXCR4 currently used to mobilize cancer cells. CXCR4 is a target of microRNA (miR)-146a that may represent a new tool to inhibit CXCR4 expression. We then investigated CXCR4 regulation by miR-146a in primary AMLs and found an inverse correlation between miR-146a and CXCR4 protein expression levels in all AML subtypes. As the lowest miR-146a expression levels were observed in M5 AML, we analyzed the control of CXCR4 expression by miR-146a in normal and leukemic monocytic cells and showed that the regulatory miR-146a/CXCR4 pathway operates during monocytopoiesis, but is deregulated in AMLs. AMD3100 treatment and miR-146a overexpression were used to inhibit CXCR4 in leukemic cells. AMD3100 treatment induces the decrease of CXCR4 protein expression, associated with miR-146a increase, and increases sensitivity of leukemic blast cells to cytotoxic drugs, this effect being further enhanced by miR-146a overexpression. Altogether our data indicate that miR-146a and AMD3100, acting through different mechanism, downmodulate CXCR4 protein levels, impair leukemic cell proliferation and then may be used in combination with anti-leukemia drugs, for development of new therapeutic strategies.
MicroRNA-146a and AMD3100, two ways to control CXCR4 expression in acute myeloid leukemias
International Nuclear Information System (INIS)
Spinello, I; Quaranta, M T; Riccioni, R; Riti, V; Pasquini, L; Boe, A; Pelosi, E; Vitale, A; Foà, R; Testa, U; Labbaye, C
2011-01-01
CXCR4 is a negative prognostic marker in acute myeloid leukemias (AMLs). Therefore, it is necessary to develop novel ways to inhibit CXCR4 expression in leukemia. AMD3100 is an inhibitor of CXCR4 currently used to mobilize cancer cells. CXCR4 is a target of microRNA (miR)-146a that may represent a new tool to inhibit CXCR4 expression. We then investigated CXCR4 regulation by miR-146a in primary AMLs and found an inverse correlation between miR-146a and CXCR4 protein expression levels in all AML subtypes. As the lowest miR-146a expression levels were observed in M5 AML, we analyzed the control of CXCR4 expression by miR-146a in normal and leukemic monocytic cells and showed that the regulatory miR-146a/CXCR4 pathway operates during monocytopoiesis, but is deregulated in AMLs. AMD3100 treatment and miR-146a overexpression were used to inhibit CXCR4 in leukemic cells. AMD3100 treatment induces the decrease of CXCR4 protein expression, associated with miR-146a increase, and increases sensitivity of leukemic blast cells to cytotoxic drugs, this effect being further enhanced by miR-146a overexpression. Altogether our data indicate that miR-146a and AMD3100, acting through different mechanism, downmodulate CXCR4 protein levels, impair leukemic cell proliferation and then may be used in combination with anti-leukemia drugs, for development of new therapeutic strategies
Transitioning to Intel-based Linux Servers in the Payload Operations Integration Center
Guillebeau, P. L.
2004-01-01
The MSFC Payload Operations Integration Center (POIC) is the focal point for International Space Station (ISS) payload operations. The POIC contains the facilities, hardware, software and communication interface necessary to support payload operations. ISS ground system support for processing and display of real-time spacecraft and telemetry and command data has been operational for several years. The hardware components were reaching end of life and vendor costs were increasing while ISS budgets were becoming severely constrained. Therefore it has been necessary to migrate the Unix portions of our ground systems to commodity priced Intel-based Linux servers. hardware architecture including networks, data storage, and highly available resources. This paper will concentrate on the Linux migration implementation for the software portion of our ground system. The migration began with 3.5 million lines of code running on Unix platforms with separate servers for telemetry, command, Payload information management systems, web, system control, remote server interface and databases. The Intel-based system is scheduled to be available for initial operational use by August 2004 The overall migration to Intel-based Linux servers in the control center involves changes to the This paper will address the Linux migration study approach including the proof of concept, criticality of customer buy-in and importance of beginning with POSlX compliant code. It will focus on the development approach explaining the software lifecycle. Other aspects of development will be covered including phased implementation, interim milestones and metrics measurements and reporting mechanisms. This paper will also address the testing approach covering all levels of testing including development, development integration, IV&V, user beta testing and acceptance testing. Test results including performance numbers compared with Unix servers will be included. need for a smooth transition while maintaining
Aprà, E; Kowalski, K
2016-03-08
In this paper we discuss the implementation of multireference coupled-cluster formalism with singles, doubles, and noniterative triples (MRCCSD(T)), which is capable of taking advantage of the processing power of the Intel Xeon Phi coprocessor. We discuss the integration of two levels of parallelism underlying the MRCCSD(T) implementation with computational kernels designed to offload the computationally intensive parts of the MRCCSD(T) formalism to Intel Xeon Phi coprocessors. Special attention is given to the enhancement of the parallel performance by task reordering that has improved load balancing in the noniterative part of the MRCCSD(T) calculations. We also discuss aspects regarding efficient optimization and vectorization strategies.
Porting FEASTFLOW to the Intel Xeon Phi: Lessons Learned
Georgios Goumas
2014-01-01
In this paper we report our experiences in porting the FEASTFLOW software infrastructure to the Intel Xeon Phi coprocessor. Our efforts involved both the evaluation of programming models including OpenCL, POSIX threads and OpenMP and typical optimization strategies like parallelization and vectorization. Since the straightforward porting process of the already existing OpenCL version of the code encountered performance problems that require further analysis, we focused our efforts on the impl...
Single event effect testing of the Intel 80386 family and the 80486 microprocessor
International Nuclear Information System (INIS)
Moran, A.; LaBel, K.; Gates, M.; Seidleck, C.; McGraw, R.; Broida, M.; Firer, J.; Sprehn, S.
1996-01-01
The authors present single event effect test results for the Intel 80386 microprocessor, the 80387 coprocessor, the 82380 peripheral device, and on the 80486 microprocessor. Both single event upset and latchup conditions were monitored
A high-throughput readout architecture based on PCI-Express Gen3 and DirectGMA technology
International Nuclear Information System (INIS)
Rota, L.; Vogelgesang, M.; Perez, L.E. Ardila; Caselle, M.; Chilingaryan, S.; Dritschler, T.; Zilio, N.; Kopmann, A.; Balzer, M.; Weber, M.
2016-01-01
Modern physics experiments produce multi-GB/s data rates. Fast data links and high performance computing stages are required for continuous data acquisition and processing. Because of their intrinsic parallelism and computational power, GPUs emerged as an ideal solution to process this data in high performance computing applications. In this paper we present a high-throughput platform based on direct FPGA-GPU communication. The architecture consists of a Direct Memory Access (DMA) engine compatible with the Xilinx PCI-Express core, a Linux driver for register access, and high- level software to manage direct memory transfers using AMD's DirectGMA technology. Measurements with a Gen3 x8 link show a throughput of 6.4 GB/s for transfers to GPU memory and 6.6 GB/s to system memory. We also assess the possibility of using the architecture in low latency systems: preliminary measurements show a round-trip latency as low as 1 μs for data transfers to system memory, while the additional latency introduced by OpenCL scheduling is the current limitation for GPU based systems. Our implementation is suitable for real-time DAQ system applications ranging from photon science and medical imaging to High Energy Physics (HEP) systems
Winkler, I G; Pettit, A R; Raggatt, L J; Jacobsen, R N; Forristal, C E; Barbier, V; Nowlan, B; Cisterne, A; Bendall, L J; Sims, N A; Lévesque, J-P
2012-07-01
The CXCR4 antagonist AMD3100 is progressively replacing cyclophosphamide (CYP) as adjuvant to granulocyte colony-stimulating factor (G-CSF) to mobilize hematopoietic stem cells (HSC) for autologous transplants in patients who failed prior mobilization with G-CSF alone. It has recently emerged that G-CSF mediates HSC mobilization and inhibits bone formation via specific bone marrow (BM) macrophages. We compared the effect of these three mobilizing agents on BM macrophages, bone formation, osteoblasts, HSC niches and HSC reconstitution potential. Both G-CSF and CYP suppressed niche-supportive macrophages and osteoblasts, and inhibited expression of endosteal cytokines resulting in major impairment of HSC reconstitution potential remaining in the mobilized BM. In sharp contrast, although AMD3100 was effective at mobilizing HSC, it did not suppress osteoblasts, endosteal cytokine expression or reconstitution potential of HSC remaining in the mobilized BM. In conclusion, although G-CSF, CYP and AMD3100 efficiently mobilize HSC into the blood, their effects on HSC niches and bone formation are distinct with both G-CSF and CYP targeting HSC niche function and bone formation, whereas AMD3100 directly targets HSC without altering niche function or bone formation.
Koushki, Amin Reza; Goodarzi, Massoud; Paidar, Moslem
2016-12-01
In the present research, 6-mm-thick 5083-H321 aluminum alloy was joined by the double-pulsed gas metal arc welding (DP-GMAW) process. The objective was to investigate the influence of the shielding gas composition on the microstructure and properties of GMA welds. A macrostructural study indicated that the addition of nitrogen and oxygen to the argon shielding gas resulted in better weld penetration. Furthermore, the tensile strength and bending strength of the welds were improved when oxygen and nitrogen (at concentrations as high as approximately 0.1vol%) were added to the shielding gas; however, these properties were adversely affected when the oxygen and nitrogen contents were increased further. This behavior was attributed to the formation of excessive brown and black oxide films on the bead surface, the formation of intermetallic compounds in the weld metal, and the formation of thicker oxide layers on the bead surface with increasing nitrogen and oxygen contents in the argon-based shielding gas. Analysis by energy-dispersive X-ray spectroscopy revealed that most of these compounds are nitrides or oxides.
Accelerating Twisted Mass LQCD with QPhiX
Energy Technology Data Exchange (ETDEWEB)
Schröck, Mario [INFN, Rome3; Simula, Silvano [INFN, Rome3; Strelchenko, Alexei [Fermilab
2016-07-08
We present the implementation of twisted mass fermion operators for the QPhiX library. We analyze the performance on the Intel Xeon Phi (Knights Corner) coprocessor as well as on Intel Xeon Haswell CPUs. In particular, we demonstrate that on the Xeon Phi 7120P the Dslash kernel is able to reach 80\\% of the theoretical peak bandwidth, while on a Xeon Haswell E5-2630 CPU our generated code for the Dslash operator with AVX2 instructions outperforms the corresponding implementation in the tmLQCD library by a factor of $\\sim 5\\times$ in single precision. We strong scale the code up to 6.8 (14.1) Tflops in single (half) precision on 64 Xeon Haswell CPUs.
Zhang, Pan; Shen, Yanqing; Wu, Wenjing; Li, Jun; Zhou, Zhongxiang
2018-03-01
Although a number of various reduced graphene oxide (RGO)-based nanomaterials with enhanced photocatalytic performance have recently been characterized, the effect of RGO reductivity on their performance is still not clear. Herein, KNbO3(100) surface modification with three RGO sheets of different reductivity is investigated using first-principles calculations, revealing that increasing RGO reductivity enhances the photocatalytic performance of KNbO3(100)/RGO nanocomposites. In contrast to CeO2/RGO nanocomposites, the O atoms of RGO inhibit the photoactivity of KNbO3/RGO nanocomposites by restraining the effect of inducing a red shift of the corresponding photocatalytic absorption spectra by C 2p states. Increased RGO reductivity extends its absorption edge to the visible light region of the optical absorption and also promotes charge transfer from the KNbO3(100) surface to RGO sheets, in contrast to the behavior observed for g-C3N4/RGO composites. Overall, this work provides a reasonable explanation of controversial experimental results obtained previously, paving the way to the development of highly efficient RGO-based photocatalysts and promoting further photocatalytic applications of KNbO3/RGO nanocomposites.
Multi-threaded ATLAS simulation on Intel Knights Landing processors
Farrell, Steven; Calafiura, Paolo; Leggett, Charles; Tsulaia, Vakhtang; Dotti, Andrea; ATLAS Collaboration
2017-10-01
The Knights Landing (KNL) release of the Intel Many Integrated Core (MIC) Xeon Phi line of processors is a potential game changer for HEP computing. With 72 cores and deep vector registers, the KNL cards promise significant performance benefits for highly-parallel, compute-heavy applications. Cori, the newest supercomputer at the National Energy Research Scientific Computing Center (NERSC), was delivered to its users in two phases with the first phase online at the end of 2015 and the second phase now online at the end of 2016. Cori Phase 2 is based on the KNL architecture and contains over 9000 compute nodes with 96GB DDR4 memory. ATLAS simulation with the multithreaded Athena Framework (AthenaMT) is a good potential use-case for the KNL architecture and supercomputers like Cori. ATLAS simulation jobs have a high ratio of CPU computation to disk I/O and have been shown to scale well in multi-threading and across many nodes. In this paper we will give an overview of the ATLAS simulation application with details on its multi-threaded design. Then, we will present a performance analysis of the application on KNL devices and compare it to a traditional x86 platform to demonstrate the capabilities of the architecture and evaluate the benefits of utilizing KNL platforms like Cori for ATLAS production.
Directory of Open Access Journals (Sweden)
A. Praharaj
2015-01-01
Full Text Available In this work, initially a non-destroyable surface grafting of acid functionalized multiwalled carbon nanotubes (f-MWCNTs with biopolymer chitosan (CS was carried out using glutaraldehyde as a cross-linking agent via the controlled covalent deposition method which was characterized by Fourier transform infrared spectroscopy (FTIR and scanning electron microscopy (SEM. Then, BisGMA (bisphenol-A glycidyldimethacrylate-polyvinylpyrrolidone (PVP blend was prepared (50:50 wt% by a simple sonication method. The CS grafted f-MWCNTs (CS/f-MWCNTs were finally dispersed in BisGMA-PVP blend (BGP50 system in different compositions i.e. 0, 2, 5 and 7 wt% and pressed into molds for the fabrication of reinforced nanocomposites which were characterized by SEM. Nanocomposites reinforced with 2 wt% raw MWCNTs and acid f-MWCNTs were also fabricated and their properties were studied in detail. The results of comparative study report lower values of the investigated properties in nanocomposites with 2 wt% raw and f-MWCNTs than the one with 2 wt% CS/f-MWCNTs proving it to be a better reinforcing nanofiller. Further, the mechanical behavior of the nanocomposites with various CS/f-MWCNTs content showed a dramatic increase in Young’s Modulus, tensile strength, impact strength and hardness along with improved dynamic mechanical, thermal and electrical properties at 5 wt% content of CS/f-MWCNTs. The addition of CS/f-MWCNTs also resulted in reduced corrosion and swelling properties. Thus, the fabricated nanocomposites with optimum nanofiller content could serve as low cost and light weight structural, thermal and electrical materials compatible in various corrosive and solvent based environments.
Efficient irregular wavefront propagation algorithms on Intel® Xeon Phi™
Gomes, Jeremias M.; Teodoro, George; de Melo, Alba; Kong, Jun; Kurc, Tahsin; Saltz, Joel H.
2015-01-01
We investigate the execution of the Irregular Wavefront Propagation Pattern (IWPP), a fundamental computing structure used in several image analysis operations, on the Intel® Xeon Phi™ co-processor. An efficient implementation of IWPP on the Xeon Phi is a challenging problem because of IWPP’s irregularity and the use of atomic instructions in the original IWPP algorithm to resolve race conditions. On the Xeon Phi, the use of SIMD and vectorization instructions is critical to attain high perfo...
Optimizing the MapReduce Framework on Intel Xeon Phi Coprocessor
Lu, Mian; Zhang, Lei; Huynh, Huynh Phung; Ong, Zhongliang; Liang, Yun; He, Bingsheng; Goh, Rick Siow Mong; Huynh, Richard
2013-01-01
With the ease-of-programming, flexibility and yet efficiency, MapReduce has become one of the most popular frameworks for building big-data applications. MapReduce was originally designed for distributed-computing, and has been extended to various architectures, e,g, multi-core CPUs, GPUs and FPGAs. In this work, we focus on optimizing the MapReduce framework on Xeon Phi, which is the latest product released by Intel based on the Many Integrated Core Architecture. To the best of our knowledge...
The Adsorption of Calmoduline via Nicotinamide Immobilized Poly(HEMA-GMA Cryogels
Directory of Open Access Journals (Sweden)
Kadir Erol
2016-12-01
Full Text Available The separation and purification methods for the isolation of an important biomolecule calmoduline protein is extremely important. Among these methods, the adsorption technique is extremely popular, and the cryogels as adsorbents with the macro porous structure and interconnected flow channels cryogel they have are preferred in this field. In this study, the adsorption of calmoduline via Ca(II immobilized poly (2-hydroxyethyl methacrylate-glycidyl methacrylate, poly (HEMA-GMA, cryogels through changing interaction time, calmoduline initial concentration and temperature conditions. For the characterization of cryogels, the swelling test, Fourier Transform Infrared (FT-IR Spectroscopy, Scanning Electron Microscopy (SEM, surface area (BET, elemental analysis and ICP-OES methods were performed. Nicotinamide molecule was used as Ca (II chelating agent and the adsorption capacity of the cryogels was estimated as 1.812 mg calmoduline / g cryogel. The adsorption models of the adsorption reaction were examined by the Langmuir and Freundlich isotherm models and was determined to be more appropriate for Langmuir isotherm model.
Does the Intel Xeon Phi processor fit HEP workloads?
Nowak, A.; Bitzes, G.; Dotti, A.; Lazzaro, A.; Jarp, S.; Szostek, P.; Valsan, L.; Botezatu, M.; Leduc, J.
2014-06-01
This paper summarizes the five years of CERN openlab's efforts focused on the Intel Xeon Phi co-processor, from the time of its inception to public release. We consider the architecture of the device vis a vis the characteristics of HEP software and identify key opportunities for HEP processing, as well as scaling limitations. We report on improvements and speedups linked to parallelization and vectorization on benchmarks involving software frameworks such as Geant4 and ROOT. Finally, we extrapolate current software and hardware trends and project them onto accelerators of the future, with the specifics of offline and online HEP processing in mind.
Profiling CPU-bound workloads on Intel Haswell-EP platforms
Guerri, Marco; Cristovao, Cordeiro; CERN. Geneva. IT Department
2017-01-01
With the increasing adoption of public and private cloud resources to support the demands in terms of computing capacity of the WLCG, the HEP community has begun studying several benchmarking applications aimed at continuously assessing the performance of virtual machines procured from commercial providers. In order to characterise the behaviour of these benchmarks, in-depth profiling activities have been carried out. In this document we outline our experience in profiling one specific application, the ATLAS Kit Validation, in an attempt to explain an unexpected distribution in the performance samples obtained on systems based on Intel Haswell-EP processors.
Einkemmer, Lukas
2017-01-01
To optimize the geometry of airfoils for a specific application is an important engineering problem. In this context genetic algorithms have enjoyed some success as they are able to explore the search space without getting stuck in local optima. However, these algorithms require the computation of aerodynamic properties for a significant number of airfoil geometries. Consequently, for low-speed aerodynamics, panel methods are most often used as the inner solver. In this paper we evaluate the performance of such an optimization algorithm on modern accelerators (more specifically, the Intel Xeon Phi 7120 and the NVIDIA K80). For that purpose, we have implemented an optimized version of the algorithm on the CPU and Xeon Phi (based on OpenMP, vectorization, and the Intel MKL library) and on the GPU (based on CUDA and the MAGMA library). We present timing results for all codes and discuss the similarities and differences between the three implementations. Overall, we observe a speedup of approximately 2.5 for adding an Intel Xeon Phi 7120 to a dual socket workstation and a speedup between 3.4 and 3.8 for adding a NVIDIA K80 to a dual socket workstation.
Why K-12 IT Managers and Administrators Are Embracing the Intel-Based Mac
Technology & Learning, 2007
2007-01-01
Over the past year, Apple has dramatically increased its share of the school computer marketplace--especially in the category of notebook computers. A recent study conducted by Grunwald Associates and Rockman et al. reports that one of the major reasons for this growth is Apple's introduction of the Intel processor to the entire line of Mac…
Autonomous controller (JCAM 10) for CAMAC crate with 8080 (INTEL) microprocessor
International Nuclear Information System (INIS)
Gallice, P.; Mathis, M.
1975-01-01
The CAMAC crate autonomous controller JCAM-10 is designed around an INTEL 8080 microprocessor in association with a 5K RAM and 4K REPROM memory. The concept of the module is described, in which data transfers between CAMAC modules and the memory are optimised from software point of view as well as from execution time. In fact, the JCAM-10 is a microcomputer with a set of 1000 peripheral units represented by the CAMAC modules commercially available
Mashup d'aplicacions basat en un buscador intel·ligent
Sancho Piqueras, Javier
2010-01-01
Mashup de funcionalitats, basat en un cercador intel·ligent, en aquest cas pensat per a cursos, carreres màsters, etc. La finalitat és adjuntar diverses aplicacions amb l'únic propòsit que en aquest cas és un buscador però que també ens permet utilitzar eines per a la connectivitat mitjançant web Services, o xarxes socials. Mashup de funcionalidades, basado en un buscador inteligente, en este caso pensado para cursos, carreras másters, etc. La finalidad es juntar diversas aplicaciones con ...
Saini, Subhash; Hood, Robert T.; Chang, Johnny; Baron, John
2016-01-01
We present a performance evaluation conducted on a production supercomputer of the Intel Xeon Processor E5- 2680v3, a twelve-core implementation of the fourth-generation Haswell architecture, and compare it with Intel Xeon Processor E5-2680v2, an Ivy Bridge implementation of the third-generation Sandy Bridge architecture. Several new architectural features have been incorporated in Haswell including improvements in all levels of the memory hierarchy as well as improvements to vector instructions and power management. We critically evaluate these new features of Haswell and compare with Ivy Bridge using several low-level benchmarks including subset of HPCC, HPCG and four full-scale scientific and engineering applications. We also present a model to predict the performance of HPCG and Cart3D within 5%, and Overflow within 10% accuracy.
Balancing Contention and Synchronization on the Intel Paragon
Bokhari, Shahid H.; Nicol, David M.
1996-01-01
The Intel Paragon is a mesh-connected distributed memory parallel computer. It uses an oblivious and deterministic message routing algorithm: this permits us to develop highly optimized schedules for frequently needed communication patterns. The complete exchange is one such pattern. Several approaches are available for carrying it out on the mesh. We study an algorithm developed by Scott. This algorithm assumes that a communication link can carry one message at a time and that a node can only transmit one message at a time. It requires global synchronization to enforce a schedule of transmissions. Unfortunately global synchronization has substantial overhead on the Paragon. At the same time the powerful interconnection mechanism of this machine permits 2 or 3 messages to share a communication link with minor overhead. It can also overlap multiple message transmission from the same node to some extent. We develop a generalization of Scott's algorithm that executes complete exchange with a prescribed contention. Schedules that incur greater contention require fewer synchronization steps. This permits us to tradeoff contention against synchronization overhead. We describe the performance of this algorithm and compare it with Scott's original algorithm as well as with a naive algorithm that does not take interconnection structure into account. The Bounded contention algorithm is always better than Scott's algorithm and outperforms the naive algorithm for all but the smallest message sizes. The naive algorithm fails to work on meshes larger than 12 x 12. These results show that due consideration of processor interconnect and machine performance parameters is necessary to obtain peak performance from the Paragon and its successor mesh machines.
Does the Intel Xeon Phi processor fit HEP workloads?
International Nuclear Information System (INIS)
Nowak, A; Bitzes, G; Dotti, A; Lazzaro, A; Jarp, S; Szostek, P; Valsan, L; Botezatu, M; Leduc, J
2014-01-01
This paper summarizes the five years of CERN openlab's efforts focused on the Intel Xeon Phi co-processor, from the time of its inception to public release. We consider the architecture of the device vis a vis the characteristics of HEP software and identify key opportunities for HEP processing, as well as scaling limitations. We report on improvements and speedups linked to parallelization and vectorization on benchmarks involving software frameworks such as Geant4 and ROOT. Finally, we extrapolate current software and hardware trends and project them onto accelerators of the future, with the specifics of offline and online HEP processing in mind.
International Nuclear Information System (INIS)
LMP, Campos; Boaro, LC; LKG, Santos; Parra, DF; Lugão, AB
2015-01-01
Dental restorative composites are activated by visible light and the polymerization process, known as direct technique, is initiated by absorbing light in a specific wavelength range (450–500 nm). However this technique presented some disadvantages. If light is not inserted correctly, layers uncured can cause countless damage to restoration, especially with regard to mechanical properties. A clinical alternative used to reduce the shortcomings of direct application is the use of composite resins for indirect application. These composites are adaptations of resins prepared for direct use, with differences mainly in the healing process. Besides the traditional photoactivation, indirect application composites may be submitted to particular curing conditions, such as a slow curing rate, heating, vacuum, and inert-gas pressure leading to an oxygen-free environment. However few studies have been conducted on the process of post-curing by ionizing radiation at low doses. On this sense the purpose of this study was to evaluate possible interactions of ionizing radiation in the post-curing process of the experimental composites based on BisGMA/TEGDMA filled with silica Aerosil OX-50 silanized. Characterization of the experimental composites was performed by thermogravimetry analysis, infrared spectroscopy, elastic modulus and flexural strength. Statistical analysis of results was calculated by one-way ANOVA/Tukey's test. Cross-linking of the polymeric matrix caused by ionizing radiation, influenced the thermal stability of irradiated specimens. FTIR analysis showed that the ionizing radiation induced a post-cure reaction in the specimens. The irradiation dose influenced directly the mechanical properties that showed a strong positive correlation between flexural strength and irradiation and between modulus strength and irradiation. - Highlights: • Interactions of ionizing radiation in BisGMA/TEGDMA experimental dental composites filled with sylanized silica.
Thread-Level Parallelization and Optimization of NWChem for the Intel MIC Architecture
Energy Technology Data Exchange (ETDEWEB)
Shan, Hongzhang; Williams, Samuel; Jong, Wibe de; Oliker, Leonid
2014-10-10
In the multicore era it was possible to exploit the increase in on-chip parallelism by simply running multiple MPI processes per chip. Unfortunately, manycore processors' greatly increased thread- and data-level parallelism coupled with a reduced memory capacity demand an altogether different approach. In this paper we explore augmenting two NWChem modules, triples correction of the CCSD(T) and Fock matrix construction, with OpenMP in order that they might run efficiently on future manycore architectures. As the next NERSC machine will be a self-hosted Intel MIC (Xeon Phi) based supercomputer, we leverage an existing MIC testbed at NERSC to evaluate our experiments. In order to proxy the fact that future MIC machines will not have a host processor, we run all of our experiments in tt native mode. We found that while straightforward application of OpenMP to the deep loop nests associated with the tensor contractions of CCSD(T) was sufficient in attaining high performance, significant effort was required to safely and efficiently thread the TEXAS integral package when constructing the Fock matrix. Ultimately, our new MPI OpenMP hybrid implementations attain up to 65x better performance for the triples part of the CCSD(T) due in large part to the fact that the limited on-card memory limits the existing MPI implementation to a single process per card. Additionally, we obtain up to 1.6x better performance on Fock matrix constructions when compared with the best MPI implementations running multiple processes per card.
Evaluation of vectorization potential of Graph500 on Intel's Xeon Phi
Stanic, Milan; Palomar, Oscar; Ratkovic, Ivan; Duric, Milovan; Unsal, Osman; Cristal, Adrian; Valero, Mateo
2014-01-01
Graph500 is a data intensive application for high performance computing and it is an increasingly important workload because graphs are a core part of most analytic applications. So far there is no work that examines if Graph500 is suitable for vectorization mostly due a lack of vector memory instructions for irregular memory accesses. The Xeon Phi is a massively parallel processor recently released by Intel with new features such as a wide 512-bit vector unit and vector scatter/gather instru...
Newsgroups, Activist Publics, and Corporate Apologia: The Case of Intel and Its Pentium Chip.
Hearit, Keith Michael
1999-01-01
Applies J. Grunig's theory of publics to the phenomenon of Internet newsgroups using the case of the flawed Intel Pentium chip. Argues that technology facilitates the rapid movement of publics from the theoretical construct stage to the active stage. Illustrates some of the difficulties companies face in establishing their identity in cyberspace.…
A Non-Intrusive GMA Welding Process Quality Monitoring System Using Acoustic Sensing.
Cayo, Eber Huanca; Alfaro, Sadek Crisostomo Absi
2009-01-01
Most of the inspection methods used for detection and localization of welding disturbances are based on the evaluation of some direct measurements of welding parameters. This direct measurement requires an insertion of sensors during the welding process which could somehow alter the behavior of the metallic transference. An inspection method that evaluates the GMA welding process evolution using a non-intrusive process sensing would allow not only the identification of disturbances during welding runs and thus reduce inspection time, but would also reduce the interference on the process caused by the direct sensing. In this paper a nonintrusive method for weld disturbance detection and localization for weld quality evaluation is demonstrated. The system is based on the acoustic sensing of the welding electrical arc. During repetitive tests in welds without disturbances, the stability acoustic parameters were calculated and used as comparison references for the detection and location of disturbances during the weld runs.
3-D electromagnetic plasma particle simulations on the Intel Delta parallel computer
International Nuclear Information System (INIS)
Wang, J.; Liewer, P.C.
1994-01-01
A three-dimensional electromagnetic PIC code has been developed on the 512 node Intel Touchstone Delta MIMD parallel computer. This code is based on the General Concurrent PIC algorithm which uses a domain decomposition to divide the computation among the processors. The 3D simulation domain can be partitioned into 1-, 2-, or 3-dimensional sub-domains. Particles must be exchanged between processors as they move among the subdomains. The Intel Delta allows one to use this code for very-large-scale simulations (i.e. over 10 8 particles and 10 6 grid cells). The parallel efficiency of this code is measured, and the overall code performance on the Delta is compared with that on Cray supercomputers. It is shown that their code runs with a high parallel efficiency of ≥ 95% for large size problems. The particle push time achieved is 115 nsecs/particle/time step for 162 million particles on 512 nodes. Comparing with the performance on a single processor Cray C90, this represents a factor of 58 speedup. The code uses a finite-difference leap frog method for field solve which is significantly more efficient than fast fourier transforms on parallel computers. The performance of this code on the 128 node Cray T3D will also be discussed
Practical Implementation of Lattice QCD Simulation on Intel Xeon Phi Knights Landing
Kanamori, Issaku; Matsufuru, Hideo
2017-01-01
We investigate implementation of lattice Quantum Chromodynamics (QCD) code on the Intel Xeon Phi Knights Landing (KNL). The most time consuming part of the numerical simulations of lattice QCD is a solver of linear equation for a large sparse matrix that represents the strong interaction among quarks. To establish widely applicable prescriptions, we examine rather general methods for the SIMD architecture of KNL, such as using intrinsics and manual prefetching, to the matrix multiplication an...
Abuter, Roberto; Tischer, Helmut; Frahm, Robert
2014-07-01
Several high frequency loops are required to run the VLTI (Very Large Telescope Interferometer) 2, e.g. for fringe tracking11, 5, angle tracking, vibration cancellation, data capture. All these loops rely on low latency real time computers based on the VME bus, Motorola PowerPC14 hardware architecture. In this context, one highly demanding application in terms of cycle time, latency and data transfer volume is the VLTI centralized recording facility, so called, RMN recorder1 (Reflective Memory Recorder). This application captures and transfers data flowing through the distributed memory of the system in real time. Some of the VLTI data producers are running with frequencies up to 8 KHz. With the evolution from first generation instruments like MIDI3, PRIMA5, and AMBER4 which use one or two baselines, to second generation instruments like MATISSE10 and GRAVITY9 which will use all six baselines simultaneously, the quantity of signals has increased by, at least, a factor of six. This has led to a significant overload of the RMN recorder1 which has reached the natural limits imposed by the underlying hardware. At the same time, new, more powerful computers, based on the Intel multicore families of CPUs and PCI buses have become available. With the purpose of improving the performance of the RMN recorder1 application and in order to make it capable of coping with the demands of the new generation instruments, a slightly modified implementation has been developed and integrated into an Intel based multicore computer15 running the VxWorks17 real time operating system. The core of the application is based on the standard VLT software framework for instruments13. The real time task reads from the reflective memory using the onboard DMA access12 and captured data is transferred to the outside world via a TCP socket on a dedicated Ethernet connection. The diversity of the software and hardware that are involved makes this application suitable as a benchmarking platform. A
[Splenic infarction at high altitude, Huaraz-Peru (3,100 masl)].
López de Guimaraes, Douglas; Menacho López, Julio; Villanueva Palacios, Jovita; Mosquera Vásquez, Vitaliano
2009-01-01
We report three cases of splenic infarction in healthy men for the first time that amounted to high altitudes, observed in the hospital "Victor Ramos Guardia" Huaraz (3100 m). Case 1 (1995) of 55 years, born in Cuba, from Lima, caucasian suddenly presented acute abdominal pain in epigastrium, distension, nausea and vomiting, was laparotomized for acute abdomen and surgical pathology revealed thrombosis with splenic infarction splenic artery and vein. During follow-up in Lima, hemoglobin electrophoresis showed that it was heterozygous carrier of the sickle trait (Hb A: 57% Hb S: 38.5%). Case 2 (1998) of 23 years, born in Cuba, from Lima, Black said acute abdominal pain in left hypochondrium, shortness of breath and chest pain, clinical examination and radiography of the abdomen showed the spleen volume increased. Case 3 (2006) of 17 years, natural and from Lima, mestizo, who came on tour promotion, acute abdominal pain referred onset in the epigastrium and left hypochondrium, headache, increase heat, nausea and vomiting, pharyngitis was found acute and painful, and spleen increased in size by clinical and x-ray of abdomen simple stand. None had no history of hemoglobinopathy and anemia. In general, medical management was supportive and cases 2 and 3 are recommended hemoglobin electrophoresis. We conclude that we must think of splenic infarction associated with height in any healthy person who is first at high altitude (> 3000m) and having a sudden acute abdominal pain in epigastrium and / or left hypochondrium, pain and palpable spleen and radiological study compatible with image. In this case is indicated by hemoglobin electrophoresis to determine whether there is an individual heterozygous carrier of the sickle trait. splenic infarction, high altitude, sickle trait, Huaraz.
DBPQL: A view-oriented query language for the Intel Data Base Processor
Fishwick, P. A.
1983-01-01
An interactive query language (BDPQL) for the Intel Data Base Processor (DBP) is defined. DBPQL includes a parser generator package which permits the analyst to easily create and manipulate the query statement syntax and semantics. The prototype language, DBPQL, includes trace and performance commands to aid the analyst when implementing new commands and analyzing the execution characteristics of the DBP. The DBPQL grammar file and associated key procedures are included as an appendix to this report.
Bliemel, Michael; Ali-Hassan, Hossam
2014-01-01
For several years, we used Intel's flash-based game "IT Manager 3: Unseen Forces" as an experiential learning tool, where students had to act as a manager making real-time prioritization decisions about repairing computer problems, training and upgrading systems with better technologies as well as managing increasing numbers of technical…
International Nuclear Information System (INIS)
Singh, Vijay K.; Wise, Stephen Y.; Fatanmi, Oluseyi O.; Beattie, Lindsay A.; Ducey, Elizabeth J.; Seed, Thomas M.
2014-01-01
The purpose of this study was to elucidate the role of alpha-tocopherol succinate (TS)- and AMD3100-mobilized progenitors in mitigating combined injury associated with acute radiation exposure in combination with secondary physical wounding. CD2F1 mice were exposed to high doses of cobalt-60 gamma-radiation and then transfused intravenously with 5 million peripheral blood mononuclear cells (PBMCs) from TS- and AMD3100-injected mice after irradiation. Within 1 h after irradiation, mice were exposed to secondary wounding. Mice were observed for 30 d after irradiation and cytokine analysis was conducted by multiplex Luminex assay at various time-points after irradiation and wounding. Our results initially demonstrated that transfusion of TS-mobilized progenitors from normal mice enhanced survival of acutely irradiated mice exposed 24 h prior to transfusion to supralethal doses (11.5–12.5 Gy) of 60 Co gamma-radiation. Subsequently, comparable transfusions of TS-mobilized progenitors were shown to significantly mitigate severe combined injuries in acutely irradiated mice. TS administered 24 h before irradiation was able to protect mice against combined injury as well. Cytokine results demonstrated that wounding modulates irradiation-induced cytokines. This study further supports the conclusion that the infusion of TS-mobilized progenitor-containing PBMCs acts as a bridging therapy in radiation-combined-injury mice. We suggest that this novel bridging therapeutic approach involving the infusion of TS-mobilized hematopoietic progenitors following acute radiation exposure or combined injury might be applicable to humans. (author)
A Monte Carlo study of the ''minus sign problem'' in the t-J model using an intel IPSC/860 hypercube
International Nuclear Information System (INIS)
Kovarik, M.D.; Barnes, T.; Tennessee Univ., Knoxville, TN
1993-01-01
We describe a Monte Carlo simulation of the 2-dimensional t-J model on an Intel iPSC/860 hypercube. The problem studied is the determination of the dispersion relation of a dynamical hole in the t-J model of the high temperature superconductors. Since this problem involves the motion of many fermions in more than one spatial dimensions, it is representative of the class of systems that suffer from the ''minus sign problem'' of dynamical fermions which has made Monte Carlo simulation very difficult. We demonstrate that for small values of the hole hopping parameter one can extract the entire hole dispersion relation using the GRW Monte Carlo algorithm, which is a simulation of the Euclidean time Schroedinger equation, and present results on 4 x 4 and 6 x 6 lattices. We demonstrate that a qualitative picture at higher hopping parameters may be found by extrapolating weak hopping results where the minus sign problem is less severe. Generalization to physical hopping parameter values will only require use of an improved trial wavefunction for importance sampling
Directory of Open Access Journals (Sweden)
Aline B. Denis
2016-01-01
Full Text Available This study aimed to analyze the kinetic parameters of two monomers using attenuated total reflectance Fourier transform infrared (ATR-FTIR: 2,2-bis-[4-(2-hydroxy-3-methacryloxypropyl-1-oxy-phenyl] propane (Bis-GMA and triethylene glycol dimethacrylate (TEGDMA. The following were calculated to evaluate the kinetic parameters: maximum conversion rate (Rpmax, time at the maximum polymerization rate (tmax, conversion at Rpmax, and total conversion recorded at the maximum conversion point after 300 s. Camphorquinone (CQ and phenyl propanedione (PPD were used in this study as photoinitiators, whereas N,N-dimethyl-p-toluidine (DMPT amine was used as a coinitiator. LED apparatus and halogen lamp were used in turn to evaluate the effect that light source had on the monomer kinetics. The mass concentration ratio for the three resin preparations was 0.7 : 0.3 for Bis-GMA and TEGDMA: R1 (CQ + DMPT, R2 (PPD + DMPT, and R3 (PPD + CQ + DMPT. The PPD association with the CQ photoinitiator altered the polymerization kinetics compared to a resin containing only the CQ photoinitiator. The light sources exhibited no significant differences for tmax of R1 and R3. Resins containing only the PPD initiator exhibited a higher tmax than those containing only CQ. However, the Rpmax decreased for resins containing the PPD photoinitiator.
Acceleration of Blender Cycles Path-Tracing Engine Using Intel Many Integrated Core Architecture
Jaroš , Milan; Říha , Lubomír; Strakoš , Petr; Karásek , Tomáš; Vašatová , Alena; Jarošová , Marta; Kozubek , Tomáš
2015-01-01
Part 2: Algorithms; International audience; This paper describes the acceleration of the most computationally intensive kernels of the Blender rendering engine, Blender Cycles, using Intel Many Integrated Core architecture (MIC). The proposed parallelization, which uses OpenMP technology, also improves the performance of the rendering engine when running on multi-core CPUs and multi-socket servers. Although the GPU acceleration is already implemented in Cycles, its functionality is limited. O...
Performance of R-GMA based grid job monitoring system for CMS data production
Byrom, Robert; Fisher, Steve M; Grandi, Claudio; Hobson, Peter R; Kyberd, Paul; MacEvoy, Barry; Nebrensky, Jindrich Josef; Tallini, Hugh; Traylen, Stephen
2004-01-01
High Energy Physics experiments, such as the Compact Muon Solenoid (CMS) at the CERN laboratory in Geneva, have large-scale data processing requirements, with stored data accumulating at a rate of 1 Gbyte/s. This load comfortably exceeds any previous processing requirements and we believe it may be most efficiently satisfied through Grid computing. Management of large Monte Carlo productions (~3000 jobs) or data analyses and the quality assurance of the results requires careful monitoring and bookkeeping, and an important requirement when using the Grid is the ability to monitor transparently the large number of jobs that are being executed simultaneously at multiple remote sites. R-GMA is a monitoring and information management service for distributed resources based on the Grid Monitoring Architecture of the Global Grid Forum. We have previously developed a system allowing us to test its performance under a heavy load while using few real Grid resources. We present the latest results on this system and comp...
DEFF Research Database (Denmark)
Hatse, Sigrid; Princen, Katrien; Vermeire, Kurt
2003-01-01
The interaction of the CXCR4 antagonist AMD3100 with its target is greatly influenced by specific aspartate residues in the receptor protein, including Asp(171) and Asp(262). We have now found that aspartate-to-asparagine substitutions at these positions differentially affect the binding of four...
International Nuclear Information System (INIS)
Kovarik, M.D.; Barnes, T.; Tennessee Univ., Knoxville, TN
1993-01-01
We describe a Monte Carlo simulation of a dynamical fermion problem in two spatial dimensions on an Intel iPSC/860 hypercube. The problem studied is the determination of the dispersion relation of a dynamical hole in the t-J model of the high temperature superconductors. Since this problem involves the motion of many fermions in more than one spatial dimensions, it is representative of the class of systems that suffer from the ''minus sign problem'' of dynamical fermions which has made Monte Carlo simulation very difficult. We demonstrate that for small values of the hole hopping parameter one can extract the entire hole dispersion relation using the GRW Monte Carlo algorithm, which is a simulation of the Euclidean time Schroedinger equation, and present results on 4 x 4 and 6 x 6 lattices. Generalization to physical hopping parameter values wig only require use of an improved trial wavefunction for importance sampling
Faerber, Christian
2017-10-01
The LHCb experiment at the LHC will upgrade its detector by 2018/2019 to a ‘triggerless’ readout scheme, where all the readout electronics and several sub-detector parts will be replaced. The new readout electronics will be able to readout the detector at 40 MHz. This increases the data bandwidth from the detector down to the Event Filter farm to 40 TBit/s, which also has to be processed to select the interesting proton-proton collision for later storage. The architecture of such a computing farm, which can process this amount of data as efficiently as possible, is a challenging task and several compute accelerator technologies are being considered for use inside the new Event Filter farm. In the high performance computing sector more and more FPGA compute accelerators are used to improve the compute performance and reduce the power consumption (e.g. in the Microsoft Catapult project and Bing search engine). Also for the LHCb upgrade the usage of an experimental FPGA accelerated computing platform in the Event Building or in the Event Filter farm is being considered and therefore tested. This platform from Intel hosts a general CPU and a high performance FPGA linked via a high speed link which is for this platform a QPI link. On the FPGA an accelerator is implemented. The used system is a two socket platform from Intel with a Xeon CPU and an FPGA. The FPGA has cache-coherent memory access to the main memory of the server and can collaborate with the CPU. As a first step, a computing intensive algorithm to reconstruct Cherenkov angles for the LHCb RICH particle identification was successfully ported in Verilog to the Intel Xeon/FPGA platform and accelerated by a factor of 35. The same algorithm was ported to the Intel Xeon/FPGA platform with OpenCL. The implementation work and the performance will be compared. Also another FPGA accelerator the Nallatech 385 PCIe accelerator with the same Stratix V FPGA were tested for performance. The results show that the Intel
Applying the roofline performance model to the intel xeon phi knights landing processor
Doerfler, D; Deslippe, J; Williams, S; Oliker, L; Cook, B; Kurth, T; Lobet, M; Malas, T; Vay, JL; Vincenti, H
2016-01-01
� Springer International Publishing AG 2016. The Roofline Performance Model is a visually intuitive method used to bound the sustained peak floating-point performance of any given arithmetic kernel on any given processor architecture. In the Roofline, performance is nominally measured in floating-point operations per second as a function of arithmetic intensity (operations per byte of data). In this study we determine the Roofline for the Intel Knights Landing (KNL) processor, determining t...
Performance Engineering for a Medical Imaging Application on the Intel Xeon Phi Accelerator
Hofmann, Johannes; Treibig, Jan; Hager, Georg; Wellein, Gerhard
2013-01-01
We examine the Xeon Phi, which is based on Intel's Many Integrated Cores architecture, for its suitability to run the FDK algorithm--the most commonly used algorithm to perform the 3D image reconstruction in cone-beam computed tomography. We study the challenges of efficiently parallelizing the application and means to enable sensible data sharing between threads despite the lack of a shared last level cache. Apart from parallelization, SIMD vectorization is critical for good performance on t...
Gorshkov, Anton V; Kirillin, Mikhail Yu
2015-08-01
Over two decades, the Monte Carlo technique has become a gold standard in simulation of light propagation in turbid media, including biotissues. Technological solutions provide further advances of this technique. The Intel Xeon Phi coprocessor is a new type of accelerator for highly parallel general purpose computing, which allows execution of a wide range of applications without substantial code modification. We present a technical approach of porting our previously developed Monte Carlo (MC) code for simulation of light transport in tissues to the Intel Xeon Phi coprocessor. We show that employing the accelerator allows reducing computational time of MC simulation and obtaining simulation speed-up comparable to GPU. We demonstrate the performance of the developed code for simulation of light transport in the human head and determination of the measurement volume in near-infrared spectroscopy brain sensing.
Energy Technology Data Exchange (ETDEWEB)
Jin, Zheming [Argonne National Lab. (ANL), Argonne, IL (United States); Yoshii, Kazutomo [Argonne National Lab. (ANL), Argonne, IL (United States); Finkel, Hal [Argonne National Lab. (ANL), Argonne, IL (United States); Cappello, Franck [Argonne National Lab. (ANL), Argonne, IL (United States)
2017-04-20
Open Computing Language (OpenCL) is a high-level language that enables software programmers to explore Field Programmable Gate Arrays (FPGAs) for application acceleration. The Intel FPGA software development kit (SDK) for OpenCL allows a user to specify applications at a high level and explore the performance of low-level hardware acceleration. In this report, we present the FPGA performance and power consumption results of the single-precision floating-point vector add OpenCL kernel using the Intel FPGA SDK for OpenCL on the Nallatech 385A FPGA board. The board features an Arria 10 FPGA. We evaluate the FPGA implementations using the compute unit duplication and kernel vectorization optimization techniques. On the Nallatech 385A FPGA board, the maximum compute kernel bandwidth we achieve is 25.8 GB/s, approximately 76% of the peak memory bandwidth. The power consumption of the FPGA device when running the kernels ranges from 29W to 42W.
Mielikainen, Jarno; Huang, Bormin; Huang, Allen H.-L.
2015-05-01
The most widely used community weather forecast and research model in the world is the Weather Research and Forecast (WRF) model. Two distinct varieties of WRF exist. The one we are interested is the Advanced Research WRF (ARW) is an experimental, advanced research version featuring very high resolution. The WRF Nonhydrostatic Mesoscale Model (WRF-NMM) has been designed for forecasting operations. WRF consists of dynamics code and several physics modules. The WRF-ARW core is based on an Eulerian solver for the fully compressible nonhydrostatic equations. In the paper, we optimize a meridional (north-south direction) advection subroutine for Intel Xeon Phi coprocessor. Advection is of the most time consuming routines in the ARW dynamics core. It advances the explicit perturbation horizontal momentum equations by adding in the large-timestep tendency along with the small timestep pressure gradient tendency. We will describe the challenges we met during the development of a high-speed dynamics code subroutine for MIC architecture. Furthermore, lessons learned from the code optimization process will be discussed. The results show that the optimizations improved performance of the original code on Xeon Phi 7120P by a factor of 1.2x.
Performance Analysis of an Astrophysical Simulation Code on the Intel Xeon Phi Architecture
Noormofidi, Vahid; Atlas, Susan R.; Duan, Huaiyu
2015-01-01
We have developed the astrophysical simulation code XFLAT to study neutrino oscillations in supernovae. XFLAT is designed to utilize multiple levels of parallelism through MPI, OpenMP, and SIMD instructions (vectorization). It can run on both CPU and Xeon Phi co-processors based on the Intel Many Integrated Core Architecture (MIC). We analyze the performance of XFLAT on configurations with CPU only, Xeon Phi only and both CPU and Xeon Phi. We also investigate the impact of I/O and the multi-n...
Stoykov, S.; Atanassov, E.; Margenov, S.
2016-10-01
Many of the scientific applications involve sparse or dense matrix operations, such as solving linear systems, matrix-matrix products, eigensolvers, etc. In what concerns structural nonlinear dynamics, the computations of periodic responses and the determination of stability of the solution are of primary interest. Shooting method iswidely used for obtaining periodic responses of nonlinear systems. The method involves simultaneously operations with sparse and dense matrices. One of the computationally expensive operations in the method is multiplication of sparse by dense matrices. In the current work, a new algorithm for sparse matrix by dense matrix products is presented. The algorithm takes into account the structure of the sparse matrix, which is obtained by space discretization of the nonlinear Mindlin's plate equation of motion by the finite element method. The algorithm is developed to use the vector engine of Intel Xeon Phi coprocessors. It is compared with the standard sparse matrix by dense matrix algorithm and the one developed by Intel MKL and it is shown that by considering the properties of the sparse matrix better algorithms can be developed.
Directory of Open Access Journals (Sweden)
Lara Muralt
2018-06-01
Full Text Available Objective: To evaluate the effects of acute exposure to high altitude and preventive dexamethasone treatment on postural control in patients with chronic obstructive pulmonary disease (COPD.Methods: In this randomized, double-blind parallel-group trial, 104 lowlanders with COPD GOLD 1-2 age 20–75 years, living near Bishkek (760 m, were randomized to receive either dexamethasone (2 × 4 mg/day p.o. or placebo on the day before ascent and during a 2-day sojourn at Tuja-Ashu high altitude clinic (3100 m, Kyrgyzstan. Postural control was assessed with a Wii Balance BoardTM at 760 m and 1 day after arrival at 3100 m. Patients were instructed to stand immobile on both legs with eyes open during five tests of 30 s each, while the center of pressure path length (PL was measured.Results: With ascent from 760 to 3100 m the PL increased in the placebo group from median (quartiles 29.2 (25.8; 38.2 to 31.5 (27.3; 39.3 cm (P < 0.05; in the dexamethasone group the corresponding increase from 28.8 (22.8; 34.5 to 29.9 (25.2; 37.0 cm was not significant (P = 0.10. The mean difference (95% CI between dexamethasone and placebo groups in altitude-induced changes (treatment effect was -0.3 (-3.2 to 2.5 cm, (P = 0.41. Multivariable regression analysis confirmed a significant increase in PL with higher altitude (coefficient 1.6, 95% CI 0.2 to 3.1, P = 0.031 but no effect of dexamethasone was shown (coefficient -0.2, 95% CI -0.4 to 3.6, P = 0.925, even when controlled for several potential confounders. PL changes were related more to antero-posterior than lateral sway. Twenty-two of 104 patients had an altitude-related increase in the antero-posterior sway velocity of >25%, what has been associated with an increased risk of falls in previous studies.Conclusion: Lowlanders with COPD travelling from 760 to 3100 m revealed postural instability 24 h after arriving at high altitude, and this was not prevented by dexamethasone.Trial Registration
Wang, H.; Chen, H.; Chen, X.; Wu, Q.; Wang, Z.
2016-12-01
The Global Nested Air Quality Prediction Modeling System for Hg (GNAQPMS-Hg) is a global chemical transport model coupled Hg transport module to investigate the mercury pollution. In this study, we present our work of transplanting the GNAQPMS model on Intel Xeon Phi processor, Knights Landing (KNL) to accelerate the model. KNL is the second-generation product adopting Many Integrated Core Architecture (MIC) architecture. Compared with the first generation Knight Corner (KNC), KNL has more new hardware features, that it can be used as unique processor as well as coprocessor with other CPU. According to the Vtune tool, the high overhead modules in GNAQPMS model have been addressed, including CBMZ gas chemistry, advection and convection module, and wet deposition module. These high overhead modules were accelerated by optimizing code and using new techniques of KNL. The following optimized measures was done: 1) Changing the pure MPI parallel mode to hybrid parallel mode with MPI and OpenMP; 2.Vectorizing the code to using the 512-bit wide vector computation unit. 3. Reducing unnecessary memory access and calculation. 4. Reducing Thread Local Storage (TLS) for common variables with each OpenMP thread in CBMZ. 5. Changing the way of global communication from files writing and reading to MPI functions. After optimization, the performance of GNAQPMS is greatly increased both on CPU and KNL platform, the single-node test showed that optimized version has 2.6x speedup on two sockets CPU platform and 3.3x speedup on one socket KNL platform compared with the baseline version code, which means the KNL has 1.29x speedup when compared with 2 sockets CPU platform.
Benchmarking Data Analysis and Machine Learning Applications on the Intel KNL Many-Core Processor
Byun, Chansup; Kepner, Jeremy; Arcand, William; Bestor, David; Bergeron, Bill; Gadepally, Vijay; Houle, Michael; Hubbell, Matthew; Jones, Michael; Klein, Anna; Michaleas, Peter; Milechin, Lauren; Mullen, Julie; Prout, Andrew; Rosa, Antonio
2017-01-01
Knights Landing (KNL) is the code name for the second-generation Intel Xeon Phi product family. KNL has generated significant interest in the data analysis and machine learning communities because its new many-core architecture targets both of these workloads. The KNL many-core vector processor design enables it to exploit much higher levels of parallelism. At the Lincoln Laboratory Supercomputing Center (LLSC), the majority of users are running data analysis applications such as MATLAB and O...
