WorldWideScience

Sample records for integrated db values

  1. SolveDB: Integrating Optimization Problem Solvers Into SQL Databases

    DEFF Research Database (Denmark)

    Siksnys, Laurynas; Pedersen, Torben Bach

    2016-01-01

    for optimization problems, (2) an extensible infrastructure for integrating different solvers, and (3) query optimization techniques to achieve the best execution performance and/or result quality. Extensive experiments with the PostgreSQL-based implementation show that SolveDB is a versatile tool offering much...

  2. Determination of DB10B values of single and mixed cultures of ...

    African Journals Online (AJOL)

    The survi-ving fraction of isolates decreased with increased irradiation doses. DB10B values of E. coli, S. aureus and S. parat-hyphi B were respectively 0.27, 0.33 and 0.44 kGy when inoculated as single cultures, and 0.24, 0.28 and 0.32 kGy respectively when inoculated as mixed cultures. DB10B values were lower for ...

  3. FungiDB: An Integrated Bioinformatic Resource for Fungi and Oomycetes

    Directory of Open Access Journals (Sweden)

    Evelina Y. Basenko

    2018-03-01

    Full Text Available FungiDB (fungidb.org is a free online resource for data mining and functional genomics analysis for fungal and oomycete species. FungiDB is part of the Eukaryotic Pathogen Genomics Database Resource (EuPathDB, eupathdb.org platform that integrates genomic, transcriptomic, proteomic, and phenotypic datasets, and other types of data for pathogenic and nonpathogenic, free-living and parasitic organisms. FungiDB is one of the largest EuPathDB databases containing nearly 100 genomes obtained from GenBank, Aspergillus Genome Database (AspGD, The Broad Institute, Joint Genome Institute (JGI, Ensembl, and other sources. FungiDB offers a user-friendly web interface with embedded bioinformatics tools that support custom in silico experiments that leverage FungiDB-integrated data. In addition, a Galaxy-based workspace enables users to generate custom pipelines for large-scale data analysis (e.g., RNA-Seq, variant calling, etc.. This review provides an introduction to the FungiDB resources and focuses on available features, tools, and queries and how they can be used to mine data across a diverse range of integrated FungiDB datasets and records.

  4. IntegromeDB: an integrated system and biological search engine.

    Science.gov (United States)

    Baitaluk, Michael; Kozhenkov, Sergey; Dubinina, Yulia; Ponomarenko, Julia

    2012-01-19

    With the growth of biological data in volume and heterogeneity, web search engines become key tools for researchers. However, general-purpose search engines are not specialized for the search of biological data. Here, we present an approach at developing a biological web search engine based on the Semantic Web technologies and demonstrate its implementation for retrieving gene- and protein-centered knowledge. The engine is available at http://www.integromedb.org. The IntegromeDB search engine allows scanning data on gene regulation, gene expression, protein-protein interactions, pathways, metagenomics, mutations, diseases, and other gene- and protein-related data that are automatically retrieved from publicly available databases and web pages using biological ontologies. To perfect the resource design and usability, we welcome and encourage community feedback.

  5. PharmDB-K: Integrated Bio-Pharmacological Network Database for Traditional Korean Medicine.

    Directory of Open Access Journals (Sweden)

    Ji-Hyun Lee

    Full Text Available Despite the growing attention given to Traditional Medicine (TM worldwide, there is no well-known, publicly available, integrated bio-pharmacological Traditional Korean Medicine (TKM database for researchers in drug discovery. In this study, we have constructed PharmDB-K, which offers comprehensive information relating to TKM-associated drugs (compound, disease indication, and protein relationships. To explore the underlying molecular interaction of TKM, we integrated fourteen different databases, six Pharmacopoeias, and literature, and established a massive bio-pharmacological network for TKM and experimentally validated some cases predicted from the PharmDB-K analyses. Currently, PharmDB-K contains information about 262 TKMs, 7,815 drugs, 3,721 diseases, 32,373 proteins, and 1,887 side effects. One of the unique sets of information in PharmDB-K includes 400 indicator compounds used for standardization of herbal medicine. Furthermore, we are operating PharmDB-K via phExplorer (a network visualization software and BioMart (a data federation framework for convenient search and analysis of the TKM network. Database URL: http://pharmdb-k.org, http://biomart.i-pharm.org.

  6. BioPepDB: an integrated data platform for food-derived bioactive peptides.

    Science.gov (United States)

    Li, Qilin; Zhang, Chao; Chen, Hongjun; Xue, Jitong; Guo, Xiaolei; Liang, Ming; Chen, Ming

    2018-03-12

    Food-derived bioactive peptides play critical roles in regulating most biological processes and have considerable biological, medical and industrial importance. However, a large number of active peptides data, including sequence, function, source, commercial product information, references and other information are poorly integrated. BioPepDB is a searchable database of food-derived bioactive peptides and their related articles, including more than four thousand bioactive peptide entries. Moreover, BioPepDB provides modules of prediction and hydrolysis-simulation for discovering novel peptides. It can serve as a reference database to investigate the function of different bioactive peptides. BioPepDB is available at http://bis.zju.edu.cn/biopepdbr/ . The web page utilises Apache, PHP5 and MySQL to provide the user interface for accessing the database and predict novel peptides. The database itself is operated on a specialised server.

  7. Clone DB: an integrated NCBI resource for clone-associated data

    Science.gov (United States)

    Schneider, Valerie A.; Chen, Hsiu-Chuan; Clausen, Cliff; Meric, Peter A.; Zhou, Zhigang; Bouk, Nathan; Husain, Nora; Maglott, Donna R.; Church, Deanna M.