Energy Technology Data Exchange (ETDEWEB)
Anderson, James [Y-12 National Security Complex, Oak Ridge, TN (United States); Goins, Monty [Y-12 National Security Complex, Oak Ridge, TN (United States); Paul, Pran [Y-12 National Security Complex, Oak Ridge, TN (United States); Wilkinson, Alan [Y-12 National Security Complex, Oak Ridge, TN (United States); Wilson, David [Y-12 National Security Complex, Oak Ridge, TN (United States)
2015-09-03
This safety analysis report for packaging (SARP) presents the results of the safety analysis prepared in support of the Consolidated Nuclear Security, LLC (CNS) request for licensing of the Model ES-3100 package with bulk highly enriched uranium (HEU) contents and issuance of a Type B(U) Fissile Material Certificate of Compliance. This SARP, published in the format specified in the Nuclear Regulatory Commission (NRC) Regulatory Guide 7.9 and using information provided in UCID-21218 and NRC Regulatory Guide 7.10, demonstrates that the Y-12 National Security Complex (Y-12) ES-3100 package with bulk HEU contents meets the established NRC regulations for packaging, preparation for shipment, and transportation of radioactive materials given in Title 10, Part 71, of the Code of Federal Regulations (CFR) [10 CFR 71] as well as U.S. Department of Transportation (DOT) regulations for packaging and shipment of hazardous materials given in Title 49 CFR. To protect the health and safety of the public, shipments of adioactive materials are made in packaging that is designed, fabricated, assembled, tested, procured, used, maintained, and repaired in accordance with the provisions cited above. Safety requirements addressed by the regulations that must be met when transporting radioactive materials are containment of radioactive materials, radiation shielding, and assurance of nuclear subcriticality.
Wang, Hui; Chen, Huansheng; Wu, Qizhong; Lin, Junmin; Chen, Xueshun; Xie, Xinwei; Wang, Rongrong; Tang, Xiao; Wang, Zifa
2017-08-01
The Global Nested Air Quality Prediction Modeling System (GNAQPMS) is the global version of the Nested Air Quality Prediction Modeling System (NAQPMS), which is a multi-scale chemical transport model used for air quality forecast and atmospheric environmental research. In this study, we present the porting and optimisation of GNAQPMS on a second-generation Intel Xeon Phi processor, codenamed Knights Landing (KNL). Compared with the first-generation Xeon Phi coprocessor (codenamed Knights Corner, KNC), KNL has many new hardware features such as a bootable processor, high-performance in-package memory and ISA compatibility with Intel Xeon processors. In particular, we describe the five optimisations we applied to the key modules of GNAQPMS, including the CBM-Z gas-phase chemistry, advection, convection and wet deposition modules. These optimisations work well on both the KNL 7250 processor and the Intel Xeon E5-2697 V4 processor. They include (1) updating the pure Message Passing Interface (MPI) parallel mode to the hybrid parallel mode with MPI and OpenMP in the emission, advection, convection and gas-phase chemistry modules; (2) fully employing the 512 bit wide vector processing units (VPUs) on the KNL platform; (3) reducing unnecessary memory access to improve cache efficiency; (4) reducing the thread local storage (TLS) in the CBM-Z gas-phase chemistry module to improve its OpenMP performance; and (5) changing the global communication from writing/reading interface files to MPI functions to improve the performance and the parallel scalability. These optimisations greatly improved the GNAQPMS performance. The same optimisations also work well for the Intel Xeon Broadwell processor, specifically E5-2697 v4. Compared with the baseline version of GNAQPMS, the optimised version was 3.51 × faster on KNL and 2.77 × faster on the CPU. Moreover, the optimised version ran at 26 % lower average power on KNL than on the CPU. With the combined performance and energy
Directory of Open Access Journals (Sweden)
Hahn, Eckhart G.
2009-08-01
Full Text Available [english] The Framework for Qualifications of the European Higher Education Area (FQ-EHEA; Bologna Process and the European Qualifications Framework for Lifelong Learning (EQF-LLL; Lisbon Process are competence-driven frameworks for vocational and higher education programmes in need for defined learning objectives. In the field of medical education, The Netherlands and Switzerland have developed national catalogues for undergraduate medical training, which are competence-based and compatible with a two-cycle curriculum comprised of a Bachelor in Medicine and a Master in Medicine. In Germany, virtually all medical organizations, last not least the Association of Medical Faculties (MFT, have voted against the application of the two-cycle (and the three-cycle curriculum to medical undergraduate education. A standstill of the European processes will not be accepted in the political arena, and a proposition was made by the Conference of German Ministers of Higher Education to develop a medical qualification framework for Germany, asking the Association for Medical Education (GMA and the MFT to join forces. This is not possible without consented national learning objectives derived from the professional context of physicians. The GMA has teamed up with the MFT to develop National Competence-Based Learning Objectives for Undergraduate Medical Education (NKLM in Germany (see Figure 1 to fulfill these needs.
Evaluation of the Intel Sandy Bridge-EP server processor
Jarp, S; Leduc, J; Nowak, A; CERN. Geneva. IT Department
2012-01-01
In this paper we report on a set of benchmark results recently obtained by CERN openlab when comparing an 8-core “Sandy Bridge-EP” processor with Intel’s previous microarchitecture, the “Westmere-EP”. The Intel marketing names for these processors are “Xeon E5-2600 processor series” and “Xeon 5600 processor series”, respectively. Both processors are produced in a 32nm process, and both platforms are dual-socket servers. Multiple benchmarks were used to get a good understanding of the performance of the new processor. We used both industry-standard benchmarks, such as SPEC2006, and specific High Energy Physics benchmarks, representing both simulation of physics detectors and data analysis of physics events. Before summarizing the results we must stress the fact that benchmarking of modern processors is a very complex affair. One has to control (at least) the following features: processor frequency, overclocking via Turbo mode, the number of physical cores in use, the use of logical cores ...
Implementation of a 3-D nonlinear MHD [magnetohydrodynamics] calculation on the Intel hypercube
International Nuclear Information System (INIS)
Lynch, V.E.; Carreras, B.A.; Drake, J.B.; Hicks, H.R.; Lawkins, W.F.
1987-01-01
The optimization of numerical schemes and increasing computer capabilities in the last ten years have improved the efficiency of 3-D nonlinear resistive MHD calculations by about two to three orders of magnitude. However, we are still very limited in performing these types of calculations. Hypercubes have a large number of processors with only local memory and bidirectional links among neighbors. The Intel Hypercube at Oak Ridge has 64 processors with 0.5 megabytes of memory per processor. The multiplicity of processors opens new possibilities for the treatment of such computations. The constraint on time and resources favored the approach of using the existing RSF code which solves as an initial value problem the reduced set of MHD equations for a periodic cylindrical geometry. This code includes minimal physics and geometry, but contains the basic three dimensionality and nonlinear structure of the equations. The code solves the reduced set of MHD equations by Fourier expansion in two angular coordinates and finite differences in the radial one. Due to the continuing interest in these calculations and the likelihood that future supercomputers will take greater advantage of parallelism, the present study was initiated by the ORNL Exploratory Studies Committee and funded entirely by Laboratory Discretionary Funds. The objectives of the study were: to ascertain the suitability of MHD calculation for parallel computation, to design and implement a parallel algorithm to perform the computations, and to evaluate the hypercube, and in particular, ORNL's Intel iPSC, for use in MHD computations
GW Calculations of Materials on the Intel Xeon-Phi Architecture
Deslippe, Jack; da Jornada, Felipe H.; Vigil-Fowler, Derek; Biller, Ariel; Chelikowsky, James R.; Louie, Steven G.
Intel Xeon-Phi processors are expected to power a large number of High-Performance Computing (HPC) systems around the United States and the world in the near future. We evaluate the ability of GW and pre-requisite Density Functional Theory (DFT) calculations for materials on utilizing the Xeon-Phi architecture. We describe the optimization process and performance improvements achieved. We find that the GW method, like other higher level Many-Body methods beyond standard local/semilocal approximations to Kohn-Sham DFT, is particularly well suited for many-core architectures due to the ability to exploit a large amount of parallelism over plane-waves, band-pairs and frequencies. Support provided by the SCIDAC program, Department of Energy, Office of Science, Advanced Scientic Computing Research and Basic Energy Sciences. Grant Numbers DE-SC0008877 (Austin) and DE-AC02-05CH11231 (LBNL).
Blocked All-Pairs Shortest Paths Algorithm on Intel Xeon Phi KNL Processor: A Case Study
Rucci, Enzo; De Giusti, Armando Eduardo; Naiouf, Marcelo
2017-01-01
Manycores are consolidating in HPC community as a way of improving performance while keeping power efficiency. Knights Landing is the recently released second generation of Intel Xeon Phi architec- ture.While optimizing applications on CPUs, GPUs and first Xeon Phi’s has been largely studied in the last years, the new features in Knights Landing processors require the revision of programming and optimization techniques for these devices. In this work, we selected the Floyd-Warshall algorithm ...
Evaluation of the OpenCL AES Kernel using the Intel FPGA SDK for OpenCL
Energy Technology Data Exchange (ETDEWEB)
Jin, Zheming [Argonne National Lab. (ANL), Argonne, IL (United States); Yoshii, Kazutomo [Argonne National Lab. (ANL), Argonne, IL (United States); Finkel, Hal [Argonne National Lab. (ANL), Argonne, IL (United States); Cappello, Franck [Argonne National Lab. (ANL), Argonne, IL (United States)
2017-04-20
The OpenCL standard is an open programming model for accelerating algorithms on heterogeneous computing system. OpenCL extends the C-based programming language for developing portable codes on different platforms such as CPU, Graphics processing units (GPUs), Digital Signal Processors (DSPs) and Field Programmable Gate Arrays (FPGAs). The Intel FPGA SDK for OpenCL is a suite of tools that allows developers to abstract away the complex FPGA-based development flow for a high-level software development flow. Users can focus on the design of hardware-accelerated kernel functions in OpenCL and then direct the tools to generate the low-level FPGA implementations. The approach makes the FPGA-based development more accessible to software users as the needs for hybrid computing using CPUs and FPGAs are increasing. It can also significantly reduce the hardware development time as users can evaluate different ideas with high-level language without deep FPGA domain knowledge. In this report, we evaluate the performance of the kernel using the Intel FPGA SDK for OpenCL and Nallatech 385A FPGA board. Compared to the M506 module, the board provides more hardware resources for a larger design exploration space. The kernel performance is measured with the compute kernel throughput, an upper bound to the FPGA throughput. The report presents the experimental results in details. The Appendix lists the kernel source code.
Directory of Open Access Journals (Sweden)
H. Wang
2017-08-01
Full Text Available The Global Nested Air Quality Prediction Modeling System (GNAQPMS is the global version of the Nested Air Quality Prediction Modeling System (NAQPMS, which is a multi-scale chemical transport model used for air quality forecast and atmospheric environmental research. In this study, we present the porting and optimisation of GNAQPMS on a second-generation Intel Xeon Phi processor, codenamed Knights Landing (KNL. Compared with the first-generation Xeon Phi coprocessor (codenamed Knights Corner, KNC, KNL has many new hardware features such as a bootable processor, high-performance in-package memory and ISA compatibility with Intel Xeon processors. In particular, we describe the five optimisations we applied to the key modules of GNAQPMS, including the CBM-Z gas-phase chemistry, advection, convection and wet deposition modules. These optimisations work well on both the KNL 7250 processor and the Intel Xeon E5-2697 V4 processor. They include (1 updating the pure Message Passing Interface (MPI parallel mode to the hybrid parallel mode with MPI and OpenMP in the emission, advection, convection and gas-phase chemistry modules; (2 fully employing the 512 bit wide vector processing units (VPUs on the KNL platform; (3 reducing unnecessary memory access to improve cache efficiency; (4 reducing the thread local storage (TLS in the CBM-Z gas-phase chemistry module to improve its OpenMP performance; and (5 changing the global communication from writing/reading interface files to MPI functions to improve the performance and the parallel scalability. These optimisations greatly improved the GNAQPMS performance. The same optimisations also work well for the Intel Xeon Broadwell processor, specifically E5-2697 v4. Compared with the baseline version of GNAQPMS, the optimised version was 3.51 × faster on KNL and 2.77 × faster on the CPU. Moreover, the optimised version ran at 26 % lower average power on KNL than on the CPU. With the combined
Ryu, Hoon; Jeong, Yosang; Kang, Ji-Hoon; Cho, Kyu Nam
2016-12-01
Modelling of multi-million atomic semiconductor structures is important as it not only predicts properties of physically realizable novel materials, but can accelerate advanced device designs. This work elaborates a new Technology-Computer-Aided-Design (TCAD) tool for nanoelectronics modelling, which uses a sp3d5s∗ tight-binding approach to describe multi-million atomic structures, and simulate electronic structures with high performance computing (HPC), including atomic effects such as alloy and dopant disorders. Being named as Quantum simulation tool for Advanced Nanoscale Devices (Q-AND), the tool shows nice scalability on traditional multi-core HPC clusters implying the strong capability of large-scale electronic structure simulations, particularly with remarkable performance enhancement on latest clusters of Intel Xeon PhiTM coprocessors. A review of the recent modelling study conducted to understand an experimental work of highly phosphorus-doped silicon nanowires, is presented to demonstrate the utility of Q-AND. Having been developed via Intel Parallel Computing Center project, Q-AND will be open to public to establish a sound framework of nanoelectronics modelling with advanced HPC clusters of a many-core base. With details of the development methodology and exemplary study of dopant electronics, this work will present a practical guideline for TCAD development to researchers in the field of computational nanoelectronics.
A parallel implementation of particle tracking with space charge effects on an INTEL iPSC/860
International Nuclear Information System (INIS)
Chang, L.; Bourianoff, G.; Cole, B.; Machida, S.
1993-05-01
Particle-tracking simulation is one of the scientific applications that is well-suited to parallel computations. At the Superconducting Super Collider, it has been theoretically and empirically demonstrated that particle tracking on a designed lattice can achieve very high parallel efficiency on a MIMD Intel iPSC/860 machine. The key to such success is the realization that the particles can be tracked independently without considering their interaction. The perfectly parallel nature of particle tracking is broken if the interaction effects between particles are included. The space charge introduces an electromagnetic force that will affect the motion of tracked particles in 3-D space. For accurate modeling of the beam dynamics with space charge effects, one needs to solve three-dimensional Maxwell field equations, usually by a particle-in-cell (PIC) algorithm. This will require each particle to communicate with its neighbor grids to compute the momentum changes at each time step. It is expected that the 3-D PIC method will degrade parallel efficiency of particle-tracking implementation on any parallel computer. In this paper, we describe an efficient scheme for implementing particle tracking with space charge effects on an INTEL iPSC/860 machine. Experimental results show that a parallel efficiency of 75% can be obtained
By Ashley DeVine, Staff Writer Werner H. Kirstin (WHK) student intern Ben Freed was one of 40 finalists to compete in the Intel Science Talent Search (STS) in Washington, DC, in March. “It was seven intense days of interacting with amazing judges and incredibly smart and interesting students. We met President Obama, and then the MIT astronomy lab named minor planets after each
Data acquisition and processing system of energy dispersive X-ray spectrometer with microprocessor
International Nuclear Information System (INIS)
Horkay, G.; Kis-Varga, M.; Lakatos, T.; Molnar, J.; Zsurzs, M.
1984-01-01
For quantitative analysis of chemical elements by the method of X-ray spectroscopy a multichannel analyzer on the base of minicomputer with the INTEL 8080 A microprocessor is developed. The data acquisition and data processing systems which comprise a central processor, memory unit, ADC and display are described. Major system subprograms are enumerated. An example of Pb concentration determinating in a bronze specimen is given
Zhao, Shanshan; Qu, Huiling; Zhao, Yi; Xiao, Ting; Zhao, Mei; Li, Yong; Jolkkonen, Jukka; Cao, Yunpeng; Zhao, Chuansheng
2015-01-01
Forced limb-use can enhance neurogenesis and behavioral recovery as well as increasing the level of stromal cell-derived factor-1 (SDF-1) in stroke rats. We examined whether the SDF-1/CXCR4 pathway is involved in the enhanced neurogenesis and promoted behavioral recovery induced by forced limb-use in the chronic phase of stroke. The CXCR4 antagonist, AMD3100, was used to block the SDF-1/CXCR4 pathway in the ischemic rats. Brain ischemia was induced by endothelin-1. One week after ischemia, the unimpaired forelimb of rats was immobilized for 3 weeks. The proliferation, migration, and survival of DCX-positive cells in the subventricular zone (SVZ), and the dendritic complexity of DCX-positive cells in the dentate gyrus (DG), as well as the inflammatory response in the infarcted striatum were analyzed by immunohistochemistry. Functional recovery was assessed in beam-walking and water maze tests. Forced limb-use enhanced the proliferation, migration, dendritic complexity and the survival of newborn neurons. Furthermore, forced limb-use suppressed the inflammatory response and improved both motor and cognitive functions after stroke. AMD3100 significantly abrogated the enhanced neurogenesis and behavioral recovery induced by forced limb-use without influencing the inflammatory response. SDF-1/CXCR4 pathway seems to be involved in the enhancement of neurogenesis and behavioral recovery induced by post-stroke forced limb-use.
Directory of Open Access Journals (Sweden)
Sanz, Sandra
2015-06-01
Full Text Available Les últimes dècades es registra un increment de mobilitzacions socials organitzades, intervingudes, narrades i coordinades a través de les TIC. Són mostra de multituds intel·ligents (smart mobs que s'aprofiten dels nous mitjans de comunicació per organitzar-se. Tant pel nombre de missatges intercanviats i generats com per les pròpies interaccions generades, aquestes multituds intel·ligents es converteixen en objecte de les dades massives. La seva anàlisi a partir de les possibilitats que brinda l'enginyeria de dades pot contribuir a detectar idees construïdes com també sabers compartits fruit de la intel·ligència col·lectiva. Aquest fet afavoriria la reutilització d'aquesta informació per incrementar el coneixement del col·lectiu i contribuir al desenvolupament de la innovació social. És per això que en aquest article s'assenyalen els interrogants i les limitacions que encara presenten aquestes anàlisis i es posa en relleu la necessitat d'aprofundir en el desenvolupament de nous mètodes i tècniques d'anàlisi.En las últimas décadas se registra un incremento de movilizaciones sociales organizadas, mediadas, narradas y coordinadas a través de TICs. Son muestra de smart mobs o multitudes inteligentes que se aprovechan de los nuevos medios de comunicación para organizarse. Tanto por el número de mensajes intercambiados y generados como por las propias interacciones generadas, estas multitudes inteligentes se convierten en objeto del big data. Su análisis a partir de las posibilidades que brinda la ingeniería de datos puede contribuir a detectar ideas construidas así como saberes compartidos fruto de la inteligencia colectiva. Ello favorecería la reutilización de esta información para incrementar el conocimiento del colectivo y contribuir al desarrollo de la innovación social. Es por ello que en este artículo se señalan los interrogantes y limitaciones que todavía presentan estos análisis y se pone de relieve la
Decays of J/psi (3100) to baryon final states
International Nuclear Information System (INIS)
Eaton, M.W.
1982-05-01
We present results for the decays of psi(3100) into baryon and hyperon final states. The sample studied here consists of 1.3 million produced psi decays. The decays into nonstrange baryons agree well with currently established results, but with better statistics. In addition, significant resonance formation in multibody final states is observed. The decay psi → anti ppγ, the first direct photon decay of the psi involving baryons in the final state, is presented and the theoretical implications of the decays are briefly explored. Several new decays of the psi involving strange baryons are explored, including the first observations of three body final states involving hyperons. The I-spin symmetry of the strong decay psi → baryons has clearly been observed. The reduced matrix elements for psi → B anti B are presented for final states of different SU(3) content. The B 8 anti B 8 results are in excellent agreement with the psi being an SU(3) singlet as are the results for psi → B 10 anti B 10 . We present the first evidence for the SU(3) violating decays of the type psi → B 8 anti B 10 + c.c.. Angular distributions for psi → B 8 anti B 8 are presented and compared with theoretical predictions. Statistics are limited, but the data tends to prefer other than a 1 + Cos 2 theta distribution
Evaluating the transport layer of the ALFA framework for the Intel(®) Xeon Phi(™) Coprocessor
Santogidis, Aram; Hirstius, Andreas; Lalis, Spyros
2015-01-01
The ALFA framework supports the software development of major High Energy Physics experiments. As part of our research effort to optimize the transport layer of ALFA, we focus on profiling its data transfer performance for inter-node communication on the Intel Xeon Phi Coprocessor. In this article we present the collected performance measurements with the related analysis of the results. The optimization opportunities that are discovered, help us to formulate the future plans of enabling high...
Wang, Hui; Chen, Huansheng; Wu, Qizhong; Lin, Junming; Chen, Xueshun; Xie, Xinwei; Wang, Rongrong; Tang, Xiao; Wang, Zifa
2017-01-01
The GNAQPMS model is the global version of the Nested Air Quality Prediction Modelling System (NAQPMS), which is a multi-scale chemical transport model used for air quality forecast and atmospheric environmental research. In this study, we present our work of porting and optimizing the GNAQPMS model on the second generation Intel Xeon Phi processor codename “Knights Landing” (KNL). Compared with the first generation Xeon Phi coprocessor, KNL introduced many new hardware features such as a boo...
Multi-threaded ATLAS simulation on Intel Knights Landing processors
AUTHOR|(INSPIRE)INSPIRE-00014247; The ATLAS collaboration; Calafiura, Paolo; Leggett, Charles; Tsulaia, Vakhtang; Dotti, Andrea
2017-01-01
The Knights Landing (KNL) release of the Intel Many Integrated Core (MIC) Xeon Phi line of processors is a potential game changer for HEP computing. With 72 cores and deep vector registers, the KNL cards promise significant performance benefits for highly-parallel, compute-heavy applications. Cori, the newest supercomputer at the National Energy Research Scientific Computing Center (NERSC), was delivered to its users in two phases with the first phase online at the end of 2015 and the second phase now online at the end of 2016. Cori Phase 2 is based on the KNL architecture and contains over 9000 compute nodes with 96GB DDR4 memory. ATLAS simulation with the multithreaded Athena Framework (AthenaMT) is a good potential use-case for the KNL architecture and supercomputers like Cori. ATLAS simulation jobs have a high ratio of CPU computation to disk I/O and have been shown to scale well in multi-threading and across many nodes. In this paper we will give an overview of the ATLAS simulation application with detai...
Multi-threaded ATLAS Simulation on Intel Knights Landing Processors
Farrell, Steven; The ATLAS collaboration; Calafiura, Paolo; Leggett, Charles
2016-01-01
The Knights Landing (KNL) release of the Intel Many Integrated Core (MIC) Xeon Phi line of processors is a potential game changer for HEP computing. With 72 cores and deep vector registers, the KNL cards promise significant performance benefits for highly-parallel, compute-heavy applications. Cori, the newest supercomputer at the National Energy Research Scientific Computing Center (NERSC), will be delivered to its users in two phases with the first phase online now and the second phase expected in mid-2016. Cori Phase 2 will be based on the KNL architecture and will contain over 9000 compute nodes with 96GB DDR4 memory. ATLAS simulation with the multithreaded Athena Framework (AthenaMT) is a great use-case for the KNL architecture and supercomputers like Cori. Simulation jobs have a high ratio of CPU computation to disk I/O and have been shown to scale well in multi-threading and across many nodes. In this presentation we will give an overview of the ATLAS simulation application with details on its multi-thr...
EM Modeling of Far-Field Radiation Patterns for Antennas on the GMA-TT UAV
Mackenzie, Anne I.
2015-01-01
To optimize communication with the Generic Modular Aircraft T-Tail (GMA-TT) unmanned aerial vehicle (UAV), electromagnetic (EM) simulations have been performed to predict the performance of two antenna types on the aircraft. Simulated far-field radiation patterns tell the amount of power radiated by the antennas and the aircraft together, taking into account blockage by the aircraft as well as radiation by conducting and dielectric portions of the aircraft. With a knowledge of the polarization and distance of the two communicating antennas, e.g. one on the UAV and one on the ground, and the transmitted signal strength, a calculation may be performed to find the strength of the signal travelling from one antenna to the other and to check that the transmitted signal meets the receiver system requirements for the designated range. In order to do this, the antenna frequency and polarization must be known for each antenna, in addition to its design and location. The permittivity, permeability, and geometry of the UAV components must also be known. The full-wave method of moments solution produces the appropriate dBi radiation pattern in which the received signal strength is calculated relative to that of an isotropic radiator.
A new shared-memory programming paradigm for molecular dynamics simulations on the Intel Paragon
International Nuclear Information System (INIS)
D'Azevedo, E.F.; Romine, C.H.
1994-12-01
This report describes the use of shared memory emulation with DOLIB (Distributed Object Library) to simplify parallel programming on the Intel Paragon. A molecular dynamics application is used as an example to illustrate the use of the DOLIB shared memory library. SOTON-PAR, a parallel molecular dynamics code with explicit message-passing using a Lennard-Jones 6-12 potential, is rewritten using DOLIB primitives. The resulting code has no explicit message primitives and resembles a serial code. The new code can perform dynamic load balancing and achieves better performance than the original parallel code with explicit message-passing
Limited tender notification for the AMC of desktop computers and
Indian Academy of Sciences (India)
Brand. 1 INTEL 82945 EXPRESS. P4 3.0GHZ. 1X2GB + 1 x 1 GB =3GB. DDR2. 160 GB STATA. WINDOWS 7 PRO SP1. 32BIT. CD/ DVDRW. 17 " LCD. 2 INTEL G31PR. PENTIUM DUAL E2160. 1.8GHZ. 2X2GB =4GB DDR2. 160 GB STATA. WINDOWS 7 PRO SP1. 32BIT. CD/ DVDRW. 17 " LCD. 3 INTEL G31/33 EXPRESS.
Plasma turbulence calculations on the Intel iPSC/860 (rx) hypercube
International Nuclear Information System (INIS)
Lynch, V.E.; Ruiter, J.R.
1990-01-01
One approach to improving the real-time efficiency of plasma turbulence calculations is to use a parallel algorithm. A serial algorithm used for plasma turbulence calculations was modified to allocate a radial region in each node. In this way, convolutions at a fixed radius are performed in parallel, and communication is limited to boundary values for each radial region. For a semi-implicity numerical scheme (tridiagonal matrix solver), there is a factor of 3 improvement in efficiency with the Intel iPSC/860 machine using 64 processors over a single-processor Cray-II. For block-tridiagonal matrix cases (fully implicit code), a second parallelization takes place. The Fourier components are distributed in nodes. In each node, the block-tridiagonal matrix is inverted for each of allocated Fourier components. The algorithm for this second case has not yet been optimized. 10 refs., 4 figs
Lattice QCD with Domain Decomposition on Intel Xeon Phi Co-Processors
Energy Technology Data Exchange (ETDEWEB)
Heybrock, Simon; Joo, Balint; Kalamkar, Dhiraj D; Smelyanskiy, Mikhail; Vaidyanathan, Karthikeyan; Wettig, Tilo; Dubey, Pradeep
2014-12-01
The gap between the cost of moving data and the cost of computing continues to grow, making it ever harder to design iterative solvers on extreme-scale architectures. This problem can be alleviated by alternative algorithms that reduce the amount of data movement. We investigate this in the context of Lattice Quantum Chromodynamics and implement such an alternative solver algorithm, based on domain decomposition, on Intel Xeon Phi co-processor (KNC) clusters. We demonstrate close-to-linear on-chip scaling to all 60 cores of the KNC. With a mix of single- and half-precision the domain-decomposition method sustains 400-500 Gflop/s per chip. Compared to an optimized KNC implementation of a standard solver [1], our full multi-node domain-decomposition solver strong-scales to more nodes and reduces the time-to-solution by a factor of 5.
Emmarcar el debat: Lliure expressió contra propietat intel·lectual, els propers cinquanta anys
Directory of Open Access Journals (Sweden)
Eben Moglen
2007-02-01
Full Text Available
El Prof. Moglen explica i analitza, des d'una perspectiva històrica, la profunda revolució social i legal que resulta de la tecnologia digital quan aquesta s'aplica a tots els camps: programari, música i tot tipus de creacions. En concret, explica la manera en què la tecnologia digital està forçant una modificació substancial (desaparició dels sistemes de propietat intel·lectual i fa prediccions per al futur pròxim dels mercats de la PI.
Indian Academy of Sciences (India)
In late 1996 Intel announced an enhancement of the Pentium. Processor architecture and christened it MMX technology or multimedia extensions. The Intel MMX technology is purportedly the most significant enhancement to the Intel architecture since the extension of the x86 architecture to 32 bits in 1985 when Intel first ...
Applications Performance on NAS Intel Paragon XP/S - 15#
Saini, Subhash; Simon, Horst D.; Copper, D. M. (Technical Monitor)
1994-01-01
The Numerical Aerodynamic Simulation (NAS) Systems Division received an Intel Touchstone Sigma prototype model Paragon XP/S- 15 in February, 1993. The i860 XP microprocessor with an integrated floating point unit and operating in dual -instruction mode gives peak performance of 75 million floating point operations (NIFLOPS) per second for 64 bit floating point arithmetic. It is used in the Paragon XP/S-15 which has been installed at NAS, NASA Ames Research Center. The NAS Paragon has 208 nodes and its peak performance is 15.6 GFLOPS. Here, we will report on early experience using the Paragon XP/S- 15. We have tested its performance using both kernels and applications of interest to NAS. We have measured the performance of BLAS 1, 2 and 3 both assembly-coded and Fortran coded on NAS Paragon XP/S- 15. Furthermore, we have investigated the performance of a single node one-dimensional FFT, a distributed two-dimensional FFT and a distributed three-dimensional FFT Finally, we measured the performance of NAS Parallel Benchmarks (NPB) on the Paragon and compare it with the performance obtained on other highly parallel machines, such as CM-5, CRAY T3D, IBM SP I, etc. In particular, we investigated the following issues, which can strongly affect the performance of the Paragon: a. Impact of the operating system: Intel currently uses as a default an operating system OSF/1 AD from the Open Software Foundation. The paging of Open Software Foundation (OSF) server at 22 MB to make more memory available for the application degrades the performance. We found that when the limit of 26 NIB per node out of 32 MB available is reached, the application is paged out of main memory using virtual memory. When the application starts paging, the performance is considerably reduced. We found that dynamic memory allocation can help applications performance under certain circumstances. b. Impact of data cache on the i860/XP: We measured the performance of the BLAS both assembly coded and Fortran
2015-05-20
Joint Oil Analysis Program Spectrometer Standards SCP Science (Conostan) Qualification Report For D19-0, D3-100, and D12- XXX Series Standards NF...Candidate Type D19-0 ICP-AES Results ..................................................................... 4 Table V. Candidate Type D12- XXX ...Physical Property Results .................................................. 5 Table VI. Candidate Type D12- XXX Rotrode-AES Results
A performance study of sparse Cholesky factorization on INTEL iPSC/860
Zubair, M.; Ghose, M.
1992-01-01
The problem of Cholesky factorization of a sparse matrix has been very well investigated on sequential machines. A number of efficient codes exist for factorizing large unstructured sparse matrices. However, there is a lack of such efficient codes on parallel machines in general, and distributed machines in particular. Some of the issues that are critical to the implementation of sparse Cholesky factorization on a distributed memory parallel machine are ordering, partitioning and mapping, load balancing, and ordering of various tasks within a processor. Here, we focus on the effect of various partitioning schemes on the performance of sparse Cholesky factorization on the Intel iPSC/860. Also, a new partitioning heuristic for structured as well as unstructured sparse matrices is proposed, and its performance is compared with other schemes.
OpenMP GNU and Intel Fortran programs for solving the time-dependent Gross-Pitaevskii equation
Young-S., Luis E.; Muruganandam, Paulsamy; Adhikari, Sadhan K.; Lončar, Vladimir; Vudragović, Dušan; Balaž, Antun
2017-11-01
We present Open Multi-Processing (OpenMP) version of Fortran 90 programs for solving the Gross-Pitaevskii (GP) equation for a Bose-Einstein condensate in one, two, and three spatial dimensions, optimized for use with GNU and Intel compilers. We use the split-step Crank-Nicolson algorithm for imaginary- and real-time propagation, which enables efficient calculation of stationary and non-stationary solutions, respectively. The present OpenMP programs are designed for computers with multi-core processors and optimized for compiling with both commercially-licensed Intel Fortran and popular free open-source GNU Fortran compiler. The programs are easy to use and are elaborated with helpful comments for the users. All input parameters are listed at the beginning of each program. Different output files provide physical quantities such as energy, chemical potential, root-mean-square sizes, densities, etc. We also present speedup test results for new versions of the programs. Program files doi:http://dx.doi.org/10.17632/y8zk3jgn84.2 Licensing provisions: Apache License 2.0 Programming language: OpenMP GNU and Intel Fortran 90. Computer: Any multi-core personal computer or workstation with the appropriate OpenMP-capable Fortran compiler installed. Number of processors used: All available CPU cores on the executing computer. Journal reference of previous version: Comput. Phys. Commun. 180 (2009) 1888; ibid.204 (2016) 209. Does the new version supersede the previous version?: Not completely. It does supersede previous Fortran programs from both references above, but not OpenMP C programs from Comput. Phys. Commun. 204 (2016) 209. Nature of problem: The present Open Multi-Processing (OpenMP) Fortran programs, optimized for use with commercially-licensed Intel Fortran and free open-source GNU Fortran compilers, solve the time-dependent nonlinear partial differential (GP) equation for a trapped Bose-Einstein condensate in one (1d), two (2d), and three (3d) spatial dimensions for
Hirano, Akihiro; Nakayama, Kenji
2008-01-01
This paper presents an computationally ef cient implementation of sparse-tap FIR adaptive lters with tapposition control on Intel IA-32 processors with single-instruction multiple-data (SIMD) capability. In order to overcome randomorder memory access which prevents a ectorization, a blockbased processing and a re-ordering buffer are introduced. A dynamic register allocation and the use of memory-to-register operations help the maximization of the loop-unrolling level. Up to 66percent speedup ...
Discovery of an L-alanine ester prodrug of the Hsp90 inhibitor, MPC-3100.
Kim, Se-Ho; Tangallapally, Rajendra; Kim, In Chul; Trovato, Richard; Parker, Daniel; Patton, J Scott; Reeves, Leslie; Bradford, Chad; Wettstein, Daniel; Baichwal, Vijay; Papac, Damon; Bajji, Ashok; Carlson, Robert; Yager, Kraig M
2015-11-15
Various types of Hsp90 inhibitors have been and continue to undergo clinical investigation. One development candidate is the purine-based, synthetic Hsp90 inhibitor 1 (MPC-3100), which successfully completed a phase I clinical study. However, further clinical development of 1 was hindered by poor solubility and consequent formulation issues and promoted development of a more water soluble prodrug. Towards this end, numerous pro-moieties were explored in vitro and in vivo. These studies resulted in identification of L-alanine ester mesylate, 2i (MPC-0767), which exhibited improved aqueous solubility, adequate chemical stability, and rapid bioconversion without the need for solubilizing excipients. Based on improved physical characteristics and favorable PK and PD profiles, 2i mesylate was selected for further development. A convergent, scalable, chromatography-free synthesis for 2i mesylate was developed to support further clinical evaluation. Copyright © 2015 Elsevier Ltd. All rights reserved.
A comparison of SuperLU solvers on the intel MIC architecture
Tuncel, Mehmet; Duran, Ahmet; Celebi, M. Serdar; Akaydin, Bora; Topkaya, Figen O.
2016-10-01
In many science and engineering applications, problems may result in solving a sparse linear system AX=B. For example, SuperLU_MCDT, a linear solver, was used for the large penta-diagonal matrices for 2D problems and hepta-diagonal matrices for 3D problems, coming from the incompressible blood flow simulation (see [1]). It is important to test the status and potential improvements of state-of-the-art solvers on new technologies. In this work, sequential, multithreaded and distributed versions of SuperLU solvers (see [2]) are examined on the Intel Xeon Phi coprocessors using offload programming model at the EURORA cluster of CINECA in Italy. We consider a portfolio of test matrices containing patterned matrices from UFMM ([3]) and randomly located matrices. This architecture can benefit from high parallelism and large vectors. We find that the sequential SuperLU benefited up to 45 % performance improvement from the offload programming depending on the sparse matrix type and the size of transferred and processed data.
H. Wang; H. Wang; H. Wang; H. Wang; H. Chen; H. Chen; Q. Wu; Q. Wu; J. Lin; X. Chen; X. Xie; R. Wang; R. Wang; X. Tang; Z. Wang
2017-01-01
The Global Nested Air Quality Prediction Modeling System (GNAQPMS) is the global version of the Nested Air Quality Prediction Modeling System (NAQPMS), which is a multi-scale chemical transport model used for air quality forecast and atmospheric environmental research. In this study, we present the porting and optimisation of GNAQPMS on a second-generation Intel Xeon Phi processor, codenamed Knights Landing (KNL). Compared with the first-generation Xeon Phi coprocessor (code...
Denis, Aline B; Diagone, Cristina A; Plepis, Ana M G; Viana, Rommel B
2015-12-05
A method for the extraction and quantification of two residual monomers, bisphenol glycidyl dimethacrylate (Bis-GMA) and triethylene glycol dimethacrylate (TEGDMA), that were evaluated using high efficiency liquid chromatography with UV detection was developed and validated in this study. Three types of solvents were applied in the extraction of the monomers (methanol, ethanol and acetonitrile), where the highest extraction efficiency was obtained using acetonitrile. The different resins were prepared by photoactivation of Bis-GMA and TEGDMA monomers. Additionally, the effects of the addition of two photoinitiators (camphorquinone (CQ) and phenyl propanodione (PPD) and that of a co-initiator (N,N-dimethyl-p-toluidine) were also analyzed. When only the CQ photoinitiator was used, a smaller amount of residual monomers was obtained, whereas a larger amount was obtained with PPD. When the two photoinitiators were used in the same matrix, however, no significant changes were observed in relation to the amount of residual TEGDMA monomers. For the addition of the co-initiator, there were no large changes in the extraction of residual monomers. The effect of the two photoactivation sources (halogen lamp and LED) led to small differences in the elution of the two monomers, although all of the resins differed significantly when photoactivated with a LED. Quantum chemical calculations using Density Functional Theory were carried out to characterize several molecular properties of each monomer. Copyright © 2015 Elsevier B.V. All rights reserved.
Jenkins, David R.; Basden, Alastair; Myers, Richard M.
2018-05-01
We propose a solution to the increased computational demands of Extremely Large Telescope (ELT) scale adaptive optics (AO) real-time control with the Intel Xeon Phi Knights Landing (KNL) Many Integrated Core (MIC) Architecture. The computational demands of an AO real-time controller (RTC) scale with the fourth power of telescope diameter and so the next generation ELTs require orders of magnitude more processing power for the RTC pipeline than existing systems. The Xeon Phi contains a large number (≥64) of low power x86 CPU cores and high bandwidth memory integrated into a single socketed server CPU package. The increased parallelism and memory bandwidth are crucial to providing the performance for reconstructing wavefronts with the required precision for ELT scale AO. Here, we demonstrate that the Xeon Phi KNL is capable of performing ELT scale single conjugate AO real-time control computation at over 1.0kHz with less than 20μs RMS jitter. We have also shown that with a wavefront sensor camera attached the KNL can process the real-time control loop at up to 966Hz, the maximum frame-rate of the camera, with jitter remaining below 20μs RMS. Future studies will involve exploring the use of a cluster of Xeon Phis for the real-time control of the MCAO and MOAO regimes of AO. We find that the Xeon Phi is highly suitable for ELT AO real time control.
Evaluation of the Intel iWarp parallel processor for space flight applications
Hine, Butler P., III; Fong, Terrence W.
1993-01-01
The potential of a DARPA-sponsored advanced processor, the Intel iWarp, for use in future SSF Data Management Systems (DMS) upgrades is evaluated through integration into the Ames DMS testbed and applications testing. The iWarp is a distributed, parallel computing system well suited for high performance computing applications such as matrix operations and image processing. The system architecture is modular, supports systolic and message-based computation, and is capable of providing massive computational power in a low-cost, low-power package. As a consequence, the iWarp offers significant potential for advanced space-based computing. This research seeks to determine the iWarp's suitability as a processing device for space missions. In particular, the project focuses on evaluating the ease of integrating the iWarp into the SSF DMS baseline architecture and the iWarp's ability to support computationally stressing applications representative of SSF tasks.
Towards a Formal Model of the X86 ISA
2012-03-30
implies (and (natp i) (natp j) (< i *2^27*)) 101 (equal (nth i (nth *mem-tablei* (initialize-mem-table j x86-64))) (if (<= j i) 1 (nth i (nth *mem...for a MOV instruction ; targeting a GPR ; see Intel 2.2.1.5, p. 2-14, and see AMD Vol. 3 Sec. 1.6 ; (p. 24), which restricts 64-bit immediates to "MOV...instructions that load ; GPRs ". And see AMD Vol. 1 Sec. 3.2.3.3 ("Immediate Operand Size"), which ; specifies those opcodes as "B8h through BFh
Towards Wearable Cognitive Assistance
2013-12-01
MHz 2002 Itanium R© 1 GHz Blackberry 133 MHz 5810 2007 Intel R© 9.6 GHz Apple 412 MHz CoreTM 2 (4 cores) iPhone 2011 Intel R© 32 GHz Samsung 2.4 GHz...Xeon R© X5 (2x6 cores) Galaxy S2 (2 cores) 2013 Intel R© 64 GHz Samsung 6.4 GHz Xeon R© E5 (2x12 cores) Galaxy S4 (4 cores) Google Glass 2.4 GHz OMAP... diverse inputs: the language content and deep semantics of the words, the tone in which they are spoken, the facial expressions and eye movements with
Efficient irregular wavefront propagation algorithms on Intel® Xeon Phi™
Gomes, Jeremias M.; Teodoro, George; de Melo, Alba; Kong, Jun; Kurc, Tahsin; Saltz, Joel H.
2016-01-01
We investigate the execution of the Irregular Wavefront Propagation Pattern (IWPP), a fundamental computing structure used in several image analysis operations, on the Intel® Xeon Phi™ co-processor. An efficient implementation of IWPP on the Xeon Phi is a challenging problem because of IWPP’s irregularity and the use of atomic instructions in the original IWPP algorithm to resolve race conditions. On the Xeon Phi, the use of SIMD and vectorization instructions is critical to attain high performance. However, SIMD atomic instructions are not supported. Therefore, we propose a new IWPP algorithm that can take advantage of the supported SIMD instruction set. We also evaluate an alternate storage container (priority queue) to track active elements in the wavefront in an effort to improve the parallel algorithm efficiency. The new IWPP algorithm is evaluated with Morphological Reconstruction and Imfill operations as use cases. Our results show performance improvements of up to 5.63× on top of the original IWPP due to vectorization. Moreover, the new IWPP achieves speedups of 45.7× and 1.62×, respectively, as compared to efficient CPU and GPU implementations. PMID:27298591
Efficient irregular wavefront propagation algorithms on Intel® Xeon Phi™.
Gomes, Jeremias M; Teodoro, George; de Melo, Alba; Kong, Jun; Kurc, Tahsin; Saltz, Joel H
2015-10-01
We investigate the execution of the Irregular Wavefront Propagation Pattern (IWPP), a fundamental computing structure used in several image analysis operations, on the Intel ® Xeon Phi ™ co-processor. An efficient implementation of IWPP on the Xeon Phi is a challenging problem because of IWPP's irregularity and the use of atomic instructions in the original IWPP algorithm to resolve race conditions. On the Xeon Phi, the use of SIMD and vectorization instructions is critical to attain high performance. However, SIMD atomic instructions are not supported. Therefore, we propose a new IWPP algorithm that can take advantage of the supported SIMD instruction set. We also evaluate an alternate storage container (priority queue) to track active elements in the wavefront in an effort to improve the parallel algorithm efficiency. The new IWPP algorithm is evaluated with Morphological Reconstruction and Imfill operations as use cases. Our results show performance improvements of up to 5.63 × on top of the original IWPP due to vectorization. Moreover, the new IWPP achieves speedups of 45.7 × and 1.62 × , respectively, as compared to efficient CPU and GPU implementations.
Influence of solar and geomagnetic activity in Gymnodinium catenatum (Dinophyceae) cultures.
Vale, Paulo
2017-01-01
Laboratory cultures of the paralytic shellfish poisoning producing microalga Gymnodinium catenatum were subjected to a hypo-osmotic shock and changes in cell concentration were observed in two separate experiments of 8 and 24 hours duration, respectively. The increase in geomagnetic activity (GMA), radio and X-ray fluxes and solar X-ray flares were negatively correlated with cell numbers. Cell losses were observed in the short experiment, but not in the longest one. GMA action was related to the course of the experimental period, while electromagnetic radiation (EMR) was only significantly related when the previous hours before the experiments were considered. The differential action windows might be indicative of two differential disruptive mechanisms: EMR might act on DNA synthesis and mitosis phases of the cell cycle (taking place in the dark period) and GMA might be more disruptive at the end of mytosis or cytokinesis phases taking place in the light period. Formation of long chains (> 4 cells/chain) was reduced with salinity and with temperatures above 27ºC but increased with EMR and GMA, particularly when grown at the highest temperatures recorded during the study period (≥28ºC).
Plasma Science and Applications at the Intel Science Fair: A Retrospective
Berry, Lee
2009-11-01
For the past five years, the Coalition for Plasma Science (CPS) has presented an award for a plasma project at the Intel International Science and Engineering Fair (ISEF). Eligible projects have ranged from grape-based plasma production in a microwave oven to observation of the effects of viscosity in a fluid model of quark-gluon plasma. Most projects have been aimed at applications, including fusion, thrusters, lighting, materials processing, and GPS improvements. However diagnostics (spectroscopy), technology (magnets), and theory (quark-gluon plasmas) have also been represented. All of the CPS award-winning projects so far have been based on experiments, with two awards going to women students and three to men. Since the award was initiated, both the number and quality of plasma projects has increased. The CPS expects this trend to continue, and looks forward to continuing its work with students who are excited about the possibilities of plasma. You too can share this excitement by judging at the 2010 fair in San Jose on May 11-12.
Syntheses of amine-type adsorbents with emulsion graft polymerization of glycidyl methacrylate
International Nuclear Information System (INIS)
Seko, N.; Bang, L.T.; Tamada, M.
2007-01-01
Glycidyl methacrylate (GMA) which was precursor monomer for the synthesis of metal ion adsorbent was emulsified by surfactant of Tween 20 (Tw-20). The emulsion of 5% GMA in the water was stable for 48 h at Tw-20 concentration of 0.5%. Graft polymerization of GMA on polyethylene fiber was carried out in the emulsion state at various pre-irradiation doses. Degree of grafting (Dg) reached 103%, 301% and 348% for 1 h grafting at 40 deg. C with pre-irradiation of 10, 30 and 40 kGy, respectively. But the Dg was depressed when the pre-irradiation dose was over 50 kGy since cross-linking occurred simultaneously in the trunk polymer. Dg decreased with increment of Tw-20 concentration in emulsion of 5% GMA at pre-irradiation of 40 kGy. The three kinds of amine-type adsorbents were synthesized by reacting diethylenetriamine (DETA), triethylenetetramine (TETA) and ethylenediamine (EDA) with GMA-grafted polyethylene fiber. The synthesized EDA-type adsorbent had the highest selectivity against U ion and the distribution coefficient was 2.0 x 10 6
La responsabilitat davant la intel·ligència artificial en el comerç electrònic
Martín i Palomas, Elisabet
2015-01-01
Es planteja en aquesta tesi l'efecte produït sobre la responsabilitat derivada de les accions realitzades autònomament per sistemes dotats d'intel·ligència artificial, sense la participació directa de cap ésser humà, en els temes més directament relacionats amb el comerç electrònic. Per a això s'analitzen les activitats realitzades per algunes de les principals empreses internacionals de comerç electrònic, com el grup nord-americà eBay o el grup xinès Alibaba. Després de desenvolupar els prin...
Cao, Y; Hunter, Z R; Liu, X; Xu, L; Yang, G; Chen, J; Patterson, C J; Tsakmaklis, N; Kanan, S; Rodig, S; Castillo, J J; Treon, S P
2015-01-01
CXCR4(WHIM) somatic mutations are common Waldenstrom's Macroglobulinemia (WM), and are associated with clinical resistance to ibrutinib. We engineered WM cells to express the most common WHIM (Warts, Hypogammaglobulinemia, Infections and Myelokathexis), CXCR(S338X) mutation in WM. Following SDF-1a stimulation, CXCR4(S338X) WM cells exhibited decreased receptor internalization, enhanced and sustained AKT kinase (AKT) and extracellular regulated kinase (ERK) signaling, decreased poly (ADP-ribose) polymerase and caspase 3 cleavage, and decreased Annexin V staining versus CXCR4 wild-type (WT) cells. CXCR4(S338X)-related signaling and survival effects were blocked by the CXCR4 inhibitor AMD3100. SDF-1a-treated CXCR4(S338X) WM cells showed sustained AKT and ERK activation and decreased apoptotic changes versus CXCR4(WT) cells following ibrutinib treatment, findings which were also reversed by AMD3100. AKT or ERK antagonists restored ibrutinib-triggered apoptotic changes in SDF-1a-treated CXCR4(S338X) WM cells demonstrating their role in SDF-1a-mediated ibrutinib resistance. Enhanced bone marrow pAKT staining was also evident in CXCR4(WHIM) versus CXCR4(WT) WM patients, and remained active despite ibrutinib therapy in CXCR4(WHIM) patients. Last, CXCR4(S338X) WM cells showed varying levels of resistance to other WM relevant therapeutics, including bendamustine, fludarabine, bortezomib and idelalisib in the presence of SDF-1a. These studies demonstrate a functional role for CXCR4(WHIM) mutations, and provide a framework for investigation of CXCR4 inhibitors in WM.
Communication overhead on the Intel Paragon, IBM SP2 and Meiko CS-2
Bokhari, Shahid H.
1995-01-01
Interprocessor communication overhead is a crucial measure of the power of parallel computing systems-its impact can severely limit the performance of parallel programs. This report presents measurements of communication overhead on three contemporary commercial multicomputer systems: the Intel Paragon, the IBM SP2 and the Meiko CS-2. In each case the time to communicate between processors is presented as a function of message length. The time for global synchronization and memory access is discussed. The performance of these machines in emulating hypercubes and executing random pairwise exchanges is also investigated. It is shown that the interprocessor communication time depends heavily on the specific communication pattern required. These observations contradict the commonly held belief that communication overhead on contemporary machines is independent of the placement of tasks on processors. The information presented in this report permits the evaluation of the efficiency of parallel algorithm implementations against standard baselines.
Performance Evaluation of Multithreaded Geant4 Simulations Using an Intel Xeon Phi Cluster
Directory of Open Access Journals (Sweden)
P. Schweitzer
2015-01-01
Full Text Available The objective of this study is to evaluate the performances of Intel Xeon Phi hardware accelerators for Geant4 simulations, especially for multithreaded applications. We present the complete methodology to guide users for the compilation of their Geant4 applications on Phi processors. Then, we propose series of benchmarks to compare the performance of Xeon CPUs and Phi processors for a Geant4 example dedicated to the simulation of electron dose point kernels, the TestEm12 example. First, we compare a distributed execution of a sequential version of the Geant4 example on both architectures before evaluating the multithreaded version of the Geant4 example. If Phi processors demonstrated their ability to accelerate computing time (till a factor 3.83 when distributing sequential Geant4 simulations, we do not reach the same level of speedup when considering the multithreaded version of the Geant4 example.
Deployment of the OSIRIS EM-PIC code on the Intel Knights Landing architecture
Fonseca, Ricardo
2017-10-01
Electromagnetic particle-in-cell (EM-PIC) codes such as OSIRIS have found widespread use in modelling the highly nonlinear and kinetic processes that occur in several relevant plasma physics scenarios, ranging from astrophysical settings to high-intensity laser plasma interaction. Being computationally intensive, these codes require large scale HPC systems, and a continuous effort in adapting the algorithm to new hardware and computing paradigms. In this work, we report on our efforts on deploying the OSIRIS code on the new Intel Knights Landing (KNL) architecture. Unlike the previous generation (Knights Corner), these boards are standalone systems, and introduce several new features, include the new AVX-512 instructions and on-package MCDRAM. We will focus on the parallelization and vectorization strategies followed, as well as memory management, and present a detailed performance evaluation of code performance in comparison with the CPU code. This work was partially supported by Fundaçã para a Ciência e Tecnologia (FCT), Portugal, through Grant No. PTDC/FIS-PLA/2940/2014.
Modeling high-temperature superconductors and metallic alloys on the Intel IPSC/860
Geist, G. A.; Peyton, B. W.; Shelton, W. A.; Stocks, G. M.
Oak Ridge National Laboratory has embarked on several computational Grand Challenges, which require the close cooperation of physicists, mathematicians, and computer scientists. One of these projects is the determination of the material properties of alloys from first principles and, in particular, the electronic structure of high-temperature superconductors. While the present focus of the project is on superconductivity, the approach is general enough to permit study of other properties of metallic alloys such as strength and magnetic properties. This paper describes the progress to date on this project. We include a description of a self-consistent KKR-CPA method, parallelization of the model, and the incorporation of a dynamic load balancing scheme into the algorithm. We also describe the development and performance of a consolidated KKR-CPA code capable of running on CRAYs, workstations, and several parallel computers without source code modification. Performance of this code on the Intel iPSC/860 is also compared to a CRAY 2, CRAY YMP, and several workstations. Finally, some density of state calculations of two perovskite superconductors are given.
International Nuclear Information System (INIS)
Moawia, Rihab Musaad; Nasef, Mohamed Mahmoud; Mohamed, Nor Hasimah; Ripin, Adnan
2016-01-01
Flax fibres were modified by radiation induced graft copolymerization of glycidyl methacrylate (GMA) by pre-irradiation method in an emulsion medium. The effect of reaction parameters on the degree of grafting (DOG) such as concentration of bleaching agent, absorbed dose, monomer concentration, temperature and reaction time were investigated. The DOG was found to be dependent on the investigated parameters. The incorporation of poly(GMA) grafts in the bleached flax fibres was confirmed by Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM). The structural and mechanical changes were evaluated by X-ray diffraction (XRD) and mechanical tester, respectively. The results revealed that reacting bleached flax fibres irradiated with 20 kGy with 5% GMA emulsion containing 0.5% polyoxyethylene-sorbitan monolaurate (Tween 20) surfactant at 40 °C for 1 h led to a maximum DOG of 148%. The grafted fibres showed sufficient mechanical strength and hydrophobicity which make them promising precursors for development of adsorbents after appropriate chemical treatments. - Highlights: • Flax fibers were modified by radiation induced emulsion grafting of GMA. • Bleaching with 0.7 wt% Na-chlorite was essential for achieving high DOGs. • Effect of reaction parameters on the degree of grafting were established. • The incorporation of poly-GMA grafts was proved by SEM, FTIR and XRD. • The obtained poly-GMA grafted flax fibers have potential for adsorbent making.
Performance optimization of Qbox and WEST on Intel Knights Landing
Zheng, Huihuo; Knight, Christopher; Galli, Giulia; Govoni, Marco; Gygi, Francois
We present the optimization of electronic structure codes Qbox and WEST targeting the Intel®Xeon Phi™processor, codenamed Knights Landing (KNL). Qbox is an ab-initio molecular dynamics code based on plane wave density functional theory (DFT) and WEST is a post-DFT code for excited state calculations within many-body perturbation theory. Both Qbox and WEST employ highly scalable algorithms which enable accurate large-scale electronic structure calculations on leadership class supercomputer platforms beyond 100,000 cores, such as Mira and Theta at the Argonne Leadership Computing Facility. In this work, features of the KNL architecture (e.g. hierarchical memory) are explored to achieve higher performance in key algorithms of the Qbox and WEST codes and to develop a road-map for further development targeting next-generation computing architectures. In particular, the optimizations of the Qbox and WEST codes on the KNL platform will target efficient large-scale electronic structure calculations of nanostructured materials exhibiting complex structures and prediction of their electronic and thermal properties for use in solar and thermal energy conversion device. This work was supported by MICCoM, as part of Comp. Mats. Sci. Program funded by the U.S. DOE, Office of Sci., BES, MSE Division. This research used resources of the ALCF, which is a DOE Office of Sci. User Facility under Contract DE-AC02-06CH11357.
Evaluation of CHO Benchmarks on the Arria 10 FPGA using Intel FPGA SDK for OpenCL
Energy Technology Data Exchange (ETDEWEB)
Jin, Zheming [Argonne National Lab. (ANL), Argonne, IL (United States); Yoshii, Kazutomo [Argonne National Lab. (ANL), Argonne, IL (United States); Finkel, Hal [Argonne National Lab. (ANL), Argonne, IL (United States); Cappello, Franck [Argonne National Lab. (ANL), Argonne, IL (United States)
2017-05-23
The OpenCL standard is an open programming model for accelerating algorithms on heterogeneous computing system. OpenCL extends the C-based programming language for developing portable codes on different platforms such as CPU, Graphics processing units (GPUs), Digital Signal Processors (DSPs) and Field Programmable Gate Arrays (FPGAs). The Intel FPGA SDK for OpenCL is a suite of tools that allows developers to abstract away the complex FPGA-based development flow for a high-level software development flow. Users can focus on the design of hardware-accelerated kernel functions in OpenCL and then direct the tools to generate the low-level FPGA implementations. The approach makes the FPGA-based development more accessible to software users as the needs for hybrid computing using CPUs and FPGAs are increasing. It can also significantly reduce the hardware development time as users can evaluate different ideas with high-level language without deep FPGA domain knowledge. Benchmarking of OpenCL-based framework is an effective way for analyzing the performance of system by studying the execution of the benchmark applications. CHO is a suite of benchmark applications that provides support for OpenCL [1]. The authors presented CHO as an OpenCL port of the CHStone benchmark. Using Altera OpenCL (AOCL) compiler to synthesize the benchmark applications, they listed the resource usage and performance of each kernel that can be successfully synthesized by the compiler. In this report, we evaluate the resource usage and performance of the CHO benchmark applications using the Intel FPGA SDK for OpenCL and Nallatech 385A FPGA board that features an Arria 10 FPGA device. The focus of the report is to have a better understanding of the resource usage and performance of the kernel implementations using Arria-10 FPGA devices compared to Stratix-5 FPGA devices. In addition, we also gain knowledge about the limitations of the current compiler when it fails to synthesize a benchmark
Dawlee, S; Jayakrishnan, A; Jayabalan, M
2009-12-01
A new class of radiopaque copolymer using methyl methacrylate (MMA) and glycidyl methacrylate (GMA) monomers was synthesized and characterized. The copolymer was made radiopaque by the epoxide ring opening of GMA using the catalyst o-phenylenediamine and the subsequent covalent attachment of elemental iodine. The copolymer was characterized by Fourier transform infrared (FTIR) spectra, energy dispersive X-ray analysis using environmental scanning electron microscope (EDAX), thermogravimetric analysis (TGA), and differential scanning calorimetry (DSC). X-ray visibility of the copolymer was checked by X-radiography. Blood compatibility and cytotoxicity of the newly synthesized copolymer were also evaluated. The iodinated copolymer was thermally stable, blood compatible, non-cytotoxic, and highly radiopaque. The presence of bulky iodine group created a new copolymer with modified properties for potential use in biomedical applications.
NaF-loaded core-shell PAN-PMMA nanofibers as reinforcements for Bis-GMA/TEGDMA restorative resins.
Cheng, Liyuan; Zhou, Xuegang; Zhong, Hong; Deng, Xuliang; Cai, Qing; Yang, Xiaoping
2014-01-01
A kind of core-shell nanofibers containing sodium fluoride (NaF) was produced and used as reinforcing materials for dimethacrylate-based dental restorative resins in this study. The core-shell nanofibers were prepared by coaxial-electrospinning with polyacrylonitrile (PAN) and poly(methyl methacrylate) (PMMA) solutions as core and shell fluids, respectively. The produced PAN-PMMA nanofibers varied in fiber diameter and the thickness of PMMA shell depending on electrospinning parameters. NaF-loaded nanofibers were obtained by incorporating NaF nanocrystals into the core fluid at two loadings (0.8 or 1.0wt.%). Embedment of NaF nanocrystals into the PAN core did not damage the core-shell structure. The addition of PAN-PMMA nanofibers into Bis-GMA/TEGDMA clearly showed the reinforcement due to the good interfacial adhesion between fibers and resin. The flexural strength (Fs) and flexural modulus (Ey) of the composites decreased slightly as the thickness of PMMA shell increasing. Sustained fluoride releases with minor initial burst release were achieved from NaF-loaded core-shell nanofibers and the corresponding composites, which was quite different from the case of embedding NaF nanocrystals into the dental resin directly. The study demonstrated that NaF-loaded PAN-PMMA core-shell nanofibers were not only able to improve the mechanical properties of restorative resin, but also able to provide sustained fluoride release to help in preventing secondary caries. © 2013.
Nadkarni, P M; Miller, P L
1991-01-01
A parallel program for inter-database sequence comparison was developed on the Intel Hypercube using two models of parallel programming. One version was built using machine-specific Hypercube parallel programming commands. The other version was built using Linda, a machine-independent parallel programming language. The two versions of the program provide a case study comparing these two approaches to parallelization in an important biological application area. Benchmark tests with both programs gave comparable results with a small number of processors. As the number of processors was increased, the Linda version was somewhat less efficient. The Linda version was also run without change on Network Linda, a virtual parallel machine running on a network of desktop workstations.
International Nuclear Information System (INIS)
Silva, Murilo S.; Souza, Adriana M.C.
2011-01-01
In this work, the mechanical properties and morphology PP/recycled PET blends with addition of P(E-co-MA-co-GMA) copolymer and/or montmorillonite clay (MMT) was investigated. The blends were obtained by extrusion and their morphology was observed by scanning electron microscopy. The mechanical properties were evaluated by tensile and impact tests. Thin films of nanocomposites were characterized by x-ray diffraction (XRD). The addition of P (E-co-MA-co-GMA) or MMT clay separately promoted a decrease of the dispersed phase size. XRD analysis indicated that there was incorporation of polymer in clay galleries. The addition of clay in PP / PET blend resulted in an increase of apparent elastic modulus, impact resistance and HDT and a decrease of tensile strength and elongation at break. The addition of P (E-co-MA-co-GMA) resulted in an increased impact strength and reduction of other properties. There were no significant changes on mechanical properties when the clay and P (E-co-MA-co-GMA) are added simultaneously. (author)
Software and DVFS Tuning for Performance and Energy-Efficiency on Intel KNL Processors
Directory of Open Access Journals (Sweden)
Enrico Calore
2018-06-01
Full Text Available Energy consumption of processors and memories is quickly becoming a limiting factor in the deployment of large computing systems. For this reason, it is important to understand the energy performance of these processors and to study strategies allowing their use in the most efficient way. In this work, we focus on the computing and energy performance of the Knights Landing Xeon Phi, the latest Intel many-core architecture processor for HPC applications. We consider the 64-core Xeon Phi 7230 and profile its performance and energy efficiency using both its on-chip MCDRAM and the off-chip DDR4 memory as the main storage for application data. As a benchmark application, we use a lattice Boltzmann code heavily optimized for this architecture and implemented using several different arrangements of the application data in memory (data-layouts, in short. We also assess the dependence of energy consumption on data-layouts, memory configurations (DDR4 or MCDRAM and the number of threads per core. We finally consider possible trade-offs between computing performance and energy efficiency, tuning the clock frequency of the processor using the Dynamic Voltage and Frequency Scaling (DVFS technique.
OpenMP-accelerated SWAT simulation using Intel C and FORTRAN compilers: Development and benchmark
Ki, Seo Jin; Sugimura, Tak; Kim, Albert S.
2015-02-01
We developed a practical method to accelerate execution of Soil and Water Assessment Tool (SWAT) using open (free) computational resources. The SWAT source code (rev 622) was recompiled using a non-commercial Intel FORTRAN compiler in Ubuntu 12.04 LTS Linux platform, and newly named iOMP-SWAT in this study. GNU utilities of make, gprof, and diff were used to develop the iOMP-SWAT package, profile memory usage, and check identicalness of parallel and serial simulations. Among 302 SWAT subroutines, the slowest routines were identified using GNU gprof, and later modified using Open Multiple Processing (OpenMP) library in an 8-core shared memory system. In addition, a C wrapping function was used to rapidly set large arrays to zero by cross compiling with the original SWAT FORTRAN package. A universal speedup ratio of 2.3 was achieved using input data sets of a large number of hydrological response units. As we specifically focus on acceleration of a single SWAT run, the use of iOMP-SWAT for parameter calibrations will significantly improve the performance of SWAT optimization.
The Focusing Optics X-ray Solar Imager Small Explorer Concept Mission
Christe, Steven; Shih, Albert Y.; Dennis, Brian R.; Glesener, Lindsay; Krucker, Sam; Saint-Hilaire, Pascal; Gubarev, Mikhail; Ramsey, Brian
2016-05-01
We present the FOXSI (Focusing Optics X-ray Solar Imager) small explorer (SMEX) concept, a mission dedicated to studying particle acceleration and energy release on the Sun. FOXSI is designed as a 3-axis stabilized spacecraft in low-Earth orbit making use of state-of-the-art grazing incidence focusing optics combined withpixelated solid-state detectors, allowing for direct imaging of solar X-rays. The current design being studied features multiple telescopes with a 14 meter focal length enabled by a deployable boom.FOXSI will observe the Sun in the 3-100 keV energy range. The FOXSI imaging concept has already been tested on two sounding rocket flights, in 2012 and 2014 and on the HEROES balloon payload flight in 2013. FOXSI will image the Sun with an angular resolution of 5'', a spectral resolution of 0.5 keV, and sub-second temporal resolution. FOXSI is a direct imaging spectrometer with high dynamic range and sensitivity and will provide a brand-new perspective on energy release on the Sun. We describe the mission and its science objectives.
Scientific Programming with High Performance Fortran: A Case Study Using the xHPF Compiler
Directory of Open Access Journals (Sweden)
Eric De Sturler
1997-01-01
Full Text Available Recently, the first commercial High Performance Fortran (HPF subset compilers have appeared. This article reports on our experiences with the xHPF compiler of Applied Parallel Research, version 1.2, for the Intel Paragon. At this stage, we do not expect very High Performance from our HPF programs, even though performance will eventually be of paramount importance for the acceptance of HPF. Instead, our primary objective is to study how to convert large Fortran 77 (F77 programs to HPF such that the compiler generates reasonably efficient parallel code. We report on a case study that identifies several problems when parallelizing code with HPF; most of these problems affect current HPF compiler technology in general, although some are specific for the xHPF compiler. We discuss our solutions from the perspective of the scientific programmer, and presenttiming results on the Intel Paragon. The case study comprises three programs of different complexity with respect to parallelization. We use the dense matrix-matrix product to show that the distribution of arrays and the order of nested loops significantly influence the performance of the parallel program. We use Gaussian elimination with partial pivoting to study the parallelization strategy of the compiler. There are various ways to structure this algorithm for a particular data distribution. This example shows how much effort may be demanded from the programmer to support the compiler in generating an efficient parallel implementation. Finally, we use a small application to show that the more complicated structure of a larger program may introduce problems for the parallelization, even though all subroutines of the application are easy to parallelize by themselves. The application consists of a finite volume discretization on a structured grid and a nested iterative solver. Our case study shows that it is possible to obtain reasonably efficient parallel programs with xHPF, although the compiler
Dey, T.; Rodrigue, P.
2015-07-01
We aim to evaluate the Intel Xeon Phi coprocessor for acceleration of 3D Positron Emission Tomography (PET) image reconstruction. We focus on the sensitivity map calculation as one computational intensive part of PET image reconstruction, since it is a promising candidate for acceleration with the Many Integrated Core (MIC) architecture of the Xeon Phi. The computation of the voxels in the field of view (FoV) can be done in parallel and the 103 to 104 samples needed to calculate the detection probability of each voxel can take advantage of vectorization. We use the ray tracing kernels of the Embree project to calculate the hit points of the sample rays with the detector and in a second step the sum of the radiological path taking into account attenuation is determined. The core components are implemented using the Intel single instruction multiple data compiler (ISPC) to enable a portable implementation showing efficient vectorization either on the Xeon Phi and the Host platform. On the Xeon Phi, the calculation of the radiological path is also implemented in hardware specific intrinsic instructions (so-called `intrinsics') to allow manually-optimized vectorization. For parallelization either OpenMP and ISPC tasking (based on pthreads) are evaluated.Our implementation achieved a scalability factor of 0.90 on the Xeon Phi coprocessor (model 5110P) with 60 cores at 1 GHz. Only minor differences were found between parallelization with OpenMP and the ISPC tasking feature. The implementation using intrinsics was found to be about 12% faster than the portable ISPC version. With this version, a speedup of 1.43 was achieved on the Xeon Phi coprocessor compared to the host system (HP SL250s Gen8) equipped with two Xeon (E5-2670) CPUs, with 8 cores at 2.6 to 3.3 GHz each. Using a second Xeon Phi card the speedup could be further increased to 2.77. No significant differences were found between the results of the different Xeon Phi and the Host implementations. The examination
International Nuclear Information System (INIS)
Dey, T.; Rodrigue, P.
2015-01-01
We aim to evaluate the Intel Xeon Phi coprocessor for acceleration of 3D Positron Emission Tomography (PET) image reconstruction. We focus on the sensitivity map calculation as one computational intensive part of PET image reconstruction, since it is a promising candidate for acceleration with the Many Integrated Core (MIC) architecture of the Xeon Phi. The computation of the voxels in the field of view (FoV) can be done in parallel and the 10 3 to 10 4 samples needed to calculate the detection probability of each voxel can take advantage of vectorization. We use the ray tracing kernels of the Embree project to calculate the hit points of the sample rays with the detector and in a second step the sum of the radiological path taking into account attenuation is determined. The core components are implemented using the Intel single instruction multiple data compiler (ISPC) to enable a portable implementation showing efficient vectorization either on the Xeon Phi and the Host platform. On the Xeon Phi, the calculation of the radiological path is also implemented in hardware specific intrinsic instructions (so-called 'intrinsics') to allow manually-optimized vectorization. For parallelization either OpenMP and ISPC tasking (based on pthreads) are evaluated.Our implementation achieved a scalability factor of 0.90 on the Xeon Phi coprocessor (model 5110P) with 60 cores at 1 GHz. Only minor differences were found between parallelization with OpenMP and the ISPC tasking feature. The implementation using intrinsics was found to be about 12% faster than the portable ISPC version. With this version, a speedup of 1.43 was achieved on the Xeon Phi coprocessor compared to the host system (HP SL250s Gen8) equipped with two Xeon (E5-2670) CPUs, with 8 cores at 2.6 to 3.3 GHz each. Using a second Xeon Phi card the speedup could be further increased to 2.77. No significant differences were found between the results of the different Xeon Phi and the Host implementations. The
Liu, Yuan-Kwei
1991-01-01
The feasibility is analyzed of upgrading the Intel 386 microprocessor, which has been proposed as the baseline processor for the Space Station Freedom (SSF) Data Management System (DMS), to the more advanced i486 microprocessors. The items compared between the two processors include the instruction set architecture, power consumption, the MIL-STD-883C Class S (Space) qualification schedule, and performance. The advantages of the i486 over the 386 are (1) lower power consumption; and (2) higher floating point performance. The i486 on-chip cache does not have parity check or error detection and correction circuitry. The i486 with on-chip cache disabled, however, has lower integer performance than the 386 without cache, which is the current DMS design choice. Adding cache to the 386/386 DX memory hierachy appears to be the most beneficial change to the current DMS design at this time.
Energy Technology Data Exchange (ETDEWEB)
Doerfler, Douglas [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Austin, Brian [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Cook, Brandon [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Deslippe, Jack [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Kandalla, Krishna [Cray Inc, Bloomington, MN (United States); Mendygral, Peter [Cray Inc, Bloomington, MN (United States)
2017-09-12
There are many potential issues associated with deploying the Intel Xeon Phi™ (code named Knights Landing [KNL]) manycore processor in a large-scale supercomputer. One in particular is the ability to fully utilize the high-speed communications network, given that the serial performance of a Xeon Phi TM core is a fraction of a Xeon®core. In this paper, we take a look at the trade-offs associated with allocating enough cores to fully utilize the Aries high-speed network versus cores dedicated to computation, e.g., the trade-off between MPI and OpenMP. In addition, we evaluate new features of Cray MPI in support of KNL, such as internode optimizations. We also evaluate one-sided programming models such as Unified Parallel C. We quantify the impact of the above trade-offs and features using a suite of National Energy Research Scientific Computing Center applications.
2017-12-01
BX equation to find B while minimizing the squared difference between Y and BX. We used the Intel Math Kernel Library (Intel® Math Kernel Library...virtually eliminate distance-dependent motion artifacts in resting state fMRI. J. Appl. Math . 935154 (2013). Lowe, M.J., Mock, B.J., Sorenson, J.A., 1998...feature is IC energy. The energy of a discrete time signal of x is defined by: Ex ∑∞ n=−∞ |x [n] |2 (2) Kurtosis can also be used for separating
Directory of Open Access Journals (Sweden)
Jünger, Jana
2010-08-01
Full Text Available [english] With the introduction of the new medical licensing regulation [1] in 2002, a reform process was initiated nationwide that aimed to redesign medical degree programs at universities to make them more practice-oriented and to establish quality assurance in teaching. Five centers of excellence were set up at the medical schools in Baden-Württemberg that merged to form the Network for Excellence in Medical Education.The Network for Excellence in Medical Education carried out a survey among the five medical schools in Baden-Württemberg on the implementation of the requirements set down in the GMA guidelines for university-specific, high-quality assessments during the clinical phase of medical studies. The network’s next steps for improving the quality of assessments at medical schools were prioritized in order to determine the urgency of support to be given to Baden-Württemberg’s faculties of medicine in implementing the GMA requirements.It became apparent that essential parts of the requirements formulated in the guidelines had already been fulfilled or at least could be fulfilled in the near future. It was observed that establishing structured review processes during assessment preparation and in particular the follow-up presented considerable difficulties. A focus group analysis identified the following objectives for the network: supporting medical schools in their review processes; compiling a comprehensive assessment program and assessment reports with statistical analysis. Training the people responsible for assessment is another priority.The results largely correspond to those from a similar survey carried out among medical schools in Bavaria and show that organizational structures, such as those that have been established in the centers of excellence in education and assessment in Baden-Württemberg and Bavaria, can offer essential support in the quality assurance of assessment.[german] Mit der Einführung der novellierten
Parallel spatial direct numerical simulations on the Intel iPSC/860 hypercube
Joslin, Ronald D.; Zubair, Mohammad
1993-01-01
The implementation and performance of a parallel spatial direct numerical simulation (PSDNS) approach on the Intel iPSC/860 hypercube is documented. The direct numerical simulation approach is used to compute spatially evolving disturbances associated with the laminar-to-turbulent transition in boundary-layer flows. The feasibility of using the PSDNS on the hypercube to perform transition studies is examined. The results indicate that the direct numerical simulation approach can effectively be parallelized on a distributed-memory parallel machine. By increasing the number of processors nearly ideal linear speedups are achieved with nonoptimized routines; slower than linear speedups are achieved with optimized (machine dependent library) routines. This slower than linear speedup results because the Fast Fourier Transform (FFT) routine dominates the computational cost and because the routine indicates less than ideal speedups. However with the machine-dependent routines the total computational cost decreases by a factor of 4 to 5 compared with standard FORTRAN routines. The computational cost increases linearly with spanwise wall-normal and streamwise grid refinements. The hypercube with 32 processors was estimated to require approximately twice the amount of Cray supercomputer single processor time to complete a comparable simulation; however it is estimated that a subgrid-scale model which reduces the required number of grid points and becomes a large-eddy simulation (PSLES) would reduce the computational cost and memory requirements by a factor of 10 over the PSDNS. This PSLES implementation would enable transition simulations on the hypercube at a reasonable computational cost.
Moawia, Rihab Musaad; Nasef, Mohamed Mahmoud; Mohamed, Nor Hasimah; Ripin, Adnan
2016-05-01
Flax fibres were modified by radiation induced graft copolymerization of glycidyl methacrylate (GMA) by pre-irradiation method in an emulsion medium. The effect of reaction parameters on the degree of grafting (DOG) such as concentration of bleaching agent, absorbed dose, monomer concentration, temperature and reaction time were investigated. The DOG was found to be dependent on the investigated parameters. The incorporation of poly(GMA) grafts in the bleached flax fibres was confirmed by Fourier transform infrared spectroscopy (FTIR) and scanning electron microscopy (SEM). The structural and mechanical changes were evaluated by X-ray diffraction (XRD) and mechanical tester, respectively. The results revealed that reacting bleached flax fibres irradiated with 20 kGy with 5% GMA emulsion containing 0.5% polyoxyethylene-sorbitan monolaurate (Tween 20) surfactant at 40 °C for 1 h led to a maximum DOG of 148%. The grafted fibres showed sufficient mechanical strength and hydrophobicity which make them promising precursors for development of adsorbents after appropriate chemical treatments.
Graphene macro-assembly-fullerene composite for electrical energy storage
Campbell, Patrick G.; Baumann, Theodore F.; Biener, Juergen; Merrill, Matthew; Montalvo, Elizabeth; Worsley, Marcus A.; Biener, Monika M.; Hernandez, Maira Raquel Ceron
2018-01-16
Disclosed here is a method for producing a graphene macro-assembly (GMA)-fullerene composite, comprising providing a GMA comprising a three-dimensional network of graphene sheets crosslinked by covalent carbon bonds, and incorporating at least 20 wt. % of at least one fullerene compound into the GMA based on the initial weight of the GMA to obtain a GMA-fullerene composite. Also described are a GMA-fullerene composite produced, an electrode comprising the GMA-fullerene composite, and a supercapacitor comprising the electrode and optionally an organic or ionic liquid electrolyte in contact with the electrode.
Görlitz, Anja; Ebert, Thomas; Bauer, Daniel; Grasl, Matthäus; Hofer, Matthias; Lammerding-Köppel, Maria; Fabry, Götz
2015-01-01
Recent developments in medical education have created increasing challenges for medical teachers which is why the majority of German medical schools already offer educational and instructional skills trainings for their teaching staff. However, to date no framework for educational core competencies for medical teachers exists that might serve as guidance for the qualification of the teaching faculty. Against the background of the discussion about competency based medical education and based upon the international literature, the GMA Committee for Faculty and Organizational Development in Teaching developed a model of core teaching competencies for medical teachers. This framework is designed not only to provide guidance with regard to individual qualification profiles but also to support further advancement of the content, training formats and evaluation of faculty development initiatives and thus, to establish uniform quality criteria for such initiatives in German-speaking medical schools. The model comprises a framework of six competency fields, subdivided into competency components and learning objectives. Additional examples of their use in medical teaching scenarios illustrate and clarify each specific teaching competency. The model has been designed for routine application in medical schools and is thought to be complemented consecutively by additional competencies for teachers with special duties and responsibilities in a future step. PMID:26038688
INTEGRAL discovered a new hard X-ray source: IGRJ17511-3057
DEFF Research Database (Denmark)
Baldovin, C.; Kuulkers, E.; Ferrigno, C.
2009-01-01
with a significance of 14 sigma in the 20-40 keV energy band, and 7 sigma in the 40-80 keV energy band. The corresponding count rates in these bands are 4.2+/0.3 cts/s (28 mCrab) and 1.8+/-0.3 cts/s (25 mCrab), respectively. The source is also detected in the JEM-X mosaic in the three energy bands 3-7 keV, 7-11 ke......V, and 11-20 keV. The source flux is ~20 mCrab and the detection significance is 3 sigma in all bands. The best determined source position is RA: 267.811 DEC: -30.954 (J2000), with a 90% error radius of 2.0 arcmin. The combined IBIS/ISGRI and JEM-X spectrum in the 3-100 keV energy range is well described...... by a single power-law with photon index 2.0+/-0.2. The source flux is 5.7e-10 erg/cm2/s in the 3-20 keV energy band and 4.8e-10 erg/cm2/s in the 20-100 keV energy band....
International Nuclear Information System (INIS)
Liu, T.; Xu, X.G.; Carothers, C.D.
2013-01-01
Hardware accelerators are currently becoming increasingly important in boosting high performance computing systems. In this study, we tested the performance of two accelerator models, NVIDIA Tesla M2090 GPU and Intel Xeon Phi 5110p coprocessor, using a new Monte Carlo photon transport package called ARCHER-CT we have developed for fast CT imaging dose calculation. The package contains three code variants, ARCHER-CT(CPU), ARCHER-CT(GPU) and ARCHER-CT(COP) to run in parallel on the multi-core CPU, GPU and coprocessor architectures respectively. A detailed GE LightSpeed Multi-Detector Computed Tomography (MDCT) scanner model and a family of voxel patient phantoms were included in the code to calculate absorbed dose to radiosensitive organs under specified scan protocols. The results from ARCHER agreed well with those from the production code Monte Carlo N-Particle eXtended (MCNPX). It was found that all the code variants were significantly faster than the parallel MCNPX running on 12 MPI processes, and that the GPU and coprocessor performed equally well, being 2.89-4.49 and 3.01-3.23 times faster than the parallel ARCHER-CT(CPU) running with 12 hyper-threads. (authors)
Liu, Tianyu; Xu, X. George; Carothers, Christopher D.
2014-06-01
Hardware accelerators are currently becoming increasingly important in boosting high performance computing sys- tems. In this study, we tested the performance of two accelerator models, NVIDIA Tesla M2090 GPU and Intel Xeon Phi 5110p coprocessor, using a new Monte Carlo photon transport package called ARCHER-CT we have developed for fast CT imaging dose calculation. The package contains three code variants, ARCHER - CTCPU, ARCHER - CTGPU and ARCHER - CTCOP to run in parallel on the multi-core CPU, GPU and coprocessor architectures respectively. A detailed GE LightSpeed Multi-Detector Computed Tomography (MDCT) scanner model and a family of voxel patient phantoms were included in the code to calculate absorbed dose to radiosensitive organs under specified scan protocols. The results from ARCHER agreed well with those from the production code Monte Carlo N-Particle eXtended (MCNPX). It was found that all the code variants were significantly faster than the parallel MCNPX running on 12 MPI processes, and that the GPU and coprocessor performed equally well, being 2.89~4.49 and 3.01~3.23 times faster than the parallel ARCHER - CTCPU running with 12 hyperthreads.
Energy Technology Data Exchange (ETDEWEB)
Markiewicz, T.W.
1981-10-01
Interactions of 209-GeV muons within an instrumented magnetized-steel calorimeter have produced 4374 +- 87 ..mu../sup +/..mu../sup -/ pairs from J/psi decay, corresponding to the cross section sigma(..mu..N ..-->.. ..mu.. psi X) = 0.64 +- 0.10 nb. These interactions are classified as either elastic (sigma = 0.36 +- 0.07 nb) or inelastic (sigma = 0.28 +- 0.06 nb) based primarily on the calorimetric determination of E/sub X/. The cross section for elastic psi production by virtual photons, sigma/sub eff/(..gamma../sub V/N), rises with energy nu as log nu. Its dependence on Q/sup 2/ fits the vector-meson dominance form P(..lambda..) = (1 + Q/sup 2//..lambda../sup 2/)/sup -2/, with ..lambda.. = (2.0 - 2.4) +- 0.15 GeV, where the spread in values arises from considering the possibility of a Q/sup 2/ dependence in the decay angular distribution W (theta,phi) and in the nuclear shadowing factor. We find that W(theta,phi) is consistent with the form expected if the reaction ..gamma../sub V/N ..-->.. psiN conserves helicity in the s channel through natural-parity exchange in the t channel. After correction for nuclear effects, d sigma/sub eff//dt is described by the sum of two exponential terms in t, with average t slope b = 2.56 (+0.35 or - 0.32). The photon-gluon fusion (..gamma..g ..-->.. psi) perturbative quantum chromodynamic model for psi production provides an excellent description of the nu dependence of sigma/sub eff/, but cannot simultaneously explain the observed cross section and value of ..lambda... The differential cross section d/sup 2/sigma/sub eff//dzdp/sub perpindicular//sup 2/ for inelastically produced psi's rises approximately linearly with elasticity z identical with E/sub psi//nu. The p/sub perpendicular//sup 2/ dependence is flatter than that of d sigma/dt for elastic events, with average p/sub perpendicular//sup 2/ slope b = 1.46 +- 0.10. The Q/sup 2/ dependence of sigma/sub eff/ is that of P(..lambda..) with ..lambda.. = 3.0 +- 0.2 GeV, and
International Nuclear Information System (INIS)
Markiewicz, T.W.
1981-10-01
Interactions of 209-GeV muons within an instrumented magnetized-steel calorimeter have produced 4374 +- 87 μ + μ - pairs from J/psi decay, corresponding to the cross section sigma(μN → μ psi X) = 0.64 +- 0.10 nb. These interactions are classified as either elastic (sigma = 0.36 +- 0.07 nb) or inelastic (sigma = 0.28 +- 0.06 nb) based primarily on the calorimetric determination of E/sub X/. The cross section for elastic psi production by virtual photons, sigma/sub eff/(γ/sub V/N), rises with energy nu as log nu. Its dependence on Q 2 fits the vector-meson dominance form P(Λ) = (1 + Q 2 /Λ 2 ) -2 , with Λ = (2.0 - 2.4) +- 0.15 GeV, where the spread in values arises from considering the possibility of a Q 2 dependence in the decay angular distribution W (theta,phi) and in the nuclear shadowing factor. We find that W(theta,phi) is consistent with the form expected if the reaction γ/sub V/N → psiN conserves helicity in the s channel through natural-parity exchange in the t channel. After correction for nuclear effects, d sigma/sub eff//dt is described by the sum of two exponential terms in t, with average t slope b = 2.56 (+0.35 or - 0.32). The photon-gluon fusion (γg → psi) perturbative quantum chromodynamic model for psi production provides an excellent description of the nu dependence of sigma/sub eff/, but cannot simultaneously explain the observed cross section and value of Λ. The differential cross section d 2 sigma/sub eff//dzdp/sub perpindicular/ 2 for inelastically produced psi's rises approximately linearly with elasticity z identical with E/sub psi//nu. The p/sub perpendicular/ 2 dependence is flatter than that of d sigma/dt for elastic events, with average p/sub perpendicular/ 2 slope b = 1.46 +- 0.10. The Q 2 dependence of sigma/sub eff/ is that of P(Λ) with Λ = 3.0 +- 0.2 GeV, and the nu dependence is similar to that observed for elastic production. 101 references, 33 figures, 20 tables
Controlled protein adsorption on PMOXA/PAA based coatings by thermally induced immobilization
Mumtaz, Fatima; Chen, Chaoshi; Zhu, Haikun; Pan, Chao; Wang, Yanmei
2018-05-01
In this work, poly(2-methyl-2-oxazoline-random-glycidyl methacrylate) (PMOXA-r-GMA) and poly(acrylic acid)-block-poly(glycidyl methacrylate) (PAA-b-PGMA) copolymers were synthesized via cationic ring-opening polymerization (CROP) of 2-methyl-2-oxazoline (MOXA) and reversible addition-fragmentation chain transfer (RAFT) polymerization of acrylic acid (AA) followed by their random and block copolymerization with glycidyl methacrylate (GMA), respectively, and then characterized carefully. PMOXA/PAA based coatings were then prepared by simply spin coating the mixture of PMOXA-r-GMA and PAA-b-PGMA copolymer solutions onto silicon/glass substrates followed by annealing at 110 °C. The coatings were rigorously characterized by using X-ray photoelectron spectroscopy (XPS), the static water contact angle (WCA) test, ellipsometry and atomic force microscopy (AFM). The results demonstrated that the coating based mixed PMOXA/PAA brushes with desired surface composition could be attained by simply maintaining their percentage in the mixture of PMOXA-r-GMA and PAA-b-PGMA copolymer solutions. Finally, the switchable behavior of PMOXA/PAA based coatings toward bovine serum albumin (BSA) adsorption was investigated by fluorescein isothiocyanate-labelled BSA (FITC-BSA) assay and quartz crystal microbalance with dissipation monitoring (QCM-D), which indicated that the coating based mixed PMOXA/PAA brushes could control BSA adsorption/desorption from very low to high amount (>90% desorption) through adjusting the composition of PMOXA-r-GMA and PAA-b-PGMA solution used in preparing PMOXA/PAA based coatings upon pH and ionic strength change. Furthermore, PMOXA/PAA based coatings displayed efficient repeatability of reversible BSA adsorption/desorption cycles.
Directory of Open Access Journals (Sweden)
,
2008-02-01
Full Text Available [english] With the implementation of a new licensing regulation for doctors in 2002 the responsibility for assessment was assigned from the German national examination board to the individual faculties, especially so for clinical subjects.39 graded reports have to be issued between the first national board examination (after 2 years of preclinical studies and the start of the internship (6th year. This new task provides special demands for assessment organization at faculty level. A number of prerequisites have to be met to guarantee adequate quality in assessment. To support faculties in meeting these requirements, guidelines were issued in cooperation with GMA assessment committee and the Baden-Württemberg competence centre for assessment in medical education. Developed on broad consensus these guidelines define quality requirements based on international standards. Their effect on quality improvement in German medical faculty’s examinations in clinical subjects is to be researched concomitantly.[german] Die neue ärztliche Approbationsordnung (ÄAppO aus dem Jahre 2002 verlagert die Prüfungsverantwortung insbesondere für den klinischen Studienabschnitt auf die Fakultäten:39 benotete Leistungsnachweise sind zwischen der ersten Staatsprüfung und praktischem Jahr zu erstellen. Diese neue Aufgabe stellt besondere Anforderungen an das fakultäre Prüfungswesen. Um eine angemessene Qualität der fakultären Prüfungen sicher zu stellen, sind eine Reihe von Voraussetzungen zu erfüllen. Die vorliegenden Leitlinien des GMA-Ausschusses Prüfungen und des Kompetenzzentrums Prüfungen des Landes Baden-Württemberg wurden erstellt, um die Fakultäten in dieser Aufgabe zu unterstützen. Die vorliegenden Leitlinien definieren die Qualitätsanforderungen unter Berücksichtigung internationaler Standards und wurden in breitem Konsens entwickelt. Ihre Wirkung im Hinblick auf die Qualitätsverbesserung der fakultären Prüfungen im klinischen
Thread-level parallelization and optimization of NWChem for the Intel MIC architecture
Energy Technology Data Exchange (ETDEWEB)
Shan, Hongzhang [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Williams, Samuel [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); de Jong, Wibe [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Oliker, Leonid [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2015-01-01
In the multicore era it was possible to exploit the increase in on-chip parallelism by simply running multiple MPI processes per chip. Unfortunately, manycore processors' greatly increased thread- and data-level parallelism coupled with a reduced memory capacity demand an altogether different approach. In this paper we explore augmenting two NWChem modules, triples correction of the CCSD(T) and Fock matrix construction, with OpenMP in order that they might run efficiently on future manycore architectures. As the next NERSC machine will be a self-hosted Intel MIC (Xeon Phi) based supercomputer, we leverage an existing MIC testbed at NERSC to evaluate our experiments. In order to proxy the fact that future MIC machines will not have a host processor, we run all of our experiments in native mode. We found that while straightforward application of OpenMP to the deep loop nests associated with the tensor contractions of CCSD(T) was sufficient in attaining high performance, significant e ort was required to safely and efeciently thread the TEXAS integral package when constructing the Fock matrix. Ultimately, our new MPI+OpenMP hybrid implementations attain up to 65× better performance for the triples part of the CCSD(T) due in large part to the fact that the limited on-card memory limits the existing MPI implementation to a single process per card. Additionally, we obtain up to 1.6× better performance on Fock matrix constructions when compared with the best MPI implementations running multiple processes per card.
Wydra, James W; Cramer, Neil B; Stansbury, Jeffrey W; Bowman, Christopher N
2014-06-01
A model BisGMA/TEGDMA unfilled resin was utilized to investigate the effect of varied irradiation intensity on the photopolymerization kinetics and shrinkage stress evolution, as a means for evaluation of the reciprocity relationship. Functional group conversion was determined by FTIR spectroscopy and polymerization shrinkage stress was obtained by a tensometer. Samples were polymerized with UV light from an EXFO Acticure with 0.1wt% photoinitiator. A one-dimensional kinetic model was utilized to predict the conversion-dose relationship. As irradiation intensity increased, conversion decreased at a constant irradiation dose and the overall dose required to achieve full conversion increased. Methacrylate conversion ranged from 64±2% at 3mW/cm(2) to 78±1% at 24mW/cm(2) while the final shrinkage stress varied from 2.4±0.1MPa to 3.0±0.1MPa. The ultimate conversion and shrinkage stress levels achieved were dependent not only upon dose but also the irradiation intensity, in contrast to an idealized reciprocity relationship. A kinetic model was utilized to analyze this behavior and provide theoretical conversion profiles versus irradiation time and dose. Analysis of the experimental and modeling results demonstrated that the polymerization kinetics do not and should not be expected to follow the reciprocity law behavior. As irradiation intensity is increased, the overall dose required to achieve full conversion also increased. Further, the ultimate conversion and shrinkage stress that are achieved are not dependent only upon dose but rather upon the irradiation intensity and corresponding polymerization rate. Copyright © 2014 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
Comparison of Software Technologies for Vectorization and Parallelization
Lazzaro, Alfio; Nowak, Andrzej; Valsan, Liviu
2012-01-01
This paper demonstrates how modern software development methodologies can be used to give an existing sequential application a considerable performance speed-up on modern x86 server systems. Whereas, in the past, speed-up was directly linked to the increase in clock frequency when moving to a more modern system, current x86 servers present a plethora of “performance dimensions” that need to be harnessed with great care. The application we used is a real-life data analysis example in C++ analyzing High Energy Physics data. The key software methods used are OpenMP, Intel Threading Building Blocks (TBB), Intel Cilk Plus, and the auto-vectorization capability of the Intel compiler (Composer XE). Somewhat surprisingly, the Message Passing Interface (MPI) is successfully added, although our focus is on single-node rather than multi-node performance optimization. The paper underlines the importance of algorithmic redesign in order to optimize each performance dimension and links this to close control of the memo...
Islam, Aminul; Kumar, Suneel; Zaidi, Noushi; Ahmad, Hilal
2016-12-15
An ethylenediamine functionalized glycidyl methacrylate (GMA) based terpolymeric chelating resin was synthesized for the separation and preconcentration of Cd(II) and Zn(II) by SPE from bread, rice and fruit juice prior to FAAS determination. The resin was characterized by FT-IR, TGA/DTA, SEM, BET analysis and EDS. Synthesized resin shows a good capacity of 53.96mgg(-1) for Cd(II) and 24.19mgg(-1) for Zn(II) at pH 8.0. Five isotherm equilibrium models were studied to explain the sorption phenomenon out of which Langmuir, Dubinin-Radushkevich, Scatchard and Temkin models were found to be the best fitted. The limit of detection (LOD) and limit of quantification (LOQ) were observed to be 1.5 and 5.1μgL(-1) for Cd and 1.2 and 4.1μgL(-1) for Zn. The reliability of the method was investigated by the analysis of SRM and the recovery of analytes from various spiked food samples. Copyright © 2016 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Bondar, Yu.V.; Kim, H.J.; Lim, Y.J.; Kravets, L.I.
2004-01-01
Full text: Two types of sorption-active polypropylene fiber carrying strong-acid sulfonate groups and amino groups have been synthesized by radiation-induced graft polymerization of glycidyl methacrylate (GMA) with subsequent chemical modification of the epoxy groups of poly-GMA graft chains. The effect of various polymerization parameters on the GMA grafting degree was investigated in detail. The epoxy ring-opening of poly-GMA graft chains with introduction of strong-acid sulfonate groups was carried out with sodium hydrogen sulfite in water-dimethylformamide solution at 70 o C. The main peculiarities of the sulfonation reaction in depending on the reaction time and GMA grafting degree have been investigated. It was shown that for the samples with GMA grafting degree more than 50% two simultaneous processes take place during the sulfonation reaction, namely the incorporation of the sulfonate groups via opening of the GMA epoxy-rings as well as hydrolysis of the GMA epoxy-rings with the formation of α-glycol groups. Amine groups were incorporated by treatment of GMA-grafted polypropylene fibers with excess of diethylene triamine reagent. The conversion of the epoxy groups into the functional groups was investigated as a function of the degree of GMA grafting and reaction time. The ion-exchange characteristics of obtained sorption-active polypropylene fibers were determined
International Nuclear Information System (INIS)
Bondar, Yu.V.; Kim, H.J.; Lim, Y.J.; Kravets, L.I.
2004-01-01
Two types of sorption-active polypropylene fiber carrying strong-acid sulfonate groups and amino groups have been synthesized by radiation-induced graft polymerization of glycidyl methacrylate (GMA) with subsequent chemical modification of the epoxy groups of poly-GMA graft chains. The effect of various polymerization parameters on the GMA grafting degree was investigated in detail. The epoxy ring-opening of poly-GMA graft chains with introduction of strong-acid sulfonate groups was carried out with sodium hydrogen sulfite in water-dimethylformamide solution at 70 o C. The main peculiarities of the sulfonation reaction in depending on the reaction time and GMA grafting degree have been investigated. It was shown that for the samples with GMA grafting degree more than 50% two simultaneous processes take place during the sulfonation reaction, namely the incorporation of the sulfonate groups via opening of the GMA epoxy-rings as well as hydrolysis of the GMA epoxy-rings with the formation of α-glycol groups. Amine groups were incorporated by treatment of GMA-grafted polypropylene fibers with excess of diethylene triamine reagent. The conversion of the epoxy groups into the functional groups was investigated as a function of the degree of GMA grafting and reaction time. The ion-exchange characteristics of obtained sorption-active polypropylene fibers were determined. (author)
Structure/property relationships in multipass GMA welding of beryllium.
Energy Technology Data Exchange (ETDEWEB)
Hochanadel, P. W. (Patrick W.); Hults, W. L. (William L.); Thoma, D. J. (Dan J.); Dave, V. R. (Vivek R.); Kelly, A. M. (Anna Marie); Pappin, P. A. (Pallas A.); Cola, M. J. (Mark J.); Burgardt, P. (Paul)
2001-01-01
Beryllium is an interesting metal that has a strength to weight ratio six times that of steel. Because of its unique mechanical properties, beryllium is used in aerospace applications such as satellites. In addition, beryllium is also used in x-ray windows because it is nearly transparent to x-rays. Joining of beryllium has been studied for decades (Ref.l). Typically joining processes include braze-welding (either with gas tungsten arc or gas metal arc), soldering, brazing, and electron beam welding. Cracking which resulted from electron beam welding was recently studied to provide structure/property relationships in autogenous welds (Ref. 2). Braze-welding utilizes a welding arc to melt filler, and only a small amount of base metal is melted and incorporated into the weld pool. Very little has been done to characterize the braze-weld in terms of the structure/property relationships, especially with reference to multipass welding. Thus, this investigation was undertaken to evaluate the effects of multiple passes on microstructure, weld metal composition, and resulting material properties for beryllium welded with aluminum-silicon filler metal.
Perfmon2: a leap forward in performance monitoring
International Nuclear Information System (INIS)
Jarp, S; Jurga, R; Nowak, A
2008-01-01
This paper describes the software component, perfmon2, that is about to be added to the Linux kernel as the standard interface to the Performance Monitoring Unit (PMU) on common processors, including x86 (AMD and Intel), Sun SPARC, MIPS, IBM Power and Intel Itanium. It also describes a set of tools for doing performance monitoring in practice and details how the CERN openlab team has participated in the testing and development of these tools
Perfmon2: a leap forward in performance monitoring
Energy Technology Data Exchange (ETDEWEB)
Jarp, S; Jurga, R; Nowak, A [CERN, Geneva (Switzerland)], E-mail: Sverre.Jarp@cern.ch
2008-07-15
This paper describes the software component, perfmon2, that is about to be added to the Linux kernel as the standard interface to the Performance Monitoring Unit (PMU) on common processors, including x86 (AMD and Intel), Sun SPARC, MIPS, IBM Power and Intel Itanium. It also describes a set of tools for doing performance monitoring in practice and details how the CERN openlab team has participated in the testing and development of these tools.
Perfmon2 a leap forward in performance monitoring
Jarp, S; Nowak, A
2008-01-01
This paper describes the software component, perfmon2, that is about to be added to the Linux kernel as the standard interface to the Performance Monitoring Unit (PMU) on common processors, including x86 (AMD and Intel), Sun SPARC, MIPS, IBM Power and Intel Itanium. It also describes a set of tools for doing performance monitoring in practice and details how the CERN openlab team has participated in the testing and development of these tools.
Perfmon2: a leap forward in performance monitoring
Jarp, S.; Jurga, R.; Nowak, A.
2008-07-01
This paper describes the software component, perfmon2, that is about to be added to the Linux kernel as the standard interface to the Performance Monitoring Unit (PMU) on common processors, including x86 (AMD and Intel), Sun SPARC, MIPS, IBM Power and Intel Itanium. It also describes a set of tools for doing performance monitoring in practice and details how the CERN openlab team has participated in the testing and development of these tools.
Search for Pentaquarks in the Hadronic Decays of the Z Boson with the DELPHI Detector at LEP
Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, P; Ballestrero, A; Bambade, P; Barbier, R; Bardin, D; Barker, G J; Baroncelli, A; Battaglia, M; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N; Benvenuti, A; Bérat, C; Berggren, M; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Buschbeck, B; Buschmann58, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F; Chapkin, M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis51, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J; Gandelman, M; García, C; Gavillet, P; Gazis, E; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke1, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Kokkinias, P; Leinonen, L; Katsoufis, E; Kernel, G; Kersevan, B P; Krumshtein, Z; Lesiak, T; Kerzel, U; Liebig, W; King, B T; Lamsa, J; Liko, D; Kjaer, N J; Leder, G; Kluit, P; Kourkoumelis, C; Leitner, R; Kuznetsov, O; Kucharczyk, M; Ledroit, F; Lopes, J H; Lemonne, J; Lepeltier, V; Lipniacka, A; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Paganoni, M; Nassiakou, M; Paiano, S; Navarria, F; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Ouraou, A; Parkes, C; Oblakowska-Mucha, A; Oyanguren, A; Obraztsov, V F; Olshevski, A; Palacios, J P; Onofre, A; Palka, H; Orava, R; Österberg, K; Pape, L; Papadopoulou, T D; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, A; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Sekulin, R; Siebel, M; Sisakian, A; Smadja, G; Smirnova, O; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Tegenfeldt, F; Timmermans, J; Tkatchev, L; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Remortel, N; Van Vulpen, I; Vegni, G; Veloso, F; Venus, W; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O; Zalewska-Bak, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zintchenko, A; Zupan, M
2007-01-01
The quark model does not exclude states composed of more than three quarks, like pentaquark systems. Controversial evidence for such states has been published in the last years, in particular: for a strange pentaquark Theta(1540)+; for a double-strange state, the Xi(1862)--, subsequently called Phi(1860)--; and for a charmed state, the Theta_c(3100)^0. If confirmed, a full pentaquark family might exist; such pentaquark states could be produced in e+e- annihilations near the Z energy. In this paper a search for pentaquarks is described using the DELPHI detector at LEP, characterized by powerful particle identification sub-systems crucial in the separation of the signal from the background for these states. At 95% CL, upper limits are set on the production rates of such particles and their charge-conjugate state per Z decay: x Br(Theta+ -> pK0_S) x Br(Phi(1860)-- -> Xi- pi-) x Br(Theta_c(3100)^0 -> D*+ pbar) < 8.8 x 10^{-4} .
Improvement of cytocompatibility of polylactide by filling with marine algae powder
Energy Technology Data Exchange (ETDEWEB)
Wu, Tung-Yi [Department of Materials Science and Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Yang, Ming-Chien, E-mail: myang@mail.ntust.edu.tw [Department of Materials Science and Engineering, National Taiwan University of Science and Technology, Taipei 10607, Taiwan (China); Hsu, Yi-Chiang [Graduate Institute of Medical Science, College of Health Sciences, Chang Jung Christian University, Tainan 71101, Taiwan (China); Innovative Research Center of Medicine, College of Health Sciences, Chang Jung Christian University, Tainan 71101, Taiwan (China)
2015-05-01
This work evaluated the cytocompatibility, thermal and mechanical properties of composites of polylactide (PLA) and marine algae powder (MAP). To improve the thermal and mechanical properties of PLA–MAP composites, glycidyl methacrylate (GMA) was used as the compatibilizer for the blending of PLA and MAP. The PLA-g-GMA/MAP composites exhibited superior mechanical properties, attributing to higher compatibility between the polymer and MAP, comparing to PLA/MAP composites. The dispersion of MAP in the PLA-g-GMA matrix was highly homogeneous as a result of etherification. The lower melt torque of the PLA-g-GMA/MAP composites also made them more processable than PLA/MAP. To assess the cytocompatibility, normal human foreskin fibroblasts (FBs) were seeded onto each type of the composites. Results of FB proliferation, collagen production, and cytotoxicity assays indicated greater cytocompatibility for the PLA/MAP composites than for the PLA-g-GMA/MAP composites. Furthermore, both PLA/MAP and PLA-g-GMA/MAP composites were more cytocompatible than pure PLA. - Highlights: • PLA was grafted with GMA to form ether bond with marine algae powder (MAP). • Composites of PLA-g-GMA and MAP exhibited cytocompatibility with fibroblasts. • PLA-g-GMA/MAP composites exhibited mechanical properties superior to PLA/MAP. • PLA-g-GMA/MAP composites were more processable than PLA/MAP.
Improvement of cytocompatibility of polylactide by filling with marine algae powder
International Nuclear Information System (INIS)
Wu, Tung-Yi; Yang, Ming-Chien; Hsu, Yi-Chiang
2015-01-01
This work evaluated the cytocompatibility, thermal and mechanical properties of composites of polylactide (PLA) and marine algae powder (MAP). To improve the thermal and mechanical properties of PLA–MAP composites, glycidyl methacrylate (GMA) was used as the compatibilizer for the blending of PLA and MAP. The PLA-g-GMA/MAP composites exhibited superior mechanical properties, attributing to higher compatibility between the polymer and MAP, comparing to PLA/MAP composites. The dispersion of MAP in the PLA-g-GMA matrix was highly homogeneous as a result of etherification. The lower melt torque of the PLA-g-GMA/MAP composites also made them more processable than PLA/MAP. To assess the cytocompatibility, normal human foreskin fibroblasts (FBs) were seeded onto each type of the composites. Results of FB proliferation, collagen production, and cytotoxicity assays indicated greater cytocompatibility for the PLA/MAP composites than for the PLA-g-GMA/MAP composites. Furthermore, both PLA/MAP and PLA-g-GMA/MAP composites were more cytocompatible than pure PLA. - Highlights: • PLA was grafted with GMA to form ether bond with marine algae powder (MAP). • Composites of PLA-g-GMA and MAP exhibited cytocompatibility with fibroblasts. • PLA-g-GMA/MAP composites exhibited mechanical properties superior to PLA/MAP. • PLA-g-GMA/MAP composites were more processable than PLA/MAP
Synthesis and characterization of monosize magnetic poly(glycidyl methacrylate) beads
Institute of Scientific and Technical Information of China (English)
Evrim Banu Alt1nta(s); Lokman Uzun; Adil Denizli
2007-01-01
Monosize, 1.6 μm, magnetic beads of poly(glycidyl methacrylate) [M-poly(GMA)], were prepared by dispersion polymerization in the presence of Fe3O4 nano-powder. Monosize M-poly(GMA) beads were characterized by swelling tests, density measurements, electron spin resonance (ESR), vibrating sample magnetometer (VSM) and scanning electron microscopy (SEM). The characteristic functional groups of M-poly(GMA)beads were analyzed by Fourier transform infrared spectrometer (FTIR). The M-poly(GMA) beads are highly uniform in size and have a spherical shape and non-porous structure. Polydispersity index (PDI) of M-poly(GMA) beads was calculated to be around 1.008. The hydrated density of the M-poly(GMA) beads measured at 25 ℃ was 1.14 g/cm3. The content of oxirane groups on the surface of the M-poly(GMA) sample was found to be 3.46 mmol/g by using perchloric acid titration. The specific surface area of the M-poly(GMA) beads was determined to be 3.2 m2/g.The equilibrium swelling ratio was 52%. The volume fraction of magnetite nanopowder in the M-poly(GMA) beads was found to be 4.5%. The g factor, that can be considered as a quantity characteristic of the molecules in which the unpaired electrons are located, was found to be 2.28for M-poly(GMA). The external magnetic field at resonance was calculated to be 2055 Gs which was found sufficient to excite all of the dipole moments present in 1.0 g of M-poly(GMA) sample.