    2013-01-01

    The National Center for Biotechnology Information (NCBI) Clone DB (http://www.ncbi.nlm.nih.gov/clone/) is an integrated resource providing information about and facilitating access to clones, which serve as valuable research reagents in many fields, including genome sequencing and variation analysis. Clone DB represents an expansion and replacement of the former NCBI Clone Registry and has records for genomic and cell-based libraries and clones representing more than 100 different eukaryotic taxa. Records provide details of library construction, associated sequences, map positions and information about resource distribution. Clone DB is indexed in the NCBI Entrez system and can be queried by fields that include organism, clone name, gene name and sequence identifier. Whenever possible, genomic clones are mapped to reference assemblies and their map positions provided in clone records. Clones mapping to specific genomic regions can also be searched for using the NCBI Clone Finder tool, which accepts queries based on sequence coordinates or features such as gene or transcript names. Clone DB makes reports of library, clone and placement data on its FTP site available for download. With Clone DB, users now have available to them a centralized resource that provides them with the tools they will need to make use of these important research reagents. PMID:23193260

  8. CerealsDB 3.0: expansion of resources and data integration.

    Science.gov (United States)

    Wilkinson, Paul A; Winfield, Mark O; Barker, Gary L A; Tyrrell, Simon; Bian, Xingdong; Allen, Alexandra M; Burridge, Amanda; Coghill, Jane A; Waterfall, Christy; Caccamo, Mario; Davey, Robert P; Edwards, Keith J

    2016-06-24

    The increase in human populations around the world has put pressure on resources, and as a consequence food security has become an important challenge for the 21st century. Wheat (Triticum aestivum) is one of the most important crops in human and livestock diets, and the development of wheat varieties that produce higher yields, combined with increased resistance to pests and resilience to changes in climate, has meant that wheat breeding has become an important focus of scientific research. In an attempt to facilitate these improvements in wheat, plant breeders have employed molecular tools to help them identify genes for important agronomic traits that can be bred into new varieties. Modern molecular techniques have ensured that the rapid and inexpensive characterisation of SNP markers and their validation with modern genotyping methods has produced a valuable resource that can be used in marker assisted selection. CerealsDB was created as a means of quickly disseminating this information to breeders and researchers around the globe. CerealsDB version 3.0 is an online resource that contains a wide range of genomic datasets for wheat that will assist plant breeders and scientists to select the most appropriate markers for use in marker assisted selection. CerealsDB includes a database which currently contains in excess of a million putative varietal SNPs, of which several hundreds of thousands have been experimentally validated. In addition, CerealsDB also contains new data on functional SNPs predicted to have a major effect on protein function and we have constructed a web service to encourage data integration and high-throughput programmatic access. CerealsDB is an open access website that hosts information on SNPs that are considered useful for both plant breeders and research scientists. The recent inclusion of web services designed to federate genomic data resources allows the information on CerealsDB to be more fully integrated with the WheatIS network and

  9. RAId_DbS: mass-spectrometry based peptide identification web server with knowledge integration

    Directory of Open Access Journals (Sweden)

    Ogurtsov Aleksey Y

    2008-10-01

    Full Text Available Abstract Background Existing scientific literature is a rich source of biological information such as disease markers. Integration of this information with data analysis may help researchers to identify possible controversies and to form useful hypotheses for further validations. In the context of proteomics studies, individualized proteomics era may be approached through consideration of amino acid substitutions/modifications as well as information from disease studies. Integration of such information with peptide searches facilitates speedy, dynamic information retrieval that may significantly benefit clinical laboratory studies. Description We have integrated from various sources annotated single amino acid polymorphisms, post-translational modifications, and their documented disease associations (if they exist into one enhanced database per organism. We have also augmented our peptide identification software RAId_DbS to take into account this information while analyzing a tandem mass spectrum. In principle, one may choose to respect or ignore the correlation of amino acid polymorphisms/modifications within each protein. The former leads to targeted searches and avoids scoring of unnecessary polymorphism/modification combinations; the latter explores possible polymorphisms in a controlled fashion. To facilitate new discoveries, RAId_DbS also allows users to conduct searches permitting novel polymorphisms as well as to search a knowledge database created by the users. Conclusion We have finished constructing enhanced databases for 17 organisms. The web link to RAId_DbS and the enhanced databases is http://www.ncbi.nlm.nih.gov/CBBResearch/qmbp/RAId_DbS/index.html. The relevant databases and binaries of RAId_DbS for Linux, Windows, and Mac OS X are available for download from the same web page.

  10. Balanced PIN-TIA photoreceiver with integrated 3 dB fiber coupler for distributed fiber optic sensors

    Science.gov (United States)

    Datta, Shubhashish; Rajagopalan, Sruti; Lemke, Shaun; Joshi, Abhay

    2014-06-01

    We report a balanced PIN-TIA photoreceiver integrated with a 3 dB fiber coupler for distributed fiber optic sensors. This detector demonstrates -3 dB bandwidth >15 GHz and coupled conversion gain >65 V/W per photodiode through either input port of the 3 dB coupler, and can be operated at local oscillator power of +17 dBm. The combined common mode rejection of the balanced photoreceiver and the integrated 3 dB coupler is >20 dB. We also present measurement results with various optical stimuli, namely impulses, sinusoids, and pseudo-random sequences, which are relevant for time domain reflectometry, frequency domain reflectometry, and code correlation sensors, respectively.

  11. MIPS Arabidopsis thaliana Database (MAtDB): an integrated biological knowledge resource for plant genomics

    Science.gov (United States)

    Schoof, Heiko; Ernst, Rebecca; Nazarov, Vladimir; Pfeifer, Lukas; Mewes, Hans-Werner; Mayer, Klaus F. X.