Kim, L U; Kim, J W; Kim, C K
2006-09-01
To prepare a dental composite that has a low amount of curing shrinkage and excellent mechanical strength, various 2,2-bis[4-(2-hydroxy-3-methacryloyloxy propoxy) phenyl] propane (Bis-GMA) derivatives were synthesized via molecular structure design, and afterward, properties of their mixtures were explored. Bis-GMA derivatives, which were obtained by substituting methyl groups for hydrogen on the phenyl ring in the Bis-GMA, exhibited lower curing shrinkage than Bis-GMA, whereas their viscosities were higher than that of Bis-GMA. Other Bis-GMA derivatives, which contained a glycidyl methacrylate as a molecular end group exhibited reduced curing shrinkage and viscosity. Methoxy substitution for hydroxyl groups on the Bis-GMA derivatives was performed for the further reduction of the viscosity and curing shrinkage. Various resin mixtures, which had the same viscosity as the commercial one, were prepared, and their curing shrinkage was examined. A resin mixture containing 2,2-bis[3,5-dimethyl, 4-(2-methoxy-3-methacryloyloxy propoxy) phenyl] propane] (TMBis-M-GMA) as a base resin and 4-tert-butylphenoxy-2-methyoxypropyl methacrylate (t-BP-M-GMA) as a diluent exhibited the lowest curing shrinkage among them. The composite prepared from this resin mixture also exhibited the lowest curing shrinkage along with enhanced mechanical properties.
CXCR4/CXCL12/CXCR7 axis is functional in neuroendocrine tumors and signals on mTOR.
Circelli, Luisa; Sciammarella, Concetta; Guadagno, Elia; Tafuto, Salvatore; del Basso de Caro, Marialaura; Botti, Giovanni; Pezzullo, Luciano; Aria, Massimo; Ramundo, Valeria; Tatangelo, Fabiana; Losito, Nunzia Simona; Ieranò, Caterina; D'Alterio, Crescenzo; Izzo, Francesco; Ciliberto, Gennaro; Colao, Annamaria; Faggiano, Antongiulio; Scala, Stefania
2016-04-05
To evaluate the possible crosstalk between C-X-C chemokine receptor 4 (CXCR4)/C-X-C motif chemokine 12 (CXCL12)/C-X-C chemokine receptor 7 (CXCR7) axis with the mammalian target of rapamycin (mTOR) pathway in neuroendocrine tumors (NETs). Sixty-one human NETs were included into the study. CXCR4/CXCL12/CXCR7 axis and mTOR pathway were assessed by qRT-PCR and immunohistochemistry (IHC). The effect of mTOR inhibitor, RAD001, was evaluated on CXCR4 pathway through proliferation and p-Erk and p-AKT induction. CXCR4/CXCL12/CXCR7 axis and p-mTOR were found to be active and correlated with grading, Ki67 index and tumor stage. mTOR pathway activation significantly correlated with poor prognosis. In human NET cells, CXCL12 induced mTOR signalling while AMD3100 (CXCR4-antagonist) impaired it. The mTOR-antagonist, RAD001, impaired the CXCL12-dependent induction of CXCR4 downstream effectors. Combination of AMD3100 and RAD001 potentiate cell growth inhibition. CXCR4/CXCL12/CXCR7 axis is active in NETs and signals on mTOR. CXCR4 might be considered a prognostic factor in NETs. Combined treatment with AMD3100 and RAD001 may provide clinical benefits in NET patients with drug-resistant.
Development of a Plasma Streaming System for the Mirror Fusion Test Facility
International Nuclear Information System (INIS)
Holdsworth, T.; Clark, R.N.; McCotter, R.E.; Rossow, T.L.; Cruz, G.E.
1979-01-01
The Plasma Streaming System (PSS) is an essential portion of the Mirror Fusion Test Facility (MFTF), scheduled for completion in October 1981. The PSS will develop a plasma density of at least 2 x 10 12 particles/cm 3 at the MFTF magnet centerline by injecting particles along the field lines. The plasma will have a midplane plasma radius as large as 40 cm with variable plasma particle energy and beam geometry. Minimum amounts of impurities will be injected, with emphasis on minimizing high Z materials. Each of the 60 PSS units will consist of a gun magnet assembly (GMA) and a power supply. Each GMA consists of a plasma streaming gun, a pulse magnet that provides variable beam shaping, and a fast reaction pulse gas valve
Traileka Glacier X-Stack. Final Scientific/Technical Report
Energy Technology Data Exchange (ETDEWEB)
Borkar, Shekhar [Intel Federal LLC, Fairfax, VA (United States)
2015-09-01
The XStack Traleika Glacier (XSTG) project was a three-year research award for exploring a revolutionary exascale-class machine software framework. The XSTG program, including Intel, UC San Diego, Pacific Northwest National Lab, UIUC, Rice University, Reservoir Labs, ET International, and U. Delaware, had major accomplishments, insights, and products resulting from this three-year effort.
2016-06-01
the simulation actually runs, but the graphic card does not render. Another feature of Unity is that the user can see profile data in Unity Editor...optimized the number of waypoints on a laptop with an integrated graphic card Intel HD4400. A dedicated graphic card would be better and faster. 47...manipulating x, y, and z values of the three-dimensional thread vector on a laptop that runs an Intel HD4400 on-board graphic card . In this function
Institute of Scientific and Technical Information of China (English)
杨晓林; 黄建龙; 高保娇; 门吉英
2015-01-01
以甲基丙烯酸缩水甘油酯(GMA)和甲基丙烯酸甲酯(MMA)的交联共聚微球 GMA/MMA 为基质,经过几步大分子反应在微球表面合成与固载了 N-羟基邻苯二甲酰亚胺(NHPI),形成固载有 NHPI 的聚合物微球GMA/MMA-NHPI。将 GMA/MMA-NHPI 与 Co(OAc)2组成共催化体系,用于分子氧氧化苯甲醇的反应过程。研究结果表明,GMA/MMA-NHPI与Co(OAc)2所构成的共催化体系在温和条件(65℃和常压氧气)下可有效地实现苯甲醇的分子氧氧化过程,将其深度氧化为苯甲酸,显示出较好的催化活性和高的选择性(苯甲酸的选择性为96%)。主催化剂GMA/MMA-NHPI固载的NHPI与助催化剂Co(OAc)2适宜的摩尔比为20:1;主催化剂所含NHPI的摩尔分数为底物的10%时催化剂的用量比较适宜。固体催化剂GMA/MMA-NHPI还具有良好的再循环使用性能。%Crosslinked polymeric microspheres GMA/MMA of glycidyl methacrylate (GMA) and methyl methacrylate (MMA) were prepared, and then N-hydroxyphthalimide (NHPI) was synthesized and immobilized on GMA/MMA microspheres through several polymer reaction steps, resulting in the functionalized microspheres GMA/MMA-NHPI. The solid catalyst GMA/MMA-NHPI in combination with Co(OAc)2 was used in aerobic oxidation of benzyl alcohol. Experimental results showed that the composite catalyst consisting of GMA/MMA-NHPI and Co(OAc)2 could effectively catalyze aerobic oxidation of benzyl alcohol by molecular oxygen under mild conditions (65℃ and normal pressure). Benzyl alcohol was deeply oxidized to benzoic acid. Although benzyl alcohol conversion rate was not very high, catalytic activity was satisfactory and benzoic acid selectivity was as high as 96%. The appropriate molar ratio of immobilized NHPI on GMA/MMA-NHPI microspheres to Co(OAc)2 was 20:1, and the appropriate amount of GMA/MMA-NHPI was 10% (mol) of the substrate. The solid catalyst GMA/MMA-NHPI microspheres showed good recycling and reusing
Zhang, Weizhou; Wang, Kai; Yan, Wei; Guo, Weihong
2017-10-01
New toughened poly(butylene terephthalate) (PBT)/poly(ethylene terephthalate) (PET) (40/60 wt%) blends were obtained by melting with Glycidyl methacrylate grafted poly(ethylene octane) copolymer (POE-g-GMA), varying the POE-g-GMA content up to 20 wt%, in a twin-screw extruder, followed by injection molding. The influence of POE-g-GMA on the properties of the PBT/PET blends was investigated by mechanical testing, Fourier transform infrared (FT-IR) analysis, gel fractions analysis, dynamic mechanical analysis (DMA), differential scanning calorimetry (DSC) and scanning electronic microscopy (SEM). The mechanical testing results indicated that the incorporation of POE-g-GMA led to increases in the notched impact strength and decreases in the tensile strength, flexural strength, and flexural modulus. When POE-g-GMA content reached 20 wt%, the notched impact strength (8.0 kJ m-2) was achieved for the PBT/PET/POE-g-GMA blends. FT-IR results proved that some PBT/PET/POE-g-GMA copolymers were produced, which improved the compatibility between POE-g-GMA and the PBT/PET matrix. The extent of crosslinking was observed by gel fraction measurements. DMA results further testified chain-extending and micro-crosslink reactions occurred between POE-g-GMA and PBT/PET blends. In addition, the reactions induced by POE-g-GMA affected the crystallization behavior of PBT/PET blends obviously, as observed from DSC results. By means of SEM observation of the impact fracture surface morphology, and the discussion of the micro-crosslink reaction process between the epoxide-containing elastomers and PBT/PET matrix, the toughening mechanism was proposed to be taken into account the shear yielding of PBT/PET matrix and cavitation of elastomer particles.
Directory of Open Access Journals (Sweden)
Toshimi Chiba
2011-12-01
Full Text Available Granulocyte and monocyte adsorptive apheresis (GMA is reportedly useful as induction therapy for Crohn’s disease (CD. However, the effects of GMA on CD64 have not been well characterized. We report here our assessment of CD64 expression on neutrophils before and after treatment with GMA in two patients with CD. The severity of CD was assessed with the CD activity index (CDAI. The duration of each GMA session was 60 min at a flow rate of 30 ml/min as per protocol. CD64 expression on neutrophils was measured by analyzing whole blood with a FACScan flow cytometer. In case 1, CD64 levels after each session of GMA tended to decrease compared to pretreatment levels, whereas in case 2, CD64 levels dropped significantly after treatment. The CDAI decreased after GMA in both cases 1 and 2. A significant correlation was noted between CDAI scores and CD64 levels in both cases. In conclusion, GMA reduced blood CD64 levels, which would be an important factor for the decrease of CDAI scores.
Okamoto, Shoji; Okamoto, Satoshi; Yokoyama, Shintaro; Akiyama, Kensuke; Funakubo, Hiroshi
2016-10-01
{100}-oriented Pb(Zr x ,Ti1- x )O3 (PZT) thin films of approximately 2 µm thickness and Zr/(Zr + Ti) ratios of 0.39-0.65 were epitaxially grown on (100)cSrRuO3//(100)SrTiO3 (STO) and (100)cSrRuO3//(100)cLaNiO3//(100)CeO2//(100)YSZ//(100)Si (Si) substrates having different thermal expansion coefficients by pulsed metal-organic chemical vapor deposition (MOCVD). The effects of Zr/(Zr + Ti) ratio and type of substrate on the crystal structure and dielectric, ferroelectric and piezoelectric properties of the films were systematically investigated. The X-ray diffraction measurement showed that both films changed from having a tetragonal symmetry to rhombohedral symmetry through the coexisting region with increasing Zr/(Zr + Ti) ratio. This region showed the Zr/(Zr + Ti) ratios of 0.45-0.59 for the films on the STO substrates that were wider than the films on the Si substrates. Saturation polarization values were minimum at approximately Zr/(Zr + Ti) = 0.50 for the films on the STO substrates, and no obvious Zr/(Zr + Ti) ratio dependence was detected in the films on the Si substrates. On the other hand, the maximum field-induced strain values measured by scanning force microscopy at approximately Zr/(Zr + Ti) = 0.50 at 100 kV/cm were about 0.5 and 0.1% in the films on the Si and STO, respectively.
An association between geomagnetic activity and dream bizarreness.
Lipnicki, Darren M
2009-07-01
Daily disturbances of the earth's magnetic field produce variations in geomagnetic activity (GMA) that are reportedly associated with widespread effects on human health and behaviour. Some of these effects could be mediated by an established influence of GMA on the secretion of melatonin. There is evidence from unrelated research that melatonin influences dream bizarreness, and it is hypothesised here that there is an association between GMA and dream bizarreness. Also reported is a preliminary test of this hypothesis, a case study in which the dreams recorded over 6.5 years by a young adult male were analysed. Reports of dreams from the second of two consecutive days of either low or high GMA (K index sum or = 28) were self-rated for bizarreness on a 1-5 scale. Dreams from low GMA periods (n=69, median bizarreness=4) were found to be significantly more bizarre than dreams from high GMA periods (n=85, median bizarreness=3; p=0.006), supporting the hypothesised association between GMA and dream bizarreness. Studies with larger samples are needed to verify this association, and to determine the extent to which melatonin may be involved. Establishing that there is an association between GMA and dream bizarreness would have relevance for neurophysiological theories of dreaming, and for models of psychotic symptoms resembling bizarre dream events.
Sanus, Galip Zihni; Kucukyuruk, Baris; Biceroglu, Huseyin; Isler, Cihan; Tanriverdi, Taner; Bas, Ahmet; Albayram, Sait; Kurkcu, Mehmet; Oz, Buge
2014-07-01
Promising clinical results were reported in watertight closure of anterior skull base defects (ASBDs) with bisphenol-a-glycidyl-dimethacrylate (bis-GMA)-based materials to prevent the cerebrospinal fluid leaks. However, interrelation of these materials with surrounding bones in histologic level, referred to as the osteointegration, has not been reported in the anterior skull base. In addition, an illustrative case with an ASBD that was repaired using a bis-GMA composite has been presented. Twenty New Zealand rabbits were divided into 4 groups: control and sham groups consisted of 2 and 6 rabbits, respectively. The "skull base defect" group (n = 6) underwent a unifrontal craniectomy and an iatrogenic ASBD followed by creating a dural defect to obtain a cerebrospinal fluid leak. Similar bony and dural defects were acquired in the "repair with bis-GMA based allograft" group (n = 6), but the bony defect was closed with bis-GMA-based allograft. All animals in the "skull base defect" group died in 3 weeks after surgery. There were no animal losses in the "repair with bis-GMA based allograft" group at the sixth month. Histologic evaluation revealed complete osteointegration of bis-GMA composite with surrounding bones. bis-GMA based allograft achieved a watertight repair of the ASBD. Histologic findings of this study showed that bis-GMA composite is a reliable material to be used in the closure of anterior skull base bony defects.
DEFF Research Database (Denmark)
Hatse, S; Princen, K; Gerlach, L O
2001-01-01
by mutational analysis. We established a set of stably transfected U87.CD4 cell lines expressing different mutant forms of CXCR4 (i.e., CXCR4[WT], CXCR4[D171N], CXCR4[D262N], CXCR4[D171N,D262N], and CXCR4[H281A]), to compare the activity of the compound against mutated versus wild-type CXCR4. We found...... by substitution of Asp(171) and/or Asp(262) by neutral asparagine residue(s). Both aspartates, but most particularly Asp(262), also proved essential for the anti-HIV-1 activity of AMD3100 against the viruses NL4.3, IIIB, and HE. In contrast, substitution of His(281) by a neutral alanine potentiated...
Leang, Sarom S; Rendell, Alistair P; Gordon, Mark S
2014-03-11
Increasingly, modern computer systems comprise a multicore general-purpose processor augmented with a number of special purpose devices or accelerators connected via an external interface such as a PCI bus. The NVIDIA Kepler Graphical Processing Unit (GPU) and the Intel Phi are two examples of such accelerators. Accelerators offer peak performances that can be well above those of the host processor. How to exploit this heterogeneous environment for legacy application codes is not, however, straightforward. This paper considers how matrix operations in typical quantum chemical calculations can be migrated to the GPU and Phi systems. Double precision general matrix multiply operations are endemic in electronic structure calculations, especially methods that include electron correlation, such as density functional theory, second order perturbation theory, and coupled cluster theory. The use of approaches that automatically determine whether to use the host or an accelerator, based on problem size, is explored, with computations that are occurring on the accelerator and/or the host. For data-transfers over PCI-e, the GPU provides the best overall performance for data sizes up to 4096 MB with consistent upload and download rates between 5-5.6 GB/s and 5.4-6.3 GB/s, respectively. The GPU outperforms the Phi for both square and nonsquare matrix multiplications.
Energy Technology Data Exchange (ETDEWEB)
Thang, Bui Hung; Trinh, Pham Van; Quang, Le Dinh; Khoi, Phan Hong; Minh, Phan Ngoc [Vietnam Academy of Science and Technology, Ho Chi Minh CIty (Viet Nam); Huong, Nguyen Thi [Hanoi University of Science, Hanoi (Viet Nam); Vietnam National University, Hanoi (Viet Nam)
2014-08-15
Carbon nanotubes (CNTs) are some of the most valuable materials with high thermal conductivity. The thermal conductivity of individual multiwalled carbon nanotubes (MWCNTs) grown by using chemical vapor deposition is 600 ± 100 Wm{sup -1}K{sup -1} compared with the thermal conductivity 419 Wm{sup -1}K{sup -1} of Ag. Carbon-nanotube-based liquids - a new class of nanomaterials, have shown many interesting properties and distinctive features offering potential in heat dissipation applications for electronic devices, such as computer microprocessor, high power LED, etc. In this work, a multiwalled carbon-nanotube-based liquid was made of well-dispersed hydroxyl-functional multiwalled carbon nanotubes (MWCNT-OH) in ethylene glycol (EG)/distilled water (DW) solutions by using Tween-80 surfactant and an ultrasonication method. The concentration of MWCNT-OH in EG/DW solutions ranged from 0.1 to 1.2 gram/liter. The dispersion of the MWCNT-OH-based EG/DW solutions was evaluated by using a Zeta-Sizer analyzer. The MWCNT-OH-based EG/DW solutions were used as coolants in the liquid cooling system for the Intel Core i5 processor. The thermal dissipation efficiency and the thermal response of the system were evaluated by directly measuring the temperature of the micro-processor using the Core Temp software and the temperature sensors built inside the micro-processor. The results confirmed the advantages of CNTs in thermal dissipation systems for computer processors and other high-power electronic devices.
International Nuclear Information System (INIS)
Thang, Bui Hung; Trinh, Pham Van; Quang, Le Dinh; Khoi, Phan Hong; Minh, Phan Ngoc; Huong, Nguyen Thi
2014-01-01
Carbon nanotubes (CNTs) are some of the most valuable materials with high thermal conductivity. The thermal conductivity of individual multiwalled carbon nanotubes (MWCNTs) grown by using chemical vapor deposition is 600 ± 100 Wm -1 K -1 compared with the thermal conductivity 419 Wm -1 K -1 of Ag. Carbon-nanotube-based liquids - a new class of nanomaterials, have shown many interesting properties and distinctive features offering potential in heat dissipation applications for electronic devices, such as computer microprocessor, high power LED, etc. In this work, a multiwalled carbon-nanotube-based liquid was made of well-dispersed hydroxyl-functional multiwalled carbon nanotubes (MWCNT-OH) in ethylene glycol (EG)/distilled water (DW) solutions by using Tween-80 surfactant and an ultrasonication method. The concentration of MWCNT-OH in EG/DW solutions ranged from 0.1 to 1.2 gram/liter. The dispersion of the MWCNT-OH-based EG/DW solutions was evaluated by using a Zeta-Sizer analyzer. The MWCNT-OH-based EG/DW solutions were used as coolants in the liquid cooling system for the Intel Core i5 processor. The thermal dissipation efficiency and the thermal response of the system were evaluated by directly measuring the temperature of the micro-processor using the Core Temp software and the temperature sensors built inside the micro-processor. The results confirmed the advantages of CNTs in thermal dissipation systems for computer processors and other high-power electronic devices.
Stereoscopic-3D display design: a new paradigm with Intel Adaptive Stable Image Technology [IA-SIT
Jain, Sunil
2012-03-01
Stereoscopic-3D (S3D) proliferation on personal computers (PC) is mired by several technical and business challenges: a) viewing discomfort due to cross-talk amongst stereo images; b) high system cost; and c) restricted content availability. Users expect S3D visual quality to be better than, or at least equal to, what they are used to enjoying on 2D in terms of resolution, pixel density, color, and interactivity. Intel Adaptive Stable Image Technology (IA-SIT) is a foundational technology, successfully developed to resolve S3D system design challenges and deliver high quality 3D visualization at PC price points. Optimizations in display driver, panel timing firmware, backlight hardware, eyewear optical stack, and synch mechanism combined can help accomplish this goal. Agnostic to refresh rate, IA-SIT will scale with shrinking of display transistors and improvements in liquid crystal and LED materials. Industry could profusely benefit from the following calls to action:- 1) Adopt 'IA-SIT S3D Mode' in panel specs (via VESA) to help panel makers monetize S3D; 2) Adopt 'IA-SIT Eyewear Universal Optical Stack' and algorithm (via CEA) to help PC peripheral makers develop stylish glasses; 3) Adopt 'IA-SIT Real Time Profile' for sub-100uS latency control (via BT Sig) to extend BT into S3D; and 4) Adopt 'IA-SIT Architecture' for Monitors and TVs to monetize via PC attach.
Energy Technology Data Exchange (ETDEWEB)
Fedan, Jeffrey S., E-mail: jsf2@cdc.gov; Thompson, Janet A.; Meighan, Terence G.; Zeidler-Erdely, Patti C.; Antonini, James M.
2017-07-01
Welding fume inhalation causes pulmonary toxicity, including susceptibility to infection. We hypothesized that airway epithelial ion transport is a target of fume toxicity, and investigated the effects of fume particulates from manual metal arc-stainless steel (MMA-SS) and gas metal arc-mild steel (GMA-MS) on ion transport in normal human bronchial epithelium (NHBE) cultured in air-interface. MMA-SS particles, more soluble than GMA-MS particles, contain Cr, Ni, Fe and Mn; GMA-MS particles contain Fe and Mn. MMA-SS or GMA-MS particles (0.0167–166.7 μg/cm{sup 2}) were applied apically to NHBEs. After 18 h transepithelial potential difference (V{sub t}), resistance (R{sub t}), and short circuit current (I{sub sc}) were measured. Particle effects on Na{sup +} and Cl¯ channels and the Na{sup +},K{sup +},2Cl¯-cotransporter were evaluated using amiloride (apical), 5-nitro-2-[(3-phenylpropyl)amino]benzoic acid (NPPB, apical), and bumetanide (basolateral), respectively. MMA-SS (0.0167–16.7 μg/cm{sup 2}) increased basal V{sub t}. Only 16.7 μg/cm{sup 2} GMA-MS increased basal V{sub t} significantly. MMA-SS or GMA-MS exposure potentiated I{sub sc} responses (decreases) to amiloride and bumetanide, while not affecting those to NPPB, GMA-MS to a lesser degree than MMA-SS. Variable effects on R{sub t} were observed in response to amiloride, and bumetanide. Generally, MMA-SS was more potent in altering responses to amiloride and bumetanide than GMA-MS. Hyperpolarization occurred in the absence of LDH release, but decreases in V{sub t}, R{sub t}, and I{sub sc} at higher fume particulate doses accompanied LDH release, to a greater extent for MMA-SS. Thus, Na{sup +} transport and Na{sup +},K{sup +},2Cl¯-cotransport are affected by fume exposure; MMA-MS is more potent than GMA-MS. Enhanced Na{sup +} absorption and decreased airway surface liquid could compromise defenses against infection. - Highlights: • Welding fume particle toxicity was investigated in human bronchial
Energy Technology Data Exchange (ETDEWEB)
Doose, C.; Kim, S.H.
1997-08-01
Local feedback for the APS storage ring uses local bumps to control the position and angle of the positron beam through each x-ray source point. Induced eddy currents in the aluminum vacuum chamber dominate the AC characteristics of the corrector magnetic fields. Small differences in the geometries at each magnet location change the eddy current effects and result in bump closure errors which must be reduced in order to minimize the coupling between each of the many local loops and the global control loop. By a combination of flux-damping coils, flux-shielding copper sheets, and a set of steel laminations for end-flux clamping, the differences of the eddy current effects between two corrector magnets were reduced from 0.18 Gm/A to 0.035 Gm/A in the frequency span of 0.1-100 Hz.
Microprocessor system to recover data from a self-scanning photodiode array
International Nuclear Information System (INIS)
Koppel, L.N.; Gadd, T.J.
1975-01-01
A microprocessor system developed at Lawrence Livermore Laboratory has expedited the recovery of data describing the low energy x-ray spectra radiated by laser-fusion targets. An Intel microprocessor controls the digitization and scanning of the data stream of an x-ray-sensitive self-scanning photodiode array incorporated in a crystal diffraction spectrometer
International Nuclear Information System (INIS)
Ma, Liang; Wang, Mozhen; Ge, Xuewu
2013-01-01
To improve the compatibility between ethylene-methyl acrylate-glycidyl methacrylate random terpolymer (E-MA-GMA) elastomer and poly(ethylene terephthalate) (PET), thereby enhance the toughening effect of E-MA-GMA on PET, γ-radiation-induced graft copolymerization technique was used to graft methyl acrylate (MA) monomer onto PET. The produced PET-g-PMA copolymer can be used as a self-compatibilizer in PET/E-MA-GMA blend since the copolymer contains the same segments, respectively, with PET and E-MA-GMA. The impact strength of PET/E-MA-GMA blend increased nearly by 30% in the presence of less than 0.1 wt% PET-g-PMA compared with that of the neat PET/elastomer blend, without loss of the tensile strength of the blends. This work proposed a potential application of radiation-induced grafting copolymerization technique on the in-situ compatibilization of PET/elastomer blends so as to improve the integral mechanical properties of PET based engineering plastic. - Highlights: • PMA was grafted onto PET resins by γ-ray radiation-induced copolymerization. • The obtained PET-g-PMA can improve the compatibility between PET and E-MA-GMA. • A small amount of PET-g-PMA can enhance the impact strength of PET/E-MA-GMA blend
Navier-Stokes Aerodynamic Simulation of the V-22 Osprey on the Intel Paragon MPP
Vadyak, Joseph; Shrewsbury, George E.; Narramore, Jim C.; Montry, Gary; Holst, Terry; Kwak, Dochan (Technical Monitor)
1995-01-01
The paper will describe the Development of a general three-dimensional multiple grid zone Navier-Stokes flowfield simulation program (ENS3D-MPP) designed for efficient execution on the Intel Paragon Massively Parallel Processor (MPP) supercomputer, and the subsequent application of this method to the prediction of the viscous flowfield about the V-22 Osprey tiltrotor vehicle. The flowfield simulation code solves the thin Layer or full Navier-Stoke's equation - for viscous flow modeling, or the Euler equations for inviscid flow modeling on a structured multi-zone mesh. In the present paper only viscous simulations will be shown. The governing difference equations are solved using a time marching implicit approximate factorization method with either TVD upwind or central differencing used for the convective terms and central differencing used for the viscous diffusion terms. Steady state or Lime accurate solutions can be calculated. The present paper will focus on steady state applications, although time accurate solution analysis is the ultimate goal of this effort. Laminar viscosity is calculated using Sutherland's law and the Baldwin-Lomax two layer algebraic turbulence model is used to compute the eddy viscosity. The Simulation method uses an arbitrary block, curvilinear grid topology. An automatic grid adaption scheme is incorporated which concentrates grid points in high density gradient regions. A variety of user-specified boundary conditions are available. This paper will present the application of the scalable and superscalable versions to the steady state viscous flow analysis of the V-22 Osprey using a multiple zone global mesh. The mesh consists of a series of sheared cartesian grid blocks with polar grids embedded within to better simulate the wing tip mounted nacelle. MPP solutions will be shown in comparison to equivalent Cray C-90 results and also in comparison to experimental data. Discussions on meshing considerations, wall clock execution time
Kurina, Irina V.; Blyakharchuk, Tatiana A.
2018-03-01
Our research is devoted to paleohydrological reconstruction in the swamp located in the river valley on the piedmont of the Altai Mountains in the south of Western Siberia. The reconstruction was carried out based on rhizopod analysis for the last 3100 cal yr. A large amount of different testate amoebae was found in the peat. Total 64 testate amoebae taxa were recorded in the peat core with the most abundant being: Trinema lineare, Centropyxis aculeata, C. aerophila, Euglypha rotunda, Cryptodifflugia sp. Decrease of surface wetness in the swamp are observed 2280, 2140, 1900–600 cal yr BP and increase – in 2700, 2500–1900, 230–215 cal yr BP. The results of our reconstruction of the swamp paleohydrology agrees well with the paleoclimatic data obtained earlier for the central area of the south of Western Siberia Plain. It indicates a high sensitivity of the swamp to climatic changes in the Holocene. The rhizopod analysis proved to be very effective when used for paleohydrology reconstruction in minerotrophic peat.
Peak heart rate decreases with increasing severity of acute hypoxia
DEFF Research Database (Denmark)
Lundby, C; Araoz, M; Van Hall, Gerrit
2001-01-01
, 459, and 404 mmHg) in a hypobaric chamber and while breathing 9% O(2) in N(2). These conditions were equivalent to altitudes of 3300, 4300, 5300, and 6300 m above sea level, respectively. At 4300 m, maximal exercise was also repeated after 4 and 8 h. Peak heart rate (HR) decreased from 191 (182......-202) (mean and range) at sea level to 189 (179-200), 182 (172-189), 175 (166-183), and 165 (162-169) in the acute hypoxic conditions. Peak HR did not decrease further after 4 and 8 h at 4300 m compared to the acute exposure at this altitude. Between barometric pressures of 518 and 355 mmHg (approximately...... 3300 and 6300 m), peak HR decreased linearly: peak HR(hypobaria) = peak HR(sea level) - 0.135 x [hypobaria(3100) - hypobaria (mmHg)]; or peak HR(altitude) = peak HR(sea level) - 0.15 x (altitude - 3100 m). This corresponds to approximately 1-beat x min(-1) reduction in peak HR for every 7-mmHg decrease...
A meta-analysis of the relationship between general mental ability and nontask performance.
Gonzalez-Mulé, Erik; Mount, Michael K; Oh, In-Sue
2014-11-01
Although one of the most well-established research findings in industrial-organizational psychology is that general mental ability (GMA) is a strong and generalizable predictor of job performance, this meta-analytically derived conclusion is based largely on measures of task or overall performance. The primary purpose of this study is to address a void in the research literature by conducting a meta-analysis to determine the direction and magnitude of the correlation of GMA with 2 dimensions of nontask performance: counterproductive work behaviors (CWB) and organizational citizenship behaviors (OCB). Overall, the results show that the true-score correlation between GMA and CWB is essentially 0 (-.02, k = 35), although rating source of CWB moderates this relationship. The true-score correlation between GMA and OCB is positive but modest in magnitude (.23, k = 43). The 2nd purpose of this study is to conduct meta-analytic relative weight analyses to determine the relative importance of GMA and the five-factor model (FFM) of personality traits in predicting nontask and task performance criteria. Results indicate that, collectively, the FFM traits are substantially more important for CWB than GMA, that the FFM traits are roughly equal in importance to GMA for OCB, and that GMA is substantially more important for task and overall job performance than the FFM traits. Implications of these findings for the development of optimal selection systems and the development of comprehensive theories of job performance are discussed along with study limitation and future research directions. (PsycINFO Database Record (c) 2014 APA, all rights reserved).
Directory of Open Access Journals (Sweden)
Elena Vismara
2013-05-01
Full Text Available High-grade cellulose (97% α-cellulose content of 48% crystallinity index was extracted from the renewable marine biomass waste Posidonia oceanica using H2O2 and organic peracids following an environmentally friendly and chlorine-free process. This cellulose appeared as a new high-grade cellulose of waste origin quite similar to the high-grade cellulose extracted from more noble starting materials like wood and cotton linters. The benefits of α-cellulose recovery from P. oceanica were enhanced by its transformation into cellulose acetate CA and cellulose derivative GMA-C. Fully acetylated CA was prepared by conventional acetylation method and easily transformed into a transparent film. GMA-C with a molar substitution (MS of 0.72 was produced by quenching Fenton’s reagent (H2O2/FeSO4 generated cellulose radicals with GMA. GMA grafting endowed high-grade cellulose from Posidonia with adsorption capability. GMA-C removes β-naphthol from water with an efficiency of 47%, as measured by UV-Vis spectroscopy. After hydrolysis of the glycidyl group to glycerol group, the modified GMA-C was able to remove p-nitrophenol from water with an efficiency of 92%, as measured by UV-Vis spectroscopy. α-cellulose and GMA-Cs from Posidonia waste can be considered as new materials of potential industrial and environmental interest.
AbdulJabbar, Mustafa Abdulmajeed; Al Farhan, Mohammed; Yokota, Rio; Keyes, David E.
2017-01-01
Manycore optimizations are essential for achieving performance worthy of anticipated exascale systems. Utilization of manycore chips is inevitable to attain the desired floating point performance of these energy-austere systems. In this work, we revisit ExaFMM, the open source Fast Multiple Method (FMM) library, in light of highly tuned shared-memory parallelization and detailed performance analysis on the new highly parallel Intel manycore architecture, Knights Landing (KNL). We assess scalability and performance gain using task-based parallelism of the FMM tree traversal. We also provide an in-depth analysis of the most computationally intensive part of the traversal kernel (i.e., the particle-to-particle (P2P) kernel), by comparing its performance across KNL and Broadwell architectures. We quantify different configurations that exploit the on-chip 512-bit vector units within different task-based threading paradigms. MPI communication-reducing and NUMA-aware approaches for the FMM’s global tree data exchange are examined with different cluster modes of KNL. By applying several algorithm- and architecture-aware optimizations for FMM, we show that the N-Body kernel on 256 threads of KNL achieves on average 2.8× speedup compared to the non-vectorized version, whereas on 56 threads of Broadwell, it achieves on average 2.9× speedup. In addition, the tree traversal kernel on KNL scales monotonically up to 256 threads with task-based programming models. The MPI-based communication-reducing algorithms show expected improvements of the data locality across the KNL on-chip network.
AbdulJabbar, Mustafa Abdulmajeed
2017-07-31
Manycore optimizations are essential for achieving performance worthy of anticipated exascale systems. Utilization of manycore chips is inevitable to attain the desired floating point performance of these energy-austere systems. In this work, we revisit ExaFMM, the open source Fast Multiple Method (FMM) library, in light of highly tuned shared-memory parallelization and detailed performance analysis on the new highly parallel Intel manycore architecture, Knights Landing (KNL). We assess scalability and performance gain using task-based parallelism of the FMM tree traversal. We also provide an in-depth analysis of the most computationally intensive part of the traversal kernel (i.e., the particle-to-particle (P2P) kernel), by comparing its performance across KNL and Broadwell architectures. We quantify different configurations that exploit the on-chip 512-bit vector units within different task-based threading paradigms. MPI communication-reducing and NUMA-aware approaches for the FMM’s global tree data exchange are examined with different cluster modes of KNL. By applying several algorithm- and architecture-aware optimizations for FMM, we show that the N-Body kernel on 256 threads of KNL achieves on average 2.8× speedup compared to the non-vectorized version, whereas on 56 threads of Broadwell, it achieves on average 2.9× speedup. In addition, the tree traversal kernel on KNL scales monotonically up to 256 threads with task-based programming models. The MPI-based communication-reducing algorithms show expected improvements of the data locality across the KNL on-chip network.
Dulucq, Jean-Louis; Wintringer, Pascal; Mahajna, Ahmad
2009-03-01
Two revolutions in inguinal hernia repair surgery have occurred during the last two decades. The first was the introduction of tension-free hernia repair by Liechtenstein in 1989 and the second was the application of laparoscopic surgery to the treatment of inguinal hernia in the early 1990s. The purposes of this study were to assess the safety and effectiveness of laparoscopic totally extraperitoneal (TEP) repair and to discuss the technical changes that we faced on the basis of our accumulative experience. Patients who underwent an elective inguinal hernia repair at the Department of Abdominal Surgery at the Institute of Laparoscopic Surgery (ILS), Bordeaux, between June 1990 and May 2005 were enrolled retrospectively in this study. Patient demographic data, operative and postoperative course, and outpatient follow-up were studied. A total of 3,100 hernia repairs were included in the study. The majority of the hernias were repaired by TEP technique; the repair was done by transabdominal preperitoneal (TAPP) repair in only 3%. Eleven percent of the hernias were recurrences after conventional repair. Mean operative time was 17 min in unilateral hernia and 24 min in bilateral hernia. There were 36 hernias (1.2%) that required conversion: 12 hernias were converted to open anterior Liechtenstein and 24 to laparoscopic TAPP technique. The incidence of intraoperative complications was low. Most of the patients were discharged at the second day of the surgery. The overall postoperative morbidity rate was 2.2%. The incidence of recurrence rate was 0.35%. The recurrence rate for the first 200 repairs was 2.5%, but it decreased to 0.47% for the subsequent 1,254 hernia repairs According to our experience, in the hands of experienced laparoscopic surgeons, laparoscopic hernia repair seems to be the favored approach for most types of inguinal hernias. TEP is preferred over TAPP as the peritoneum is not violated and there are fewer intra-abdominal complications.
Stoupel, Eliyahu
2015-03-01
We are constantly affected by changes in space weather. The principal "players" are solar activity (SA), geomagnetic activity (GMA) and antagonistic to them, cosmic ray activity (CRA) and high energy proton flux. CRA is measured by neutron activity on the earth's surface in imp/min. SA and GMA are linked and serve as a shield for the earth from CRA. For a long time SA and GMA were the main areas of studies. The aim of this study was to compare some effects of the mentioned forces and discuss the temporal distribution of both groups of space weather, in relation to their effects on humans. The time distribution of GMA storms (daily) was compared with quiet (low) GMA, with higher CRA (neutron activity). Space weather data were obtained from the USA, Russia and Finland. A total of 4383 days were analyzed in the years 2000-2012. A total of 71 days (1.62%) of geomagnetic storms (GS) and 2753 days (63.8%) of quiet (I0) GMA were registered. A second study was provided including the years 1983-2007 (9131 days); here 3800 days (41.62%) were quiet GMA days and 400 storm days (4.38%). According to publications in the medical literature, many phenomena are connected with the extremes of space weather. Despite a great number of publications and the significant role of GS, it is a relatively rare event and most medical emergencies and deaths occur on days of low GMA, accompanied by higher CRA (neutron activity). High neutron activity deserves more attention when analyzing space effects on human health and their mechanism of action.
A Theory of Sex Differences in Technical Aptitude and Some Supporting Evidence.
Schmidt, Frank L
2011-11-01
In this article, I present a theory that explains the origin of sex differences in technical aptitudes. The theory takes as proven that there are no sex differences in general mental ability (GMA), and it postulates that sex differences in technical aptitude (TA) stem from differences in experience in technical areas, which is in turn based on sex differences in technical interests. Using a large data set, I tested and found support for four predictions made by this theory: (a) the construct level correlation between technical aptitude and GMA is larger for females than males, (b) the observed and true score variability of technical aptitude is greater among males than females, (c) at every level of GMA females have lower levels of technical aptitude, and (d) technical aptitude measures used as estimates of GMA for decision purposes would result in underestimation of GMA levels for girls and women. Given that GMA carries the weight of prediction of job performance, the support found for this last prediction suggests that, for many jobs, technical aptitude tests may underpredict the job performance of female applicants and employees. Future research should examine this question. © Association for Psychological Science 2011.
International Nuclear Information System (INIS)
Selambakkannu, S.; Nor Azillah Fatimah Othman; Siti Fatahiyah Mohamad
2016-01-01
This paper focused on pre-treated banana fibers as a trunk polymer for optimization of radiation-induced graft copolymerization process parameters. Pre-treated banana fiber was grafted with glycidyl methacrylate (GMA) via electron beam irradiation. Optimization of grafting parameters in term of grafting yield was analyzed at numerous radiation dose, monomer concentration and reaction time. Grafting yield had been calculated gravimetrically against all the process parameters. The grafting yield at 40 kGy had increases from 14 % to 22.5 % at 1 h and 24 h of reaction time respectively. Grafting yield at 1 % of GMA was about 58 % and it increases to 187 % at 3 % GMA. The grafting of GMA onto pre-treated banana fibers confirmed with the characterization using FTIR, SEM and TGA. Grafting of GMA onto pre-treated fibers was successfully carried out and it was confirmed by the results obtained via the characterization. (author)
Fedan, Jeffrey S; Thompson, Janet A; Meighan, Terence G; Zeidler-Erdely, Patti C; Antonini, James M
2017-07-01
Welding fume inhalation causes pulmonary toxicity, including susceptibility to infection. We hypothesized that airway epithelial ion transport is a target of fume toxicity, and investigated the effects of fume particulates from manual metal arc-stainless steel (MMA-SS) and gas metal arc-mild steel (GMA-MS) on ion transport in normal human bronchial epithelium (NHBE) cultured in air-interface. MMA-SS particles, more soluble than GMA-MS particles, contain Cr, Ni, Fe and Mn; GMA-MS particles contain Fe and Mn. MMA-SS or GMA-MS particles (0.0167-166.7μg/cm 2 ) were applied apically to NHBEs. After 18h transepithelial potential difference (V t ), resistance (R t ), and short circuit current (I sc ) were measured. Particle effects on Na + and Cl¯ channels and the Na + ,K + ,2Cl¯-cotransporter were evaluated using amiloride (apical), 5-nitro-2-[(3-phenylpropyl)amino]benzoic acid (NPPB, apical), and bumetanide (basolateral), respectively. MMA-SS (0.0167-16.7μg/cm 2 ) increased basal V t . Only 16.7μg/cm 2 GMA-MS increased basal V t significantly. MMA-SS or GMA-MS exposure potentiated I sc responses (decreases) to amiloride and bumetanide, while not affecting those to NPPB, GMA-MS to a lesser degree than MMA-SS. Variable effects on R t were observed in response to amiloride, and bumetanide. Generally, MMA-SS was more potent in altering responses to amiloride and bumetanide than GMA-MS. Hyperpolarization occurred in the absence of LDH release, but decreases in V t , R t , and I sc at higher fume particulate doses accompanied LDH release, to a greater extent for MMA-SS. Thus, Na + transport and Na + ,K + ,2Cl¯-cotransport are affected by fume exposure; MMA-MS is more potent than GMA-MS. Enhanced Na + absorption and decreased airway surface liquid could compromise defenses against infection. Published by Elsevier Inc.
Synthesis and characterization of new functionalized polymer-Fe3O4 nanocomposite particles
Directory of Open Access Journals (Sweden)
A. Bukowska
2017-01-01
Full Text Available In this study, Fe3O4 nanoparticles (NPs were functionalized with copolymer or terpolymer bearing glycidyl methacrylate (GMA moieties making them suitable for potential applications as drug delivery systems (DDS. For this purpose, the surface of magnetic nanoparticles was first coated with 3-(trimethoxysilyl propyl methacrylate (MPS by a silanization reaction to introduce reactive methacrylate groups onto the surface. Subsequently, monomers were grafted onto the surface of modified-MPS particles via two polymerization methods: seed emulsion (GMA, divinylbenzene, DVB, and styrene, S and distillation – precipitation (GMA and DVB. The obtained nanocomposite particles were characterized by FTIR (Fourier transform infrared spectroscopy, DR UV-Vis (diffuse reflectance ultraviolet – visible spectroscopy, TEM (transmission electron microscopy combined with EDS (energy dispersive X-ray spectroscopy analysis and DLS (dynamic light scattering. FTIR spectroscopy showed that indeed a polymer – Fe3O4@MPS composite was obtained. TEM and EDS analysis showed that the seed emulsion method resulted in nanosized, 100 nm Fe3O4@MPS core/polymer shell NPs, forming long chains. On the contrary, the distillation – precipitation method caused the formation of an inverted structure, i.e. polymer core coated by a Fe3O4@MPS shell, which exhibited a very coarse size distribution varying from several hundreds to over 2 µm.
Halyo, V.; Lujan, P.; Karpusenko, V.; Vladimirov, A.
2014-04-07
Recent innovations focused around {\\em parallel} processing, either through systems containing multiple processors or processors containing multiple cores, hold great promise for enhancing the performance of the trigger at the LHC and extending its physics program. The flexibility of the CMS/ATLAS trigger system allows for easy integration of computational accelerators, such as NVIDIA's Tesla Graphics Processing Unit (GPU) or Intel's \\xphi, in the High Level Trigger. These accelerators have the potential to provide faster or more energy efficient event selection, thus opening up possibilities for new complex triggers that were not previously feasible. At the same time, it is crucial to explore the performance limits achievable on the latest generation multicore CPUs with the use of the best software optimization methods. In this article, a new tracking algorithm based on the Hough transform will be evaluated for the first time on a multi-core Intel Xeon E5-2697v2 CPU, an NVIDIA Tesla K20c GPU, and an Intel \\x...
Kumar, Ravindra; Kar, Kamal K.; Kumar, Vijai
2018-01-01
Bisphenol-A polycarbonate (PC) and poly(butylene terephthalate) (PBT) were melt blended with ethylene-n-butylacrylate-glycidylmethacrylate terpolymer (E-BA-GMA) at various proportions in order to study the effects of compatibilizers on mechanical, thermal and flow properties of blends. Furthermore, on the basis of this study, PC and PBT were melt-blended at 60/40 proportion with three different compatibilizers viz., ethylene-n-butylacrylate copolymer (E-BA), E-BA-GMA and random copolymer of ethylene and glycidylmethacrylate (E-GMA) at 3 phr loading in a co-rotating twin screw extruder. Tensile, flexural and impact tests were carried out on injection molded samples of PC/PBT blends. The notched izod impact strength increases enormously (˜2-3 times) on addition of any one of the three compatibilizers, and elongation at break (%) also improves tremendously (3, 5 and 4 times) on incorporation of E-BA, E-BA-GMA and E-GMA copolymer, respectively while other mechanical properties decreases slightly (3%-8%) on addition of any one of these compatibilizers. The heat deflection temperature (HDT) raises ˜8 °C-9 °C on addition of either E-BA-GMA or E-GMA, while E-BA shows a negative effect on HDT. The melt flow index diminishes significantly (˜5%-20%) on incorporation of these compatibilizers. The morphology studies via scanning electron microscopy of these four blends were carried out to confirm the mechanical results.
Directory of Open Access Journals (Sweden)
Pablo Ferrándiz
2010-07-01
Full Text Available La disposició final segona del Projecte de llei d'economia sostenible que el Govern ha presentat al Congrés dels Diputats projecta crear una nova comissió de propietat intel·lectual al si del Ministeri de Cultura, que passarà a estar integrada per dues seccions: la Secció Primera i la Secció Segona. En particular, a la Secció Segona es vol atribuir la instrucció i resolució d'un nou procediment administratiu, anomenat per al restabliment de la legalitat, el qual podrà finalitzar amb l'adopció de mesures de restricció a la prestació de serveis de la societat de la informació, com ara la interrupció del servei o la retirada de les dades, quan vulnerin drets de propietat intel·lectual, però sempre que el seu responsable ho dugui a terme amb ànim de lucre, directe o indirecte, o hagi causat o sigui susceptible de causar un dany patrimonial. Encara que l'execució de tals mesures requerirà l'autorització judicial prèvia mitjançant una interlocutòria, l'òrgan competent per a la qual és el Jutjat Central Contenciós Administratiu de l'Audiència Nacional, l'atribució a una administració pública de competències per a resoldre controvèrsies o conflictes entre particulars, sobre drets (els de propietat intel·lectual de naturalesa estrictament privada (això és, uns drets, encara que sigui especial, de propietat, planteja no pocs interrogants passant l'assumpte pel tamís del principi de separació de poders que consagra l'article 117 de la Constitució i qüestiona la neutralitat de l'Administració pública, ja que no es justifica degudament en el projecte de llei que amb la seva actuació serveix, com exigeix l'article 103 del text fonamental, amb objectivitat, als interessos generals.
Energy Technology Data Exchange (ETDEWEB)
Qin, J; Bauer, M A, E-mail: qin.jinhui@gmail.com, E-mail: bauer@uwo.ca [Computer Science Department, University of Western Ontario, London, ON N6A 5B7 (Canada)
2010-11-01
The analysis of synchrotron X-ray Diffraction (XRD) data has been used by scientists and engineers to understand and predict properties of materials. However, the large volume of XRD image data and the intensive computations involved in the data analysis makes it hard for researchers to quickly reach any conclusions about the images from an experiment when using conventional XRD data analysis software. Synchrotron time is valuable and delays in XRD data analysis can impact decisions about subsequent experiments or about materials that they are investigating. In order to improve the data analysis performance, ideally to achieve near real time data analysis during an XRD experiment, we designed and implemented software for accelerated XRD data analysis. The software has been developed for a heterogeneous high performance computing (HPC) system, comprised of IBM PowerXCell 8i processors and Intel quad-core Xeon processors. This paper describes the software and reports on the improved performance. The results indicate that it is possible for XRD data to be analyzed at the rate it is being produced.
International Nuclear Information System (INIS)
Qin, J; Bauer, M A
2010-01-01
The analysis of synchrotron X-ray Diffraction (XRD) data has been used by scientists and engineers to understand and predict properties of materials. However, the large volume of XRD image data and the intensive computations involved in the data analysis makes it hard for researchers to quickly reach any conclusions about the images from an experiment when using conventional XRD data analysis software. Synchrotron time is valuable and delays in XRD data analysis can impact decisions about subsequent experiments or about materials that they are investigating. In order to improve the data analysis performance, ideally to achieve near real time data analysis during an XRD experiment, we designed and implemented software for accelerated XRD data analysis. The software has been developed for a heterogeneous high performance computing (HPC) system, comprised of IBM PowerXCell 8i processors and Intel quad-core Xeon processors. This paper describes the software and reports on the improved performance. The results indicate that it is possible for XRD data to be analyzed at the rate it is being produced.
Directory of Open Access Journals (Sweden)
Paulo J. Modenesi
2011-03-01
Full Text Available O processo de soldagem GMAW é caracterizado por uma forte interdependência de seus parâmetros operacionais e uma grande sensibilidade a variações destes. Estas características podem causar variações nas condições operacionais, dificultando o estabelecimento e a reprodução destas condições que, usualmente precisam ser verificadas pela realização de testes. Como uma forma de minimizar esta dificuldade e facilitar o entendimento da relação entre as variáveis deste processo, tem-se trabalhado no desenvolvimento de um modelo matemático capaz de simular aspectos elétricos e operacionais da soldagem GMAW. O objetivo do presente trabalho foi estudar procedimentos de determinação e fatores que afetam duas variáveis fundamentais para o desenvolvimento deste modelo (a resistividade elétrica do arame durante a soldagem e a soma das quedas de tensão anódica e catódica no arco, U AC na soldagem com transferência por curto-circuito. Os testes experimentais envolveram a deposição mecanizada de cordões emaço de baixo carbono usando arames do mesmo material com diferentes gases de proteção. Metodologias para a determinação dos parâmetros citados foram desenvolvidas com base em procedimentos similares indicados na literatura. Os detalhes destes procedimentos são avaliados, os resultados obtidos são comparados com dados da literatura e métodos para estimar a resistência elétrica entre o bico de contato e o eletrodo são apresentados. Os resultados sugerem valores para esta resistência entre 6 e 9 mΩ.GMA welding is characterized by a strong dependence between its operational parameters and a high sensitivity to small variations of those. These characteristics tend to make it harder to replicate welding conditions. It is also a barrier to welding automation and makes it necessary to perform a number of real welding tests before determining operational conditions for a given application. In order to contribute to reduce
Effects of feed-borne Fusarium mycotoxins on hematology and immunology of turkeys.
Chowdhury, S R; Smith, T K; Boermans, H J; Woodward, B
2005-11-01
Feeding grains naturally-contaminated with Fusarium mycotoxins has been shown to alter the metabolism and performance of turkeys. The objectives of the current experiment were to examine the effects of feeding turkeys with grains naturally contaminated with Fusarium mycotoxins on their hematology and immunological indices (including functions), and the possible protective effect of feeding a polymeric glucomannan mycotoxin adsorbent (GMA). Two hundred twenty-five 1-d-old male turkey poults were fed corn, wheat, and soybean meal-based starter (0 to 3 wk), grower (4 to 6 wk), developer (7 to 9 wk), and finisher (10 to 12 wk) diets formulated with uncontaminated grains, contaminated grains, or contaminated grains with 0.2% GMA. The chronic consumption of Fusarium mycotoxins caused minor and transient changes in hematocrit (0.33 L/L) and hemoglobin (10(6) g/L) concentrations as well as in blood basophil (0.13 x 10(9)/L) and monocyte counts (3.42 x 10(9)/L) compared with controls. Supplementation of the contaminated diet with GMA prevented these effects on blood cell counts. Biliary IgA concentrations were significantly increased (4.45-fold) when birds were fed contaminated grains compared with controls, but serum IgA concentrations were not affected. Contact hypersensitivity to dinitrochlorobenzene, which is a CD8+ T-cell-mediated delayed-type hypersensitivity response, was decreased (48%) by feed-borne mycotoxins compared with the control. By contrast, the primary and secondary antibody response to sheep red blood cells, a CD4+ T-cell-mediated response, was not affected. It was concluded that chronic consumption of grains naturally contaminated with Fusarium mycotoxins exerts only minor adverse effects on the hematology and some immunological indices of turkeys. Consumption of grains naturally contaminated with Fusarium mycotoxins may, however, increase the susceptibility of turkeys to infectious agents against which CD8+ T cells play a major role in defense.