    2004-01-01

    Arabidopsis thaliana is the most widely studied model plant. Functional genomics is intensively underway in many laboratories worldwide. Beyond the basic annotation of the primary sequence data, the annotated genetic elements of Arabidopsis must be linked to diverse biological data and higher order information such as metabolic or regulatory pathways. The MIPS Arabidopsis thaliana database MAtDB aims to provide a comprehensive resource for Arabidopsis as a genome model that serves as a primary reference for research in plants and is suitable for transfer of knowledge to other plants, especially crops. The genome sequence as a common backbone serves as a scaffold for the integration of data, while, in a complementary effort, these data are enhanced through the application of state-of-the-art bioinformatics tools. This information is visualized on a genome-wide and a gene-by-gene basis with access both for web users and applications. This report updates the information given in a previous report and provides an outlook on further developments. The MAtDB web interface can be accessed at http://mips.gsf.de/proj/thal/db. PMID:14681437

  12. dbPAF: an integrative database of protein phosphorylation in animals and fungi.

    Science.gov (United States)

    Ullah, Shahid; Lin, Shaofeng; Xu, Yang; Deng, Wankun; Ma, Lili; Zhang, Ying; Liu, Zexian; Xue, Yu

    2016-03-24

    Protein phosphorylation is one of the most important post-translational modifications (PTMs) and regulates a broad spectrum of biological processes. Recent progresses in phosphoproteomic identifications have generated a flood of phosphorylation sites, while the integration of these sites is an urgent need. In this work, we developed a curated database of dbPAF, containing known phosphorylation sites in H. sapiens, M. musculus, R. norvegicus, D. melanogaster, C. elegans, S. pombe and S. cerevisiae. From the scientific literature and public databases, we totally collected and integrated 54,148 phosphoproteins with 483,001 phosphorylation sites. Multiple options were provided for accessing the data, while original references and other annotations were also present for each phosphoprotein. Based on the new data set, we computationally detected significantly over-represented sequence motifs around phosphorylation sites, predicted potential kinases that are responsible for the modification of collected phospho-sites, and evolutionarily analyzed phosphorylation conservation states across different species. Besides to be largely consistent with previous reports, our results also proposed new features of phospho-regulation. Taken together, our database can be useful for further analyses of protein phosphorylation in human and other model organisms. The dbPAF database was implemented in PHP + MySQL and freely available at http://dbpaf.biocuckoo.org.

  13. Substrate integrated waveguide (SIW 3 dB coupler for K-Band applications

    Directory of Open Access Journals (Sweden)

    Khalid Nurehansafwanah

    2017-01-01

    Full Text Available This paper presented a designed coupler by using Rogers RO4003C with thickness (h 0.508 mm and relative permittivity (εr 3.55. The four port network coupler operates in K-band (18-27 GHz and design by using substrate integrated waveguide (SIW method. The reflection coefficient and isolation coefficient of propose Substrate Integrated Waveguide (SIW coupler is below than -10 dB. Meanwhile the coupler requirements are phase shift 90° between coupled port and output. SIW are high performance broadband interconnects with excellent immunity to electromagnetic interference and suitable for use in microwave and communication electronics, as well as increase bandwidth systems. The designs of coupler are investigated using CST Microwave Studio simulation tool. This proposed couplers are varied from parameters that cover the frequency range (21 -24 GHz and better performance of scattering (S-parameter.

  14. Development of integrated D/B system for the safety-related structures in nuclear power plant

    International Nuclear Information System (INIS)

    Cho, M. S.; Song, Y. C.; Lee, J. S.; Choi, W. S.

    2002-01-01

    The integrated D/B system is developed for digitalizing the history of the safety-related structures of nuclear power plant. It have 5 database which are consist of Generals, Structural and Design, Materials, Construction, Aging and repair information D/B. For efficient operation of the system, we are to set up the outline of the system, find out data field for target structures, and develop utilities. Utilities will be the aging and repair data management program, the close examination management program, the data search engine with various options which help users to find the information quickly, and the data management program restoring, updating and exchanging input data. Development of the integrated D/B system of the safety-related structures will contribute to management of the structures of nuclear power plant with advanced technology

  15. MIPS Arabidopsis thaliana Database (MAtDB): an integrated biological knowledge resource based on the first complete plant genome

    Science.gov (United States)

    Schoof, Heiko; Zaccaria, Paolo; Gundlach, Heidrun; Lemcke, Kai; Rudd, Stephen; Kolesov, Grigory; Arnold, Roland; Mewes, H. W.; Mayer, Klaus F. X.

    2002-01-01

    Arabidopsis thaliana is the first plant for which the complete genome has been sequenced and published. Annotation of complex eukaryotic genomes requires more than the assignment of genetic elements to the sequence. Besides completing the list of genes, we need to discover their cellular roles, their regulation and their interactions in order to understand the workings of the whole plant. The MIPS Arabidopsis thaliana Database (MAtDB; http://mips.gsf.de/proj/thal/db) started out as a repository for genome sequence data in the European Scientists Sequencing Arabidopsis (ESSA) project and the Arabidopsis Genome Initiative. Our aim is to transform MAtDB into an integrated biological knowledge resource by integrating diverse data, tools, query and visualization capabilities and by creating a comprehensive resource for Arabidopsis as a reference model for other species, including crop plants. PMID:11752263

  16. MannDB – A microbial database of automated protein sequence analyses and evidence integration for protein characterization

    Directory of Open Access Journals (Sweden)

    Kuczmarski Thomas A

    2006-10-01

    Full Text Available Abstract Background MannDB was created to meet a need for rapid, comprehensive automated protein sequence analyses to support selection of proteins suitable as targets for driving the development of reagents for pathogen or protein toxin detection. Because a large number of open-source tools were needed, it was necessary to produce a software system to scale the computations for whole-proteome analysis. Thus, we built a fully automated system for executing software tools and for storage, integration, and display of automated protein sequence analysis and annotation data. Description MannDB is a relational database that organizes data resulting from fully automated, high-throughput protein-sequence analyses using open-source tools. Types of analyses provided include predictions of cleavage, chemical properties, classification, features, functional assignment, post-translational modifications, motifs, antigenicity, and secondary structure. Proteomes (lists of hypothetical and known proteins are downloaded and parsed from Genbank and then inserted into MannDB, and annotations from SwissProt are downloaded when identifiers are found in the Genbank entry or when identical sequences are identified. Currently 36 open-source tools are run against MannDB protein sequences either on local systems or by means of batch submission to external servers. In addition, BLAST against protein entries in MvirDB, our database of microbial virulence factors, is performed. A web client browser enables viewing of computational results and downloaded annotations, and a query tool enables structured and free-text search capabilities. When available, links to external databases, including MvirDB, are provided. MannDB contains whole-proteome analyses for at least one representative organism from each category of biological threat organism listed by APHIS, CDC, HHS, NIAID, USDA, USFDA, and WHO. Conclusion MannDB comprises a large number of genomes and comprehensive protein

  17. The influence of attention on value integration.

    Science.gov (United States)

    Kunar, Melina A; Watson, Derrick G; Tsetsos, Konstantinos; Chater, Nick

    2017-08-01

    People often have to make decisions based on many pieces of information. Previous work has found that people are able to integrate values presented in a rapid serial visual presentation (RSVP) stream to make informed judgements on the overall stream value (Tsetsos et al. Proceedings of the National Academy of Sciences of the United States of America, 109(24), 9659-9664, 2012). It is also well known that attentional mechanisms influence how people process information. However, it is unknown how attentional factors impact value judgements of integrated material. The current study is the first of its kind to investigate whether value judgements are influenced by attentional processes when assimilating information. Experiments 1-3 examined whether the attentional salience of an item within an RSVP stream affected judgements of overall stream value. The results showed that the presence of an irrelevant high or low value salient item biased people to judge the stream as having a higher or lower overall mean value, respectively. Experiments 4-7 directly tested Tsetsos et al.'s (Proceedings of the National Academy of Sciences of the United States of America, 109(24), 9659-9664, 2012) theory examining whether extreme values in an RSVP stream become over-weighted, thereby capturing attention more than other values in the stream. The results showed that the presence of both a high (Experiments 4, 6 and 7) and a low (Experiment 5) value outlier captures attention leading to less accurate report of subsequent items in the stream. Taken together, the results showed that valuations can be influenced by attentional processes, and can lead to less accurate subjective judgements.

  18. Integrating XQuery and P2P in MonetDB/XQuery*

    NARCIS (Netherlands)

    Y. Zhang (Ying); P.A. Boncz (Peter); M. Arenas (Marcelo); J. Hidders

    2007-01-01

    textabstractMonetDB/XQuery* is a fully functional publicly available XML DBMS that has been extended with distributed and P2P data management functionality. Our (minimal) XQuery language extension XRPC adds the concept of RPC to XQuery, and exploits the set-at-a-time database processing model to

  19. Integrative missing value estimation for microarray data.

    Science.gov (United States)

    Hu, Jianjun; Li, Haifeng; Waterman, Michael S; Zhou, Xianghong Jasmine

    2006-10-12

    Missing value estimation is an important preprocessing step in microarray analysis. Although several methods have been developed to solve this problem, their performance is unsatisfactory for datasets with high rates of missing data, high measurement noise, or limited numbers of samples. In fact, more than 80% of the time-series datasets in Stanford Microarray Database contain less than eight samples. We present the integrative Missing Value Estimation method (iMISS) by incorporating information from multiple reference microarray datasets to improve missing value estimation. For each gene with missing data, we derive a consistent neighbor-gene list by taking reference data sets into consideration. To determine whether the given reference data sets are sufficiently informative for integration, we use a submatrix imputation approach. Our experiments showed that iMISS can significantly and consistently improve the accuracy of the state-of-the-art Local Least Square (LLS) imputation algorithm by up to 15% improvement in our benchmark tests. We demonstrated that the order-statistics-based integrative imputation algorithms can achieve significant improvements over the state-of-the-art missing value estimation approaches such as LLS and is especially good for imputing microarray datasets with a limited number of samples, high rates of missing data, or very noisy measurements. With the rapid accumulation of microarray datasets, the performance of our approach can be further improved by incorporating larger and more appropriate reference datasets.

  20. Integrative missing value estimation for microarray data

    Directory of Open Access Journals (Sweden)

    Zhou Xianghong

    2006-10-01

    Full Text Available Abstract Background Missing value estimation is an important preprocessing step in microarray analysis. Although several methods have been developed to solve this problem, their performance is unsatisfactory for datasets with high rates of missing data, high measurement noise, or limited numbers of samples. In fact, more than 80% of the time-series datasets in Stanford Microarray Database contain less than eight samples. Results We present the integrative Missing Value Estimation method (iMISS by incorporating information from multiple reference microarray datasets to improve missing value estimation. For each gene with missing data, we derive a consistent neighbor-gene list by taking reference data sets into consideration. To determine whether the given reference data sets are sufficiently informative for integration, we use a submatrix imputation approach. Our experiments showed that iMISS can significantly and consistently improve the accuracy of the state-of-the-art Local Least Square (LLS imputation algorithm by up to 15% improvement in our benchmark tests. Conclusion We demonstrated that the order-statistics-based integrative imputation algorithms can achieve significant improvements over the state-of-the-art missing value estimation approaches such as LLS and is especially good for imputing microarray datasets with a limited number of samples, high rates of missing data, or very noisy measurements. With the rapid accumulation of microarray datasets, the performance of our approach can be further improved by incorporating larger and more appropriate reference datasets.