Directory of Open Access Journals (Sweden)
Kaimeng Xu
2016-01-01
Full Text Available Rubber seed shell (RSS was modified by grafting treatment using glycidyl methacrylate (GMA at various concentrations. The RSS was then used to reinforce high-density polyethylene (HDPE. The effects of modification on the mechanical, water absorption, and thermal properties of the RSS/HDPE composites were studied using a mechanical testing instrument, weighing method, Vicat softening temperature (VST testing, thermogravimetry, and dynamic mechanical analysis. The results showed that the GMA grafting produced an improvement in the flexural and tensile properties of the composites. The water absorption rate of the composites also had an obvious decrease. While a slight increase in VST was found, the various concentrations of GMA showed no improvement in VST. GMA modification also could elevate the thermal stability of the composites at the initial decomposition stage. The optimum grafting concentration of GMA (2.5% led to the lowest thermal weight loss (37.07% and 26.56% during the first and second decomposition stages. The E’ values of the composites had a significant increase with the addition of GMA. There were two peaks of tan δ for the untreated samples, but the modified samples exhibited a shift in the transition peak at higher temperatures; moreover, the second peak disappeared.
Yang, Shengchao; Ye, Fanggui; Lv, Qinghui; Zhang, Cong; Shen, Shufen; Zhao, Shulin
2014-09-19
Metal-organic framework (MOF) HKUST-1 nanoparticles have been incorporated into poly(glycidyl methacrylate-co-ethylene dimethacrylate) (HKUST-1-poly(GMA-co-EDMA)) monoliths to afford stationary phases with enhanced chromatographic performance of small molecules in the reversed phase capillary liquid chromatography. The effect of HKUST-1 nanoparticles in the polymerization mixture on the performance of the monolithic column was explored in detail. While the bare poly(GMA-co-EDMA) monolith exhibited poor resolution (RsHKUST-1 nanoparticles to the polymerization mixture provide high increased resolution (Rs≥1.3) and high efficiency ranged from 16,300 to 44,300plates/m. Chromatographic performance of HKUST-1-poly(GMA-co-EDMA) monolith was demonstrated by separation of various analytes including polycyclic aromatic hydrocarbons, ethylbenzene and styrene, phenols and aromatic acids using a binary polar mobile phase (CH3CN/H2O). The HKUST-1-poly(GMA-co-EDMA) monolith displayed enhanced hydrophobic and π-π interaction characteristics in the reversed phase separation of test analytes compared to the bare poly(GMA-co-EDMA) monolith. The experiment results showed that HKUST-1-poly(GMA-co-EDMA) monoliths are an alternative to enhance the chromatographic separation of small molecules. Copyright © 2014 Elsevier B.V. All rights reserved.
CERN. Geneva
2012-01-01
With Moore's Law alive and well, more and more parallelism is introduced into all computing platforms at all levels of integration and programming to achieve higher performance and energy efficiency. Especially in the area of High-Performance Computing (HPC) users can entertain a combination of different hardware and software parallel architectures and programming environments. Those technologies range from vectorization and SIMD computation over shared memory multi-threading (e.g. OpenMP) to distributed memory message passing (e.g. MPI) on cluster systems. We will discuss HPC industry trends and Intel's approach to it from processor/system architectures and research activities to hardware and software tools technologies. This includes the recently announced new Intel(r) Many Integrated Core (MIC) architecture for highly-parallel workloads and general purpose, energy efficient TFLOPS performance, some of its architectural features and its programming environment. At the end we will have a br...
Directory of Open Access Journals (Sweden)
Jingyu Zhang
Full Text Available While much research has investigated the predictors of operators' performance such as personality, attitudes and motivation in high-risk industries, its cognitive antecedents and boundary conditions have not been fully investigated. Based on a multilevel investigation of 312 nuclear power plant main control room operators from 50 shift teams, the present study investigated how general mental ability (GMA at both individual and team level can influence task and safety performance. At the individual level, operators' GMA was predictive of their task and safety performance and this trend became more significant as they accumulated more experience. At the team level, we found team GMA had positive influences on all three performance criteria. However, we also found a "big-fish-little-pond" effect insofar as team GMA had a relatively smaller effect and inhibited the contribution of individual GMA to workers' extra-role behaviors (safety participation compared to its clear beneficial influence on in-role behaviors (task performance and safety compliance. The possible mechanisms related to learning and social comparison processes are discussed.
Zhang, Jingyu; Li, Yongjuan; Wu, Changxu
2013-01-01
While much research has investigated the predictors of operators' performance such as personality, attitudes and motivation in high-risk industries, its cognitive antecedents and boundary conditions have not been fully investigated. Based on a multilevel investigation of 312 nuclear power plant main control room operators from 50 shift teams, the present study investigated how general mental ability (GMA) at both individual and team level can influence task and safety performance. At the individual level, operators' GMA was predictive of their task and safety performance and this trend became more significant as they accumulated more experience. At the team level, we found team GMA had positive influences on all three performance criteria. However, we also found a "big-fish-little-pond" effect insofar as team GMA had a relatively smaller effect and inhibited the contribution of individual GMA to workers' extra-role behaviors (safety participation) compared to its clear beneficial influence on in-role behaviors (task performance and safety compliance). The possible mechanisms related to learning and social comparison processes are discussed.
Gefen, Aharon; Zaidman, Irina; Shachor-Meyouhas, Yael; Avidor, Israela; Hakim, Fahed; Weyl Ben-Arush, Myriam; Kassis, Imad
2015-03-01
Both transplanted and leukemia patients are at high risk (HR) for invasive pulmonary aspergillosis (IPA). Methods for rapid diagnosis are crucial. Our objective was to investigate the impact of serial serum galactomannan assay (GMA) screening on IPA diagnosis in children. Between January 2010 and December 2011, all children following stem cell transplantation (SCT) or with HR leukemia were prospectively included. Serum samples for GMA were taken once-twice weekly. Results >.5 were considered positive. Patients suspected of having IPA were stratified as possible, probable, and definite. Forty-six children (median age, 8 years) were included, 38 after SCT (32 allogeneic), 8 with HR leukemia. A total of 510 samples were taken; screening period was 1-6 months for 34 patients. GMA was negative in 28 patients, all but one without suspicion of IPA. Eighteen patients had positive GMA: while four (22%) were upgraded to probable IPA, fourteen (78%) were considered as false positives (FP), some associated with piperacillin-tazobactam treatment. GMA sensitivity and specificity were 0.8 and 0.66, respectively; positive- and negative-predictive values (PPV, NPV) were 0.22 and 0.96, respectively. GMA may have a role in evaluating HR children for IPA. Both NPV and FP rates are high. The cost benefit of early detection versus over-diagnosis should be further studied.
Directory of Open Access Journals (Sweden)
Schnabel, Kai P.
2011-11-01
standardisieren. Auf Initiative der deutschsprachigen Skills Labs wurde der GMA-Ausschuss für praktische Fertigkeiten gegründet, der einen kompetenzbasierten Lernzielkatalog entwickelte, dessen Entstehung und Struktur hier beschrieben wird.Ziel des Kataloges ist es, die praktischen Fertigkeiten im Medizinstudium zu definieren und damit den Fakultäten eine rationale Planungsgrundlage für die zur Vermittlung praktischer Fertigkeiten notwendigen Ressourcen zu geben.Methodik: Aufbauend auf schon vorhandenen deutschsprachigen Lernzielkatalogen wurde mittels einem mehrfach iterativem Kondensationsprozesses, der der Erarbeitung von S1-Leitlinien entspricht, vorgegangen, um eine breite fachliche und politische Abstützung zu erhalten. Ergebnisse: Es wurden 289 verschiedene praktische Lernziele identifiziert, die zwölf verschiedenen Organsystemen, drei Grenzbereichen zu anderen Kompetenzbereichen und einem Bereich mit organsystemübergreifenden Fertigkeiten zugeordnet. Sie wurden drei verschiedenen zeitlichen und drei verschiedenen Tiefendimensionen zugeordnet und mit dem Schweizer und dem Österreichischem Pendant abgeglichen. Diskussion: Das vorliegende Konsensusstatement kann den deutschen Fakultäten eine Grundlage zur Planung der Vermittlung praktischer Fertigkeiten bieten und bildet einen wichtigen Schritt zu einem nationalen Standard medizinischer Lernziele.Blick in die Zukunft: Das Konsensusstatement soll einen formativen Effekt auf die medizinischen Fakultäten haben, ihre praktischen Unterrichtsinhalte entsprechend zu vermitteln und die Ressourcen danach zu planen.
1974-12-23
in greater detail by a dental manufacturerI0 advocates the use of a composite Bis -GMA resin+ to "ad- hesively" bond an acrylic pontic directly to...interface between the pontic and Bis -GMA resin used to cement the pontic to the natural teeth. This consistent mode of failure suggested that an...examination of the failed "bridges" showed that delamination occurred at the interface between the pontic and Bis -GMA resin used to cement the pontic to the
Ueki, Yuji; Chandra Dafader, Nirmal; Hoshina, Hiroyuki; Seko, Noriaki; Tamada, Masao
2012-07-01
Radiation-induced graft polymerization of glycidyl methacrylate (GMA) onto non-woven polyethylene (NWPE) fabric was achieved under normal pressure and air atmospheric conditions, without using unique apparatus such as glass ampoules or vacuum lines. To attain graft polymerization under normal pressure and air atmospheric conditions, the effects of the pre-irradiation dose, pre-irradiation atmosphere, pre-irradiation temperature, de-aeration of GMA-emulsion, grafting atmosphere in a reactor, and dissolved oxygen (DO) concentration in GMA-emulsion on the degree of grafting (Dg) were investigated in detail. It was found that the DO concentration had the strongest influence, the pre-irradiation dose, de-aeration of emulsion and grafting atmosphere had a relatively strong impact, and the pre-irradiation atmosphere and pre-irradiation temperature had the least effect on Dg. The optimum DO concentration before grafting was 2.0 mg/L or less. When a polyethylene bottle was used as a reactor instead of a glass ampoule, graft polymerization under normal pressure and air atmospheric conditions could be achieved under the following conditions; the pre-irradiation dose was more than 50 kGy, the volume ratio of GMA-emulsion to air was 50:1 or less, and the DO concentration in GMA-emulsion during grafting was below 2.0 mg/L. Under these grafting conditions, Dg was controlled within a range of up to 362%. The prepared GMA-grafted NWPE (GMA-g-NWPE) fabric was modified with a phosphoric acid to obtain an adsorbent for heavy metal ions. In the column-mode adsorption tests of Pb(II), the adsorption performance of the produced phosphorylated GMA-g-NWPE fabric (fibrous metal adsorbent) was not essentially dependent on the flow rate of the feed. The breakthrough points of 200, 500, and 1000 h-1 in space velocity were 483, 477 and 462 bed volumes, and the breakthrough capacities of the three flow rates were 1.16, 1.15 and 1.16 mmol-Pb(II)/g-adsorbent.
Wang, Hejing; Qian, Junmin; Zhang, Yaping; Xu, Weijun; Xiao, Juxiang; Suo, Aili
2017-01-01
Breast cancer negatively affects women's health worldwide. The tumour microenvironment plays a critical role in tumour initiation, proliferation, and metastasis. Cancer cells are traditionally grown in two-dimensional (2D) cultures as monolayers on a flat solid surface lacking cell-cell and cell-matrix interactions. These experimental conditions deviate from the clinical situation. Improved experimental systems that can mimic the in vivo situation are required to discover new therapies, particularly for anti-angiogenic agents that mainly target intercellular factors and play an essential role in treating some cancers. Chitosan can be modified to construct three-dimensional (3D) tumour models. Here, we report an in vitro 3D tumour model using a hydroxyethyl chitosan/glycidyl methacrylate (HECS-GMA) hydrogel produced by a series of chitosan modifications. Parameters relating to cell morphology, viability, proliferation, and migration were analysed using breast cancer MCF-7 cells. In a xenograft model, secretion of angiogenesis-related growth factors and the anti-angiogenic efficacy of Endostar and Bevacizumab in cells grown in HECS-GMA hydrogels were assessed by immunohistochemistry. Hydroxyethyl chitosan/glycidyl methacrylate hydrogels had a highly porous microstructure, mechanical properties, swelling ratio, and morphology consistent with a 3D tumour model. Compared with a 2D monolayer culture, breast cancer MCF-7 cells residing in the HECS-GMA hydrogels grew as tumour-like clusters in a 3D formation. In a xenograft model, MCF-7 cells cultured in the HECS-GMA hydrogels had increased secretion of angiogenesis-related growth factors. Recombinant human endostatin (Endostar), but not Bevacizumab (Avastin), was an effective anti-angiogenic agent in HECS-GMA hydrogels. The HECS-GMA hydrogel provided a 3D tumour model that mimicked the in vivo cancer microenvironment and supported the growth of MCF7 cells better than traditional tissue culture plates. The HECS-GMA
Toporek, Chuck
2008-01-01
When Steve Jobs jumped on stage at Macworld San Francisco 2006 and announced the new Intel-based Macs, the question wasn't if, but when someone would figure out a hack to get Windows XP running on these new "Mactels." Enter Boot Camp, a new system utility that helps you partition and install Windows XP on your Intel Mac. Boot Camp does all the heavy lifting for you. You won't need to open the Terminal and hack on system files or wave a chicken bone over your iMac to get XP running. This free program makes it easy for anyone to turn their Mac into a dual-boot Windows/OS X machine. Running Bo
MILC Code Performance on High End CPU and GPU Supercomputer Clusters
DeTar, Carleton; Gottlieb, Steven; Li, Ruizi; Toussaint, Doug
2018-03-01
With recent developments in parallel supercomputing architecture, many core, multi-core, and GPU processors are now commonplace, resulting in more levels of parallelism, memory hierarchy, and programming complexity. It has been necessary to adapt the MILC code to these new processors starting with NVIDIA GPUs, and more recently, the Intel Xeon Phi processors. We report on our efforts to port and optimize our code for the Intel Knights Landing architecture. We consider performance of the MILC code with MPI and OpenMP, and optimizations with QOPQDP and QPhiX. For the latter approach, we concentrate on the staggered conjugate gradient and gauge force. We also consider performance on recent NVIDIA GPUs using the QUDA library.
MILC Code Performance on High End CPU and GPU Supercomputer Clusters
Directory of Open Access Journals (Sweden)
DeTar Carleton
2018-01-01
Full Text Available With recent developments in parallel supercomputing architecture, many core, multi-core, and GPU processors are now commonplace, resulting in more levels of parallelism, memory hierarchy, and programming complexity. It has been necessary to adapt the MILC code to these new processors starting with NVIDIA GPUs, and more recently, the Intel Xeon Phi processors. We report on our efforts to port and optimize our code for the Intel Knights Landing architecture. We consider performance of the MILC code with MPI and OpenMP, and optimizations with QOPQDP and QPhiX. For the latter approach, we concentrate on the staggered conjugate gradient and gauge force. We also consider performance on recent NVIDIA GPUs using the QUDA library.
Computing on Knights and Kepler Architectures
International Nuclear Information System (INIS)
Bortolotti, G; Caberletti, M; Ferraro, A; Giacomini, F; Manzali, M; Maron, G; Salomoni, D; Crimi, G; Zanella, M
2014-01-01
A recent trend in scientific computing is the increasingly important role of co-processors, originally built to accelerate graphics rendering, and now used for general high-performance computing. The INFN Computing On Knights and Kepler Architectures (COKA) project focuses on assessing the suitability of co-processor boards for scientific computing in a wide range of physics applications, and on studying the best programming methodologies for these systems. Here we present in a comparative way our results in porting a Lattice Boltzmann code on two state-of-the-art accelerators: the NVIDIA K20X, and the Intel Xeon-Phi. We describe our implementations, analyze results and compare with a baseline architecture adopting Intel Sandy Bridge CPUs.
Experiences and results multitasking a hydrodynamics code on global and local memory machines
International Nuclear Information System (INIS)
Mandell, D.
1987-01-01
A one-dimensional, time-dependent Lagrangian hydrodynamics code using a Godunov solution method has been multimasked for the Cray X-MP/48, the Intel iPSC hypercube, the Alliant FX series and the IBM RP3 computers. Actual multitasking results have been obtained for the Cray, Intel and Alliant computers and simulated results were obtained for the Cray and RP3 machines. The differences in the methods required to multitask on each of the machines is discussed. Results are presented for a sample problem involving a shock wave moving down a channel. Comparisons are made between theoretical speedups, predicted by Amdahl's law, and the actual speedups obtained. The problems of debugging on the different machines are also described
Energy Technology Data Exchange (ETDEWEB)
Takemiya, Hiroshi; Ohta, Hirofumi; Honma, Ichirou
1996-03-01
The parallelization of Electro-Magnetic Cascade Monte Carlo Simulation Code, EGS4 on distributed memory scalar parallel computer: Intel Paragon XP/S15-256 is described. EGS4 has the feature that calculation time for one incident particle is quite different from each other because of the dynamic generation of secondary particles and different behavior of each particle. Granularity for parallel processing, parallel programming model and the algorithm of parallel random number generation are discussed and two kinds of method, each of which allocates particles dynamically or statically, are used for the purpose of realizing high speed parallel processing of this code. Among four problems chosen for performance evaluation, the speedup factors for three problems have been attained to nearly 100 times with 128 processor. It has been found that when both the calculation time for each incident particles and its dispersion are large, it is preferable to use dynamic particle allocation method which can average the load for each processor. And it has also been found that when they are small, it is preferable to use static particle allocation method which reduces the communication overhead. Moreover, it is pointed out that to get the result accurately, it is necessary to use double precision variables in EGS4 code. Finally, the workflow of program parallelization is analyzed and tools for program parallelization through the experience of the EGS4 parallelization are discussed. (author).
Parallel algorithms for continuum dynamics
International Nuclear Information System (INIS)
Hicks, D.L.; Liebrock, L.M.
1987-01-01
Simply porting existing parallel programs to a new parallel processor may not achieve the full speedup possible; to achieve the maximum efficiency may require redesigning the parallel algorithms for the specific architecture. The authors discuss here parallel algorithms that were developed first for the HEP processor and then ported to the CRAY X-MP/4, the ELXSI/10, and the Intel iPSC/32. Focus is mainly on the most recent parallel processing results produced, i.e., those on the Intel Hypercube. The applications are simulations of continuum dynamics in which the momentum and stress gradients are important. Examples of these are inertial confinement fusion experiments, severe breaks in the coolant system of a reactor, weapons physics, shock-wave physics. Speedup efficiencies on the Intel iPSC Hypercube are very sensitive to the ratio of communication to computation. Great care must be taken in designing algorithms for this machine to avoid global communication. This is much more critical on the iPSC than it was on the three previous parallel processors
A comparative critical analysis of modern task-parallel runtimes.
Energy Technology Data Exchange (ETDEWEB)
Wheeler, Kyle Bruce; Stark, Dylan; Murphy, Richard C.
2012-12-01
The rise in node-level parallelism has increased interest in task-based parallel runtimes for a wide array of application areas. Applications have a wide variety of task spawning patterns which frequently change during the course of application execution, based on the algorithm or solver kernel in use. Task scheduling and load balance regimes, however, are often highly optimized for specific patterns. This paper uses four basic task spawning patterns to quantify the impact of specific scheduling policy decisions on execution time. We compare the behavior of six publicly available tasking runtimes: Intel Cilk, Intel Threading Building Blocks (TBB), Intel OpenMP, GCC OpenMP, Qthreads, and High Performance ParalleX (HPX). With the exception of Qthreads, the runtimes prove to have schedulers that are highly sensitive to application structure. No runtime is able to provide the best performance in all cases, and those that do provide the best performance in some cases, unfortunately, provide extremely poor performance when application structure does not match the schedulers assumptions.
Veranes-Pantoja, Yaimarilis; Autran-Mateu, Fernando; Álvarez-Brito, Rubén; Gil-Mur, Francisco Javier
2005-01-01
En el presente trabajo se estudian la resistencia a la compresión, módulo en compresión, resistencia a la compresión diametral, dureza, desgaste y profundidad de curado de seis formulaciones de composites dentales fotopolimerizables. Los composites fueron preparados usando como matrices combinaciones de Bis-GMA/DMATEEG, Bis-GMA/MPS, Bis-GMA/DMATEEG/MPS. Como relleno se utilizó cuarzo del yacimiento "El Cacahual" y la combinación de cuarzo/aerosil 200. La resina VenusTM Heraus Kulzer fue utili...
Space weather and human deaths distribution: 25 years' observation (Lithuania, 1989-2013).
Stoupel, Eliyahu G; Petrauskiene, Jadvyga; Kalediene, Ramune; Sauliune, Skirmante; Abramson, Evgeny; Shochat, Tzippy
2015-09-01
Human health is affected by space weather component [solar (SA), geomagnetic (GMA), cosmic ray (CRA) - neutrons, space proton flux] activity levels. The aim of this study was to check possible links between timing of human (both genders) monthly deaths distribution and space weather activity. Human deaths distribution in the Republic of Lithuania from 1989 to 2013 (25 years, i.e., 300 consecutive months) was studied, which included 1,050,503 deaths (549,764 male, 500,739 female). Pearson correlation coefficients (r) and their probabilities (p) were obtained for years: months 1-12, sunspot number, smoothed sunspot number, solar flux (2800 MGH, 10.7 cm), adjusted solar flux for SA; A, C indices of GMA; neutron activity at the earth's surface (imp/min) for CRA. The cosmophysical data were obtained from space science institutions in the USA, Russia and Finland. The mentioned physical parameters were compared with the total number of deaths, deaths from ischemic heart disease (n=376,074), stroke (n=132,020), non-cardiovascular causes (n=542,409), accidents (n=98,805), traffic accidents (n=21,261), oncology (n=193,017), diabetes mellitus (n=6631) and suicide (n=33,072). Space factors were interrelated as follows for the considered period: CRA was inversely related to SA and GMA, CRA/SA (r=-0.86, p>0.0001), CRA/GMA (r=-0.70, pweather component activity. Extreme levels of activities of both groups (SA, GMA, and opposite CRA - neutron) are related to some health risks. In the considered period, there were relatively few GMA storms and low GMA was dominating, accompanied by higher CRA (neutron) activity. The ways of action of the components of space weather on the human body need additional studies. There is a special need for the prevention of rising cerebral vascular accidents and oncology malignancies as the causes of death.
Aerdts, A.M.; Groeninckx, G.; Zirkzee, H.F.; Aert, van H.A.M.; Geurts, J.M.
1997-01-01
Functional core—shell impact modifiers of glycidyl methacrylate (GMA) functionalized methyl methacrylate—butadiene—styrene (MBS) have been prepared via a seeded semi-continuous emulsion polymerization. These functional MBS—GMA particles were blended with polyamide-6. Investigations by transmission
Research of Jiles-Atherton Dynamic Model in Giant Magnetostrictive Actuator
Directory of Open Access Journals (Sweden)
Yongguang Liu
2016-01-01
Full Text Available Due to the existence of multicoupled nonlinear factors in the giant magnetostrictive actuator (GMA, building precise mathematical model is highly important to study GMA’s characteristics and control strategies. Minor hysteresis loops near the bias magnetic field would be often applied because of its relatively good linearity. Load, friction, and disc spring stiffness seriously affect the output characteristics of the GMA in high frequency. Therefore, the current-displacement dynamic minor loops mathematical model coupling of electric-magnetic-machine is established according to Jiles-Atherton (J-A dynamic model of hysteresis material, GMA structural dynamic equation, Ampere loop circuit law, and nonlinear piezomagnetic equation and demonstrates its correctness and effectiveness in the experiments. Finally, some laws are achieved between key structural parameters and output characteristics of GMA, which provides important theoretical foundation for structural design.
Polypropylene fibers modified by plasma treatment for preparation of Ag nanoparticles.
Tseng, Chun-Hao; Wang, Cheng-Chien; Chen, Chuh-Yung
2006-03-09
A novel method for preparing poly(propylene-graft-2-methacrylic acid 3-(bis-carboxymethylamino)-2-hydroxy-propyl ester)-silver fibers (PPG-IAg fibers) by plasma-induced grafting polymerization is presented in this study. The chelating groups, -N(CH2COO-)2 (GMA-IDA), on the surface of the PPG-I fibers are the coordination sites for chelating silver ions. At these sites, Ag nanoparticles were grown first by reduction with UV light with a wavelength of 366 nm, and second, through immersion in a 24% formaldehyde solution with pH values set variously at 2, 5, 8, and 11. The characteristics of the PPG-I fibers with differing durations of plasma treatment were monitored by using a Fourier transform infrared (FT-IR) spectroscope. Scanning electronic microscopy (SEM) and elemental analysis show that the percentage of GMA-IDA grafted onto PP fiber reaches a maximum when the plasma treatment time is 3 min. Plasma treatment time beyond a certain length of time results in an abundance of free radicals and causes considerable cross-linking on the fiber surface which thus decreases the extent of grafting. Moreover, the crystalline phase of Ag nanoparticles is identified by using X-ray diffraction (XRD). When the PPG-I fibers are reduced by the UV light method, SEM and TEM microscopes reveal that the size of the Ag nanoparticles on the fiber surface decreases significantly with the increase of pH values in aqueous solutions. Notably, in the reduction of formaldehyde solution, the particle size of Ag nanoparticles reaches a minimum at the lowest pH value. The TEM observations show that Ag nanoparticles are distributed both in the exterior and interior of the grafting layer. In addition, under high pH values the distribution of the Ag nanoparticles permeate more deeply in the GMA-IDA grafting layer due to the swelling effect of the GMA-IDA polymer.
International Nuclear Information System (INIS)
Coskun, E.
1995-09-01
Time-dependent Ginzburg-Landau (TDGL) equations are considered for modeling a thin-film finite size superconductor placed under magnetic field. The problem then leads to the use of so-called natural boundary conditions. Computational domain is partitioned into subdomains and bond variables are used in obtaining the corresponding discrete system of equations. An efficient time-differencing method based on the Forward Euler method is developed. Finally, a variable strength magnetic field resulting in a vortex motion in Type II High T c superconducting films is introduced. The authors tackled the problem using two different state-of-the-art parallel computing tools: BlockComm/Chameleon and PCN. They had access to two high-performance distributed memory supercomputers: the Intel iPSC/860 and IBM SP1. They also tested the codes using, as a parallel computing environment, a cluster of Sun Sparc workstations
Frederiks, W. M.; Bosch, K. S.
1993-01-01
Freeze-substituted rat liver embedded in glycol methacrylate (GMA) has been used to demonstrate the activities of several enzymes. The following enzymes could be detected in GMA-sections by the indicated histochemical procedure(s): 5'-nucleotidase (lead salt, cerium-diaminobenzidine), alkaline
The billion-mulmod-per-second PC
Bernstein, D.J.; Chen, H.-C.; Chen, M.S.; Cheng, C.M.; Hsiao, C.H.; Lange, T.; Lin, Z.C.; Yang, B.Y.
2009-01-01
This paper sets new speed records for ECM, the elliptic-curve method of factorization, on several different hardware platforms: GPUs (specifically the NVIDIA GTX), x86 CPUs with SSE2 (specifically the Intel Core 2 and the AMD Phenom), and the Cell (specifically the PlayStation 3 and the PowerXCell
Evaluation of an Adaptive Automation Trigger Based on Task Performance, Priority, and Frequency
2013-06-01
with dual Intel ® Xeon ® CPU x5550 processors @ 2.67 GHz each, 12.0 GB RAM, and a 1.5 GB PCIe nVidia Quadro FX 4800 graphics card (Microsoft...Cole Publishing Company . Miller, C. A., & Parasuraman, R. (2007). Designing for flexible interaction between humans and automation: Delegation
SWPS3 - fast multi-threaded vectorized Smith-Waterman for IBM Cell/B.E. and x86/SSE2.
Szalkowski, Adam; Ledergerber, Christian; Krähenbühl, Philipp; Dessimoz, Christophe
2008-10-29
We present swps3, a vectorized implementation of the Smith-Waterman local alignment algorithm optimized for both the Cell/BE and x86 architectures. The paper describes swps3 and compares its performances with several other implementations. Our benchmarking results show that swps3 is currently the fastest implementation of a vectorized Smith-Waterman on the Cell/BE, outperforming the only other known implementation by a factor of at least 4: on a Playstation 3, it achieves up to 8.0 billion cell-updates per second (GCUPS). Using the SSE2 instruction set, a quad-core Intel Pentium can reach 15.7 GCUPS. We also show that swps3 on this CPU is faster than a recent GPU implementation. Finally, we note that under some circumstances, alignments are computed at roughly the same speed as BLAST, a heuristic method. The Cell/BE can be a powerful platform to align biological sequences. Besides, the performance gap between exact and heuristic methods has almost disappeared, especially for long protein sequences.
Search for the X(4140) state in B+->J/psi phi K.sup.+./sup. decays with the D0 detector
Czech Academy of Sciences Publication Activity Database
Abazov, V. M.; Abbott, B.; Acharya, B.S.; Kupčo, Alexander; Lokajíček, Miloš
2014-01-01
Roč. 89, č. 1 (2014), "012004-1"-"012004-8" ISSN 1550-7998 R&D Projects: GA MŠk(CZ) LG12006 Institutional support: RVO:68378271 Keywords : D0 * B decay * J/psi(3100) * Batavia TEVATRON Coll * branching ratio * enhancement * statistical Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.643, year: 2014
International Nuclear Information System (INIS)
Bondar, Yu.V.; Kim, H.J.; Lim, Y.J.
2006-01-01
The design and development of sorption-active natural and synthetic polymer fibers and textile materials is of great scientific and practical interest. The advantages of that type of polymeric adsorbents, as their highly developed specific surface, excellent ion-exchange and adsorption parameters and ease of their use especially under continuous conditions, allow them to find a great application in the chemical, biomedical, ecological and industrial fields. To obtain functional polymer materials with the desired performance, the non-active polymer surface have to be modified. Among different innovative techniques used for the introduction of graft chains, the radiation-chemical method of initiation has some economical and ecological preferences over others. It allows to introduce into inert polymeric matrix chains of a monomer already containing a desirable functional group, or to graft chains of a precursor-monomer and subsequently its chemical modification to form required functional groups. At present an epoxy-group containing monomer, glycidyl methacrylate (GMA), is successfully used as a precursor-monomer for production of polymeric adsorbents of variety applications on the base of membranes, films, fibers and fabrics. Two types of sorption-active polypropylene fiber carrying strong-acid sulfonate groups and amino groups have been synthesized by radiation-induced graft polymerization of GMA, with subsequent chemical modification of the epoxy groups of poly-GMA graft chains. The effect of various polymerization parameters on the GMA grafting degree was investigated in detail. The epoxy ring-opening of poly-GMA graft chains with introduction of strong-acid sulfonate groups was carried out with sodium hydrogen sulfite in water-dimethylformamide solution at 70 deg C. The main peculiarities of the sulfonation reaction in depending on the reaction time and GMA grafting degree have been investigated. Amine groups were incorporated by treatment of the GMA
Mbewe, Njelembo J; Sitali, Lungowe; Namangala, Boniface; Michelo, Charles
2015-04-15
Trypanocides will continue to play an important role in the control of tsetse fly transmitted trypanosomosis now and in the near future. The drugs are mostly administered by farmers without any veterinary supervision leading to misuse and under dosing of medication, and these could be factors that promote trypanocidal drug resistance (TDR) development. In order to delay or prevent TDR, the Food and Agriculture Organization (FAO) recommended guidelines on trypanocide use. It is not known if these recommended guidelines are adhered to in Itezhi tezhi district of Zambia. A survey was undertaken to examine how socio-economic and environmental factors were associated with adherence to the recommended guidelines on trypanocide use in Itezhi tezhi, Central Zambia. Ninety farmers who use trypanocides were interviewed using a questionnaire to collect their socio-economic characteristics (age, education in years, cattle herd size, competence on trypanocide use and their access to extension on trypanocide use) and trypanocide usage practices while crush pens which they use were stratified according to location, whether in the Game Management Area (GMA) (Mutenda, Itumbi, Kapulwe and Banachoongo) or non-GMA (Iyanda, New Ngoma and Shinampamba) as an environmental factor. Associations and measures of associations to adherence of FAO guidelines were determined. The results showed that 25.6% of the farmers adhered to guidelines by FAO on trypanocide use and that none of the socio-economic factors under investigation were significantly associated with it. Further the farmers that used crush pens that were in the GMA had an 80% reduction in the likelihood of adhering to the FAO guidelines on trypanocide use than those that used crush pens in the non-GMA (AOR 0.20, 95% CI: 0.05-0.81, P=0.02). There was low adherence to the recommended FAO guidelines on trypanocide use and it was associated with the location of the crush pen whether in the GMA or not, as an environmental factor. With
Adaptación de Neurite a Intel Xeon Phi
Yanguas Martín, Jorge Pablo
2016-01-01
Hoy en día, podremos comprobar que todos los súper computadores que se utilizan alrededor del mundo aprovechan numerosos procesadores en paralelo con la intención de conseguir el mejor rendimiento posible. La lista de los diez súper computadores más potentes del mundo de noviembre de 2015 utilizan esta filosofía.Con la particularidad de que dos de ellos utilizan a modo de coprocesador las GPUs K20x de Nvidia y otros dos, uno de ellos siendo actualmente el súper computador má...
Electrical resistivity surface for FeO-Fe2O3-P2O5 glasses
Vaughan, J. G.; Kinser, D. L.
1975-01-01
The dc electrical properties and microstructure of x(FeO-Fe2O3)-(100-x)P2O5 glasses were investigated up to a maximum of x = 75 mol %. Results indicate that, in general, the minimum resistivity of the glass does not occur at equal Fe(2+) and Fe(3+) concentrations, although for the special case where x = 55 mol % the minimum does occur at Fe(2+)/Fe total = 0.5, as reported by other investigators. Evidence presented shows that the position of the minimum resistivity is a function of total iron content. The minimum shifts to glasses richer in Fe(2+) at higher total iron concentrations.
International Nuclear Information System (INIS)
Shin, Boo Young; Kim, Jae Hong
2015-01-01
Polyamide (PA6) has been modified by electron-beam initiated mediator process to improve drawbacks of PA6. Glycidyl methacrylate (GMA) was chosen as a reactive mediator for modification process of PA6. The mixture of the PA6 and GMA was prepared by using a twin-screw extruder, and then the mixture was exposed to electron-beam irradiation at various doses at room temperature. The modified PA6 were characterized by observing rheological and mechanical properties and compared virgin PA6. Thermal properties, water absorption, and gel fraction were also investigated. Tight gel was not found even when PA6 was irradiated at 200 kGy. Complex viscosity and storage modulus of PA6 were remarkably increased by electron-beam irradiation with medium of GMA. Maximum increase in complex viscosity was 75 times higher than virgin PA6 at 0.1 rad/s when it was irradiated at 200 kGy with the GMA. Mechanical properties were also improved without scarifying of processability. The reaction mechanisms for the mediation process with the reactive mediator of GMA were estimated to elucidate the cause of significantly enhanced rheological and mechanical properties without loss of thermoplasticity. - Highlights: • PA6 was modified by the electron-beam initiated mediation process. • Maximum increase in complex viscosity of modified PA6 was 75 times higher than virgin PA6 at 0.1 rad/s. • Mechanical properties were improved without scarifying of processability. • The GMA as a mediator played a key role in the electron-beam initiated mediation process
THE EFFECTS OF GLYCOL METHACRYLATE AS A DEHYDRATING AGENT ON THE DIMENSIONAL CHANGES OF LIVER-TISSUE
GERRITS, PO; HOROBIN, RW; STOKROOS, [No Value
The dimensional changes of liver sections during the course of processing with glycol methacrylate (GMA) or with ethanol are described. Tissue processing with ethanol served as a control. During prolonged processing steps (24 h each), linear shrinkage of tissue specimens dehydrated with GMA at room
When intelligence is (dys)functional for achieving sales performance
Verbeke, W.J.; Belschak, F.D.; Bakker, A.B.; Dietz, B.
2008-01-01
Using two samples of salespeople, the authors investigate how a combination of general mental ability (GMA) and specific skills and capabilities (social competence and thinking styles) enables salespeople to reach their sales goals. The study finds evidence for an interaction between GMA and social
Advanced signal separation and recovery algorithms for digital x-ray spectroscopy
International Nuclear Information System (INIS)
Mahmoud, Imbaby I.; El-Tokhy, Mohamed S.
2015-01-01
X-ray spectroscopy is widely used for in-situ applications for samples analysis. Therefore, spectrum drawing and assessment of x-ray spectroscopy with high accuracy is the main scope of this paper. A Silicon Lithium Si(Li) detector that cooled with a nitrogen is used for signal extraction. The resolution of the ADC is 12 bits. Also, the sampling rate of ADC is 5 MHz. Hence, different algorithms are implemented. These algorithms were run on a personal computer with Intel core TM i5-3470 CPU and 3.20 GHz. These algorithms are signal preprocessing, signal separation and recovery algorithms, and spectrum drawing algorithm. Moreover, statistical measurements are used for evaluation of these algorithms. Signal preprocessing based on DC-offset correction and signal de-noising is performed. DC-offset correction was done by using minimum value of radiation signal. However, signal de-noising was implemented using fourth order finite impulse response (FIR) filter, linear phase least-square FIR filter, complex wavelet transforms (CWT) and Kalman filter methods. We noticed that Kalman filter achieves large peak signal to noise ratio (PSNR) and lower error than other methods. However, CWT takes much longer execution time. Moreover, three different algorithms that allow correction of x-ray signal overlapping are presented. These algorithms are 1D non-derivative peak search algorithm, second derivative peak search algorithm and extrema algorithm. Additionally, the effect of signal separation and recovery algorithms on spectrum drawing is measured. Comparison between these algorithms is introduced. The obtained results confirm that second derivative peak search algorithm as well as extrema algorithm have very small error in comparison with 1D non-derivative peak search algorithm. However, the second derivative peak search algorithm takes much longer execution time. Therefore, extrema algorithm introduces better results over other algorithms. It has the advantage of recovering and
Energy Technology Data Exchange (ETDEWEB)
Grasselli, M [Buenos Aires Univ. (Argentina). Facultad de Farmacia y Bioquimica; Yoshii, Fumio [Japan Atomic Energy Research Inst., Takasaki, Gunma (Japan). Takasaki Radiation Chemistry Research Establishment
1999-07-01
Glycidyl methacrylate (GMA) and N,N-dimethylacrylamide (DMAA) have been co-grafted on hollow fiber membranes of macroporous polyethylene. Grafted copolymers have been obtained with different ratios of the monomers (molar ratio between 0 and 2 DMAA/GMA). The properties of the modified membranes are studied.
International Nuclear Information System (INIS)
Grasselli, M.; Yoshii, Fumio
1999-01-01
Glycidyl methacrylate (GMA) and N,N-dimethylacrylamide (DMAA) have been co-grafted on hollow fiber membranes of macroporous polyethylene. Grafted copolymers have been obtained with different ratios of the monomers (molar ratio between 0 and 2 DMAA/GMA). The properties of the modified membranes are studied
Control of drug releasing from biodegradable polymer drug delivery system by gamma-ray irradiation
International Nuclear Information System (INIS)
Yoshioka, Sumie; Aso, Yukio; Kojima, Shigeo
1999-01-01
In order to introduce the drug to the target organ, we developed a gel to control the drug releasing velocity by response to change of temperature by means of γ-ray irradiation to gelatin-GMA modified dextran mixture aqueous solution. A certain level of molecular weight of drug is necessary. The response to the temperature (change of drug releasing velocity) was affected by the concentration of gelatin and the modification rate of GMA. The Higuchi equation was applied to the releasing of β-galactosidase from gelatin-dextran gel and the releasing velocity was calculated. The releasing velocity decreased with increasing GMA modification rate at 37degC and 15degC. The releasing velocity of β-galactosidase decreased with increasing the concentration of gelatin at 15degC, but the velocity increased with increasing the concentration at 37degC. These results indicated that the good drug releasing conditions are obtained by controlling the GMA modification rate and the concentration of gelatin. (S.Y.)
Ma, Yanli; He, Ling; Jia, Mengjun; Zhao, Lingru; Zuo, Yanyan; Hu, Pingan
2017-08-15
Three polysiloxane/epoxy hybrids obtained by evolving cage- or linear-structured polysiloxane into poly glycidyl methacrylate (PGMA) matrix are compared used as coatings. One is the cage-structured hybrid of P(GMA/MA-POSS) copolymer obtained by GMA and methacrylisobutyl polyhedral oligomeric silsesquioxane (MA-POSS) via free radical polymerization, the other two are PGMA/NH 2 -POSS and PGMA/NH 2 -PDMS hybrids by cage-structured aminopropyllsobutyl POSS (NH 2 -POSS) or linear-structured diamino terminated poly(dimethylsiloxane) (NH 2 -PDMS) to cure PGMA. The effect of MA-POSS, NH 2 -POSS and NH 2 -PDMS on polysiloxane/epoxy hybrid films is characterized according to their surface morphology, transparency, permeability, adhesive strength and thermo-mechanical properties. Due to caged POSS tending to agglomerate onto the film surface, P(GMA/MA-POSS) and PGMA/NH 2 -POSS films exhibit much more heterogeneous surfaces than PGMA/NH 2 -PDMS film, but the well-compatibility between epoxy matrix and MA-POSS has provided P(GMA/MA-POSS) film with much higher transmittance (98%) than PGMA/NH 2 -POSS film (24%), PGMA/NH 2 -PDMS film (27%) and traditional epoxy resin film (5%). The introduction of polysiloxane into epoxy matrix is confirmed to create hybrids with strong adhesive strength (526-1113N) and high thermos-stability (T g =262-282°C), especially the cage-structured P(GMA/MA-POSS) hybrid (1113N and 282°C), but the flexible PDMS improves PGMA/NH 2 -PDMS hybrid with much higher storage modulus (519MPa) than PGMA/NH 2 -POSS (271MPa), which suggests that PDMS is advantage in improving the film stiffness than POSS cages. However, cage-structured P(GMA/MA-POSS) and PGMA/NH 2 -POSS indicate higher permeability than PGMA/NH 2 -PDMS and traditional epoxy resin. Comparatively, the cage-structured P(GMA/MA-POSS) hybrid is the best coating in transparency, permeability, adhesive strength and thermostability, but linear-structured PGMA/NH 2 -PDMS hybrid behaviors the best coating in
Lattice Boltzmann Simulation Optimization on Leading Multicore Platforms
Energy Technology Data Exchange (ETDEWEB)
Williams, Samuel; Carter, Jonathan; Oliker, Leonid; Shalf, John; Yelick, Katherine
2008-02-01
We present an auto-tuning approach to optimize application performance on emerging multicore architectures. The methodology extends the idea of search-based performance optimizations, popular in linear algebra and FFT libraries, to application-specific computational kernels. Our work applies this strategy to a lattice Boltzmann application (LBMHD) that historically has made poor use of scalar microprocessors due to its complex data structures and memory access patterns. We explore one of the broadest sets of multicore architectures in the HPC literature, including the Intel Clovertown, AMD Opteron X2, Sun Niagara2, STI Cell, as well as the single core Intel Itanium2. Rather than hand-tuning LBMHD for each system, we develop a code generator that allows us identify a highly optimized version for each platform, while amortizing the human programming effort. Results show that our auto-tuned LBMHD application achieves up to a 14x improvement compared with the original code. Additionally, we present detailed analysis of each optimization, which reveal surprising hardware bottlenecks and software challenges for future multicore systems and applications.
Grapho-Morphological Awareness in Spanish L2 Reading: How Do Learners Use This Metalinguistic Skill?
Miguel, Nausica Marcos
2012-01-01
This paper contributes to the literature on the transferability of grapho-morphological awareness (GMA) for second language (L2) learners by analysing L2 learners' knowledge of morphology in reading. GMA helps readers to identify grammatical categories, infer meanings of unfamiliar words, and access stored lexical information. Previous research…
DEFF Research Database (Denmark)
Brown, Annemette K; Greisen, Gorm; Haugsted, Ulla
2016-01-01
recordings to assess GMA, in a busy Danish outpatient clinic. METHODS: The study comprised 30-term infants born with perinatal asphyxia, who were video recorded at three months. They were assessed by two certified GMA observers and re-assessed two weeks later. Interobserver and intra-observer agreements were...
Bayramoglu, Gulay; Tekinay, Turgay; Ozalp, V Cengiz; Arica, M Yakup
2015-05-15
Lysozyme is an important polypetide used in medical and food applications. We report a novel magnetic strong cation exchange beads for efficient purification of lysozyme from chicken egg white. Magnetic chitosan (MCHT) beads were synthesized via phase inversion method, and then grafted with poly(glycidyl methacrylate) (p(GMA)) via the surface-initiated atom transfer radical polymerization (SI-ATRP). Epoxy groups of the grafted polymer, were modified into strong cation-exchange groups (i.e., sulfonate groups) in the presence of sodium sulfite. The MCTH and MCTH-g-p(GMA)-SO3H beads were characterized by ATR-FTIR, SEM, and VSM. The sulphonate groups content of the modified MCTH-g-p(GMA)-4 beads was found to be 0.53mmolg(-1) of beads by the potentiometric titration method. The MCTH-g-p(GMA)-SO3H beads were first used as an ion-exchange support for adsorption of lysozyme from aqueous solution. The influence of different experimental parameters such as pH, contact time, and temperature on the adsorption process was evaluated. The maximum adsorption capacity was found to be 208.7mgg(-1) beads. Adsorption of lysozyme on the MCTH-g-p(GMA)-SO3H beads fitted to Langmuir isotherm model and followed the pseudo second-order kinetic. More than 93% of the adsorbed lysozyme was desorbed using Na2CO3 solution (pH 11.0). The purity of the lysozyme was checked by HPLC and SDS gel electrophoresis. In addition, the MCTH-g-p(GMA)-SO3H beads prepared in this work showed promising potential for separation of various anionic molecules. Copyright © 2015 Elsevier B.V. All rights reserved.
ADAPS (Airborne Data Acquisition and Processing System) Operation and Maintenance Manual
1984-03-01
3091 3092 3093 3100 3110 3120 3130 3140 3150 3160 3170 3180 3190 3200 3220 3230 I j Aborti Abort2 XI = 11 Start 1=0 FOR X1 = 19...8217 ■■ .-..„-.■. ■.«,5,v-,,^,., .-,,.-.■■■ .■,.■■-„:«:.-,..«.,,,. ■■,.-. 3830 Restar t1: GOSUB Aborti 3840 LINE TYPE 1 :^ . ^ 3850 MOVE 5.Bt
New particles: experimental results
International Nuclear Information System (INIS)
Augustin, J.E.
The results of studies on production and properties of psi(3100) and psi(3700) resonances are presented, particular attention being given to spin, parity, g-parity and isospin determination. Evidence obtained in the SPEAR and DORIS storage rings in psi'→γ chi and psi→γX intermediate states are presented, together with SPEAR results on e-μ events and high energy jet production. (39 references) [fr
Synthesis and Properties of Reactive Interfacial Agents for Polycaprolactone-Starch Blends
Sugih, Asaf K.; Drijfhout, Jan. P.; Picchioni, Francesco; Janssen, Leon P. B. M.; Heeres, Hero J.
2009-01-01
The synthesis of two reactive interfacial agents for starch-polycaprolactone (PCL) blends, PCL-g-glycidyl methacrylate (PCL-g-GMA) and PCL-g-diethyl maleate (PCL-g-DEM) is described. The compounds were prepared by reacting a low molecular weight PCL. (M(w) 3000) with GMA or DEM in the presence of
Positron trapping defects in free-volume investigation of Ge–Ga–S–CsCl glasses
International Nuclear Information System (INIS)
Klym, H.; Ingram, A.; Shpotyuk, O.; Hotra, O.; Popov, A.I.
2016-01-01
Evolution of free-volume positron trapping defects caused by crystallization process in (80GeS_2–20Ga_2S_3)_1_0_0_−_x(CsCl)_x, 0 ≤ x ≤ 15 chalcogenide-chalcohalide glasses was studied by positron annihilation lifetime technique. It is established that CsCl additives in Ge–Ga–S glassy matrix transform defect-related component spectra, indicating that the agglomeration of free-volume voids occurs in initial and crystallized (80GeS_2–20Ga_2S_3)_1_0_0_−_x(CsCl)_x, 0 ≤ x ≤ 10 glasses. Void fragmentation in (80GeS_2–20Ga_2S_3)_8_5(CsCl)_1_5 glass can be associated with loosing of their inner structure. Full crystallization in each of these glasses corresponds to the formation of defect-related voids. These trends are confirmed by positron-positronium decomposition algorithm. It is shown, that CsCl additives result in white shift in the visible regions in transmission spectra. The γ-irradiation of 80GeS_2–20Ga_2S_3 base glass leads to slight long-wavelength shift of the fundamental optical absorption edge and decreasing of transmission speaks in favor of possible formation of additional defects in glasses and their darkening. - Highlights: • CsCl additives in Ge–Ga–S glassy matrix lead to the agglomeration of voids. • Full crystallization of Ge–Ga–S–CsCl glasses corresponds to the formation of defect voids. • Gamma-irradiation of glass stimulates the creation of additional defects and darkening.
Chen, Yin; Scanlan, Julie; Song, Lijiang; Crombie, Andrew; Rahman, M. Tanvir; Schäfer, Hendrik; Murrell, J. Colin
2010-01-01
Methylocella silvestris BL2, a facultative methane utilizer, can grow on monomethylamine (MMA) as a sole carbon and nitrogen source. No activity of MMA dehydrogenase was detectable. Instead, this bacterium utilizes a methylated amino acid pathway (γ-glutamylmethylamide [GMA] and N-methylglutamate [NMG]) for MMA metabolism. The activities of the two key enzymes in this pathway, GMA synthetase and NMG dehydrogenase, were found when the bacterium was grown on MMA. GMA was detected by high-performance liquid chromatography-mass spectrometry only when the bacterium was grown on MMA but not when it was grown on methanol. Proteomic analysis of soluble and membrane fractions of the proteome from MMA- and methanol-grown cultures revealed that an eight-gene cluster (Msil2632 to Msil2639) was induced by MMA and cotranscribed as an operon, as shown by reverse transcription-PCR. GMA-dissimilating enzyme activity was also detected when it was grown on MMA. Formaldehyde and ammonium production from GMA was dependent on glutamate but not on α-ketoglutarate. Marker exchange mutagenesis of a putative GMAS gene homologue (gmas, Msil2635) within this eight-gene cluster, with a kanamycin gene cassette, abolished growth of M. silvestris on MMA as either a sole carbon or a sole nitrogen source. Overall, our results suggest that gmas is essential in MMA metabolism by M. silvestris. PMID:20472738
Chen, Yin; Scanlan, Julie; Song, Lijiang; Crombie, Andrew; Rahman, M Tanvir; Schäfer, Hendrik; Murrell, J Colin
2010-07-01
Methylocella silvestris BL2, a facultative methane utilizer, can grow on monomethylamine (MMA) as a sole carbon and nitrogen source. No activity of MMA dehydrogenase was detectable. Instead, this bacterium utilizes a methylated amino acid pathway (gamma-glutamylmethylamide [GMA] and N-methylglutamate [NMG]) for MMA metabolism. The activities of the two key enzymes in this pathway, GMA synthetase and NMG dehydrogenase, were found when the bacterium was grown on MMA. GMA was detected by high-performance liquid chromatography-mass spectrometry only when the bacterium was grown on MMA but not when it was grown on methanol. Proteomic analysis of soluble and membrane fractions of the proteome from MMA- and methanol-grown cultures revealed that an eight-gene cluster (Msil2632 to Msil2639) was induced by MMA and cotranscribed as an operon, as shown by reverse transcription-PCR. GMA-dissimilating enzyme activity was also detected when it was grown on MMA. Formaldehyde and ammonium production from GMA was dependent on glutamate but not on alpha-ketoglutarate. Marker exchange mutagenesis of a putative GMAS gene homologue (gmas, Msil2635) within this eight-gene cluster, with a kanamycin gene cassette, abolished growth of M. silvestris on MMA as either a sole carbon or a sole nitrogen source. Overall, our results suggest that gmas is essential in MMA metabolism by M. silvestris.
Moyna, Áine; Connolly, Damian; Nesterenko, Ekaterina; Nesterenko, Pavel N; Paull, Brett
2013-03-01
Lauryl methacrylate-co-ethylene dimethacrylate monoliths were polymerised within fused silica capillaries and subsequently photo-grafted with varying amounts of glycidyl methacrylate (GMA). The grafted monoliths were then further modified with iminodiacetic acid (IDA), resulting in a range of chelating ion-exchange monoliths of increasing capacity. The IDA functional groups were attached via ring opening of the epoxy group on the poly(GMA) structure. Increasing the amount of attached poly(GMA), via photo-grafting with increasing concentrations of GMA, from 15 to 35%, resulted in a proportional and controlled increase in the complexation capacity of the chelating monoliths. Scanning capacitively coupled contactless conductivity detection (sC(4)D) was used to characterise and verify homogenous distribution of the chelating ligand along the length of the capillaries non-invasively. Chelation ion chromatographic separations of selected transition and heavy metals were carried out, with retention factor data proportional to the concentration of grafted poly(GMA). Average peak efficiencies of close to 5,000 N/m were achieved, with the isocratic separation of Na, Mg(II), Mn(II), Co(II), Cd(II) and Zn(II) possible on a 250-mm-long monolith. Multiple monolithic columns produced to the same recipes gave RSD data for retention factors of ions). The monolithic chelating ion-exchanger was applied to the separation of alkaline earth and transition metal ions spiked in natural and potable waters.