  1. TransAtlasDB: an integrated database connecting expression data, metadata and variants

    Science.gov (United States)

    Adetunji, Modupeore O; Lamont, Susan J; Schmidt, Carl J

    2018-01-01

    Abstract High-throughput transcriptome sequencing (RNAseq) is the universally applied method for target-free transcript identification and gene expression quantification, generating huge amounts of data. The constraint of accessing such data and interpreting results can be a major impediment in postulating suitable hypothesis, thus an innovative storage solution that addresses these limitations, such as hard disk storage requirements, efficiency and reproducibility are paramount. By offering a uniform data storage and retrieval mechanism, various data can be compared and easily investigated. We present a sophisticated system, TransAtlasDB, which incorporates a hybrid architecture of both relational and NoSQL databases for fast and efficient data storage, processing and querying of large datasets from transcript expression analysis with corresponding metadata, as well as gene-associated variants (such as SNPs) and their predicted gene effects. TransAtlasDB provides the data model of accurate storage of the large amount of data derived from RNAseq analysis and also methods of interacting with the database, either via the command-line data management workflows, written in Perl, with useful functionalities that simplifies the complexity of data storage and possibly manipulation of the massive amounts of data generated from RNAseq analysis or through the web interface. The database application is currently modeled to handle analyses data from agricultural species, and will be expanded to include more species groups. Overall TransAtlasDB aims to serve as an accessible repository for the large complex results data files derived from RNAseq gene expression profiling and variant analysis. Database URL: https://modupeore.github.io/TransAtlasDB/ PMID:29688361

  2. CerealsDB 2.0: an integrated resource for plant breeders and scientists

    Directory of Open Access Journals (Sweden)

    Wilkinson Paul A

    2012-09-01

    Full Text Available Abstract Background Food security is an issue that has come under renewed scrutiny amidst concerns that substantial yield increases in cereal crops are required to feed the world’s booming population. Wheat is of fundamental importance in this regard being one of the three most important crops for both human consumption and livestock feed; however, increase in crop yields have not kept pace with the demands of a growing world population. In order to address this issue, plant breeders require new molecular tools to help them identify genes for important agronomic traits that can be introduced into elite varieties. Studies of the genome using next-generation sequencing enable the identification of molecular markers such as single nucleotide polymorphisms that may be used by breeders to identify and follow genes when breeding new varieties. The development and application of next-generation sequencing technologies has made the characterisation of SNP markers in wheat relatively cheap and straightforward. There is a growing need for the widespread dissemination of this information to plant breeders. Description CerealsDB is an online resource containing a range of genomic datasets for wheat (Triticum aestivum that will assist plant breeders and scientists to select the most appropriate markers for marker assisted selection. CerealsDB includes a database which currently contains in excess of 100,000 putative varietal SNPs, of which several thousand have been experimentally validated. In addition, CerealsDB contains databases for DArT markers and EST sequences, and links to a draft genome sequence for the wheat variety Chinese Spring. Conclusion CerealsDB is an open access website that is rapidly becoming an invaluable resource within the wheat research and plant breeding communities.

  3. PGSB/MIPS PlantsDB Database Framework for the Integration and Analysis of Plant Genome Data.

    Science.gov (United States)

    Spannagl, Manuel; Nussbaumer, Thomas; Bader, Kai; Gundlach, Heidrun; Mayer, Klaus F X

    2017-01-01

    Plant Genome and Systems Biology (PGSB), formerly Munich Institute for Protein Sequences (MIPS) PlantsDB, is a database framework for the integration and analysis of plant genome data, developed and maintained for more than a decade now. Major components of that framework are genome databases and analysis resources focusing on individual (reference) genomes providing flexible and intuitive access to data. Another main focus is the integration of genomes from both model and crop plants to form a scaffold for comparative genomics, assisted by specialized tools such as the CrowsNest viewer to explore conserved gene order (synteny). Data exchange and integrated search functionality with/over many plant genome databases is provided within the transPLANT project.

  4. MELCOR DB Construction for the Severe Accident Analysis DB

    International Nuclear Information System (INIS)

    Song, Y. M.; Ahn, K. I.

    2011-01-01

    The Korea Atomic Energy Research Institute (KAERI) has been constructing a severe accident analysis database (DB) under a National Nuclear R and D Program. In particular, an MAAP (commercial code being widely used in industries for integrated severe accident analysis) DB for many scenarios including a station blackout (SBO) has been completed. This paper shows the MELCOR DB construction process with examples of SBO scenarios, and the results will be used for a comparison with the MAAP DB

  5. Set-Valued Stochastic Equation with Set-Valued Square Integrable Martingale

    Directory of Open Access Journals (Sweden)

    Li Jun-Gang

    2017-01-01

    Full Text Available In this paper, we shall introduce the stochastic integral of a stochastic process with respect to set-valued square integrable martingale. Then we shall give the Aumann integral measurable theorem, and give the set-valued stochastic Lebesgue integral and set-valued square integrable martingale integral equation. The existence and uniqueness of solution to set-valued stochastic integral equation are proved. The discussion will be useful in optimal control and mathematical finance in psychological factors.

  6. The strategic value of partial vertical integration

    OpenAIRE

    Fiocco, Raffaele

    2014-01-01

    We investigate the strategic incentives for partial vertical integration, namely, partial ownership agreements between manufacturers and retailers, when retailers privately know their costs and engage in differentiated good price competition. The partial misalignment between the profit objectives within a partially integrated manufacturer-retailer hierarchy entails a higher retail price than under full integration. This `information vertical effect' translates into an opposite ...