Computer-based video analysis identifies infants with absence of fidgety movements.
Støen, Ragnhild; Songstad, Nils Thomas; Silberg, Inger Elisabeth; Fjørtoft, Toril; Jensenius, Alexander Refsum; Adde, Lars
2017-10-01
BackgroundAbsence of fidgety movements (FMs) at 3 months' corrected age is a strong predictor of cerebral palsy (CP) in high-risk infants. This study evaluates the association between computer-based video analysis and the temporal organization of FMs assessed with the General Movement Assessment (GMA).MethodsInfants were eligible for this prospective cohort study if referred to a high-risk follow-up program in a participating hospital. Video recordings taken at 10-15 weeks post term age were used for GMA and computer-based analysis. The variation of the spatial center of motion, derived from differences between subsequent video frames, was used for quantitative analysis.ResultsOf 241 recordings from 150 infants, 48 (24.1%) were classified with absence of FMs or sporadic FMs using the GMA. The variation of the spatial center of motion (C SD ) during a recording was significantly lower in infants with normal (0.320; 95% confidence interval (CI) 0.309, 0.330) vs. absence of or sporadic (0.380; 95% CI 0.361, 0.398) FMs (P<0.001). A triage model with C SD thresholds chosen for sensitivity of 90% and specificity of 80% gave a 40% referral rate for GMA.ConclusionQuantitative video analysis during the FMs' period can be used to triage infants at high risk of CP to early intervention or observational GMA.
DSC and Raman studies of silver borotellurite glasses
Kaur, Amandeep; Khanna, Atul; Gonzàlez, Fernando
2016-05-01
Silver borotellurite glasses of composition: xAg2O-yB2O3-(100-x-y)TeO2 (x=20-mol%, y = 0, 10, 20 and 30-mol%) were prepared and characterized by density, X-ray diffraction (XRD), differential scanning calorimetry, and Raman spectroscopy. XRD confirmed the amorphous structure of all samples. Density of glasses decreases while the glass transition temperature increases with increase in B2O3 content from 10 to 30-mol%. Raman study shows that coordination number of Te with oxygen decreases steadily from 3.42 to 3.18 on adding B2O3 due to the transformation of TeO4 into TeO3 units.
Scalability of Parallel Spatial Direct Numerical Simulations on Intel Hypercube and IBM SP1 and SP2
Joslin, Ronald D.; Hanebutte, Ulf R.; Zubair, Mohammad
1995-01-01
The implementation and performance of a parallel spatial direct numerical simulation (PSDNS) approach on the Intel iPSC/860 hypercube and IBM SP1 and SP2 parallel computers is documented. Spatially evolving disturbances associated with the laminar-to-turbulent transition in boundary-layer flows are computed with the PSDNS code. The feasibility of using the PSDNS to perform transition studies on these computers is examined. The results indicate that PSDNS approach can effectively be parallelized on a distributed-memory parallel machine by remapping the distributed data structure during the course of the calculation. Scalability information is provided to estimate computational costs to match the actual costs relative to changes in the number of grid points. By increasing the number of processors, slower than linear speedups are achieved with optimized (machine-dependent library) routines. This slower than linear speedup results because the computational cost is dominated by FFT routine, which yields less than ideal speedups. By using appropriate compile options and optimized library routines on the SP1, the serial code achieves 52-56 M ops on a single node of the SP1 (45 percent of theoretical peak performance). The actual performance of the PSDNS code on the SP1 is evaluated with a "real world" simulation that consists of 1.7 million grid points. One time step of this simulation is calculated on eight nodes of the SP1 in the same time as required by a Cray Y/MP supercomputer. For the same simulation, 32-nodes of the SP1 and SP2 are required to reach the performance of a Cray C-90. A 32 node SP1 (SP2) configuration is 2.9 (4.6) times faster than a Cray Y/MP for this simulation, while the hypercube is roughly 2 times slower than the Y/MP for this application. KEY WORDS: Spatial direct numerical simulations; incompressible viscous flows; spectral methods; finite differences; parallel computing.
Optimization of annealing parameters for the growth of epitaxial Ba2YCu3O7-x films on LaAlO3(100)
International Nuclear Information System (INIS)
Siegal, M.P.; Phillips, J.M.; van Dover, R.B.; Tiefel, T.H.; Marshall, J.H.
1990-01-01
The superconducting and structural properties of Ba 2 YCu 3 O 7-x (BYCO) films on LaAlO 3 (100) substrates can be improved by carefully optimizing the post-deposition annealing parameters. Films are grown by co-deposition of BaF 2 , Y, and Cu in the correct stoichiometric ratio to within 1% of 2:1:3. Annealing parameters in an ex situ furnace, including the ambient, annealing temperature, oxidation temperature, and duration of anneals are systematically studied. Films are characterized for epitaxial quality (χ min ), morphology, critical temperature (T c ), sharpness of the superconducting transition (ΔT), and critical current density (J c ). For example, beyond simply dissociating BaF 2 , the use of wet O 2 appears to prevent the agglomeration of oxides during the initial heating process, and then act to thermodynamically stabilize the basic BYCO film structure at high temperatures after being formed. Comparisons are made with the best single-crystal BYCO structural and electrical data available. The optimized films have relatively smooth morphology with χ min c >90 K, ΔT c >10 6 A/cm 2 in essentially zero magnetic field at 77 K
Inhalation of gas metal arc-stainless steel welding fume promotes lung tumorigenesis in A/J mice.
Falcone, Lauryn M; Erdely, Aaron; Meighan, Terence G; Battelli, Lori A; Salmen, Rebecca; McKinney, Walter; Stone, Samuel; Cumpston, Amy; Cumpston, Jared; Andrews, Ronnee N; Kashon, Michael; Antonini, James M; Zeidler-Erdely, Patti C
2017-08-01
Epidemiologic studies suggest an increased risk of lung cancer with exposure to welding fumes, but controlled animal studies are needed to support this association. Oropharyngeal aspiration of collected "aged" gas metal arc-stainless steel (GMA-SS) welding fume has been shown by our laboratory to promote lung tumor formation in vivo using a two-stage initiation-promotion model. Our objective in this study was to determine whether inhalation of freshly generated GMA-SS welding fume also acts as a lung tumor promoter in lung tumor-susceptible mice. Male A/J mice received intraperitoneal (IP) injections of corn oil or the chemical initiator 3-methylcholanthrene (MCA; 10 µg/g) and 1 week later were exposed by whole-body inhalation to air or GMA-SS welding aerosols for 4 h/d × 4 d/w × 9 w at a target concentration of 40 mg/m 3 . Lung nodules were enumerated at 30 weeks post-initiation. GMA-SS fume significantly promoted lung tumor multiplicity in A/J mice initiated with MCA (16.11 ± 1.18) compared to MCA/air-exposed mice (7.93 ± 0.82). Histopathological analysis found that the increased number of lung nodules in the MCA/GMA-SS group were hyperplasias and adenomas, which was consistent with developing lung tumorigenesis. Metal deposition analysis in the lung revealed a lower deposited dose, approximately fivefold compared to our previous aspiration study, still elicited a significant lung tumorigenic response. In conclusion, this study demonstrates that inhaling GMA-SS welding fume promotes lung tumorigenesis in vivo which is consistent with the epidemiologic studies that show welders may be at an increased risk for lung cancer.
Domènech, Eugeni; Panés, Julián; Hinojosa, Joaquín; Annese, Vito; Magro, Fernando; Sturniolo, Giacomo Carlo; Bossa, Fabrizio; Fernández, Francisco; González-Conde, Benito; García-Sánchez, Valle; Dignass, Axel; Herrera, José Manuel; Cabriada, José Luis; Guardiola, Jordi; Vecchi, Maurizio; Portela, Francisco; Ginard, Daniel
2018-05-25
Steroid-dependency occurs in up to 30% of patients with ulcerative colitis [UC]. In this setting, few drugs have demonstrated efficacy in inducing steroid-free remission. The aim of this study was to evaluate the efficacy and safety of adding granulocyte/monocyte apheresis [GMA] to oral prednisone in patients with steroid-dependent UC. This was a randomized, multicentre, open trial comparing 7 weekly sessions of GMA plus oral prednisone [40 mg/day and tapering] with prednisone alone, in patients with active, steroid-dependent UC [Mayo score 4-10 and inability to withdraw corticosteroids in 3 months or relapse within the first 3 months after discontinuation]. Patients were stratified by concomitant use of thiopurines at inclusion. A 9-week tapering schedule of prednisone was pre-established in both study groups. The primary endpoint was steroid-free remission [defined as a total Mayo score ≤2, with no subscore >1] at Week 24, with no re-introduction of corticosteroids. In all 123 patients were included [63 GMA group, 62 prednisone alone]. In the intention-to-treat analysis, steroid-free remission at Week 24 was achieved in 13% (95% confidence interval [CI] 6-24) in the GMA group and 7% [95% CI 2-16] in the control group [p = 0.11]. In the GMA group, time to relapse was significantly longer (hazard ratio [HR] 1.7 [1.16-2.48], P = 0.005) and steroid-related adverse events were significantly lower [6% vs 20%, P < 0.05]. In a randomized trial, the addition of 7 weekly sessions of GMA to a conventional course of oral prednisone did not increase the proportion of steroid-free remissions in patients with active steroid-dependent UC, though it delayed clinical relapse.
Furnham, Adrian; Crump, John
2013-01-01
In all 794 young people aged around 30 yrs completed three intelligence (Raven's Progressive matrices: GMA Numerical and GMA Verbal) and one personality inventory (16PF). They were all graduates and 173 were identified clearly as Arts graduates and 518 as Science students. There were various sex differences on all measures. All seven hypotheses…
Wang, Yong; Lan, Qingkuo; Zhao, Xin; Xu, Wentao; Li, Feiwu; Wang, Qinying; Chen, Rui
2016-01-01
MicroRNAs (miRNAs) have been widely demonstrated to play fundamental roles in gene regulation in most eukaryotes. To date, there has been no study describing the miRNA composition in genetically modified organisms (GMOs). In this study, small RNAs from dry seeds of two GM soybean lines and their parental cultivars were investigated using deep sequencing technology and bioinformatic approaches. As a result, several differentially expressed gma-miRNAs were found between the GM and non-GM soybeans. Meanwhile, more differentially expressed gma-miRNAs were identified between distantly relatednon-GM soybeans, indicating that the miRNA components of soybean seeds varied among different soybean lines, including the GM and non-GM soybeans, and the extent of difference might be related to their genetic relationship. Additionally, fourteen novel gma-miRNA candidates were predicted in soybean seeds including a potential bidirectionally transcribed miRNA family with two genomic loci (gma-miR-N1). Our findings firstly provided useful data for miRNA composition in edible GM crops and also provided valuable information for soybean miRNA research. PMID:27214227
Directory of Open Access Journals (Sweden)
Yong Wang
Full Text Available MicroRNAs (miRNAs have been widely demonstrated to play fundamental roles in gene regulation in most eukaryotes. To date, there has been no study describing the miRNA composition in genetically modified organisms (GMOs. In this study, small RNAs from dry seeds of two GM soybean lines and their parental cultivars were investigated using deep sequencing technology and bioinformatic approaches. As a result, several differentially expressed gma-miRNAs were found between the GM and non-GM soybeans. Meanwhile, more differentially expressed gma-miRNAs were identified between distantly relatednon-GM soybeans, indicating that the miRNA components of soybean seeds varied among different soybean lines, including the GM and non-GM soybeans, and the extent of difference might be related to their genetic relationship. Additionally, fourteen novel gma-miRNA candidates were predicted in soybean seeds including a potential bidirectionally transcribed miRNA family with two genomic loci (gma-miR-N1. Our findings firstly provided useful data for miRNA composition in edible GM crops and also provided valuable information for soybean miRNA research.
Anirudhan, Thayyath S.; Nima, Jayachandran; Divya, Peethambaran L.
2015-11-01
The present investigation concerns the development and evaluation of a novel drug delivery system, aminated-glycidylmethacrylate grafted cellulose-grafted polymethacrylic acid-succinyl cyclodextrin (Cell-g-(GMA/en)-PMA-SCD) for the controlled release of 5-Fluorouracil, an anticancer drug. The prepared drug carrier was characterized by FT-IR, XRD and SEM techniques. Binding kinetics and isotherm studies of 5-FU onto Cell-g-(GMA/en)-PMA-SCD were found to follow pseudo-second-order and Langmuir model respectively. Maximum binding capacity of drug carrier was found to be 149.09 mg g-1 at 37 °C. Swelling studies, in vitro release kinetics, drug loading efficiency and encapsulation efficiency of Cell-g-(GMA/en)-PMA-SCD were studied. The release kinetics was analyzed using Ritger-Peppas equation at pH 7.4. Cytotoxicity analysis on MCF-7 (human breast carcinoma) cells indicated that the drug carrier shows sustained and controlled release of drug to the target site. Hence, it is evident from this investigation that Cell-g-(GMA/en)-PMA-SCD could be a promising carrier for 5-FU.
Wang, Yong; Lan, Qingkuo; Zhao, Xin; Xu, Wentao; Li, Feiwu; Wang, Qinying; Chen, Rui
2016-01-01
MicroRNAs (miRNAs) have been widely demonstrated to play fundamental roles in gene regulation in most eukaryotes. To date, there has been no study describing the miRNA composition in genetically modified organisms (GMOs). In this study, small RNAs from dry seeds of two GM soybean lines and their parental cultivars were investigated using deep sequencing technology and bioinformatic approaches. As a result, several differentially expressed gma-miRNAs were found between the GM and non-GM soybeans. Meanwhile, more differentially expressed gma-miRNAs were identified between distantly relatednon-GM soybeans, indicating that the miRNA components of soybean seeds varied among different soybean lines, including the GM and non-GM soybeans, and the extent of difference might be related to their genetic relationship. Additionally, fourteen novel gma-miRNA candidates were predicted in soybean seeds including a potential bidirectionally transcribed miRNA family with two genomic loci (gma-miR-N1). Our findings firstly provided useful data for miRNA composition in edible GM crops and also provided valuable information for soybean miRNA research.
Effect of Temperature on Granulocyte and Monocyte Adsorption to Cellulose Acetate Beads.
Nishise, Shoichi; Takeda, Yuji; Abe, Yasuhiko; Sasaki, Yu; Nara, Hidetoshi; Asao, Hironobu; Ueno, Yoshiyuki
2017-06-01
Granulocyte and monocyte (GM) adsorptive apheresis (GMA) is an effective therapy for inflammatory disorders including inflammatory bowel disease (IBD). During GMA, the blood of a patient with IBD passes through a column to contact cellulose acetate (CA) beads at a temperature below body temperature, likely close to room temperature. Here we investigated the effect of temperature on GM adsorption to CA beads in vitro. We incubated peripheral blood with and without CA beads at 5°C, 25°C, 37°C, and 43°C and calculated the ratios of adsorbed GMs. The ratios of adsorbed GMs increased as the temperature was raised. Additionally, we measured complement activation fragment concentrations. C3a and C5a concentrations also increased as the temperature was raised, and C5a concentrations had a positive correlation with the ratios of adsorbed GMs. These results suggest that warming the column during GMA might increase GM adsorption to CA beads, thereby enhancing the clinical efficacy of GMA. © 2017 International Society for Apheresis, Japanese Society for Apheresis, and Japanese Society for Dialysis Therapy.
Thin-film type Li-ion battery, using a polyethylene separator grafted with glycidyl methacrylate
International Nuclear Information System (INIS)
Ko, J.M.; Min, B.G.; Kim, D.-W.; Ryu, K.S.; Kim, K.M.; Lee, Y.G.; Chang, S.H.
2004-01-01
For the improvement of organic electrolyte holding ability, the hydrophobic surface of a porous polyethylene (PE)-membrane separator was modified by grafting a hydrophilic monomer, glycidyl methacrylate (GMA), PE-g-GMA, by using electron beam technology, and applied to a thin film type Li-ion battery to elucidate the effect of a surface modification of a PE membrane separator on the cyclic life of Li-ion batteries. The Li-ion battery using the PE-g-GMA membrane separator showed a better cycle life than that of the unmodified PE membrane separator, indicating that the surface hydrophilicity of the PE membrane separator improved the electrolyte holding capability between the electrodes in the Li-ion cell and prevented the electrolyte leakage
Effect of compatibilizer on impact and morphological analysis of recycled HDPE/PET blends
Energy Technology Data Exchange (ETDEWEB)
Salleh, Mohd Nazry [School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor, Malaysia and School of Materials Engineering, Universiti Malaysia Perlis, 02600 Jejawi, Perlis (Malaysia); Ahmad, Sahrim; Ghani, Mohd Hafizuddin Ab; Chen, Ruey Shan [School of Applied Physics, Faculty of Science and Technology, Universiti Kebangsaan Malaysia, 43600 Bangi, Selangor (Malaysia)
2013-11-27
Blends based on recycled high density polyethylene (rHDPE) and recycled polyethylene terephthalate (rPET) were prepared using a corotating twin screw extruder. PET and HDPE are incompatible polymers and their blends showed poor properties. Compatibilization is a step to obtain blends with good mechanical properties and in this work, ethylene glycidyl methacrylate copolymer (E-GMA) was used as a compatibilizing agent. The effect of blends based on rHDPE and rPET with and without a compatibilizer, E-GMA were examined. From the studies clearly showed that the addition of 5% E-GMA increased the impact strength. SEM analysis of rHDPE/rPET blends confirmed the morphological interaction and improved interfacial bonding between two phases.
Topological phases in Ba-Borate glasses
Holbrook, Chad; Czaja, Andrew; Boolchand, Punit
2015-03-01
Twelve compositions in the (BaO)x(B2O3)100-x pseudo binary, in the 15% Modulated- DSC and Raman scattering experiments were undertaken systematically as function of BaO content (x). Calorimetric measurements reveal Tg(x) to show a broad maximum and the non-reversing enthalpy to show a Gaussian-like reversibility window2, both centered near x = 28%. Raman scattering displays rich lineshapes with modes similar to those observed in Na-Borates2. Modes near 808 cm-1, 770 cm-1, 740 cm-1 and 705 cm-1 are observed, and identified with breathing modes of pure and mixed rings from characteristic structural groupings2. These preliminary results suggest that glasses at x 30% in the flexible phase. Supported by NSF Grant DMR 08-53957.
Purification of yeast alcohol dehydrogenase by using immobilized metal affinity cryogels
International Nuclear Information System (INIS)
Akduman, Begüm; Uygun, Murat; Uygun, Deniz Aktaş; Akgöl, Sinan; Denizli, Adil
2013-01-01
In this study, poly(2-hydroxyethyl methacrylate–glycidylmethacrylate) [poly(HEMA–GMA)] cryogels were prepared by radical cryocopolymerization of HEMA with GMA as a functional comonomer and N,N′-methylene-bisacrylamide (MBAAm) as a crosslinker. Iminodiacetic acid (IDA) functional groups were attached via ring opening of the epoxy group on the poly(HEMA–GMA) cryogels and then Zn(II) ions were chelated with these structures. Characterization of cryogels was performed by FTIR, SEM, EDX and swelling studies. These cryogels have interconnected pores of 30–50 μm size. The equilibrium swelling degree of Zn(II) chelated poly(HEMA–GMA)-IDA cryogels was approximately 600%. Zn(II) chelated poly(HEMA–GMA)-IDA cryogels were used in the adsorption of alcohol dehydrogenase from aqueous solutions and adsorption was performed in continuous system. The effects of pH, alcohol dehydrogenase concentration, temperature, and flow rate on adsorption were investigated. The maximum amount of alcohol dehydrogenase adsorption was determined to be 9.94 mg/g cryogel at 1.0 mg/mL alcohol dehydrogenase concentration and in acetate buffer at pH 5.0 with a flow rate of 0.5 mL/min. Desorption of adsorbed alcohol dehydrogenase was carried out by using 1.0 M NaCI at pH 8.0 phosphate buffer and desorption yield was found to be 93.5%. Additionally, these cryogels were used for purification of alcohol dehydrogenase from yeast with a single-step. The purity of desorbed alcohol dehydrogenase was shown by silver-stained SDS–PAGE. This purification process can successfully be used for the purification of alcohol dehydrogenase from unclarified yeast homogenates and this work is the first report about the usage of the cryogels for purification of alcohol dehydrogenase. - Highlights: • Poly(HEMA–GMA) cryogels were synthesized by radical cryocopolymerization technique. • Prepared cryogels were functionalized with IDA, then Zn(II) ions were chelated to the cryogel. • Zn(II) chelated poly(HEMA–GMA
Purification of yeast alcohol dehydrogenase by using immobilized metal affinity cryogels
Energy Technology Data Exchange (ETDEWEB)
Akduman, Begüm [Chemistry Department, Adnan Menderes University, Aydın (Turkey); Uygun, Murat [Koçarlı Vocational and Training School, Adnan Menderes University, Aydın (Turkey); Uygun, Deniz Aktaş, E-mail: daktas@adu.edu.tr [Chemistry Department, Adnan Menderes University, Aydın (Turkey); Akgöl, Sinan [Biochemistry Department, Ege University, İzmir (Turkey); Denizli, Adil [Chemistry Department, Hacettepe University, Ankara (Turkey)
2013-12-01
In this study, poly(2-hydroxyethyl methacrylate–glycidylmethacrylate) [poly(HEMA–GMA)] cryogels were prepared by radical cryocopolymerization of HEMA with GMA as a functional comonomer and N,N′-methylene-bisacrylamide (MBAAm) as a crosslinker. Iminodiacetic acid (IDA) functional groups were attached via ring opening of the epoxy group on the poly(HEMA–GMA) cryogels and then Zn(II) ions were chelated with these structures. Characterization of cryogels was performed by FTIR, SEM, EDX and swelling studies. These cryogels have interconnected pores of 30–50 μm size. The equilibrium swelling degree of Zn(II) chelated poly(HEMA–GMA)-IDA cryogels was approximately 600%. Zn(II) chelated poly(HEMA–GMA)-IDA cryogels were used in the adsorption of alcohol dehydrogenase from aqueous solutions and adsorption was performed in continuous system. The effects of pH, alcohol dehydrogenase concentration, temperature, and flow rate on adsorption were investigated. The maximum amount of alcohol dehydrogenase adsorption was determined to be 9.94 mg/g cryogel at 1.0 mg/mL alcohol dehydrogenase concentration and in acetate buffer at pH 5.0 with a flow rate of 0.5 mL/min. Desorption of adsorbed alcohol dehydrogenase was carried out by using 1.0 M NaCI at pH 8.0 phosphate buffer and desorption yield was found to be 93.5%. Additionally, these cryogels were used for purification of alcohol dehydrogenase from yeast with a single-step. The purity of desorbed alcohol dehydrogenase was shown by silver-stained SDS–PAGE. This purification process can successfully be used for the purification of alcohol dehydrogenase from unclarified yeast homogenates and this work is the first report about the usage of the cryogels for purification of alcohol dehydrogenase. - Highlights: • Poly(HEMA–GMA) cryogels were synthesized by radical cryocopolymerization technique. • Prepared cryogels were functionalized with IDA, then Zn(II) ions were chelated to the cryogel. • Zn(II) chelated poly(HEMA–GMA
Contact allergy to epoxy (meth)acrylates.
Aalto-Korte, Kristiina; Jungewelter, Soile; Henriks-Eckerman, Maj-Len; Kuuliala, Outi; Jolanki, Riitta
2009-07-01
Contact allergy to epoxy (meth)acrylates, 2,2-bis[4-(2-hydroxy-3-methacryloxypropoxy) phenyl]propane (bis-GMA), 2,2-bis[4-(2-hydroxy-3-acryloxypropoxy)phenyl]-propane (bis-GA), 2,2-bis[4-(methacryl-oxyethoxy)phenyl] propane (bis-EMA), 2,2-bis[4-(methacryloxy)phenyl]-propane (bis-MA), and glycidyl methacrylate (GMA) is often manifested together with contact allergy to diglycidyl ether of bisphenol A (DGEBA) epoxy resin. To analyse patterns of concomitant allergic reactions to the five epoxy (meth)acrylates in relation to exposure. We reviewed the 1994-2008 patch test files at the Finnish Institute of Occupational Health (FIOH) for reactions to the five epoxy (meth)acrylates, and examined the patients' medical records for exposure. Twenty-four patients had an allergic reaction to at least one of the studied epoxy (meth)acrylates, but specific exposure was found only in five patients: two bis-GMA allergies from dental products, two bis-GA allergies from UV-curable printing inks, and one bis-GA allergy from an anaerobic glue. Only 25% of the patients were negative to DGEBA epoxy resin. The great majority of allergic patch test reactions to bis-GMA, bis-GA, GMA and bis-EMA were not associated with specific exposure, and cross-allergy to DGEBA epoxy resin remained a probable explanation. However, independent reactions to bis-GA indicated specific exposure. Anaerobic sealants may induce sensitization not only to aliphatic (meth)acrylates but also to aromatic bis-GA.
Supertoughened renewable PLA reactive multiphase blends system: phase morphology and performance.
Zhang, Kunyu; Nagarajan, Vidhya; Misra, Manjusri; Mohanty, Amar K
2014-08-13
Multiphase blends of poly(lactic acid) (PLA), ethylene-methyl acrylate-glycidyl methacrylate (EMA-GMA) terpolymer, and a series of renewable poly(ether-b-amide) elastomeric copolymer (PEBA) were fabricated through reactive melt blending in an effort to improve the toughness of the PLA. Supertoughened PLA blend showing impact strength of ∼500 J/m with partial break impact behavior was achieved at an optimized blending ratio of 70 wt % PLA, 20 wt % EMA-GMA, and 10 wt % PEBA. Miscibility and thermal behavior of the binary blends PLA/PEBA and PLA/EMA-GMA, and the multiphase blends were also investigated through differential scanning calorimetric (DSC) and dynamic mechanical analysis (DMA). Phase morphology and fracture surface morphology of the blends were studied through scanning electron microscopy (SEM) and atomic force microscopy (AFM) to understand the strong corelation between the morphology and its significant effect on imparting tremendous improvement in toughness. A unique "multiple stacked structure" with partial encapsulation of EMA-GMA and PEBA minor phases was observed for the PLA/EMA-GMA/PEBA (70/20/10) revealing the importance of particular blend composition in enhancing the toughness. Toughening mechanism behind the supertoughened PLA blends have been established by studying the impact fractured surface morphology at different zones of fracture. Synergistic effect of good interfacial adhesion and interfacial cavitations followed by massive shear yielding of the matrix was believed to contribute to the enormous toughening effect observed in these multiphase blends.
GPU accelerated simulations of 3D deterministic particle transport using discrete ordinates method
International Nuclear Information System (INIS)
Gong Chunye; Liu Jie; Chi Lihua; Huang Haowei; Fang Jingyue; Gong Zhenghu
2011-01-01
Graphics Processing Unit (GPU), originally developed for real-time, high-definition 3D graphics in computer games, now provides great faculty in solving scientific applications. The basis of particle transport simulation is the time-dependent, multi-group, inhomogeneous Boltzmann transport equation. The numerical solution to the Boltzmann equation involves the discrete ordinates (S n ) method and the procedure of source iteration. In this paper, we present a GPU accelerated simulation of one energy group time-independent deterministic discrete ordinates particle transport in 3D Cartesian geometry (Sweep3D). The performance of the GPU simulations are reported with the simulations of vacuum boundary condition. The discussion of the relative advantages and disadvantages of the GPU implementation, the simulation on multi GPUs, the programming effort and code portability are also reported. The results show that the overall performance speedup of one NVIDIA Tesla M2050 GPU ranges from 2.56 compared with one Intel Xeon X5670 chip to 8.14 compared with one Intel Core Q6600 chip for no flux fixup. The simulation with flux fixup on one M2050 is 1.23 times faster than on one X5670.
GPU accelerated simulations of 3D deterministic particle transport using discrete ordinates method
Gong, Chunye; Liu, Jie; Chi, Lihua; Huang, Haowei; Fang, Jingyue; Gong, Zhenghu
2011-07-01
Graphics Processing Unit (GPU), originally developed for real-time, high-definition 3D graphics in computer games, now provides great faculty in solving scientific applications. The basis of particle transport simulation is the time-dependent, multi-group, inhomogeneous Boltzmann transport equation. The numerical solution to the Boltzmann equation involves the discrete ordinates ( Sn) method and the procedure of source iteration. In this paper, we present a GPU accelerated simulation of one energy group time-independent deterministic discrete ordinates particle transport in 3D Cartesian geometry (Sweep3D). The performance of the GPU simulations are reported with the simulations of vacuum boundary condition. The discussion of the relative advantages and disadvantages of the GPU implementation, the simulation on multi GPUs, the programming effort and code portability are also reported. The results show that the overall performance speedup of one NVIDIA Tesla M2050 GPU ranges from 2.56 compared with one Intel Xeon X5670 chip to 8.14 compared with one Intel Core Q6600 chip for no flux fixup. The simulation with flux fixup on one M2050 is 1.23 times faster than on one X5670.
Efficacy and safety of granulocyte, monocyte/macrophage adsorptive in pediatric ulcerative colitis
DEFF Research Database (Denmark)
Ruuska, Tarja; Küster, Peter; Grahnquist, Lena
2016-01-01
AIM: To investigate efficacy and safety for granulocyte, monocyte apheresis in a population of pediatric patients with ulcerative colitis. METHODS: The ADAPT study was a prospective, open-label, multicenter study in pediatric patients with moderate, active ulcerative colitis with pediatric...... ulcerative colitis activity index (PUCAI) of 35-64. Patients received one weekly apheresis with Adacolumn(®) granulocyte, monocyte/macrophage adsorptive (GMA) apheresis over 5 consecutive weeks, optionally followed by up to 3 additional apheresis treatments over 3 consecutive weeks. The primary endpoint...... mg daily on average from Baseline to week 12. CONCLUSION: Adacolumn(®) GMA apheresis treatment was effective in pediatric patients with moderate active Ulcerative Colitis. No new safety signals were reported. The present data contribute to considering GMA apheresis as a therapeutic option...
International Nuclear Information System (INIS)
Tong Long; Zu Jianhua; Liu Xinwen; Sun Guisheng; Yu Chunhui
2006-01-01
Glycidyl methacrylate (GMA) was grafted onto HDPE membranes by pre-irradiation method with 1.8 MeV E-beam and a kind of membranes having reactive epoxy groups was successfully synthesized. Effects of monomer concentration, reaction temperature and time and irradiation dose on the grafting yield were studied. Composition, thermo-property and surface morphology of the grafted membranes were studied by FTIR, DSC and Tapping-mode AFM, respectively. The FTIR measurements proved the synthesized copolymer is HDPE-g-GMA. The DSC results indicated the grafted HDPE's melting temperature (T m ) and heat of fusion (ΔH f ( HDPE) ) which was reduced with increasing grafting yield. The AFM images indicated that surface of the HDPE-g-GMA membranes was rougher than the virgin HDPE. (authors)
Directory of Open Access Journals (Sweden)
Ivan José de Santana
2011-09-01
Full Text Available Este artigo descreve a concepção e validação de um modelo matemático direcionado à soldagem GMAW. O modelo permite a predição de alguns parâmetros de soldagem, assim como o comportamento do processo em condições operacionais de transferência metálica por vôo livre. Este modelo foi baseado em um conjunto de equações, que descrevem as características operacionais da fonte de energia, as quedas de tensão que ocorrem no arco elétrico e nos componentes do circuito de soldagem, e em um balanço de energia na ponta do arame. A validação do modelo envolveu testes de soldagem mecanizada em corpos-de-prova de aço baixo carbono, com monitoração da corrente, tensão, comprimento de arco e velocidade de alimentação de arame. O modelo mostrou-se capaz de prever,em diferentes situações, com erros inferiores a 10%, os valores médios de alguns parâmetros fundamentais no processo de soldagem GMAW (valores médios de corrente, tensão e comprimento de arco elétrico, assim como, o comportamento destes na ocorrência de mudanças operacionais.This paper describes the conception and validation of a mathematical model applied to GMA welding. This model allows predicting some welding parameters as well as process behavior for operation with free flight transfer mode. This model was based on a set of equations that describes the power source characteristics, the voltage drop along the electric arc, the welding circuit and the energy balance on the wire tip. The model validation was performed by comparing its results to experimental welding trials. In this test specimen steel of low carbon was used and the parameters welding current and voltage, speed of wire feeding and arc length were monitored. The results have shown that the model is able to correctly predict how different parameters change with alterations in wire feed, in different situations. Furthermore, welding current and voltage e arc length value were predicted with a least
Ruane, P J; Brinson, C; Ramgopal, M; Ryan, R; Coate, B; Cho, M; Kakuda, T N; Anderson, D
2015-05-01
Following antiretroviral therapy failure, patients are often treated with a three-drug regimen that includes two nucleoside/tide reverse transcriptase inhibitors [N(t)RTIs]. An alternative two-drug nucleoside-sparing regimen may decrease the pill burden and drug toxicities associated with the use of N(t)RTIs. The Intelence aNd pRezista Once A Day Study (INROADS; NCT01199939) evaluated the nucleoside-sparing regimen of etravirine 400 mg with darunavir/ritonavir 800/100 mg once-daily in HIV-1-infected treatment-experienced subjects or treatment-naïve subjects with transmitted resistance. In this exploratory phase 2b, single-arm, open-label, multicentre, 48-week study, the primary endpoint was the proportion of subjects who achieved HIV-1 RNA treatment-experienced subjects or treatment-naïve subjects with transmitted resistance was virologically efficacious and well tolerated. © 2014 British HIV Association.
Directory of Open Access Journals (Sweden)
MA Qiang
2016-09-01
Full Text Available An amphiphilic random copolymer of polyglycidyl methacrylate-co-N-vinyl carbazole P(GMA-co-NVC was synthesized by free radical polymerization and was used to noncovalently modify multi-walled carbon nanotubes (MWCNTs. The obtained P(GMA-co-NVC/MWCNTs was mixed with epoxy resin and used to reinforce epoxy resin. Polymer modified carbon nanotubes/epoxy resin composites were prepared by a casting molding method. Tensile test, electrical resistivity test and differential scanning calorimeter(DSC analysis were used to study the effect of polymer modified carbon nanotubes on the mechanical, electrical, and thermal properties of epoxy resin. The results show that the epoxy composite reinforced with P(GMA-co-NVC/MWCNTs shows a remarkable enhancement in both tensile strength and elongation at break compared to either the pure epoxy or the pristine MWCNTs/epoxy composites. In addition, the electrical conductivity of epoxy is significantly improved and the volume resistivity decreases from 1014Ω·m to 106Ω·m with 0.25% mass fraction loading of P(GMA-co-NVC/MWCNTs. Moreover, glass transition temperature of the epoxy composite also increases from 144℃ to 149℃.
Energy Technology Data Exchange (ETDEWEB)
Pan, Hsi-An [Academia Sinica, Institute of Astronomy and Astrophysics (ASIAA), P.O. Box 23-141, Taipei 10617, Taiwan (China); Kuno, Nario, E-mail: hapan@asiaa.sinica.edu.tw [Faculty of Pure and Applied Sciences, University of Tsukuba, 1-1-1 Tennoudai, Tsukuba, Ibaraki 350-8577 (Japan)
2017-04-20
We study the physical properties of giant molecular cloud associations (GMAs) in M100 (NGC 4321) using the ALMA Science Verification feathered (12 m+ACA) data in {sup 12}CO (1–0). To examine the environmental dependence of their properties, GMAs are classified based on their locations in various environments as circumnuclear ring (CNR), bar, spiral, and inter-arm GMAs. The CNR GMAs are massive and compact, while the inter-arm GMAs are diffuse, with low surface density. GMA mass and size are strongly correlated, as suggested by Larson. However, the diverse power-law index of the relation implies that the GMA properties are not uniform among the environments. The CNR and bar GMAs show higher velocity dispersion than those in other environments. We find little evidence for a correlation between GMA velocity dispersion and size, which indicates that the GMAs are in diverse dynamical states. Indeed, the virial parameter of the GMAs spans nearly two orders of magnitude. Only the spiral GMAs are generally self-gravitating. Star formation activity decreases in order over the CNR, spiral, bar, and inter-arm GMAs. The diverse GMA and star formation properties in different environments lead to variations in the Kennicutt–Schmidt relation. A combination of multiple mechanisms or gas phase change is necessary to explain the observed slopes. Comparisons of GMA properties acquired with the use of the 12 m array observations with those from the feathered data are also presented. The results show that the missing flux and extended emission cannot be neglected for the study of environmental dependence.
International Nuclear Information System (INIS)
Shin, Boo Young; Han, Do Hung
2014-01-01
The aim of this study was to compatibilize immiscible polyamide 6 (PA6)/linear low density polyethylene (LLDPE) blend by using electron-beam initiated mediation process. Glycidyl methacrylate (GMA) was chosen as a mediator for cross-copolymerization at the interface between PA6 and LLDPE. The exposure process was carried out to initiate cross-copolymerization by the medium of GMA at the interface between PA and LLDPE. The mixture of the PA6/LLDPE/GMA was prepared by using a twin-screw extruder, and then the mixture was exposed to electron-beam radiation at various doses at room temperature. To investigate the results of this compatibilization strategy, the morphological and mechanical properties of the blend were analyzed. Morphology study revealed that the diameters of the dispersion particles decreased and the interfacial adhesion increased with respect to irradiation doses. The elongation at break of the blends increases significantly with increasing irradiation dose up to 100 kGy while the tensile strength and the modulus increased nonlinearly with increasing irradiation dose. The reaction mechanisms of the mediation process with the GMA mediator at the interface between PA6 and LLDPE were estimated. - Highlights: • PA6/LLDPE blend was compatibilized by the electron-beam initiated mediation process. • Interfacial adhesion was significantly enhanced by the radiation initiated cross-copolymerization. • The elongation at break of blend irradiated at 100 kGy was 4 times higher than PA6. • The GMA as a mediator played a key role in the electron-beam initiated mediation process
Corrosion Behavior of Arc Weld and Friction Stir Weld in Al 6061-T6 Alloys
International Nuclear Information System (INIS)
Yoon, Byoung Hyun; Kim, Heung Ju; Chang, Woong Seong; Kweon, Young Gak
2006-01-01
For the evaluation of corrosion resistance of Al 6061-T6 Alloy, Tafel method and immersion test was performed with Friction Stir Weld(FSW) and Gas Metal Arc Weld(GMAW). The Tafel and immersion test results indicated that GMA weld was severely attacked compared with those of friction stir weld. It may be mainly due to the galvanic corrosion mechanism act on the GMA weld
Bias Magnetic Field of Stack Giant Magnetostrictive Actuator: Design, Analysis, and Optimization
Directory of Open Access Journals (Sweden)
Zhaoshu Yang
2016-01-01
Full Text Available Many novel applications using giant magnetostrictive actuators (GMA require their actuators output bidirectional strokes to be large enough to drive the load. In these cases, the sophisticated method to form such a sufficient bias field with minimum power and bulk consumption should be considered in the principal stage of GMA design. This paper concerns the methodology of bias field design for a specific GMA with stack PMs and GMMs (SGMA: both loop and field models for its bias field are established; the optimization method for given SGMA structure is outlined; a prototype is fabricated to verify the theory. Simulation and test results indicate that the bias field could be exerted more easily using SGMA structure; the modeling and optimization methodology for SGMA is valid in practical design.
AFM study of the morphologic change of HDPE surface photografted with glycidyl methacrylate.
Wang, Huiliang; Han, Jianmei
2009-05-01
The UV-induced grafting of glycidyl methacrylate (GMA) onto high-density polyethylene (HDPE) and the atomic force microscopy (AFM) study of the morphologic change of the grafted surface are reported. The grafting was carried out in GMA acetone solutions with different monomer concentrations. Grafting was much faster in a solution with a higher monomer concentration. FTIR analyses proved that GMA had been successfully grafted onto HDPE. The morphologies of grafted HDPE surfaces changed with UV irradiation time. The monomer concentration had a significant effect on the morphologies of the grafted HDPE surfaces. The HDPE surface grafted in a solution with a higher monomer concentration was much rougher than that grafted in a solution with a lower monomer concentration. The growth models of the grafted granules or clusters are also proposed.
Motor-Driven Giant Magnetostrictive Actuator
DEFF Research Database (Denmark)
Zhang, Lihui; Xia, Yongming; Lu, Kaiyuan
2015-01-01
A typical giant magnetostrictive actuator (GMA) expands a magnetostrictive rod to generate strain by varying the current in the coil that surrounds the magnetostrictive rod. The heat generated by the current deteriorates the GMA performance. In particular, a constant current in the coil is required....... The magnetic field in the iron-gallium alloy (Galfenol), which is a type of magnetostrictive material, is periodically altered by rotating the permanent magnets instead of varying the coil current in the traditional GMA. The proposed MDGMA not only achieves continuous adjustment of the output strain, but can...... also maintain a constant output strain without consuming any power. In addition, the coil-free design releases the new MDGMA from the heat generated by the excitation coil, which allows the MDGMA to work more stably....
CERN. Geneva
2010-01-01
hazards to be avoided About the speaker Jeffrey M Arnold is a Senior Software Engineer in the Intel Compiler and Languages group at Intel Corporation. He has been part of the Digital->Compaq->Intel compiler organization for nearly 20 years; part of that time, he worked on both lo...
Alshali, Ruwaida Z; Salim, Nesreen A; Sung, Rehana; Satterthwaite, Julian D; Silikas, Nick
2015-12-01
The aim of this study was to assess monomer elution from bulk-fill and conventional resin-composites stored in different media using high performance liquid chromatography (HPLC) for up to 3 months. Six bulk-fill (SureFil SDR, Venus Bulk Fill, X-tra base, Filtek Bulk Fill flowable, Sonic Fill, and Tetric EvoCeram Bulk Fill) and eight conventional resin-composites (Grandioso Flow, Venus Diamond Flow, X-Flow, Filtek Supreme XTE, Grandioso, Venus Diamond, TPH Spectrum, and Filtek Z250) were tested. Cylindrical samples (n=5) were immersed in water, 70% ethanol/water solution (70% E/W), and artificial saliva and stored at 37°C for 24h, 1 month, and 3 months. The storage solutions were analysed with HPLC. Data were analysed with repeated measures ANOVA, one-way ANOVA, and Tukey post hoc test at α=0.05. Monomers detected in water and artificial saliva were TEGDMA, DEGDMA, UDMA, and TCD-DI-HEA. No eluted monomers were detected from X-tra base and Sonic fill in these media. All monomers showed a variable extent of elution into 70% E/W with significantly higher amounts than those detected in water and artificial saliva. Significantly higher elution was detected from UDMA-BisEMA based composites compared to BisGMA and BisGMA-BisEMA based systems in 70% E/W. The rate of elution into different media varied between different monomers and was highly dependent on the molecular weight of the eluted compounds. Elution from bulk-fill resin-composites is comparable to that of conventional materials despite their increased increment thickness. Monomer elution is highly dependent on the hydrophobicity of the base monomers and the final network characteristics of the resin-matrix. Copyright © 2015 Academy of Dental Materials. Published by Elsevier Ltd. All rights reserved.
On the periodic orbits of the Third-order differential equation x ' ' '- x ' ' x'- x= F(x,x',x ' ')
Llibre, Jaume
2013-01-01
Agraïments: The second author is partially supported by CAPES/MECD-DGU 222/2010 Brazil and Spain In this paper we study the periodic orbits of the third-order differential equation x''' − µx'' + x' − µx = εF(x, x', x''), where ε is a small parameter and the function F is of class C2.
Good, Walter F.; Herron, John M.; Maitz, Glenn S.; Gur, David; Miller, Stephen L.; Straub, William H.; Fuhrman, Carl R.
1990-08-01
We designed and implemented a high-resolution video workstation as the central hardware component in a comprehensive multi-project program comparing the use of digital and film modalities. The workstation utilizes a 1.8 GByte real-time disk (RCI) capable of storing 400 full-resolution images and two Tektronix (GMA251) display controllers with 19" monitors (GMA2O2). The display is configured in a portrait format with a resolution of 1536 x 2048 x 8 bit, and operates at 75 Hz in a noninterlaced mode. Transmission of data through a 12 to 8 bit lookup table into the display controllers occurs at 20 MBytes/second (.35 seconds per image). The workstation allows easy use of brightness (level) and contrast (window) to be manipulated with a trackball, and various processing options can be selected using push buttons. Display of any of the 400 images is also performed at 20MBytes/sec (.35 sec/image). A separate text display provides for the automatic display of patient history data and for a scoring form through which readers can interact with the system by means of a computer mouse. In addition, the workstation provides for the randomization of cases and for the immediate entry of diagnostic responses into a master database. Over the past year this workstation has been used for over 10,000 readings in diagnostic studies related to 1) image resolution; 2) film vs. soft display; 3) incorporation of patient history data into the reading process; and 4) usefulness of image processing.
Preparation and characterization of boro-tellurite glasses
Kaur, Nirmal; Khanna, Atul; Krishna, P. S. R.
2014-04-01
Glass samples of the system: xB2O3-(100-x) TeO2; x= 15, 20, 25 and 30 mol% were prepared by melt quenching and characterized by X-ray diffraction, density measurements, Differential Scanning Calorimetry and FTIR spectroscopy. XRD confirmed the amorphous structure of all samples. Density of glasses decreased with increase in B2O3 concentration due to the replacement of heavier TeO2 with lighter B2O3 whereas the glass transition temperature increased from 339°C to 366°C; the later effect was due to increase in the concentration of stronger B-O bonds in the glass network. FTIR studies found that BO4 units convert into BO3 with the addition of B2O3.
1983-09-01
duplicate a continuous function on a digital computer, and thus the machine representatic- of the GMA is only a close approximation of the continuous...error process. Thus, the manner in which the GMA process is digitally replicated has an effect on the results of the simulation. The parameterization of...Information Center 2 Cameron Station Alexandria, Virginia 22314 2. Libary , Code 0142 2 Naval Postgraduate School Monterey, California 93943 3. Professor
High performance cone-beam spiral backprojection with voxel-specific weighting
International Nuclear Information System (INIS)
Steckmann, Sven; Knaup, Michael; Kachelriess, Marc
2009-01-01
Cone-beam spiral backprojection is computationally highly demanding. At first sight, the backprojection requirements are similar to those of cone-beam backprojection from circular scans such as it is performed in the widely used Feldkamp algorithm. However, there is an additional complication: the illumination of each voxel, i.e. the range of angles the voxel is seen by the x-ray cone, is a complex function of the voxel position. In general, one needs to multiply a voxel-specific weight w(x, y, z, α) prior to adding a projection from angle α to a voxel at position x, y, z. Often, the weight function has no analytically closed form and must be numerically determined. Storage of the weights is prohibitive since the amount of memory required equals the number of voxels per spiral rotation times the number of projections a voxel receives contributions and therefore is in the order of up to 10 12 floating point values for typical spiral scans. We propose a new algorithm that combines the spiral symmetry with the ability of today's 64 bit operating systems to store large amounts of precomputed weights, even above the 4 GB limit. Our trick is to backproject into slices that are rotated in the same manner as the spiral trajectory rotates. Using the spiral symmetry in this way allows one to exploit data-level paralellism and thereby to achieve a very high level of vectorization. An additional postprocessing step rotates these slices back to normal images. Our new backprojection algorithm achieves up to 17 giga voxel updates per second on our systems that are equipped with four standard Intel X7460 hexa core CPUs (Intel Xeon 7300 platform, 2.66 GHz, Intel Corporation). This equals the reconstruction of 344 images per second assuming that each slice consists of 512 x 512 pixels and receives contributions from 512 projections. Thereby, it is an order of magnitude faster than a highly optimized code that does not make use of the spiral symmetry. In its present version, the
Scalable Architectures : The Future is Multicore
Juurlink, B.; Meenderinck, C.
2008-01-01
“The future is multicore”, it sounds like a slogan from an Intel commercial. Indeed, a few years ago Intel introduced the Core Duo microprocessor and, more recently, quad-core technology. But, is it all pure marketing? Was Intel tired of advertising with clock frequencies? Did they need another buzz
2000-04-01
be an extension of Utah’s nascent Quarks system, oriented to closely coupled cluster environments. However, the grant did not actually begin until... Intel x86, implemented ten virtual machine monitors and servers, including a virtual memory manager, a checkpointer, a process manager, a file server...Fluke, we developed a novel hierarchical processor scheduling frame- work called CPU inheritance scheduling [5]. This is a framework for scheduling
Directory of Open Access Journals (Sweden)
Karlsson Mats
2010-07-01
Full Text Available Abstract Background Patients with IBD and chronic inflammation refractory to conventional therapy often demonstrate higher risk of serious complications. Combinations of immunosuppression and biological treatment as well as surgical intervention are often used in this patient group. Hence, there is need for additional treatment options. In this observational study, focused on re-treatment and long-term results, Granulocyte/Monocyte Adsorption (GMA, Adacolumn® treatment has been investigated to study efficacy, safety and quality of life in IBD-patients with chronic activity. Methods Fifteen patients with ulcerative colitis and 25 patients with Crohn's disease, both groups with chronically active inflammation refractory to conventional medication were included in this observational study. The patients received 5-10 GMA sessions, and the clinical activity was assessed at baseline, after each completed course, and at week 10 and 20 by disease activity index, endoscopy and quality of life evaluation. Relapsed patients were re-treated by GMA in this follow-up study up to 58 months. Results Clinical response was seen in 85% and complete remission in 65% of the patients. Ten patients in the UC-group (66% and 16 patients in the CD-group (64% maintained clinical and endoscopic remission for an average of 14 months. Fourteen patients who relapsed after showing initial remission were re-treated with GMA and 13 (93% went into a second remission. Following further relapses, all of seven patients were successfully re-treated for the third time, all of three patients for the fourth time and one for a fifth time. Conclusions IBD-patients with chronic inflammation despite conventional therapy seem to benefit from GMA. Re-treatment of relapsing remission patients seems to be effective.
Girish, C K; Smith, T K; Boermans, H J; Karrow, N A
2008-03-01
An experiment was conducted to investigate the effects of feeding blends of grains naturally contaminated with Fusarium mycotoxins on performance, hematology, metabolism, and immunological parameters of turkeys. The efficacy of polymeric glucomannan mycotoxin adsorbent (GMA) in preventing these adverse effects was also evaluated. Three hundred 1-d-old male turkey poults were fed wheat-, corn-, and soybean meal-based starter (0 to 3 wk), grower (4 to 6 wk), developer (7 to 9 wk), and finisher (10 to 12 wk) diets formulated with uncontaminated grains, contaminated grains, and contaminated grains + 0.2% GMA. Feeding contaminated grains significantly decreased BW gains during the grower and developer phases, and GMA supplementation prevented these effects. There was no effect of diet, however, on feed intake or feed efficiency. The feeding of contaminated grains reduced total lymphocyte counts at wk 3 (P effect. Feeding contaminated grains significantly increased the percentage of CD4(+) lymphocyte populations during wk 6; however, there was no change in the percentage of CD8(+) and B-lymphocyte populations. Contact hypersensitivity to dinitrochlorobenzene, which is a CD8(+) T cell-mediated delayed-type hypersensitivity response, was significantly decreased after 24 and 72 h by feedborne mycotoxins compared with controls. Supplementation of the contaminated diet with GMA prevented the decrease in response after 24 h. Secondary antibody (IgG titer) response against SRBC antigens (CD4(+) T cell-dependent) was significantly decreased after feeding contaminated grains compared with controls. It was concluded that turkey performance and some blood and immunological parameters were adversely affected by feedborne Fusarium mycotoxins, and GMA prevented many of these effects.
Pozo, Carlos; Marín-Sanguino, Alberto; Alves, Rui; Guillén-Gosálbez, Gonzalo; Jiménez, Laureano; Sorribas, Albert
2011-08-25
Design of newly engineered microbial strains for biotechnological purposes would greatly benefit from the development of realistic mathematical models for the processes to be optimized. Such models can then be analyzed and, with the development and application of appropriate optimization techniques, one could identify the modifications that need to be made to the organism in order to achieve the desired biotechnological goal. As appropriate models to perform such an analysis are necessarily non-linear and typically non-convex, finding their global optimum is a challenging task. Canonical modeling techniques, such as Generalized Mass Action (GMA) models based on the power-law formalism, offer a possible solution to this problem because they have a mathematical structure that enables the development of specific algorithms for global optimization. Based on the GMA canonical representation, we have developed in previous works a highly efficient optimization algorithm and a set of related strategies for understanding the evolution of adaptive responses in cellular metabolism. Here, we explore the possibility of recasting kinetic non-linear models into an equivalent GMA model, so that global optimization on the recast GMA model can be performed. With this technique, optimization is greatly facilitated and the results are transposable to the original non-linear problem. This procedure is straightforward for a particular class of non-linear models known as Saturable and Cooperative (SC) models that extend the power-law formalism to deal with saturation and cooperativity. Our results show that recasting non-linear kinetic models into GMA models is indeed an appropriate strategy that helps overcoming some of the numerical difficulties that arise during the global optimization task.
Directory of Open Access Journals (Sweden)
Sorribas Albert
2011-08-01
Full Text Available Abstract Background Design of newly engineered microbial strains for biotechnological purposes would greatly benefit from the development of realistic mathematical models for the processes to be optimized. Such models can then be analyzed and, with the development and application of appropriate optimization techniques, one could identify the modifications that need to be made to the organism in order to achieve the desired biotechnological goal. As appropriate models to perform such an analysis are necessarily non-linear and typically non-convex, finding their global optimum is a challenging task. Canonical modeling techniques, such as Generalized Mass Action (GMA models based on the power-law formalism, offer a possible solution to this problem because they have a mathematical structure that enables the development of specific algorithms for global optimization. Results Based on the GMA canonical representation, we have developed in previous works a highly efficient optimization algorithm and a set of related strategies for understanding the evolution of adaptive responses in cellular metabolism. Here, we explore the possibility of recasting kinetic non-linear models into an equivalent GMA model, so that global optimization on the recast GMA model can be performed. With this technique, optimization is greatly facilitated and the results are transposable to the original non-linear problem. This procedure is straightforward for a particular class of non-linear models known as Saturable and Cooperative (SC models that extend the power-law formalism to deal with saturation and cooperativity. Conclusions Our results show that recasting non-linear kinetic models into GMA models is indeed an appropriate strategy that helps overcoming some of the numerical difficulties that arise during the global optimization task.
Maliszewska, Iwona; Krusiec-Swidergoł, Beata; Kasicka-Jonderko, Anna; Jonderko, Krzysztof; Błońska-Fajfrowska, Barbara
2007-01-01
The study was devoted to determine the incidence of an abnormal gastric myoelectrical activity (GMA) in children suffering from recurrent abdominal pain. Surface electrogastrograms were taken in the interdigestive state and after a meal stimulation in 187 children referred to the laboratory with the diagnosis of recurrent abdominal pain. The cohort comprised the following subgroups: age 6-11 years (33 boys and 36 girls), age 12-18 years (28 boys and 90 girls). Continuous variables characterizing quantitatively an electrogastrogram were recoded into categorical data sets, which were used further for construction of an arbitrary scale reflecting disturbances of an electrogastrographic recording: score 0--normal, score 1-2, 3-4, and 5-6 corresponding to a light, moderate, and severe disturbance of the GMA. Abnormal electrogastrograms were found in just over a half of the examined children (54.5%). Nevertheless, light abnormalities (score 1-2) were predominant--42.8% of the whole cohort. Moderate abnormalities were revealed in almost every eight patient (11.8%), whereas no case of severely disturbed GMA was disclosed. On the other hand as much as 45.5% children did not exhibit any abnormality of the electrogastrogram. No statistically significant differences were found when the frequency distributions of particular degrees of the GMA disturbance were compared among groups of different age and gender. A disclosure that an abnormal electrogastrogram is encountered in just over a half of the patients and the predominance of light disturbances within this group, implies that disturbed GMA is neither an inherent nor a pathognomonic pathological finding of the clinical picture of recurrent abdominal pain in children.
In vivo genotoxicity assessment of acrylamide and glycidyl methacrylate.
Dobrovolsky, Vasily N; Pacheco-Martinez, M Monserrat; McDaniel, L Patrice; Pearce, Mason G; Ding, Wei
2016-01-01
Acrylamide (ACR) and glycidyl methacrylate (GMA) are structurally related compounds used for making polymers with various properties. Both chemicals can be present in food either as a byproduct of processing or a constituent of packaging. We performed a comprehensive evaluation of ACR and GMA genotoxicity in Fisher 344 rats using repeated gavage administrations. Clastogenicity was measured by scoring micronucleated (MN) erythrocytes from peripheral blood, DNA damage in liver, bone marrow and kidneys was measured using the Comet assay, and gene mutation was measured using the red blood cell (RBC) and reticulocyte Pig-a assay. A limited histopathology evaluation was performed in order to determine levels of cytotoxicity. Doses of up to 20 mg/kg/day of ACR and up to 250 mg/kg/day of GMA were used. ACR treatment resulted in DNA damage in the liver, but not in the bone marrow. While ACR was not a clastogen, it was a weak (equivocal) mutagen in the cells of bone marrow. GMA caused DNA damage in the cells of bone marrow, liver and kidney, and induced MN reticulocytes and Pig-a mutant RBCs in a dose-dependent manner. Collectively, our data suggest that both compounds are in vivo genotoxins, but the genotoxicity of ACR is tissue specific. Published by Elsevier Ltd.
ZDS - a computer program for analysis of X-ray powder diffraction patterns
International Nuclear Information System (INIS)
Ondrus, P.
1993-01-01
The ZDS system creates an integrated environment of procedures for complete and precise analysis of raw powder diffraction patterns. The basis of the ZDS system is a graphic control centre for easy and user-friendly application of all included procedures. It offers a number of application procedures without an interaction with any data base. The program operates either in an automatic or manual mode. The manual mode makes possible specialized applications. The input and output of the data are compatible with Philips and Siemens powder diffraction software. The ZDS system runs with Intel 80286 or 80386-based PC computers with or without math-coprocesor. (orig.)
Cognitive Medical Wireless Testbed System (COMWITS)
2016-11-01
Number: ...... ...... Sub Contractors (DD882) Names of other research staff Inventions (DD882) Scientific Progress This testbed merges two ARO grants...bit 64 bit CPU Intel Xeon Processor E5-1650v3 (6C, 3.5 GHz, Turbo, HT , 15M, 140W) Intel Core i7-3770 (3.4 GHz Quad Core, 77W) Dual Intel Xeon
Parallel Kalman filter track fit based on vector classes
Energy Technology Data Exchange (ETDEWEB)
Kisel, Ivan [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH (Germany); Kretz, Matthias [Kirchhoff-Institut fuer Physik, Ruprecht-Karls Universitaet, Heidelberg (Germany); Kulakov, Igor [Goethe-Universitaet, Frankfurt am Main (Germany); National Taras Shevchenko University, Kyiv (Ukraine)
2010-07-01
Modern high energy physics experiments have to process terabytes of input data produced in particle collisions. The core of the data reconstruction in high energy physics is the Kalman filter. Therefore, developing the fast Kalman filter algorithm, which uses maximum available power of modern processors, is important, in particular for initial selection of events interesting for the new physics. One of processors features, which can speed up the algorithm, is a SIMD instruction set, which allows to pack several data items in one register and operate on all of them in one go, thus achieving more operations per clock cycle. Therefore a flexible and useful interface, which uses the SIMD instruction set on different CPU and GPU processors architectures, has been realized as a vector classes library. The Kalman filter based track fitting algorithm has been implemented with use of the vector classes. Fitting quality tests show good results with the residuals equal to 49 {mu}m and 44 {mu}m for x and y track parameters and relative momentum resolution of 0.7%. The fitting time of 0.053 {mu}s per track has been achieved on Intel Xeon X5550 with 8 cores at 2.6 GHz by using in addition Intel Threading Building Blocks.
Upper Atmosphere Research Report Number 4
1947-10-01
pressurized fittings and Dow Corning No. 4 ignition sealing compound . The turnstile antenna is mounted on fin I of the V-2 in the same way as was the...with a servo-operated parabolic reflector, and a rearrangement of the ground station together with an accom- panying revision of the operating... COLLECTOR . w Q O X I- < H (ZERO INPUT SIGNAL) (POINT E) 62 V. 3000 3100 3£00 1 (p) DIRECTION OF MOD FOli POSITIVE IN VSIGNAL ’UT IV
Hadade, Ioan; di Mare, Luca
2016-08-01
Modern multicore and manycore processors exhibit multiple levels of parallelism through a wide range of architectural features such as SIMD for data parallel execution or threads for core parallelism. The exploitation of multi-level parallelism is therefore crucial for achieving superior performance on current and future processors. This paper presents the performance tuning of a multiblock CFD solver on Intel SandyBridge and Haswell multicore CPUs and the Intel Xeon Phi Knights Corner coprocessor. Code optimisations have been applied on two computational kernels exhibiting different computational patterns: the update of flow variables and the evaluation of the Roe numerical fluxes. We discuss at great length the code transformations required for achieving efficient SIMD computations for both kernels across the selected devices including SIMD shuffles and transpositions for flux stencil computations and global memory transformations. Core parallelism is expressed through threading based on a number of domain decomposition techniques together with optimisations pertaining to alleviating NUMA effects found in multi-socket compute nodes. Results are correlated with the Roofline performance model in order to assert their efficiency for each distinct architecture. We report significant speedups for single thread execution across both kernels: 2-5X on the multicore CPUs and 14-23X on the Xeon Phi coprocessor. Computations at full node and chip concurrency deliver a factor of three speedup on the multicore processors and up to 24X on the Xeon Phi manycore coprocessor.
Energy Technology Data Exchange (ETDEWEB)
Souris, K; Lee, J; Sterpin, E [Universite catholique de Louvain, Brussels (Belgium)
2014-06-15
Purpose: Recent studies have demonstrated the capability of graphics processing units (GPUs) to compute dose distributions using Monte Carlo (MC) methods within clinical time constraints. However, GPUs have a rigid vectorial architecture that favors the implementation of simplified particle transport algorithms, adapted to specific tasks. Our new, fast, and multipurpose MC code, named MCsquare, runs on Intel Xeon Phi coprocessors. This technology offers 60 independent cores, and therefore more flexibility to implement fast and yet generic MC functionalities, such as prompt gamma simulations. Methods: MCsquare implements several models and hence allows users to make their own tradeoff between speed and accuracy. A 200 MeV proton beam is simulated in a heterogeneous phantom using Geant4 and two configurations of MCsquare. The first one is the most conservative and accurate. The method of fictitious interactions handles the interfaces and secondary charged particles emitted in nuclear interactions are fully simulated. The second, faster configuration simplifies interface crossings and simulates only secondary protons after nuclear interaction events. Integral depth-dose and transversal profiles are compared to those of Geant4. Moreover, the production profile of prompt gammas is compared to PENH results. Results: Integral depth dose and transversal profiles computed by MCsquare and Geant4 are within 3%. The production of secondaries from nuclear interactions is slightly inaccurate at interfaces for the fastest configuration of MCsquare but this is unlikely to have any clinical impact. The computation time varies between 90 seconds for the most conservative settings to merely 59 seconds in the fastest configuration. Finally prompt gamma profiles are also in very good agreement with PENH results. Conclusion: Our new, fast, and multi-purpose Monte Carlo code simulates prompt gammas and calculates dose distributions in less than a minute, which complies with clinical time
International Nuclear Information System (INIS)
Souris, K; Lee, J; Sterpin, E
2014-01-01
Purpose: Recent studies have demonstrated the capability of graphics processing units (GPUs) to compute dose distributions using Monte Carlo (MC) methods within clinical time constraints. However, GPUs have a rigid vectorial architecture that favors the implementation of simplified particle transport algorithms, adapted to specific tasks. Our new, fast, and multipurpose MC code, named MCsquare, runs on Intel Xeon Phi coprocessors. This technology offers 60 independent cores, and therefore more flexibility to implement fast and yet generic MC functionalities, such as prompt gamma simulations. Methods: MCsquare implements several models and hence allows users to make their own tradeoff between speed and accuracy. A 200 MeV proton beam is simulated in a heterogeneous phantom using Geant4 and two configurations of MCsquare. The first one is the most conservative and accurate. The method of fictitious interactions handles the interfaces and secondary charged particles emitted in nuclear interactions are fully simulated. The second, faster configuration simplifies interface crossings and simulates only secondary protons after nuclear interaction events. Integral depth-dose and transversal profiles are compared to those of Geant4. Moreover, the production profile of prompt gammas is compared to PENH results. Results: Integral depth dose and transversal profiles computed by MCsquare and Geant4 are within 3%. The production of secondaries from nuclear interactions is slightly inaccurate at interfaces for the fastest configuration of MCsquare but this is unlikely to have any clinical impact. The computation time varies between 90 seconds for the most conservative settings to merely 59 seconds in the fastest configuration. Finally prompt gamma profiles are also in very good agreement with PENH results. Conclusion: Our new, fast, and multi-purpose Monte Carlo code simulates prompt gammas and calculates dose distributions in less than a minute, which complies with clinical time
Stoupel, Eliiyahu; Radishauskas, Richardas; Bernotiene, Gailute; Tamoshiunas, Abdonas; Virvichiute, Daiva
2018-02-05
Many biological processes are influenced by space weather activity components such as solar activity (SA), geomagnetic activity (GMA) and cosmic ray activity (CRA). Examples are total mortality, acute myocardial infarction (AMI), stroke (cerebrovascular accident), sudden cardiac death, some congenital maladies (congenital heart disease and Down syndrome), many events in neonatology, ophtalmology, blood pressure regulation, blood coagulation, inflammation, etc. The aim of this study was to check if the level of blood troponins (Tns) - markers of myocardial damage and recognized components of modern description of AMI - is connected with the mentioned space weather parameters. Patients admitted to a 3000-bed tertiary university hospital in Kaunas, Lithuania, with suspected AMI were the object of the study. Data for the time between 2008 and 2013 - 72 consecutive months - were studied. Of the patients, 1896 (1398 male, 498 female) had elevated troponin I (Tn I) or troponin T (Tn T, sensitive Tn) levels. Normal values were 0.00-0.03 ng/mL for Tn I and 0.00-14.00 ng/mL for Tn T. Monthly means and standard deviation of Tn I and Tn T were compared with monthly markers of SA, GMA and CRA. Pearson correlation coefficients and their probabilities were established (in addition to the consecutive graphs of both comparing physical and biological data). The cosmophysical data came from space service institutions in the United States, Russia and Finland. AMI was diagnosed in 1188 patients (62.66%), and intermediate coronary syndrome in 698 patients (36.81%). There were significant links of the Tn blood levels with four SA indices and CRA (neutron activity in imp/min); there was no significant correlation with GMA indices Ap and Cp (p=0.27 and p=0.235). Tn T levels significantly correlated with the GMA indices and not with the SA and CRA levels (Ap: r=0.77, p=0.0021; Cp: r=0.729, p=0.0047). First, the monthly level of blood Tn I in ACS is significantly correlated with the indices
International Nuclear Information System (INIS)
Ferreira, Maiara S.; Sartori, Mariana N.; Oliveira, Rene R.; Guven, Olgun; Moura, Esperidiana A.B.
2014-01-01
Graphical abstract: - Highlights: • HDPE reinforced with short piassava fiber composites were prepared by melt-mixing processing. • Glycidyl methacrylate (GMA) was tested as a radiation cross-linking agent. • The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. • The better interfacial adhesion between fiber and HDPE matrix was observed for composites with GMA addition irradiated with radiation dose of 200 kGy. - Abstract: The effects of electron-beam radiation treatment on fiber-matrix adhesion and mechanical properties of short piassava fibers reinforced high density polyethylene (HDPE) matrix were studied. Glycidyl methacrylate (GMA) was added at 2.5% and 5.0% (on piassava fiber wt) as a cross-linking agent and the effects upon the properties of the resulting composites treated by electron-beam radiation were also examined. HDPE reinforced with short piassava fiber composites was prepared by melt-mixing processing, using a twin screw extruder machine. The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. Material samples were submitted to mechanical and thermo-mechanical tests and SEM analyses. Correlation between properties was discussed. The comparison of mechanical and thermo-mechanical properties of the composites showed that electron-beam radiation treatment produced a significant improvement in mechanical properties, when compared with the non-irradiated composite sample and neat HDPE. Scanning electron microscopy (SEM) studies of the composite failure surfaces indicated that there was an improved adhesion between fiber and matrix. Examination of the failure surfaces indicated dependence of the interfacial adhesion upon the radiation dose and GMA content. Better interfacial adhesion between fiber and HDPE matrix was observed for composites with 5.0% GMA addition and treated with electron
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Maiara S.; Sartori, Mariana N.; Oliveira, Rene R. [Nuclear and Energy Research Institute, IPEN-CNEN/SP, Av. Prof. Lineu Prestes 2242, zip code 05508-000 São Paulo, SP (Brazil); Guven, Olgun [Hacettepe University, Department of Chemistry, Polymer Chemistry Division, Beytepe, zip code 06800 Ankara (Turkey); Moura, Esperidiana A.B., E-mail: eabmoura@ipen.br [Nuclear and Energy Research Institute, IPEN-CNEN/SP, Av. Prof. Lineu Prestes 2242, zip code 05508-000 São Paulo, SP (Brazil)
2014-08-15
Graphical abstract: - Highlights: • HDPE reinforced with short piassava fiber composites were prepared by melt-mixing processing. • Glycidyl methacrylate (GMA) was tested as a radiation cross-linking agent. • The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. • The better interfacial adhesion between fiber and HDPE matrix was observed for composites with GMA addition irradiated with radiation dose of 200 kGy. - Abstract: The effects of electron-beam radiation treatment on fiber-matrix adhesion and mechanical properties of short piassava fibers reinforced high density polyethylene (HDPE) matrix were studied. Glycidyl methacrylate (GMA) was added at 2.5% and 5.0% (on piassava fiber wt) as a cross-linking agent and the effects upon the properties of the resulting composites treated by electron-beam radiation were also examined. HDPE reinforced with short piassava fiber composites was prepared by melt-mixing processing, using a twin screw extruder machine. The materials were irradiated with 100 and 200 kGy using a 1.5 MeV electron beam accelerator, at room temperature in presence of air. Material samples were submitted to mechanical and thermo-mechanical tests and SEM analyses. Correlation between properties was discussed. The comparison of mechanical and thermo-mechanical properties of the composites showed that electron-beam radiation treatment produced a significant improvement in mechanical properties, when compared with the non-irradiated composite sample and neat HDPE. Scanning electron microscopy (SEM) studies of the composite failure surfaces indicated that there was an improved adhesion between fiber and matrix. Examination of the failure surfaces indicated dependence of the interfacial adhesion upon the radiation dose and GMA content. Better interfacial adhesion between fiber and HDPE matrix was observed for composites with 5.0% GMA addition and treated with electron
International Nuclear Information System (INIS)
2000-01-01
In 1999, GMA executed a major shift in its business strategy and operations by selling its geophysical and geological software assets and by entering into broad based technology markets with potential sales growth in North America and internationally. The decision to diversify the company's client base followed the slowdown in the oil and gas industry in 1998 and 1999, forcing many of the company's clients to cut budgets in order to survive. The new business strategy enables GMA to concentrate on delivering software and service solutions across a wide-range of non-cyclical industries, giving the company greater access to growth markets, less susceptibility to industry down cycles and increased applications of research and development results. To give effect to the new strategy, GMA in 1999 acquired 100 per cent of a high volume virtual data management company (NRI Online Inc), 100 per cent of a newspaper circulation management software company (NTI Newspaper Technologies Inc). GMA also acquired the remaining outstanding shares of a private Alberta company which developed petrophysical software for the oil and gas industry. Through NRI's Computerized On-Line Interactive Network (COIN) GMA, to be renamed Netdriven Solutions Inc., intends to enter the Canadian oil and gas seismic data niche market by providing storage and management of large volume data sets in an on-line network environment, with high speed fibre optic communications links. Current NRI clients include Talisman Energy, Mobil Oil, Anderson Exploration, Suncor Energy , and others. The long-term goal is to expand NRI's oil and gas client base from Calgary to other national and international oil and gas regions. GMA had revenues from its combined operation in Canada, the USA and Europe of $ 5.7 million in 1999, derived from a combination of geophysical and geological software sales, maintenance contracts and geophysical consulting services. Revenues from software sale alone are down, due to the cutbacks
Energy Technology Data Exchange (ETDEWEB)
Reichl, Franz-Xaver [Walther-Straub-Institute of Pharmacology and Toxicology, Munich (Germany); Ludwig-Maximilians-University, Department of Operative Dentistry and Periodontology, Munich (Germany); Esters, Magali; Simon, Sabine; Seiss, Mario [Walther-Straub-Institute of Pharmacology and Toxicology, Munich (Germany); Kehe, Kai [Bundeswehr Institute of Pharmacology and Toxicology, Munich (Germany); Kleinsasser, Norbert [University of Regensburg, Head and Neck Surgery, Department of Otolaryngology, Regensburg (Germany); Folwaczny, Matthias; Glas, Juergen; Hickel, Reinhard [Ludwig-Maximilians-University, Department of Operative Dentistry and Periodontology, Munich (Germany)
2006-06-15
In order to test the hypothesis that released dental restorative materials can reach toxic levels in human oral tissues, the cytotoxicities of the resin-based dental (co)monomers hydroxyethylmethacrylate (HEMA), triethyleneglycoldimethacrylate (TEGDMA), urethanedimethacrylate (UDMA), and bisglycidylmethacrylate (BisGMA) compared with methyl mercury chloride (MeHgCl) and the amalgam component mercuric chloride (HgCl{sub 2}) were investigated on human gingival fibroblasts (HGF) using two different test systems: (1) the modified XTT-test and (2) the modified H 33342 staining assay. The HGF were exposed to various concentrations of the test-substances in all test systems for 24 h. All tested (co)monomers and mercury compounds significantly (P<0.05) decreased the formazan formation in the XTT-test. EC{sub 50} values in the XTT assay were obtained as half-maximum-effect concentrations from fitted curves. Following EC{sub 50} values were found (mean [mmol/l]; s.e.m. in parentheses; n=12; * significantly different to HEMA): HEMA 11.530 (0.600); TEGDMA* 3.460 (0.200); UDMA* 0.106 (0.005); BisGMA* 0.087 (0.001); HgCl{sub 2}* 0.013 (0.001); MeHgCl* 0.005 (0.001). Following relative toxicities were found: HEMA 1; TEGDMA 3; UDMA 109; BisGMA 133; HgCl{sub 2} 887; MeHgCl 2306. A significant (P<0.05) increase of the toxicity of (co)monomers and mercurials was found in the XTT-test in the following order: HEMA < TEGDMA < UDMA < BisGMA < HgCl{sub 2} < MeHgCl. TEGDMA and MeHgCl induced mainly apoptotic cell death. HEMA, UDMA, BisGMA, and HgCl{sub 2} induced mainly necrotic cell death. The results of this study indicate that resin composite components have a lower toxicity than mercury from amalgam in HGF. HEMA, BisGMA, UDMA, and HgCl{sub 2} induced mainly necrosis, but it is rather unlikely that eluted substances (solely) can reach concentrations, which might induce necrotic cell death in the human physiological situation, indicating that other (additional) factors may be involved in
CXCL12 Promotes Stem Cell Recruitment and Uterine Repair after Injury in Asherman’s Syndrome
Directory of Open Access Journals (Sweden)
Gulcin Sahin Ersoy
2017-03-01
Full Text Available Asherman’s syndrome is an acquired condition of uterine fibrosis and adhesions in response to injury that adversely affects fertility and pregnancy. We have previously demonstrated that bone marrow-derived mesenchymal stem cells (BMDSCs contribute to uterine repair after injury and that stem cells supplementation improves fertility. Here, we demonstrate that CXCL12 is the chemokine that mediates stem cell engraftment and functional improvement using a murine model of Asherman’s syndrome. After uterine injury, we demonstrate that CXCL12 augmentation increased BMDSC engraftment and that the CXCL12 receptor (CXCR4 antagonist, ADM3100, blocked stem cell recruitment. CXCL12 reduced, whereas ADM3100 increased fibrosis. CXCL12 treatment led to improved fertility and litter size, whereas ADM3100 treatment reduced fertility and litter size. ADM3100 prevented optimal spontaneous uterine repair mediated by endogenous CXCL12 production, reducing pregnancies after injury in the absence of supplemental CXCL12 administration; however, ADM3100 treatment could be partially rescued by CXCL12 augmentation. CXCL12 or other CXCR4 receptor agonists may be useful in the treatment of infertility or adverse pregnancy outcomes in Asherman’s syndrome and other related uterine disorders.
International Nuclear Information System (INIS)
Yesil, Sertan
2013-01-01
Highlights: • Mechanical properties of r-PET improved with addition of PEN, elastomers and CNT. • Elastomer size and dispersion played important role in the variation of properties. • Selective localization of CNT affected the mechanical and electrical properties. • E-EA-MAH based samples had higher mechanical properties than E-MA-GMA based ones. - Abstract: In this study, the mechanical, thermomechanical, thermal, electrical properties and the morphology of the composites, based on blends of recycled poly(ethylene terephthalate) (r-PET) and poly(ethylene naphthalate) (PEN) that were mixed with functional elastomers and multi walled carbon nanotube (CNT) were investigated. Two types of functional elastomers; terpolymer of ethylene–ethyl acrylate–maleic anhydride (E-EA-MAH) and terpolymer of ethylene–methyl acrylate–glycidyl methacrylate (E-MA-GMA), were used to ensure the miscibility between PET and PEN during the preparation of the blends and composites. All composite and blend samples were extruded by using a laboratory scale twin screw microcompounder. Test samples were prepared via laboratory scale injection molding machine. According to the results of the thermomechanical tests, usage of both elastomers enhanced the miscibility between r-PET and PEN. Morphological analyses showed that the blends and composites which contain E-EA-MAH exhibited better elastomer phase dispersion with smaller domain sizes when compared with the samples with E-MA-GMA. Samples prepared with E-EA-MAH had better mechanical properties than the ones containing E-MA-GMA due to the better elastomer phase dispersion. Moreover, addition of CNT also improved the mechanical properties of the samples for both elastomer types. In contrast to mechanical test results, samples prepared with E-MA-GMA had higher electrical conductivity values when compared with those of the ones containing E-EA-MAH due to the differences in the selective distribution of CNT particles between the
Tandem cathode for proton exchange membrane fuel cells
DEFF Research Database (Denmark)
Siahrostami, Samira; Björketun, Mårten E.; Strasser, Peter
2013-01-01
The efficiency of proton exchange membrane fuel cells is limited mainly by the oxygen reduction reaction at the cathode. The large cathodic overpotential is caused by correlations between binding energies of reaction intermediates in the reduction of oxygen to water. This work introduces a novel...... to identify potentially active and selective materials for both catalysts. Co-porphyrin is recommended for the first step, formation of hydrogen peroxide, and three different metal oxides – SrTiO3(100), CaTiO3(100) and WO3(100) – are suggested for the subsequent reduction step....
Molecular gas in the x-ray bright group NGC 5044 as revealed by ALMA
Energy Technology Data Exchange (ETDEWEB)
David, Laurence P.; Forman, William; Vrtilek, Jan; Jones, Christine; O' Sullivan, Ewan [Harvard-Smithsonian Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States); Lim, Jeremy [Department of Physics, University of Hong Kong, Pokfulam Road (Hong Kong); Combes, Francoise [Observatoire de Paris, LERMA, CNRS, 61 Avenue de l' Observatoire, F-75014 Paris (France); Salome, Philippe [LERMA Observatoire de paris, CNRS, 61 rue de l' Observatoire, F-75014 Paris (France); Edge, Alastair; Hamer, Stephen [Institute for Computational Cosmology, Department of Physics, Durham University, South Road, Durham DH1 3LE (United Kingdom); Sun, Ming [Department of Physics, University of Alabama in Huntsville, Huntsville, AL 35899 (United States); Gastaldello, Fabio; Bardelli, Sandro [INAF - IASF-Milano, Via E. Bassini 15, I-20133 Milano (Italy); Temi, Pasquale [Astrophysics Branch, NASA/Ames Research Center, MS 245-6, Moffett Field, CA 94035 (United States); Schmitt, Henrique [Remote Sensing Division, Naval Research Laboratory, 4555 Overlook Avenue SW, Washington, DC 20375 (United States); Ohyama, Youichi [Academia Sinica, Institute of Astronomy and Astrophysics, Taiwan (China); Mathews, William [University of California Observatories/Lick Observatory, Department of Astronomy and Astrophysics, University of California, Santa Cruz, CA 95064 (United States); Brighenti, Fabrizio [Dipartimento di Astronomia, Universit di Bologna, via Ranzani 1, I-40127 Bologna (Italy); Giacintucci, Simona [Department of Astronomy, University of Maryland, College Park, MD 20742 (United States); Trung, Dinh-V, E-mail: ldavid@head.cfa.harvard.edu [Institute of Physics, Vietnamese Academy of Science and Technology, 10 DaoTan Street, BaDinh, Hanoi (Viet Nam)
2014-09-10
An ALMA observation of the early-type galaxy NGC 5044, which resides at the center of an X-ray bright group with a moderate cooling flow, detected 24 molecular structures within the central 2.5 kpc. The masses of the molecular structures vary from 3 × 10{sup 5} M {sub ☉} to 10{sup 7} M {sub ☉} and the CO(2-1) linewidths vary from 15 to 65 km s{sup –1}. Given the large CO(2-1) linewidths, the observed structures are likely giant molecular associations (GMAs) and not individual giant molecular clouds (GMCs). Only a few of the GMAs are spatially resolved and the average density of these GMAs yields a GMC volume filling factor of about 15%. The masses of the resolved GMAs are insufficient for them to be gravitationally bound, however, the most massive GMA does contain a less massive component with a linewidth of 5.5 km s{sup –1} (typical of an individual virialized GMC). We also show that the GMAs cannot be pressure confined by the hot gas. Given the CO(2-1) linewidths of the GMAs (i.e., the velocity dispersion of the embedded GMCs) they should disperse on a timescale of about 12 Myr. No disk-like molecular structures are detected and all indications suggest that the molecular gas follows ballistic trajectories after condensing out of the thermally unstable hot gas. The 230 GHz luminosity of the central continuum source is 500 times greater than its low frequency radio luminosity and probably reflects a recent accretion event. The spectrum of the central continuum source also exhibits an absorption feature with a linewidth typical of an individual GMC and an infalling velocity of 250 km s{sup –1}.
Directory of Open Access Journals (Sweden)
José Humberto Vilar da Silva
2001-12-01
Full Text Available Níveis de energia metabolizável (EM de 2900, 3100 e 3300 kcal e relações energia: proteína (EM: PB de 128, 148, 168 e 188 kcal/%PB foram avaliados em frangos de corte machos de 22 a 42 dias de idade, distribuídos ao acaso em um esquema fatorial 3 x 4, com quatro repetições de 18 aves por tratamento. O aumento da relação EM: PB apresentou efeito linear decrescente sobre consumo de ração, peso vivo aos 42 dias, ganho de peso, consumo de proteína, consumo de energia metabolizável, peso da carcaça, peso da carne de peito, peso de pernas (coxa+sobrecoxa e elevou linearmente a porcentagem de gordura abdominal na carcaça em todos os níveis de energia. A relação EM: PB de 148 (20,95% PB dentro do nível de EM de 3100 kcal atende às exigências de ótimo crescimento de frangos de corte de 22 a 42 dias de idade, enquanto a relação EM: PB de 188 dentro de todos os níveis de energia estudados se mostrou inadequada. Em virtude do aumento do custo da ração, a redução da relação EM: PB, em rações práticas, deve ser avaliada para otimizar o modelo de produção em que a qualidade da carcaça também deve ser considerada.Levels of metabolizable energy (ME of 2,900, 3,100 and 3,300 kcal and energy to protein ratio (EM: PB of 128, 148, 168 and 188 kcal/%CP were evaluated with male broiler chicks from 22 to 42 days of age, assigned to a completely randomized 3 x 4 factorial design, where each treatment had four replications of 18 birds. Increasing the ME: CP ratio resulted in linear decreasing effect on feed intake, live weight, weight gain, crude protein intake, energy intake, carcass weight, breast meat weight, drumsticks weight and linearly increased abdominal fat percentage within each level of energy. The 148 ME:CP ratio (20,95% CP in the level of 3100 kcal ME met the broilers requirements to optimum growth from 22 to 42 days of age, while 188 ME:CP ratio was inadequate. Because of the high costs, decreasing EM: PB ratio must be
Girish, C K; Smith, T K
2008-06-01
An experiment was conducted to investigate the effects of feeding grains naturally contaminated with Fusarium mycotoxins on morphometric indices of duodenum, jejunum, and ileum in turkeys. The possible preventative effect of a polymeric glucomannan mycotoxin adsorbent (GMA) was also determined. Three hundred 1-d-old male turkey poults were fed wheat, corn, and soybean meal-based starter (0 to 3 wk), grower (4 to 6 wk), developer (7 to 9 wk), and finisher (10 to 12 wk) diets formulated with control grains, contaminated grains, and contaminated grains + 0.2% GMA. Morphometric indices were measured at the end of each growth phase and included villus height (VH), crypt depth, villus width, thicknesses of submucosa and muscularis, villus-to-crypt ratio, and apparent villus surface area (AVSA). At the end of the starter phase, feedborne mycotoxins significantly decreased the VH in the duodenum, and supplementation of the contaminated diet with GMA prevented this effect. The feeding of contaminated grains also reduced (P effects in jejunum and ileum. No effects of diets were seen on morphometric variables at the end of the developer and finisher phases. It was concluded that consumption of grains naturally contaminated with Fusarium mycotoxins results in adverse effects on intestinal morphology during early growth phases of turkeys, and GMA can prevent many of these effects.
Effects of feedborne fusarium mycotoxins on brain regional neurochemistry of turkeys.
Girish, C K; MacDonald, E J; Scheinin, M; Smith, T K
2008-07-01
An experiment was conducted to investigate the effects of feeding grains naturally contaminated with Fusarium mycotoxins on brain regional neurochemistry of turkeys. The possible preventative effect of a poly-meric glucomannan mycotoxin adsorbent (GMA) was also determined. Forty-five 1-d-old male turkey poults were fed wheat-, corn-, and soybean meal-based diets up to wk 6, formulated with control grains, contaminated grains, or contaminated grains + 0.2% GMA. Deoxynivalenol was the major contaminant, and the concentrations were 2.2 and 3.3 mg/kg of feed during starter and grower phases, respectively. Concentrations of brain monoamine neurotransmitters and metabolites were measured in discrete regions of the brain including the pons, hypothalamus, and cortex by HPLC with electrochemical detection. Neurotransmitters and metabolites analyzed included norepinephrine, dopamine, 3,4-dihydroxyphenylacetic acid, serotonin (5-hydroxytryptamine, 5-HT), and 5-hydroxyindoleacetic acid (5-HIAA). The concentration of 5-HIAA and the 5-HIAA:5-HT-ratio were significantly decreased in pons after feeding contaminated grains. Dietary supplementation with GMA prevented these effects. In the pons, a significant positive correlation (r = 0.52, P effects on the concentrations of neurotransmitters and metabolites in hypothalamus and cortex. It was concluded that consumption of grains naturally contaminated with Fusarium mycotoxins adversely altered the pons serotonergic system of turkeys. Supplementation with GMA partially inhibited these effects.
Improved Mechanical Performance Fracture Properties and Reliability of Radical-Cured Thermosets
Energy Technology Data Exchange (ETDEWEB)
Redline, Erica Marie [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Bolintineanu, Dan S. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Lane, J. Matthew [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Stevens, Mark J. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Alam, Todd M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Celina, Mathias C. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2016-10-01
The aim of this study was to alter polymerization chemistry to improve network homogeneity in free-radical crosslinked systems. It was hypothesized that a reduction in heterogeneity of the network would lead to improved mechanical performance. Experiments and simulations were carried out to investigate the connection between polymerization chemistry, network structure and mechanical properties. Experiments were conducted on two different monomer systems - the first is a single monomer system, urethane dimethacrylate (UDMA), and the second is a two-monomer system consisting of bisphenol A glycidyl dimethacrylate (BisGMA) and triethylene glycol dimethacrylate (TEGDMA) in a ratio of 70/30 BisGMA/TEGDMA by weight. The methacrylate systems were crosslinked using traditional radical polymeriza- tion (TRP) with azobisisobutyronitrile (AIBN) or benzoyl peroxide (BPO) as an initiator; TRP systems were used as the control. The monomers were also cross-linked using activator regenerated by electron transfer atom transfer radical polymerization (ARGET ATRP) as a type of controlled radical polymerization (CRP). FTIR and DSC were used to monitor reac- tion kinetics of the systems. The networks were analyzed using NMR, DSC, X-ray diffraction (XRD), atomic force microscopy (AFM), and small angle X-ray scattering (SAXS). These techniques were employed in an attempt to quantify differences between the traditional and controlled radical polymerizations. While a quantitative methodology for characterizing net- work morphology was not established, SAXS and AFM have shown some promising initial results. Additionally, differences in mechanical behavior were observed between traditional and controlled radical polymerized thermosets in the BisGMA/TEGDMA system but not in the UDMA materials; this finding may be the result of network ductility variations between the two materials. Coarse-grained molecular dynamics simulations employing a novel model of the CRP reaction were carried out for
High performance cone-beam spiral backprojection with voxel-specific weighting
Steckmann, Sven; Knaup, Michael; Kachelrieß, Marc
2009-06-01
Cone-beam spiral backprojection is computationally highly demanding. At first sight, the backprojection requirements are similar to those of cone-beam backprojection from circular scans such as it is performed in the widely used Feldkamp algorithm. However, there is an additional complication: the illumination of each voxel, i.e. the range of angles the voxel is seen by the x-ray cone, is a complex function of the voxel position. In general, one needs to multiply a voxel-specific weight w(x, y, z, α) prior to adding a projection from angle α to a voxel at position x, y, z. Often, the weight function has no analytically closed form and must be numerically determined. Storage of the weights is prohibitive since the amount of memory required equals the number of voxels per spiral rotation times the number of projections a voxel receives contributions and therefore is in the order of up to 1012 floating point values for typical spiral scans. We propose a new algorithm that combines the spiral symmetry with the ability of today's 64 bit operating systems to store large amounts of precomputed weights, even above the 4 GB limit. Our trick is to backproject into slices that are rotated in the same manner as the spiral trajectory rotates. Using the spiral symmetry in this way allows one to exploit data-level paralellism and thereby to achieve a very high level of vectorization. An additional postprocessing step rotates these slices back to normal images. Our new backprojection algorithm achieves up to 17 giga voxel updates per second on our systems that are equipped with four standard Intel X7460 hexa core CPUs (Intel Xeon 7300 platform, 2.66 GHz, Intel Corporation). This equals the reconstruction of 344 images per second assuming that each slice consists of 512 × 512 pixels and receives contributions from 512 projections. Thereby, it is an order of magnitude faster than a highly optimized code that does not make use of the spiral symmetry. In its present version, the
Digital system design and application with VHDL and FPGA
Energy Technology Data Exchange (ETDEWEB)
Lee, Gang; Jo, Yun Seok
2002-09-15
Contents of this book are digital system design modeling using VHDL like VHDL basics, writing VHDL for synthesis and VHDL environments, combinational logic design such as 4bit full adder and parallel combinational BCD multiplier sequential logic design, including Johnson counter, stop-watch, Dice game, traffic light controller, elevator controller and alarm clock, complex applications design like dynamic input/output circuit, PS/2 keyboard, LCD, VGA and UART. It also has a supplement about free license for ModelSim and Guide for 3100 X board user.
Digital system design and application with VHDL and FPGA
International Nuclear Information System (INIS)
Lee, Gang; Jo, Yun Seok
2002-09-01
Contents of this book are digital system design modeling using VHDL like VHDL basics, writing VHDL for synthesis and VHDL environments, combinational logic design such as 4bit full adder and parallel combinational BCD multiplier sequential logic design, including Johnson counter, stop-watch, Dice game, traffic light controller, elevator controller and alarm clock, complex applications design like dynamic input/output circuit, PS/2 keyboard, LCD, VGA and UART. It also has a supplement about free license for ModelSim and Guide for 3100 X board user.
Newey, Sarah E; Tsaknakis, Grigorios; Khoo, Cheen P; Athanassopoulos, Thanassi; Camicia, Rosalba; Zhang, Youyi; Grabowska, Rita; Harris, Adrian L; Roubelakis, Maria G; Watt, Suzanne M
2014-11-15
Proangiogenic factors, vascular endothelial growth factor (VEGF), and fibroblast growth factor-2 (FGF-2) prime endothelial cells to respond to "hematopoietic" chemokines and cytokines by inducing/upregulating expression of the respective chemokine/cytokine receptors. Coculture of human endothelial colony forming cell (ECFC)-derived cells with human stromal cells in the presence of VEGF and FGF-2 for 14 days resulted in upregulation of the "hematopoietic" chemokine CXCL12 and its CXCR4 receptor by day 3 of coculture. Chronic exposure to the CXCR4 antagonist AMD3100 in this vasculo/angiogenesis assay significantly reduced vascular tubule formation, an observation recapitulated by delayed AMD3100 addition. While AMD3100 did not affect ECFC-derived cell proliferation, it did demonstrate a dual action. First, over the later stages of the 14-day cocultures, AMD3100 delayed tubule organization into maturing vessel networks, resulting in enhanced endothelial cell retraction and loss of complexity as defined by live cell imaging. Second, at earlier stages of cocultures, we observed that AMD3100 significantly inhibited the integration of exogenous ECFC-derived cells into established, but immature, vascular networks. Comparative proteome profiler array analyses of ECFC-derived cells treated with AMD3100 identified changes in expression of potential candidate molecules involved in adhesion and/or migration. Blocking antibodies to CD31, but not CD146 or CD166, reduced the ECFC-derived cell integration into these extant vascular networks. Thus, CXCL12 plays a key role not only in endothelial cell sensing and guidance, but also in promoting the integration of ECFC-derived cells into developing vascular networks.
Energy Technology Data Exchange (ETDEWEB)
Nakamura, M; Matsuo, Y; Mukumoto, N; Iizuka, Y; Yokota, K; Mizowaki, T; Hiraoka, M [Kyoto University, Graduate School of Medicine, Kyoto (Japan); Nakao, M [Kyoto University, Graduate School of Informatics, Kyoto (Japan)
2016-06-15
Purpose: To detect target position on kV X-ray fluoroscopic images using a feature-based tracking algorithm, Accelerated-KAZE (AKAZE), for markerless real-time tumor tracking (RTTT). Methods: Twelve lung cancer patients treated with RTTT on the Vero4DRT (Mitsubishi Heavy Industries, Japan, and Brainlab AG, Feldkirchen, Germany) were enrolled in this study. Respiratory tumor movement was greater than 10 mm. Three to five fiducial markers were implanted around the lung tumor transbronchially for each patient. Before beam delivery, external infrared (IR) markers and the fiducial markers were monitored for 20 to 40 s with the IR camera every 16.7 ms and with an orthogonal kV x-ray imaging subsystem every 80 or 160 ms, respectively. Target positions derived from the fiducial markers were determined on the orthogonal kV x-ray images, which were used as the ground truth in this study. Meanwhile, tracking positions were identified by AKAZE. Among a lot of feature points, AKAZE found high-quality feature points through sequential cross-check and distance-check between two consecutive images. Then, these 2D positional data were converted to the 3D positional data by a transformation matrix with a predefined calibration parameter. Root mean square error (RMSE) was calculated to evaluate the difference between 3D tracking and target positions. A total of 393 frames was analyzed. The experiment was conducted on a personal computer with 16 GB RAM, Intel Core i7-2600, 3.4 GHz processor. Results: Reproducibility of the target position during the same respiratory phase was 0.6 +/− 0.6 mm (range, 0.1–3.3 mm). Mean +/− SD of the RMSEs was 0.3 +/− 0.2 mm (range, 0.0–1.0 mm). Median computation time per frame was 179 msec (range, 154–247 msec). Conclusion: AKAZE successfully and quickly detected the target position on kV X-ray fluoroscopic images. Initial results indicate that the differences between 3D tracking and target position would be clinically acceptable.
International Nuclear Information System (INIS)
Nakamura, M; Matsuo, Y; Mukumoto, N; Iizuka, Y; Yokota, K; Mizowaki, T; Hiraoka, M; Nakao, M
2016-01-01
Purpose: To detect target position on kV X-ray fluoroscopic images using a feature-based tracking algorithm, Accelerated-KAZE (AKAZE), for markerless real-time tumor tracking (RTTT). Methods: Twelve lung cancer patients treated with RTTT on the Vero4DRT (Mitsubishi Heavy Industries, Japan, and Brainlab AG, Feldkirchen, Germany) were enrolled in this study. Respiratory tumor movement was greater than 10 mm. Three to five fiducial markers were implanted around the lung tumor transbronchially for each patient. Before beam delivery, external infrared (IR) markers and the fiducial markers were monitored for 20 to 40 s with the IR camera every 16.7 ms and with an orthogonal kV x-ray imaging subsystem every 80 or 160 ms, respectively. Target positions derived from the fiducial markers were determined on the orthogonal kV x-ray images, which were used as the ground truth in this study. Meanwhile, tracking positions were identified by AKAZE. Among a lot of feature points, AKAZE found high-quality feature points through sequential cross-check and distance-check between two consecutive images. Then, these 2D positional data were converted to the 3D positional data by a transformation matrix with a predefined calibration parameter. Root mean square error (RMSE) was calculated to evaluate the difference between 3D tracking and target positions. A total of 393 frames was analyzed. The experiment was conducted on a personal computer with 16 GB RAM, Intel Core i7-2600, 3.4 GHz processor. Results: Reproducibility of the target position during the same respiratory phase was 0.6 +/− 0.6 mm (range, 0.1–3.3 mm). Mean +/− SD of the RMSEs was 0.3 +/− 0.2 mm (range, 0.0–1.0 mm). Median computation time per frame was 179 msec (range, 154–247 msec). Conclusion: AKAZE successfully and quickly detected the target position on kV X-ray fluoroscopic images. Initial results indicate that the differences between 3D tracking and target position would be clinically acceptable.
Energy Technology Data Exchange (ETDEWEB)
Choi, Seong-Ho; Jeong, Young Han; Ryoo, Jae Jeong; Lee, Kwang-Pill [Department of Chemistry Graduate School, Kyungpook National University, Taegu (Korea)
2000-07-01
Ion-exchange membranes modified with triethylamine [-N(CH{sub 2}CH{sub 3}){sub 3}] and phosphoric acid (-PO{sub 3}H) groups were prepared by radiation-induced grafting of glycidyl methacrylate (GMA) onto polyolefin nonwavon fabric (PNF) and subsequent chemical modification of poly (GMA) graft chains. The physical and chemical properties of the GMA-grafted PNF and the PNF modified with ion-exchange groups were investigated by SEM and XPS. The ion-exchange capacities of the cation- and anion-exchange membrane were 0.20 and 1.24mmol/g, respectively. The content of cation- and anion exchange group increased with increasing grafting yield (d.g.=100%). Electrical resistance of PNF modified with TEA and -PO{sub 3}H group decreased with increasing ion-exchange group capacities. Application of the graft-type ion-exchange membranes as separators for electrodialysis enabled use to reduce the time required to achieve 85.5% desalination of the 0.5M NaCl solution. (author)
Directory of Open Access Journals (Sweden)
Arun Kumar Gupta
2012-01-01
Full Text Available The effect of surface treated sisal fiber on the mechanical, thermal, flammability, and morphological properties of sisal fiber (SF reinforced recycled polypropylene (RPP composites was investigated. The surface of sisal fiber was modified with different chemical reagent such as silane, glycidyl methacrylate (GMA, and O-hydroxybenzene diazonium chloride (OBDC to improve the compatibility with the matrix polymer. The experimental results revealed an improvement in the tensile strength to 11%, 20%, and 31.36% and impact strength to 78.72%, 77%, and 81% for silane, GMA, and OBDC treated sisal fiber reinforced recycled Polypropylene (RPP/SF composites, respectively, as compared to RPP. The thermogravimetric analysis (TGA, differential scanning calorimeter (DSC, and heat deflection temperature (HDT results revealed improved thermal stability as compared with RPP. The flammability behaviour of silane, GMA, and OBDC treated SF/RPP composites was studied by the horizontal burning rate by UL-94. The morphological analysis through scanning electron micrograph (SEM supports improves surface interaction between fiber surface and polymer matrix.
International Nuclear Information System (INIS)
Jin Gu; Yao Qizhi; Zhang Shanzi; Zhang Lei
2008-01-01
In this study, human serum albumin (HSA) was covalently immobilized onto the inner surface of microporous poly(tetrafluoroethylene) (MPTFE) capillaries for direct bilirubin removal from human plasma. To obtain active binding sites for HSA, the MPTFE capillaries were chemically functionalized by using a coating of poly(vinyl alcohol) (PVA)-glycidyl methacrylate (GMA) copolymers. Characterization of grafted MPTFE capillaries was verified by XPS, Fourier transform infrared spectroscopy (FT-IR), scanning electronic microscopy (SEM). Non-specific adsorption on the PVA-GMA coated capillary remains low (< 0.38 mg bilirubin/g), and higher affinity adsorption capacity, of up to 73.6 mg bilirubin/g polymer was obtained after HSA is immobilized. Blood compatibility of the grafted MPTFE capillary was evaluated by SEM and platelet rich plasma (PRP) contacting experiments. The experimental data on blood compatibility indicated that PVA-coated and PVA-GMA-HSA coated PTFE capillary showed a sharp suppress on platelets adhesion. The proposed method has the potential of serving in bilirubin removal in clinical application
Bisphenol A in dental sealants and its estrogen like effect
Directory of Open Access Journals (Sweden)
Manu Rathee
2012-01-01
Full Text Available Bisphenol A or BPA-based epoxy resins are widely used in the manufacture of commercial products, including dental resins, polycarbonate plastics, and the inner coating of food cans. BPA is a precursor to the resin monomer Bis-GMA. During the manufacturing process of Bis-GMA dental sealants, Bisphenol A (BPA might be present as an impurity or as a degradation product of Bis-DMA through esterases present in saliva. Leaching of these monomers from resins can occur during the initial setting period and in conjunction with fluid sorption and desorption over time and this chemical leach from dental sealants may be bioactive. Researchers found an estrogenic effect with BPA, Bis-DMA, and Bis-GMA because BPA lacks structural specificity as a natural ligand to the estrogen receptor. It generated considerable concern regarding the safety of dental resin materials. This review focuses on the BPA in dental sealants and its estrogen-like effect.
2012-06-26
existing commercial-grade virtualization solutions (e.g., Xen, Linux KVM, VMware, or L4 ), but generally do not require such rich functional- ity [9...ports multiprocessor configuration on both AMD and Intel x86 platforms. Xen [8], KVM [27], VMware [39], NOVA [33], Virtual- box‡‡ and L4 are some...popular general purpose (open-source) hypervisors and microkernels which have been used for var- ious hypervisor based research [9,15,26,30,32,34,45
QCD thermodynamics with two flavors of quarks
International Nuclear Information System (INIS)
Bernard, C.; Ogilvie, M.C.; DeGrand, T.A.; DeTar, C.; Gottlieb, S.; Krasnitz, A.; Sugar, R.L.; Toussaint, D.
1992-01-01
We present results of numerical simulations of quantum chromo-dynamics at finite temperature on the Intel iPSC/860 parallel processor. We performed calculations with two flavors of Kogut-Susskind quarks and of Wilson quarks on 6 x 12 3 lattices in order to study the crossover from the low temperature hadronic regime to the high temperature regime. We investigate the properties of the objects whose exchange gives static screening lengths by reconstructing their correlated quark-antiquark structure. (orig.)
Laser-GMA Hybrid Pipe Welding System
National Research Council Canada - National Science Library
Reutzel, Edward W; Kern, Ludwig; Sullivan, Michael J; Tressler, Jay F; Avalos, Juan
2007-01-01
The combination of laser welding with conventional gas metal arc welding technology offers substantial increases in production rate of joining pipe through single-pass joining compared to multi-pass...
Laser-GMA Hybrid Pipe Welding System
2007-11-01
Investigation of varying laser power. The welded pipe is shown, with close -ups of the rootside reinforcement and macro sections...68 Figure 44. Investigation of varying laser stand-off. The welded pipe is shown, along with close -ups of backside...conventional beveled joints. With appropriate joint configuration and preparation, deep keyhole penetration provided by the laser and additional filler
Directory of Open Access Journals (Sweden)
Adauto Lima Cardoso
2015-06-01
Full Text Available Several types of sex chromosome systems have been recorded among Gymnotiformes, including male and female heterogamety, simple and multiple sex chromosomes, and different mechanisms of origin and evolution. The X1X1X2X2/X1X2Y systems identified in three species of this order are considered homoplasic for the group. In the genus Brachyhypopomus, only B. gauderio presented this type of system. Herein we describe the karyotypes of Brachyhypopomus pinnicaudatus and B. n. sp. FLAV, which have an X1X1X2X2/X1X2Y sex chromosome system that evolved via fusion between an autosome and the Y chromosome. The morphology of the chromosomes and the meiotic pairing suggest that the sex chromosomes of B. gauderio and B. pinnicaudatus have a common origin, whereas in B . n. sp. FLAV the sex chromosome system evolved independently. However, we cannot discard the possibility of common origin followed by distinct processes of differentiation. The identification of two new karyotypes with an X1X1X2X2/X1X2Y sex chromosome system in Gymnotiformes makes it the most common among the karyotyped species of the group. Comparisons of these karyotypes and the evolutionary history of the taxa indicate independent origins for their sex chromosomes systems. The recurrent emergence of the X1X1X2X2/X1X2Y system may represent sex chromosomes turnover events in Gymnotiformes.
Directory of Open Access Journals (Sweden)
Antonini James M
2010-06-01
Full Text Available Abstract Background Debate exists as to whether welding fume is carcinogenic, but epidemiological evidence suggests that welders are an at risk population for the development of lung cancer. Recently, we found that exposure to welding fume caused an acutely greater and prolonged lung inflammatory response in lung tumor susceptible A/J versus resistant C57BL/6J (B6 mice and a trend for increased tumor incidence after stainless steel (SS fume exposure. Here, our objective was to examine potential strain-dependent differences in the regulation and resolution of the lung inflammatory response induced by carcinogenic (Cr and Ni abundant or non-carcinogenic (iron abundant metal-containing welding fumes at the transcriptome level. Methods Mice were exposed four times by pharyngeal aspiration to 5 mg/kg iron abundant gas metal arc-mild steel (GMA-MS, Cr and Ni abundant GMA-SS fume or vehicle and were euthanized 4 and 16 weeks after the last exposure. Whole lung microarray using Illumina Mouse Ref-8 expression beadchips was done. Results Overall, we found that tumor susceptibility was associated with a more marked transcriptional response to both GMA-MS and -SS welding fumes. Also, Ingenuity Pathway Analysis revealed that gene regulation and expression in the top molecular networks differed between the strains at both time points post-exposure. Interestingly, a common finding between the strains was that GMA-MS fume exposure altered behavioral gene networks. In contrast, GMA-SS fume exposure chronically upregulated chemotactic and immunomodulatory genes such as CCL3, CCL4, CXCL2, and MMP12 in the A/J strain. In the GMA-SS-exposed B6 mouse, genes that initially downregulated cellular movement, hematological system development/function and immune response were involved at both time points post-exposure. However, at 16 weeks, a transcriptional switch to an upregulation for neutrophil chemotactic genes was found and included genes such as S100A8, S100A9 and
Photodegradable neutral-cationic brush block copolymers for nonviral gene delivery.