  7. Integrity and the Value of an Integrated Self

    NARCIS (Netherlands)

    Archer, Alfred

    What is integrity and why is it valuable? One account of the nature of integrity, proposed by John Cottingham (2010) amongst others, is The Integrated Self View. On this account integrity is a formal relation of coherence between various aspects of a person. One problem that has been raised against

  8. The Contingent Value of Organizational Integration

    Directory of Open Access Journals (Sweden)

    Virpi Turkulainen

    2013-08-01

    Full Text Available We elaborate the link between organizational design and effectiveness by examining organizational integration and performance in the context of modern manufacturing. Through careful contextualization and empirical analysis of 266 manufacturing organizations in three industries and nine countries, we uncover a joint effect of integration and complexity on organizational effectiveness. The results extend structural contingency theory, in particular the mechanisms that link organizational integration to organizational effectiveness. We conclude by discussing the continuing relevance of structural contingency theory.

  9. Set-Valued Stochastic Lebesque Integral and Representation Theorems

    Directory of Open Access Journals (Sweden)

    Jungang Li

    2008-06-01

    Full Text Available In this paper, we shall firstly illustrate why we should introduce set-valued stochastic integrals, and then we shall discuss some properties of set-valued stochastic processes and the relation between a set-valued stochastic process and its selection set. After recalling the Aumann type definition of stochastic integral, we shall introduce a new definition of Lebesgue integral of a set-valued stochastic process with respect to the time t . Finally we shall prove the presentation theorem of set-valued stochastic integral and dis- cuss further properties that will be useful to study set-valued stochastic differential equations with their applications.

  10. Value Creation Through Integrated Networks and Convergence

    Energy Technology Data Exchange (ETDEWEB)

    De Martini, Paul; Taft, Jeffrey D.

    2015-04-01

    Customer adoption of distributed energy resources and public policies are driving changes in the uses of the distribution system. A system originally designed and built for one-way energy flows from central generating facilities to end-use customers is now experiencing injections of energy from customers anywhere on the grid and frequent reversals in the direction of energy flow. In response, regulators and utilities are re-thinking the design and operations of the grid to create more open and transactive electric networks. This evolution has the opportunity to unlock significant value for customers and utilities. Alternatively, failure to seize this potential may instead lead to an erosion of value if customers seek to defect and disconnect from the system. This paper will discuss how current grid modernization investments may be leveraged to create open networks that increase value through the interaction of intelligent devices on the grid and prosumerization of customers. Moreover, even greater value can be realized through the synergistic effects of convergence of multiple networks. This paper will highlight examples of the emerging nexus of non-electric networks with electricity.

  11. Integrals of operator-valued functions

    Directory of Open Access Journals (Sweden)

    Raimond A. Struble

    1988-01-01

    Full Text Available Mikusinski-type expansions of operator-valued functions are discussed in some detail. As a natural part of the development, a “kernel” concept for operators is proposed and an elaborate system of convolution quotients in one and two variables is obtained.

  12. Aumann Type Set-valued Lebesgue Integral and Representation Theorem

    Directory of Open Access Journals (Sweden)

    Jungang Li

    2009-03-01

    Full Text Available n this paper, we shall firstly illustrate why we should discuss the Aumann type set-valued Lebesgue integral of a set-valued stochastic process with respect to time t under the condition that the set-valued stochastic process takes nonempty compact subset of d -dimensional Euclidean space. After recalling some basic results about set-valued stochastic processes, we shall secondly prove that the Aumann type set-valued Lebesgue integral of a set-valued stochastic process above is a set-valued stochastic process. Finally we shall give the representation theorem, and prove an important inequality of the Aumann type set-valued Lebesgue integrals of set-valued stochastic processes with respect to t , which are useful to study set-valued stochastic differential inclusions with applications in finance.

  13. Development and Integration of Professional Core Values Among Practicing Clinicians.

    Science.gov (United States)

    McGinnis, Patricia Quinn; Guenther, Lee Ann; Wainwright, Susan F

    2016-09-01

    The physical therapy profession has adopted professional core values, which define expected values for its members, and developed a self-assessment tool with sample behaviors for each of the 7 core values. However, evidence related to the integration of these core values into practice is limited. The aims of this study were: (1) to gain insight into physical therapists' development of professional core values and (2) to gain insight into participants' integration of professional core values into clinical practice. A qualitative design permitted in-depth exploration of the development and integration of the American Physical Therapy Association's professional core values into physical therapist practice. Twenty practicing physical therapists were purposefully selected to explore the role of varied professional, postprofessional, and continuing education experiences related to exposure to professional values. The Core Values Self-Assessment and résumé sort served as prompts for reflection via semistructured interviews. Three themes were identified: (1) personal values were the foundation for developing professional values, which were further shaped by academic and clinical experiences, (2) core values were integrated into practice independent of practice setting and varied career paths, and (3) participants described the following professional core values as well integrated into their practice: integrity, compassion/caring, and accountability. Social responsibility was an area consistently identified as not being integrated into their practice. The Core Values Self-Assessment tool is a consensus-based document developed through a Delphi process. Future studies to establish reliability and construct validity of the tool may be warranted. Gaining an in-depth understanding of how practicing clinicians incorporate professional core values into clinical practice may shed light on the relationship between core values mastery and its impact on patient care. Findings may

  14. Integrating SMMEs into Value Chains: The Role of South Africa's ...

    African Journals Online (AJOL)

    enterprises (SMMEs) is to deepen their integration into industry value chains. The goal of this article is to analyse the role and changing activities of one South African support programme for SMME development, the Tourism Enterprise Programme, which is committed to integrating SMMEs into tourism value chains.