Hu, Xianglong; Li, Yang; Liu, Tao; Zhang, Guoying; Liu, Shiyong
2014-08-01
We report on the fabrication of a photodegradable gene-delivery vector based on PEO-b-P(GMA-g-PDMAEMA) neutral-cationic brush block copolymers that possess cationic poly(N,N-dimethylaminoethyl methacrylate) (PDMAEMA) brushes for DNA compaction, poly(ethylene oxide) (PEO) as a hydrophilic block, and poly(glycidyl methacrylate) (PGMA) as the backbone. The PEO-b-P(GMA-g-PDMAEMA) copolymers were synthesized through the combination of reversible addition-fragmentation transfer (RAFT) polymerization and postmodification. A photocleavable PEO-based macroRAFT agent was first synthesized; next, the PEO-b-PGMA block copolymer was prepared by RAFT polymerization of GMA; this was followed by a click reaction to introduce the RAFT initiators on the side chains of the PGMA block; then, RAFT polymerization of DMAEMA afforded the PEO-b-P(GMA-g-PDMAEMA) copolymer. The obtained neutral-cationic brush block copolymer could effectively complex plasmid DNA (pDNA) into nanoparticles at an N/P ratio (i.e., the number of nitrogen residues per DNA phosphate) of 4. Upon UV irradiation, pDNA could be released owing to cleavage of the pDNA-binding cationic PDMAEMA side chains as well as the nitrobenzyl ester linkages at the diblock junction point. In addition, in vitro gene transfection results demonstrated that the polyplexes could be effectively internalized by cells with good transfection efficiency, and the UV irradiation protocol could considerably enhance the efficiency of gene transfection. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Humidification during high-frequency oscillatory ventilation for adults: a bench study.
Chikata, Yusuke; Imanaka, Hideaki; Ueta, Masahiko; Nishimura, Masaji
2010-12-01
High-frequency oscillatory ventilation (HFOV) has recently been applied to acute respiratory distress syndrome patients. However, the issue of humidification during HFOV has not been investigated. In a bench study, we evaluated humidification during HFOV for adults to test if adequate humidification was achieved in 2 different HFOV systems. We tested 2 brands of adult HFOV ventilators, the R100 (Metran, Japan) and the 3100B (SensorMedics, CA), under identical bias flow. A heated humidifier consisting of porous hollow fiber (Hummax II, Metran) was set for the R100, and a passover-type heated humidifier (MR850, Fisher & Paykel) was set for the 3100B, while inspiratory heating wire was applied to both systems. Each ventilator was connected to a lung model in an incubator. Absolute humidity, relative humidity and temperature at the airway opening were measured using a hygrometer under a variety of ventilatory settings: 3 stroke volumes/amplitudes, 3 frequencies, and 2 mean airway pressures. The R100 ventilator showed higher absolute humidity, higher relative humidity, and lower temperature than the 3100B. In the R100, as stroke volume and frequency increased, absolute humidity and temperature increased. In the 3100B, amplitude, frequency, and mean airway pressure minimally affected absolute humidity and temperature. Relative humidity was almost 100% in the R100, while it was 80.5±2.3% in the 3100B. Humidification during HFOV for adults was affected by stroke volume and frequency in the R100, but was not in the 3100B. Absolute humidity was above 33 mgH_2 O/L in these 2 systems under a range of settings.
Lattice Boltzmann simulation optimization on leading multicore platforms
Energy Technology Data Exchange (ETDEWEB)
Williams, S. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Univ. of California, Berkeley, CA (United States); Carter, J. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Oliker, L. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Shalf, J. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Yelick, K. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Univ. of California, Berkeley, CA (United States)
2008-01-01
We present an auto-tuning approach to optimize application performance on emerging multicore architectures. The methodology extends the idea of searchbased performance optimizations, popular in linear algebra and FFT libraries, to application-specific computational kernels. Our work applies this strategy to a lattice Boltzmann application (LBMHD) that historically has made poor use of scalar microprocessors due to its complex data structures and memory access patterns. We explore one of the broadest sets of multicore architectures in the HPC literature, including the Intel Clovertown, AMD Opteron X2, Sun Niagara2, STI Cell, as well as the single core Intel Itanium2. Rather than hand-tuning LBMHD for each system, we develop a code generator that allows us identify a highly optimized version for each platform, while amortizing the human programming effort. Results show that our autotuned LBMHD application achieves up to a 14 improvement compared with the original code. Additionally, we present detailed analysis of each optimization, which reveal surprising hardware bottlenecks and software challenges for future multicore systems and applications.
1986-08-30
the Intel /Caltech Cosmic Cube8 ; (6) massive SIMD array processors , such as the 11 Gflop IBM GFii 9 , built specifically for physics quark modelling...randomly between 0 and 100 msec. a separate communication processor ( Intel 80186) associ- (or 0 to 80 message-interaction times). In this case, in-line a...machine was announced by IMS Associates. % o The processors were Intel 8080’s. In 1983 a working hypercube, the 64-node Cosmic Cube, was demonstrated at
Unstructured Computational Aerodynamics on Many Integrated Core Architecture
Al Farhan, Mohammed A.
2016-06-08
Shared memory parallelization of the flux kernel of PETSc-FUN3D, an unstructured tetrahedral mesh Euler flow code previously studied for distributed memory and multi-core shared memory, is evaluated on up to 61 cores per node and up to 4 threads per core. We explore several thread-level optimizations to improve flux kernel performance on the state-of-the-art many integrated core (MIC) Intel processor Xeon Phi “Knights Corner,” with a focus on strong thread scaling. While the linear algebraic kernel is bottlenecked by memory bandwidth for even modest numbers of cores sharing a common memory, the flux kernel, which arises in the control volume discretization of the conservation law residuals and in the formation of the preconditioner for the Jacobian by finite-differencing the conservation law residuals, is compute-intensive and is known to exploit effectively contemporary multi-core hardware. We extend study of the performance of the flux kernel to the Xeon Phi in three thread affinity modes, namely scatter, compact, and balanced, in both offload and native mode, with and without various code optimizations to improve alignment and reduce cache coherency penalties. Relative to baseline “out-of-the-box” optimized compilation, code restructuring optimizations provide about 3.8x speedup using the offload mode and about 5x speedup using the native mode. Even with these gains for the flux kernel, with respect to execution time the MIC simply achieves par with optimized compilation on a contemporary multi-core Intel CPU, the 16-core Sandy Bridge E5 2670. Nevertheless, the optimizations employed to reduce the data motion and cache coherency protocol penalties of the MIC are expected to be of value for CFD and many other unstructured applications as many-core architecture evolves. We explore large-scale distributed-shared memory performance on the Cray XC40 supercomputer, to demonstrate that optimizations employed on Phi hybridize to this context, where each of
Unstructured Computational Aerodynamics on Many Integrated Core Architecture
Al Farhan, Mohammed A.; Kaushik, Dinesh K.; Keyes, David E.
2016-01-01
Shared memory parallelization of the flux kernel of PETSc-FUN3D, an unstructured tetrahedral mesh Euler flow code previously studied for distributed memory and multi-core shared memory, is evaluated on up to 61 cores per node and up to 4 threads per core. We explore several thread-level optimizations to improve flux kernel performance on the state-of-the-art many integrated core (MIC) Intel processor Xeon Phi “Knights Corner,” with a focus on strong thread scaling. While the linear algebraic kernel is bottlenecked by memory bandwidth for even modest numbers of cores sharing a common memory, the flux kernel, which arises in the control volume discretization of the conservation law residuals and in the formation of the preconditioner for the Jacobian by finite-differencing the conservation law residuals, is compute-intensive and is known to exploit effectively contemporary multi-core hardware. We extend study of the performance of the flux kernel to the Xeon Phi in three thread affinity modes, namely scatter, compact, and balanced, in both offload and native mode, with and without various code optimizations to improve alignment and reduce cache coherency penalties. Relative to baseline “out-of-the-box” optimized compilation, code restructuring optimizations provide about 3.8x speedup using the offload mode and about 5x speedup using the native mode. Even with these gains for the flux kernel, with respect to execution time the MIC simply achieves par with optimized compilation on a contemporary multi-core Intel CPU, the 16-core Sandy Bridge E5 2670. Nevertheless, the optimizations employed to reduce the data motion and cache coherency protocol penalties of the MIC are expected to be of value for CFD and many other unstructured applications as many-core architecture evolves. We explore large-scale distributed-shared memory performance on the Cray XC40 supercomputer, to demonstrate that optimizations employed on Phi hybridize to this context, where each of
Mahmoud Nasef, Mohamed; Abbasi, Ali; Ting, T. M.
2014-10-01
A new CO2 adsorbent containing triethylamine (TEA) was prepared by radiation induced grafting of glycidyl methacrylate (GMA) onto polyethylene coated polypropylene (PE-PP) non-woven sheet followed by amination reaction. The degree of grafting (DOG%) was controlled by variation of monomer concentration and absorbed dose. The incorporation of aminated poly(GMA) was investigated by Fourier transform infrared (FTIR) and scanning electron microscope (SEM). The adsorbent with DOG of 350% and amination yield of 60% exhibited CO2 adsorption capacity of 4.52 mol/kg at ambient temperature and pressure.
CSIR Research Space (South Africa)
Salehiyan, Reza
2017-08-01
Full Text Available . Nonlinear coefficient from FT-rheology was found to be more pronounced in case of blends filled with C30B, indicating better dispersion of C30B compare with BET which was in agreement with the SAXS results. Keywords: reactively compatibilized clay... reduced significantly upon C30B addition. Kumar et al. [11] found that Cloisite®20A (C20A) can intercalate and exfoliate into the PLA/PBAT matrices when GMA was used; which indicates that GMA can facilitate the exfoliation of clay particles into the blend...
HOLANDA, Adriano de Jesus; RUIZ, Evandro Eduardo Seron; CARNEIRO, Antonio Adilton Oliveira2
2014-01-01
The use of multimedia extension with registers that perform the same operation in multiple data of the current processors should decrease the execution time of programs used to perform the same operation in a large quantity of data. The aim of the work was quantify the number of cycles needed to perform two-dimensional cross correlation calculation on a number of generated series with different number of elements, using a program compiled using Intel® Assembly x86-64 language and SSE extensio...
JOMAR: Joint Operations with Mobile Autonomous Robots
2015-12-21
computation time. Run times were computed using the Java -based april.graph library, which is slower than g2o, but exhibits the same scaling behavior as other...Kannala and Brandt [10], which also includes tangential distortion. The details of this angular polynomial model are shown in Equations 3-8, where X...the linear model in Eqn. 12. IV. IMPLEMENTATION AprilCal is implemented in Java and runs at 25 FPS with 640 × 480 images on a quad-core Intel i7
Online Mapping and Perception Algorithms for Multi-robot Teams Operating in Urban Environments
2015-01-01
each method on a 2.53 GHz Intel i5 laptop. All our algorithms are hand-optimized, implemented in Java and single threaded. To determine which algorithm...approach would be to label all the pixels in the image with an x, y, z point. However, the angular resolution of the camera is finer than that of the...edge criterion. That is, each edge is either present or absent. In [42], edge existence is further screened by a fixed threshold for angular
2014-06-01
advanced algorithms is: Two 6-core CPUs (Intel Xeon X5650, 2.67 GHz) 72 GB RAM Two 448-core GPUs ( NVIDIA Tesla M2070, 6 GB RAM) 2...Produktionstechnik und Automatisierung, Nobelstraße 12, 70569 Stuttgart, Germany, pp 1-11 , 2013 [40] General Electric Company , “Jet Engine Bracket from...GPU Using Nvidia CUDA”, Damien Vintache, Bernard Humbert, David Brasse, TSINGHUA SCIENCE AND TECHNOLOGY, ISSNl l1007-0214l l02/20l lpp11-16,Volume
QCD thermodynamics with two flavors of quarks
Energy Technology Data Exchange (ETDEWEB)
Bernard, C.; Ogilvie, M.C. (Washington Univ., Saint Louis, MO (United States). Dept. of Physics); DeGrand, T.A. (Colorado Univ., Boulder, CO (United States). Physics Dept.); DeTar, C. (Utah Univ., Salt Lake City, UT (United States). Physics Dept.); Gottlieb, S.; Krasnitz, A. (Indiana Univ., Bloomington, IN (United States). Dept. of Physics); Sugar, R.L. (California Univ., Santa Barbara, CA (United States). Dept. of Physics); Toussaint, D. (Arizona Univ., Tucson, AZ (United States). Dept. of Physics); MIMD Lattice Computations (MILC) Collaboration
1992-05-01
We present results of numerical simulations of quantum chromo-dynamics at finite temperature on the Intel iPSC/860 parallel processor. We performed calculations with two flavors of Kogut-Susskind quarks and of Wilson quarks on 6 x 12[sup 3] lattices in order to study the crossover from the low temperature hadronic regime to the high temperature regime. We investigate the properties of the objects whose exchange gives static screening lengths by reconstructing their correlated quark-antiquark structure. (orig.).
2010-01-01
... administrative and other facilities in central business districts. (l) American Indian Religious Freedom Act of... for American Indians their inherent right of freedom to believe, express, and exercise the traditional religions of the American Indian, Eskimo, Aleut, and Native Hawaiians. ...
7 CFR 3100.44 - Implementation.
2010-01-01
... act to preserve future options; loss of important cultural resources must be avoided except in the... AGRICULTURE CULTURAL AND ENVIRONMENTAL QUALITY Enhancement, Protection, and Management of the Cultural... management of the cultural environment in the most effective and efficient manner possible. Implementation...
Energy Technology Data Exchange (ETDEWEB)
Baratéla, Fernando José Costa; Zazuco Higa, Olga [Biotechnology Center, Institute of Energy and Nuclear Research (IPEN), Av. Professor Lineu Prestes 2242, 05508-000 São Paulo, SP (Brazil); Duarte dos Passos, Esdras [PostGraduate Program in Materials for Engineering, Federal University of Itajubá (UNIFEI), Av. BPS 1303, 37500-903 Itajubá, MG (Brazil); Alencar de Queiroz, Alvaro Antonio, E-mail: alencar@unifei.edu.br [Physics and Chemistry Institute (IFQ), Federal University of Itajubá (UNIFEI), Av. BPS 1303, 37500-903 Itajubá, MG (Brazil); High Voltage Laboratory (LAT-EFEI), Federal University of Itajubá (UNIFEI), Av. BPS 1303, 37500-903 Itajubá, MG (Brazil)
2017-04-01
Electrospinning is a suitable method to produce scaffolds composed of nanoscale to microscale fibers, which are comparable to the extracellular matrix (ECM). Hyperbranched polyglycerol (HPGL) is a highly biocompatible polyether polyol potentially useful for the design of fibrous scaffolds mimicking the ECM architecture. However, scaffolds developed from HPGL have poor mechanical properties and morphological stability in the aqueous environments required for tissue engineering applications. This work reports the production of stable electrospun HPGL scaffolds (EHPGLS) using glycidyl methacrylate (GMA) as cross-linker to enhance the water stability and mechanical property of electrospun HPGL. The diameter and morphology of the produced EHPGLS were analyzed by scanning electron microscopy (SEM). It was observed that electrical fields in the range of 0.2 kV·cm{sup −1} to 1.0 kV·cm{sup −1} decrease the average fiber diameter of EHPGLS. The increase in porosity of EHPGLS with GMA concentration indicates the in situ formation of a heterogeneous structure resultant from the phase separation during crosslinking of HPGL by GMA. EHPGLS containing 20% (w/w) GMA concentration possessed highest tensile strength (295.4 ± 11.32 kPa), which is approximately 58 times higher than that of non-crosslinked EHPGLS (5.1 ± 2.12 kPa). The MTS cell viability results showed that the EHPGLS have no significant cytotoxicity effect on Chinese hamster ovary (CHO-K1) cells. Scanning electron microscopy (SEM) indicates that the cultured BALB/3T3 fibroblasts cells were able to keep contact each other's, thus forming a homogeneous monolayer on the internal surface of the EHPGLS. - Highlights: • A hyperbranched polyglycerol (HPGL) scaffold with elastic modulus of 295.4 ± 11.32 kPa was developed for soft tissue repair. • HPGL scaffold was prepared by electrospinning method. • The porosity of HPGL scaffolds can be tuned by selecting the degree of GMA in HPGL. • Electrospun HPGL
International Nuclear Information System (INIS)
Ueki, Yuji; Chandra Dafader, Nirmal; Hoshina, Hiroyuki; Seko, Noriaki; Tamada, Masao
2012-01-01
Radiation-induced graft polymerization of glycidyl methacrylate (GMA) onto non-woven polyethylene (NWPE) fabric was achieved under normal pressure and air atmospheric conditions, without using unique apparatus such as glass ampoules or vacuum lines. To attain graft polymerization under normal pressure and air atmospheric conditions, the effects of the pre-irradiation dose, pre-irradiation atmosphere, pre-irradiation temperature, de-aeration of GMA-emulsion, grafting atmosphere in a reactor, and dissolved oxygen (DO) concentration in GMA-emulsion on the degree of grafting (Dg) were investigated in detail. It was found that the DO concentration had the strongest influence, the pre-irradiation dose, de-aeration of emulsion and grafting atmosphere had a relatively strong impact, and the pre-irradiation atmosphere and pre-irradiation temperature had the least effect on Dg. The optimum DO concentration before grafting was 2.0 mg/L or less. When a polyethylene bottle was used as a reactor instead of a glass ampoule, graft polymerization under normal pressure and air atmospheric conditions could be achieved under the following conditions; the pre-irradiation dose was more than 50 kGy, the volume ratio of GMA-emulsion to air was 50:1 or less, and the DO concentration in GMA-emulsion during grafting was below 2.0 mg/L. Under these grafting conditions, Dg was controlled within a range of up to 362%. The prepared GMA–grafted NWPE (GMA–g-NWPE) fabric was modified with a phosphoric acid to obtain an adsorbent for heavy metal ions. In the column-mode adsorption tests of Pb(II), the adsorption performance of the produced phosphorylated GMA–g-NWPE fabric (fibrous metal adsorbent) was not essentially dependent on the flow rate of the feed. The breakthrough points of 200, 500, and 1000 h −1 in space velocity were 483, 477 and 462 bed volumes, and the breakthrough capacities of the three flow rates were 1.16, 1.15 and 1.16 mmol-Pb(II)/g-adsorbent.
Optimization of biotechnological systems through geometric programming
Directory of Open Access Journals (Sweden)
Torres Nestor V
2007-09-01
Full Text Available Abstract Background In the past, tasks of model based yield optimization in metabolic engineering were either approached with stoichiometric models or with structured nonlinear models such as S-systems or linear-logarithmic representations. These models stand out among most others, because they allow the optimization task to be converted into a linear program, for which efficient solution methods are widely available. For pathway models not in one of these formats, an Indirect Optimization Method (IOM was developed where the original model is sequentially represented as an S-system model, optimized in this format with linear programming methods, reinterpreted in the initial model form, and further optimized as necessary. Results A new method is proposed for this task. We show here that the model format of a Generalized Mass Action (GMA system may be optimized very efficiently with techniques of geometric programming. We briefly review the basics of GMA systems and of geometric programming, demonstrate how the latter may be applied to the former, and illustrate the combined method with a didactic problem and two examples based on models of real systems. The first is a relatively small yet representative model of the anaerobic fermentation pathway in S. cerevisiae, while the second describes the dynamics of the tryptophan operon in E. coli. Both models have previously been used for benchmarking purposes, thus facilitating comparisons with the proposed new method. In these comparisons, the geometric programming method was found to be equal or better than the earlier methods in terms of successful identification of optima and efficiency. Conclusion GMA systems are of importance, because they contain stoichiometric, mass action and S-systems as special cases, along with many other models. Furthermore, it was previously shown that algebraic equivalence transformations of variables are sufficient to convert virtually any types of dynamical models into
Energy Technology Data Exchange (ETDEWEB)
Mendoza, Alberto [Departamento de Ingenieria Quimica, Tecnologico de Monterrey, Campus Monterrey, Monterrey, Nuevo Leon (Mexico)]. E-mail: mendoza.alberto@itesm.mx; Garcia, Marisa R. [Centro de Calidad Ambiental, Tecnologico de Monterrey, Campus Monterrey, Monterrey, Nuevo Leon (Mexico)
2009-05-15
The Guadalajara Metropolitan Area (GMA) continuously registers periods of unhealthy levels of air quality. One of the most powerful tools available to describe the dynamics of air pollutants in urban areas are three-dimensional mathematical models that describe the transportation and chemical transformation of these. In this work, we present a first application of one of such models, the California/ Carneige Institute of Technology (CIT), to the GMA. The modeling period selected goes from the 16th to the 18th of May, 2001; the modeling domain covers an area of 25,600 km{sup 2} and is centered in the GMA. The statistical model performance evaluation indicates that the CIT behaved better during the last two days of the simulation. In this period, regarding O{sub 3}, the normalized bias was less than 23.5 %, the normalized error less than 36.5 %, and the daily index of agreement was above 0.8. Further more, the model was capable of reproducing the O{sub 3} peak with an error of less than 18 %. These values, compared to established guidelines on model evaluation, indicate an acceptable performance of the model for the simulated period. However, the performance of CO was not as good, and poor with respect to SO{sub 2} and NO{sub x}, indicating that additional work is needed to improve the overall performance of the model. Spatially, the model tended to represent better the dynamics of pollutants in the west region of the GMA, and temporally areas of improvement were detected in the simulation of nighttime periods. [Spanish] La Zona Metropolitana de Guadalajara (ZMG) registra continuamente periodos con niveles insalubres de calidad del aire. Una de las herramientas mas poderosas para describir la dinamica de contaminantes atmosfericos en zonas urbanas son los modelos matematicos tridimensionales que describen el transporte y transformacion quimica de los mismos. En este trabajo se presenta una primera aplicacion de uno de dichos modelos, del California/Carneige Institute
2011-06-06
... Rica S.A. of Costa Rica, Intel Malaysia Sdn. Bhd of Malaysia, Intel (Philippines) of the Philippines... any public health, safety, or welfare concerns in the United States relating to the potential orders...
Kristiansen, Joakim
2016-01-01
As Moore s law continues, processors keep getting more cores packed together on the chip. This thesis is an empirical study of the rather newly introduced Intel Many Integrated Core (IMIC) architecture found in the Intel Xeon Phi. With roughly 60 cores connected by a high performance on-die interconnect, the Intel Xeon Phi makes an interesting candidate for High Performance Computing. By digging into parallel algorithms solving three well known problems, our goal is to optimize, test and comp...
Andreu Alemany, Josep Miquel
2016-01-01
El present treball final de màster realitza una introducció als smart contracts. El treball introdueix el concepte de contracte intel·ligent, els seus usos i alguns exemples existents. Seguidament proporciona les nocions necessàries de les transaccions del protocol Bitcoin per poder implementar un contracte intel·ligent, usant la blockchain que ofereix el protocol. Per últim, s'explica la implementació d'un contracte intel·ligent usant bitcoin: un canal de micropagaments. El presente traba...
International Nuclear Information System (INIS)
Lee, Kwang-Pill; Kang, Hae-Jeong; Joo, Duck-Lae; Choi, Seong-Ho
2001-01-01
For the purpose of the recovery of urokinase, the polypropylene (PP) films were modified by radiation-induced grafting of glycidylmethacrylate (GMA) and subsequent chemical modification of epoxy group of poly-GMA graft chains. The physical and chemical properties of the irradiated PP film, GMA-grafted PP film and the PP films modified with trimethylamine (TMA), hydroxylamine (HA), diethanolamine (DEA), and tri(hydroxymethyl)aminomethane (THMAM) were investigated by IR, SEM, and XPS. The adsorption of urokinase for the PP films modified with TMA, HA, DEA, and THMAM group were examined under various conditions of the functional group content, pH value and salt. It increased with increasing the content of functional group. The adsorption behavior of the PP films modified for different functional groups was in the following order: TMA>DEA>THMAM>HA. The adsorption of urokinase by the PP films with various functional groups at pH=7.4 were higher than that at pH=9.0. In TMA, DEA, and THMAM groups, the adsorption of urokinase without salts was also higher than those with salts. (author)
Controlled grafting of vinylic monomers on polyolefins: a robust mathematical modeling approach.
Saeb, Mohammad Reza; Rezaee, Babak; Shadman, Alireza; Formela, Krzysztof; Ahmadi, Zahed; Hemmati, Farkhondeh; Kermaniyan, Tayebeh Sadat; Mohammadi, Yousef
2017-01-01
Experimental and mathematical modeling analyses were used for controlling melt free-radical grafting of vinylic monomers on polyolefins and, thereby, reducing the disturbance of undesired cross-linking of polyolefins. Response surface, desirability function, and artificial intelligence methodologies were blended to modeling/optimization of grafting reaction in terms of vinylic monomer content, peroxide initiator concentration, and melt-processing time. An in-house code was developed based on artificial neural network that learns and mimics processing torque and grafting of glycidyl methacrylate (GMA) typical vinylic monomer on high-density polyethylene (HDPE). Application of response surface and desirability function enabled concurrent optimization of processing torque and GMA grafting on HDPE, through which we quantified for the first time competition between parallel reactions taking place during melt processing: (i) desirable grafting of GMA on HDPE; (ii) undesirable cross-linking of HDPE. The proposed robust mathematical modeling approach can precisely learn the behavior of grafting reaction of vinylic monomers on polyolefins and be placed into practice in finding exact operating condition needed for efficient grafting of reactive monomers on polyolefins.
Dicty_cDB: Contig-U12802-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available cobacter cetorum strain MIT-0... 38 0.23 AF237484_1( AF237484 |pid:none) Dirofilaria immitis intermed...87 ( O97594 ) RecName: Full=Structural maintenance of chromosomes pro... 36 0.87 U00680_1( U00680 |pid:none) Brugia malayi intermed...1305( CP000879 |pid:none) Petrotoga mobilis SJ95, complet... 38 0.30 (Q9BZF9) RecName: Full=Uveal autoantigen with coiled...ns BAC clone RP11-764E7 from 2, complet... 34 0.79 6 ( FK620261 ) 454GmaGlobSeed354893 Soybean Seed...ditis elegans clone Y71H2X, *** SEQUENCI... 38 4.5 7 ( AC146972 ) Medicago truncatula clone mth2-128d9, compl
Chowdhury, S R; Smith, T K
2004-11-01
An experiment was conducted to evaluate the effects of feeding laying hens grains naturally contaminated with a combination of Fusarium mycotoxins. Parameters measured included performance, organ weights, and plasma chemistry. One hundred and forty-four, 45-wk-old laying hens were fed diets including: (1) control, (2) contaminated grains, and (3) contaminated grains + 0.2% polymeric glucomannan mycotoxin adsorbent (GMA) for a 12-wk period. The feeding of contaminated grains decreased feed consumption compared with controls in the first 4 wk. Feed consumption increased, however, from 4 to 8 wk and from 8 to 12 wk. The efficiency of feed utilization (feed consumption/egg mass) decreased compared with controls in the periods from 4 to 8 and from 8 to 12 wk when birds were fed contaminated grains. Supplementation with GMA decreased feed consumption and increased the efficiency of feed utilization in the period from 8 to 12 wk. Egg production and egg mass decreased in wk 4 and 8 compared with controls when contaminated grains were fed, whereas egg and eggshell weights decreased in the fourth wk. Plasma uric acid concentrations increased throughout the experiment and relative kidney weights increased at the end of the experiment compared with controls when birds were fed contaminated grains. The feeding of GMA prevented the elevation in uric acid concentrations and relative kidney weights. It was concluded that layer performance and metabolism were adversely affected by chronic feeding of a combination of Fusarium mycotoxins, and that GMA prevented many of these effects.
Jaffer, F; Finer, Y; Santerre, J P
2002-04-01
Cholesterol esterase (CE) and pseudocholinesterase (PCE) have been reported to degrade commercial and model composite resins containing bisphenylglycidyl dimethacrylate (BisGMA), triethylene glycol dimethacrylate (TEGDMA) or the latter in combination with urethane modified BisGMA monomer systems. In addition, human saliva has been shown to contain esterase like activities similar to CE and PCE. Hence, it was the aim of the current study to determine to what extent human saliva could degrade two common commercial composite resins (Z250 from 3M Inc. and Spectrum TPH from L.D. Caulk) which contain the above monomer systems. Saliva samples from different volunteers were collected, processed, pooled, and freeze-dried. TEGDMA and BisGMA monomers were incubated with human saliva derived esterase activity (HSDEA) and their respective hydrolysis was monitored using high performance liquid chromatography (HPLC). Both monomers were completely hydrolyzed within 25 h by HSDEA. Photopolymerized composites were incubated with buffer or human saliva (pH 7.0 and 37 C) for 2, 8 and 16 days. The incubation solutions were analyzed using HPLC and mass spectrometry. Surface morphology characterization was carried out using scanning electron microscopy. Upon biodegradation, the Z250 composite yielded higher amounts of BisGMA and TEGDMA related products relative to the TPH composite. However, there were higher amounts of ethoxylated bis-phenol A released from the TPH material. In terms of total mass of products released, human saliva demonstrated a greater ability to degrade Z250. In summary, HSDEA has been shown to contain esterase activities that can readily catalyze the biodegradation of current commercial composite resins.
Epstein, David H.; Tyburski, Matthew; Craig, Ian M.; Phillips, Karran A.; Jobes, Michelle L.; Vahabzadeh, Massoud; Mezghanni, Mustapha; Lin, Jia-Ling; Furr-Holden, C. Debra M.; Preston, Kenzie L.
2013-01-01
Background Maladaptive behaviors may be more fully understood and efficiently prevented by ambulatory tools that assess people’s ongoing experience in the context of their environment. Methods To demonstrate new field-deployable methods for assessing mood and behavior as a function of neighborhood surroundings (Geographical Momentary Assessment; GMA), we collected time-stamped GPS data and Ecological Momentary Assessment (EMA) ratings of mood, stress, and drug craving over 16 weeks at randomly prompted times during the waking hours of opioid-dependent polydrug users receiving methadone maintenance. Locations of EMA entries and participants’ travel tracks were calculated for the 12 hours before each EMA entry were mapped. Associations between subjective ratings and objective environmental ratings were evaluated at the whole neighborhood and 12-hour track levels. Results Participants (N=27) were compliant with GMA data collection; 3,711 randomly prompted EMA entries were matched to specific locations. At the neighborhood level, physical disorder was negatively correlated with negative mood, stress, and heroin and cocaine craving (ps <.0001 to .0335); drug activity was negatively correlated with stress, heroin and cocaine craving (ps .0009 to .0134). Similar relationships were found for the environments around respondents’ tracks in the 12 hours preceding EMA entries. Conclusions The results support the feasibility of GMA. The relationships between neighborhood characteristics and participants’ reports were counterintuitive and counter-hypothesized, and challenge some assumptions about how ostensibly stressful environments are associated with lived experience and how such environments ultimately impair health. GMA methodology may have applications for development of individual- or neighborhood-level interventions. PMID:24332365
Daumerie, N; Vasseur Bacle, S; Giordana, J-Y; Bourdais Mannone, C; Caria, A; Roelandt, J-L
2012-06-01
The INDIGO study (INternational study of DIscrimination and stiGma Outcomes) aims at assessing the impact of schizophrenic disorders diagnosis on privacy, social and professional life, in terms of discrimination. In the general population, and even among health and social professionals, erroneous negative stereotypes (double personality, dangerosity) lead to high social distance. And this has an impact on various parts of daily life: employment, housing, compliance, self-esteem… About a tenth of the adult population suffers from mental disorders at any one time. These disorders now account for about 12% of the global impact of disability, and this will rise to 15% by the year 2020. People living with schizophrenia, for example, experience reduced social participation, whilst public images of mental illness and social reactions add a dimension of suffering, which has been described as a "second illness". Stigmatizing attitudes and discriminatory behavior among the general population against people with severe mental illness are common in all countries. Globally, little is known of effective interventions against stigma. It is clear that the negative effects of stigma can act as formidable barriers to active recovery. The INDIGO study intends to establish detailed international data on how stigma and discrimination affect the lives of people with a diagnosis of schizophrenia. The first aim of the INDIGO study is to conduct qualitative and quantitative interviews with 25 people with a diagnosis of schizophrenia in each participating site, to elicit information on how the condition affects their everyday lives, with a focus upon sites in Europe. The second is to gather data for all participating countries on the laws, policies and regulations which set a clear distinction between people with a diagnosis of mental illness and others, to establish an international profile of such discrimination. A new scale (Discrimination and Stigma Scale [DISC]), used in a face
A multidimensional continued fraction and some of its statistical properties
International Nuclear Information System (INIS)
Baldwin, P.R.
1992-01-01
The problem of simultaneously approximating a vector of irrational numbers with rationals is analyzed in a geometrical setting using notions of dynamical systems theory. The author discusses here a (vectorial) multidimensional continued-fraction algorithm (MCFA) of additive type, the generalized mediant algorithm (GMA), and gives a geometrical interpretation to it. He calculates the invariant measure of the GMA shift as well as its Kolmogorov-Sinai (KS) entropy for arbitrary number of irrationals. The KS entropy is related to the growth rate of denominators of the Euclidean algorithm. This is the first analytical calculation of the growth rate of denominators for any MCFA
Energy Technology Data Exchange (ETDEWEB)
Vainio, J; Rokkanen, P [Tampere Univ. (Finland). Inst. of Clinical Sciences; Central Hospital, Tampere (Finland))
1978-01-01
The potential of a bis-GMA composite resin as implant material in bone is evaluated. The material is claimed to have mechanical and physical properties superior to those of the bone cements used today. A groove made in the cortex of the tibia in 18 rats was filled with bis-GMA, while a similar was left empty in the contralateral tibia. The reaction of the bone to this material was evaluated by histologic, radiologic, microradiograph and OTC-fluorescence methods. The material was well tolerated by the bone; after 1,3 and 6 weeks no reaction to the material was observed.
Narrow groove gas metal-arc welding of aluminum
International Nuclear Information System (INIS)
Armstrong, R.E.
1975-01-01
The Gas Metal-Arc (GMA) welding process is explained and the equipment used described with an analysis of power supply function and the action of the arc, followed by discussion of general applications and problems. GMA braze welding of beryllium is then described, as is the development of a special high purity filler wire and a narrow deep groove joint design for improved weld strength in beryllium. This joint design and the special wire are applied in making high strength welds in high strength aluminum for special applications. High speed motion pictures of the welding operation are shown to illustrate the talk. (auth)
Justification for recommended uncertainties
International Nuclear Information System (INIS)
Pronyaev, V.G.; Badikov, S.A.; Carlson, A.D.
2007-01-01
The uncertainties obtained in an earlier standards evaluation were considered to be unrealistically low by experts of the US Cross Section Evaluation Working Group (CSEWG). Therefore, the CSEWG Standards Subcommittee replaced the covariance matrices of evaluated uncertainties by expanded percentage errors that were assigned to the data over wide energy groups. There are a number of reasons that might lead to low uncertainties of the evaluated data: Underestimation of the correlations existing between the results of different measurements; The presence of unrecognized systematic uncertainties in the experimental data can lead to biases in the evaluated data as well as to underestimations of the resulting uncertainties; Uncertainties for correlated data cannot only be characterized by percentage uncertainties or variances. Covariances between evaluated value at 0.2 MeV and other points obtained in model (RAC R matrix and PADE2 analytical expansion) and non-model (GMA) fits of the 6 Li(n,t) TEST1 data and the correlation coefficients are presented and covariances between the evaluated value at 0.045 MeV and other points (along the line or column of the matrix) as obtained in EDA and RAC R matrix fits of the data available for reactions that pass through the formation of the 7 Li system are discussed. The GMA fit with the GMA database is shown for comparison. The following diagrams are discussed: Percentage uncertainties of the evaluated cross section for the 6 Li(n,t) reaction and the for the 235 U(n,f) reaction; estimation given by CSEWG experts; GMA result with full GMA database, including experimental data for the 6 Li(n,t), 6 Li(n,n) and 6 Li(n,total) reactions; uncertainties in the GMA combined fit for the standards; EDA and RAC R matrix results, respectively. Uncertainties of absolute and 252 Cf fission spectrum averaged cross section measurements, and deviations between measured and evaluated values for 235 U(n,f) cross-sections in the neutron energy range 1
Energy Technology Data Exchange (ETDEWEB)
Reichl, Franz-Xaver; Simon, Sabine; Esters, Magalie; Seiss, Mario [Ludwig-Maximilians-University of Munich, Walther-Straub-Institute of Pharmacology and Toxicology, Munich (Germany); Kehe, Kai [Bundeswehr Institute of Pharmacology and Toxicology, Munich (Germany); Kleinsasser, Norbert [University of Regensburg, Department of Otolaryngology - Head and Neck Surgery, Regensburg (Germany); Hickel, Reinhard [Ludwig-Maximilians-University, Department of Operative Dentistry and Periodontology, Munich (Germany)
2006-08-15
Unpolymerized resin (co)monomers or mercury (Hg) can be released from restorative dental materials (e.g. composites and amalgam). They can diffuse into the tooth pulp or the gingiva. They can also reach the gingiva and organs by the circulating blood after the uptake from swallowed saliva. The cytotoxicity of dental composite components hydroxyethylmethacrylate (HEMA), triethyleneglycoldimethacrylate (TEGDMA), urethanedimethacrylate (UDMA), and bisglycidylmethacrylate (Bis-GMA) as well as the amalgam component Hg{sup 2+} (as HgCl{sub 2}) and methyl mercury chloride (MeHgCl) was investigated on human gingival fibroblasts (HGFs) at two time intervals. To test the cytotoxicity of substances, the bromodeoxyuridine (BrdU) assay and the lactate dehydrogenase (LDH) assay were used. The test substances were added in various concentrations and cells were incubated for 24 or 48 h. The EC{sub 50} values were obtained as half-maximum-effect concentrations from fitted curves. Following EC{sub 50} values were found [BrdU: mean (mmol/l); SEM in parentheses; n=12]: (24 h/48 h) HEMA 8.860 (0.440)/6.600(0.630), TEGDMA 1.810(0.130)/1.220(0.130), UDMA 0.120(0.010)/0.140(0.010), BisGMA 0.060(0.004)/0.040(0.002), HgCl{sub 2} 0.015(0.001)/0.050(0.006), and MeHgCl 0.004(0.001)/0.005(0.001). Following EC{sub 50} values were found [LDH: mean (mmol/l); SEM in parentheses; n=12]: (24 h/48 h) HEMA 9.490(0.300)/7.890(1.230), TEGDMA 2.300(0.470)/1.950(0.310), UDMA 0.200(0.007)/0.100(0.007), BisGMA 0.070(0.005)/0.100(0.002), and MeHgCl 0.014(0.006)/0.010(0.003). In both assays, the following range of increased toxicity was found for composite components (24 and 48 h): HEMA < TEGDMA < UDMA < BisGMA. In both assays, MeHgCl was the most toxic substance. In the BrdU assay, Hg{sup 2+} was about fourfold less toxic than MeHgCl but Hg{sup 2+} was about fourfold more toxic than BisGMA. In the BrdU test, a significantly (P<0.05) decreased toxicity was observed for Hg{sup 2+} at 48 h, compared to the 24 h
SiRen: Leveraging Similar Regions for Efficient and Accurate Variant Calling
2015-05-30
Cloudera, EMC2, Ericsson, Facebook, Guavus, HP, Huawei, Informatica , Intel, Microsoft, NetApp, Pivotal, Samsung, Schlumberger, Splunk, Virdata and VMware...EMC2, Ericsson, Facebook, Guavus, HP, Huawei, Informatica , Intel, Microsoft, NetApp, Pivotal, Samsung, Schlumberger, Splunk, Virdata and VMware
Energy Technology Data Exchange (ETDEWEB)
Fuentes, G.G., E-mail: gfuentes@ain.e [Center of Advanced Surface Engineering, AIN, Cordovilla-Pamplona, E-31191 (Spain); Esparza, J.; Rodriguez, R.J. [Center of Advanced Surface Engineering, AIN, Cordovilla-Pamplona, E-31191 (Spain); Manso-Silvan, M. [Departamento de Fisica Aplicada, Universidad Autonoma de Madrid, Cantoblanco, E-28049 (Spain); Palomares, J. [Instituto de Ciencia de Materiales de Madrid, ICMM-CSIC, Cantoblanco, E-28049 (Spain); Juhasz, J.; Best, S. [Cambridge Centre for Medical Materials, Department of Materials Science and Metallurgy, University of Cambridge, Pembroke Str, Cambridge CB2 3QZ (United Kingdom); Mattilla, R.; Vallittu, P. [Institute of Dentistry, Turku Clinical Biomaterials Centre, Itaeinen Pitkaekatu 4, B FI-20520, Turku (Finland); Achanta, S. [Falex Tribology Wingepark 23 B, 3110 Rotselaar (Belgium); Giazzon, M.; Weder, G. [Centre Suisse d' Electronique et de Microtechnique, CSEM, Jaquet-Drot 1, CH-2002 Neuchatel (Switzerland); Donati, I. [Department of Life Sciences, University of Trieste, Via Licio Giorgieri 1, I 34127 Trieste (Italy)
2011-01-15
This work reports on the surface characterisation of 2,2-bis[4-(2-hydroxy-3-methacryloxyl-oxypropoxy)phenyl]propane/triethylene glycol dimethacrylate bio-compatible resins after high energy He{sup +} ion implantation treatments. The samples have been characterised by diffuse reflectance FT-IR, X-ray photo-electron spectroscopy, ultramicro-hardness and nano-scratch wear tests. In addition, osteblast cell assays MG-63 have been used to test the bio-compatibility of the resin surfaces after the ion implantation treatments. It has been observed that the maximum surface hardening of the resin surfaces is achieved at He-ion implantation energies of around 50 keV and fluences of 1 x 10{sup 16} cm{sup -2}. At 50 keV of He-ion bombardment, the wear rate of the resin surface decreases by a factor 2 with respect to the pristine resin. Finally, in vitro tests indicate that the He-ion implantation does not affect to the cell-proliferation behaviour of the UV-cured resins. The enhancement of the surface mechanical properties of these materials can have beneficial consequences, for instance in preventing wear and surface fatigue of bone-fixation prostheses, whose surfaces are continuously held to sliding and shearing contacts of sub-millimetre scale lengths.
Yu, Guo-Liang; Wang, Zhi-Gang; Li, Zhen-Yu
2018-04-01
Inspired by the newly observed state X*(3860), we analyze the strong decay behaviors of some charmonium-like states, X*(3860), X(3872), X(3915), X(3930) and X(3940), with the 3 P 0 model. We carry out our work based on the hypothesis that all of these states are charmonium systems. Our analysis indicates that, as a 0++ charmonium state, X*(3860) can reproduce the experimental data. As for X(3872), it can tentatively be interpreted as the mixture of a {{c}}\\bar{{{c}}} system and a {\\overline{{{D}}}}{{* 0}}{{{D}}}{{0}} molecular state. If we consider X(3940) as a 31 S 0 state, its total width in the present work is much lower than the experimental result. Thus, the 31 S 0 charmonium state seems not to be a good candidate for X(3940). Furthermore, our analysis implies that it is reasonable to assign X(3915) and X(3930) to be the same state, 2++. However, combining our analysis with that in Refs.[14, 71], we speculate that X(3915)/X(3930) might also be the mixture of a {{c}}\\bar{{{c}}} system and a molecular state. Supported by the Fundamental Research Funds for the Central Universities (2016MS133)
Study of the CdX-B2X3-X (X=S, Se), CdTe-B-Te systems
International Nuclear Information System (INIS)
Odin, I.N.; Grin'ko, V.V.; Safronov, E.V.; Kozlovskij, V.F.
2001-01-01
Liquidus surfaces of the CdX-B 2 X 3 -X (X=S, Se), CdTe-B-Te systems are plotted for the first time. It is shown that in equilibrium solid solutions on the basis of ternary Cd 2 B 2 X 5 compounds and binary B 2 X 3 , CdX, BS 2 compounds take part with liquid phases. p gen -T and T-x projects of p-T-x phase diagram of B-S (59-100 at. % S), B-Se (59-100 at. % Se), B-Te systems are plotted . B 2 X 3 , BS 2 compounds are formed in that regions of compositions of B-X systems . In the B-Te system compounds are not formed. Ternary compounds are not formed in the CdTe-B-Te system [ru
2013-02-22
... by accessing its Internet server ( http://www.usitc.gov ). The public record for this investigation... of Penang, Malaysia; and Intel Products (Chengdu) Ltd. of Chengdu, China (collectively, ``Intel... Commission's forthcoming opinion. The authority for the Commission's determination is contained in section...
Superconducting properties of Zr1+xNi2-xGa and Zr1-xNi2+xGa Heusler compounds
Directory of Open Access Journals (Sweden)
Saad Alzahrani
2017-05-01
Full Text Available The superconducting properties of a series of Zr1+xNi2-xGa and Zr1-xNi2+xGa compounds have been investigated by x-ray diffraction, electrical resistivity, dc magnetization, and ac susceptibility measurements. While the parent compound, ZrNi2Ga, exhibited the cubic L21 Heusler structure, multiple non-cubic structures formed in the Zr and Ni rich doped materials. For x ≤ 0.3, all Zr1-xNi2+xGa compounds demonstrated superconducting behavior, but no superconductivity was observed in the Zr1+xNi2-xGa alloys for x > 0.2. The magnetization data revealed that all materials in both Zr1+xNi2-xGa and Zr1-xNi2+xGa series exhibited type-II superconductivity. With increasing doping concentration x, the paramagnetic ordering were enhanced in both systems while the superconducting properties were found to weaken. The observations are discussed considering the structural disorders in the systems.
Bach, Harold H.; Wong, Yee M.; LaPorte, Heather M.; Gamelli, Richard L.; Majetschak, Matthias
2016-01-01
BACKGROUND Recent evidence suggests that chemokine receptor CXCR4 regulates vascular α1-adrenergic receptor function and that the noncognate CXCR4 agonist ubiquitin has therapeutic potential after trauma/hemorrhage. Pharmacologic properties of ubiquitin in large animal trauma models, however, are poorly characterized. Thus, the aims of the present study were to determine the effects of CXCR4 modulation on resuscitation requirements after polytrauma, to assess whether ubiquitin influences survival times after lethal polytrauma-hemorrhage, and to characterize its dose-effect profile in porcine models. METHODS Anesthetized pigs underwent polytrauma (PT, femur fractures/lung contusion) alone (Series 1) or PT/hemorrhage (PT/H) to a mean arterial blood pressure of 30 mmHg with subsequent fluid resuscitation (Series 2 and 3) or 40% blood volume hemorrhage within 15 minutes followed by 2.5% blood volume hemorrhage every 15 minutes without fluid resuscitation (Series 4). In Series 1, ubiquitin (175 and 350 nmol/kg), AMD3100 (CXCR4 antagonist, 350 nmol/kg), or vehicle treatment 60 minutes after PT was performed. In Series 2, ubiquitin (175, 875, and 1,750 nmol/kg) or vehicle treatment 60 minutes after PT/H was performed. In Series 3, ubiquitin (175 and 875 nmol/kg) or vehicle treatment at 60 and 180 minutes after PT/H was performed. In Series 4, ubiquitin (875 nmol/kg) or vehicle treatment 30 minutes after hemorrhage was performed. RESULTS In Series 1, resuscitation fluid requirements were significantly reduced by 40% with 350-nmol/kg ubiquitin and increased by 25% with AMD3100. In Series 2, median survival time was 190 minutes with vehicle, 260 minutes with 175-nmol/kg ubiquitin, and longer than 420 minutes with 875-nmol/kg and 1,750-nmol/kg ubiquitin (p 0.05). CONCLUSION These findings further suggest CXCR4 as a drug target after PT/H. Ubiquitin treatment reduces resuscitation fluid requirements and provides survival benefits after PT/H. The pharmacological effects of
X-ray bursts observed with JEM-X
DEFF Research Database (Denmark)
Brandt, Søren Kristian; Chenevez, Jérôme; Lund, Niels
2006-01-01
We report on the search for X-ray bursts in the JEM-X X-ray monitor on INTEGRAL during the first two years of operations. More than 350 bursts from 25 different type-I X-ray burst sources were found.......We report on the search for X-ray bursts in the JEM-X X-ray monitor on INTEGRAL during the first two years of operations. More than 350 bursts from 25 different type-I X-ray burst sources were found....
Understanding the internal structures of X(4140), X(4274), X(4500) and X(4700)
Energy Technology Data Exchange (ETDEWEB)
Chen, Hua-Xing; Cui, Er-Liang [Beihang University, School of Physics and Beijing Key Laboratory of Advanced Nuclear Materials and Physics, Beijing (China); Chen, Wei [University of Saskatchewan, Department of Physics and Engineering Physics, Saskatoon, Saskatchewan (Canada); Liu, Xiang [Lanzhou University, School of Physical Science and Technology, Lanzhou (China); Lanzhou University and Institute of Modern Physics of CAS, Research Center for Hadron and CSR Physics, Lanzhou (China); Zhu, Shi-Lin [Peking University, School of Physics and State Key Laboratory of Nuclear Physics and Technology, Beijing (China); Collaborative Innovation Center of Quantum Matter, Beijing (China); Peking University, Center of High Energy Physics, Beijing (China)
2017-03-15
We investigate the newly observed X(4500) and X(4700) based on the diquark-antidiquark configuration within the framework of QCD sum rules. Both of them may be interpreted as the D-wave cs anti c anti s tetraquark states of J{sup P} = 0{sup +}, but with opposite color structures, which is remarkably similar to the result obtained in Chen and Zhu (Phys Rev D 83:034010, 2011) that X(4140) and X(4274) can be both interpreted as the S-wave cs anti c anti s tetraquark states of J{sup P} = 1{sup +}, also with opposite color structures. However, the extracted masses and these suggested assignments to these X states do depend on these running quark masses where m{sub s}(2 GeV) = 95 ± 5 MeV and m{sub c}(m{sub c}) = 1.23 ± 0.09 GeV. As a byproduct, the masses of the hidden-bottom partner states of X(4500) and X(4700) are extracted to be both around 10.64 GeV, which can be searched for in the Υφ invariant mass distribution. (orig.)
Directory of Open Access Journals (Sweden)
Flora Eugenia Salas Madriz
2003-01-01
Full Text Available La Facultad de Educación de la Universidad de Costa Rica, consciente del impacto e importancia que están adquiriendo las tecnologías educativas digitales en el ámbito educativo a nivel nacional y mundial, ha creado el Programa Tecnologías Educativas Avanzadas (PROTEA para el desarrollo y la investigación en este campo. En este artículo se sistematiza la experiencia de nueve docentes de la Universidad de Costa Rica, que colaboraron en la adecuación para el nivel universitario del curso Intel Educar para el Futuro, impartido por la Fundación Omar Dengo. Éste está orientado a educadores de primaria y secundaria, y su propósito es poner a disposición de los educadores las herramientas del Office® de Microsoft ® para desarrollar los procesos de enseñanza. Debido a las diferencias de fondo y forma entre la educación primaria y secundaria, y la universitaria, se hizo necesario revisar el manual y la metodología a fin de adaptarlos a las necesidades de la docencia universitaria y de la formación de formadores. En este sentido, la experiencia y colaboración de los docentes participantes fue determinante para lograr que el curso alcance hoy sus objetivos de poner estas herramientas al servicio de la docencia universitaria
Directory of Open Access Journals (Sweden)
Sidan Tian
2016-06-01
Full Text Available The development of novel theranostic nanovectors is of particular interest in treating formidable diseases (e.g., cancers. Herein, we report a new tumor-targetable theranostic agent based on core crosslinked (CCL micelles, possessing tumor targetable moieties and fluorescence and magnetic resonance (MR dual imaging modalities. An azide-terminated diblock copolymer, N3-POEGMA-b-P(DPA-co-GMA, was synthesized via consecutive atom transfer radical polymerization (ATRP, where OEGMA, DPA, and GMA are oligo(ethylene glycolmethyl ether methacrylate, 2-(diisopropylaminoethyl methacrylate, and glycidyl methacrylate, respectively. The resulting diblock copolymer was further functionalized with DOTA(Gd (DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetrakisacetic acid or benzaldehyde moieties via copper(I-catalyzed alkyne-azide cycloaddition (CuAAC chemistry, resulting in the formation of DOTA(Gd-POEGMA-b-P(DPA-co-GMA and benzaldehyde-POEGMA-b-P(DPA-co-GMA copolymers. The resultant block copolymers co-assembled into mixed micelles at neutral pH in the presence of tetrakis[4-(2-mercaptoethoxyphenyl]ethylene (TPE-4SH, which underwent spontaneous crosslinking reactions with GMA residues embedded within the micellar cores, simultaneously switching on TPE fluorescence due to the restriction of intramolecular rotation. Moreover, camptothecin (CPT was encapsulated into the crosslinked cores at neutral pH, and tumor-targeting pH low insertion peptide (pHLIP, sequence: AEQNPIYWARYADWLFTTPLLLLDLALLVDADEGTCG moieties were attached to the coronas through the Schiff base chemistry, yielding a theranostic nanovector with fluorescence and MR dual imaging modalities and tumor-targeting capability. The nanovectors can be efficiently taken up by A549 cells, as monitored by TPE fluorescence. After internalization, intracellular acidic pH triggered the release of loaded CPT, killing cancer cells in a selective manner. On the other hand, the nanovectors labeled with DOTA