  15. Lingual thyroid: value of integrated imaging

    Energy Technology Data Exchange (ETDEWEB)

    Giovagnorio, F. [Sezione di Radiologia e Diagnostica per Immagini, Dipt. di Medicina Sperimentale e Patologia, Univ. `La Sapienza`, Rome (Italy); Cordier, A. [Ist. di Clinica Otorinolaringoiatrica, Univ. `La Sapienza`, Rome (Italy); Romeo, R. [Ist. di Clinica Otorinolaringoiatrica, Univ. `La Sapienza`, Rome (Italy)

    1996-02-01

    Lingual thyroid is an uncommon cause of oropharyngeal mass, due to a congential anomaly of thyroidal development and migration: It is defined precisely as the presence of thyroid tissue in the midline of the tongue base between circumvallatae papilae and the epiglottis. We report a case of lignual thyroid in which the integration of clinical data, sonography, color-duplex Doppler, MRI and scintigraphy was determinant in demonstrating the disease. A 22-year-old woman presented with a sensation of foreign body in the throat, dysphonia, dyspnoea and dysphagia; we performed sonography (7.5 MHz linear probe), color Doppler (7 MHz Doppler frequeny, PRF 3500 Hz) and MRI (1.5 T, spin-echo T1- and T2-weighted images with administration of Gd-DTPA); a scan with {sup 123}I demonstrated a relevant uptake at the base of the tongue, but no uptake at the typical thyroid location. The gland was removed and partially transplanted in the strap muscles of the neck. (orig.)

  16. Lingual thyroid: value of integrated imaging

    International Nuclear Information System (INIS)

    Giovagnorio, F.; Cordier, A.; Romeo, R.

    1996-01-01

    Lingual thyroid is an uncommon cause of oropharyngeal mass, due to a congential anomaly of thyroidal development and migration: It is defined precisely as the presence of thyroid tissue in the midline of the tongue base between circumvallatae papilae and the epiglottis. We report a case of lignual thyroid in which the integration of clinical data, sonography, color-duplex Doppler, MRI and scintigraphy was determinant in demonstrating the disease. A 22-year-old woman presented with a sensation of foreign body in the throat, dysphonia, dyspnoea and dysphagia; we performed sonography (7.5 MHz linear probe), color Doppler (7 MHz Doppler frequeny, PRF 3500 Hz) and MRI (1.5 T, spin-echo T1- and T2-weighted images with administration of Gd-DTPA); a scan with 123 I demonstrated a relevant uptake at the base of the tongue, but no uptake at the typical thyroid location. The gland was removed and partially transplanted in the strap muscles of the neck. (orig.)

  17. MelanomaDB: a Web Tool for Integrative Analysis of Melanoma Genomic Information to Identify Disease-Associated Molecular Pathways

    Directory of Open Access Journals (Sweden)

    Alexander Joseph Trevarton

    2013-07-01

    Full Text Available Despite on-going research, metastatic melanoma survival rates remain low and treatment options are limited. Researchers can now access a rapidly growing amount of molecular and clinical information about melanoma. This information is becoming difficult to assemble and interpret due to its dispersed nature, yet as it grows it becomes increasingly valuable for understanding melanoma. Integration of this information into a comprehensive resource to aid rational experimental design and patient stratification is needed. As an initial step in this direction, we have assembled a web-accessible melanoma database, MelanomaDB, which incorporates clinical and molecular data from publically available sources, which will be regularly updated as new information becomes available. This database allows complex links to be drawn between many different aspects of melanoma biology: genetic changes (e.g. mutations in individual melanomas revealed by DNA sequencing, associations between gene expression and patient survival, data concerning drug targets, biomarkers, druggability and clinical trials, as well as our own statistical analysis of relationships between molecular pathways and clinical parameters that have been produced using these data sets. The database is freely available at http://genesetdb.auckland.ac.nz/melanomadb/about.html . A subset of the information in the database can also be accessed through a freely available web application in the Illumina genomic cloud computing platform BaseSpace at http://www.biomatters.com/apps/melanoma-profiler-for-research . This illustrates dysregulation of specific signalling pathways, both across 310 exome-sequenced melanomas and in individual tumours and identifies novel features about the distribution of somatic variants in melanoma. We suggest that this database can provide a context in which to interpret the tumour molecular profiles of individual melanoma patients relative to biological information and available

  18. Everyday value conflicts and integrative complexity of thought.

    Science.gov (United States)

    Myyry, Liisa

    2002-12-01

    This study examined the value pluralism model in everyday value conflicts, and the effect of issue context on complexity of thought. According to the cognitive manager model we hypothesized that respondents would obtain a higher level of integrative complexity on personal issues that on professional and general issues. We also explored the relations of integrative complexity to value priorities, measured by the Schwartz Value Survey, and to emotional empathy. The value pluralism model was not supported by the data collected from 126 university students from social science, business and technology. The cognitive manager model was partially confirmed by data from females but not from males. Concerning value priorities, more complex respondents had higher regard for self-transcendence values, and less complex respondents for self-enhancement values Emotional empathy was also significantly related to complexity score.

  19. THE VALUE OF INTEGRITY IN THE REPORTS OF WORK

    Directory of Open Access Journals (Sweden)

    Simona-Roxana ULMAN

    2015-03-01

    Full Text Available The most important aim of this paper is to identify the main general ethical values conducting to personal integrity, to build the general ethical values pyramid and, so, helping to improve the reports of labor for having positive results on the economic field. In this context, the human psychological development theory thorough by Maslow is exploited as example for the building of a human values hierarchy necessary to the individual as a social being to engage in normal interactions with the others. These general values are an imperative for the person’s integration in society, also contributing to his belonging society’s welfare and to its performance.

  20. Optimal stability polynomials for numerical integration of initial value problems

    KAUST Repository

    Ketcheson, David I.; Ahmadia, Aron

    2013-01-01

    We consider the problem of finding optimally stable polynomial approximations to the exponential for application to one-step integration of initial value ordinary and partial differential equations. The objective is to find the largest stable step

  1. Some BMO estimates for vector-valued multilinear singular integral ...

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    the multilinear operator related to some singular integral operators is obtained. The main purpose of this paper is to establish the BMO end-point estimates for some vector-valued multilinear operators related to certain singular integral operators. First, let us introduce some notations [10,16]. Throughout this paper, Q = Q(x,r).

  2. Creating integral value for stakeholders in closed loop supply chains

    NARCIS (Netherlands)

    Schenkel, Maren; Krikke, Harold; Caniëls, Marjolein CJ; van der Laan, Erwin

    This paper contributes to the existing literature by researching integral value creation in closed loop supply chains (CLSCs). We distinguish between multiple types of business value, strategic success factors, and multiple groups of stakeholders that affect and are affected by CLSC activities. To

  3. Satisfaction with virtual worlds: An integrated model of experiential value

    NARCIS (Netherlands)

    Verhagen, T.; Feldberg, J.F.M.; van den Hooff, B.J.; Meents, S.; Merikivi, J.

    2011-01-01

    Although virtual worlds increasingly attract users today, few studies have addressed what satisfies virtual world users. We therefore defined and tested an integrated model of experiential system value and virtual world satisfaction. Drawing upon expectancy-value and cognitive evaluation theories,

  4. Note: A 102 dB dynamic-range charge-sampling readout for ionizing particle/radiation detectors based on an application-specific integrated circuit (ASIC)

    Science.gov (United States)

    Pullia, A.; Zocca, F.; Capra, S.

    2018-02-01

    An original technique for the measurement of charge signals from ionizing particle/radiation detectors has been implemented in an application-specific integrated circuit form. The device performs linear measurements of the charge both within and beyond its output voltage swing. The device features an unprecedented spectroscopic dynamic range of 102 dB and is suitable for high-resolution ion and X-γ ray spectroscopy. We believe that this approach may change a widespread paradigm according to which no high-resolution spectroscopy is possible when working close to or beyond the limit of the preamplifier's output voltage swing.

  5. ProteomicsDB.

    Science.gov (United States)

    Schmidt, Tobias; Samaras, Patroklos; Frejno, Martin; Gessulat, Siegfried; Barnert, Maximilian; Kienegger, Harald; Krcmar, Helmut; Schlegl, Judith; Ehrlich, Hans-Christian; Aiche, Stephan; Kuster, Bernhard; Wilhelm, Mathias

    2018-01-04

    ProteomicsDB (https://www.ProteomicsDB.org) is a protein-centric in-memory database for the exploration of large collections of quantitative mass spectrometry-based proteomics data. ProteomicsDB was first released in 2014 to enable the interactive exploration of the first draft of the human proteome. To date, it contains quantitative data from 78 projects totalling over 19k LC-MS/MS experiments. A standardized analysis pipeline enables comparisons between multiple datasets to facilitate the exploration of protein expression across hundreds of tissues, body fluids and cell lines. We recently extended the data model to enable the storage and integrated visualization of other quantitative omics data. This includes transcriptomics data from e.g. NCBI GEO, protein-protein interaction information from STRING, functional annotations from KEGG, drug-sensitivity/selectivity data from several public sources and reference mass spectra from the ProteomeTools project. The extended functionality transforms ProteomicsDB into a multi-purpose resource connecting quantification and meta-data for each protein. The rich user interface helps researchers to navigate all data sources in either a protein-centric or multi-protein-centric manner. Several options are available to download data manually, while our application programming interface enables accessing quantitative data systematically. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.

  6. TcruziDB, an Integrated Database, and the WWW Information Server for the Trypanosoma cruzi Genome Project

    Directory of Open Access Journals (Sweden)

    Degrave Wim

    1997-01-01

    Full Text Available Data analysis, presentation and distribution is of utmost importance to a genome project. A public domain software, ACeDB, has been chosen as the common basis for parasite genome databases, and a first release of TcruziDB, the Trypanosoma cruzi genome database, is available by ftp from ftp://iris.dbbm.fiocruz.br/pub/genomedb/TcruziDB as well as versions of the software for different operating systems (ftp://iris.dbbm.fiocruz.br/pub/unixsoft/. Moreover, data originated from the project are available from the WWW server at http://www.dbbm.fiocruz.br. It contains biological and parasitological data on CL Brener, its karyotype, all available T. cruzi sequences from Genbank, data on the EST-sequencing project and on available libraries, a T. cruzi codon table and a listing of activities and participating groups in the genome project, as well as meeting reports. T. cruzi discussion lists (tcruzi-l@iris.dbbm.fiocruz.br and tcgenics@iris.dbbm.fiocruz.br are being maintained for communication and to promote collaboration in the genome project

  7. SensorDB: a virtual laboratory for the integration, visualization and analysis of varied biological sensor data.

    Science.gov (United States)

    Salehi, Ali; Jimenez-Berni, Jose; Deery, David M; Palmer, Doug; Holland, Edward; Rozas-Larraondo, Pablo; Chapman, Scott C; Georgakopoulos, Dimitrios; Furbank, Robert T

    2015-01-01

    To our knowledge, there is no software or database solution that supports large volumes of biological time series sensor data efficiently and enables data visualization and analysis in real time. Existing solutions for managing data typically use unstructured file systems or relational databases. These systems are not designed to provide instantaneous response to user queries. Furthermore, they do not support rapid data analysis and visualization to enable interactive experiments. In large scale experiments, this behaviour slows research discovery, discourages the widespread sharing and reuse of data that could otherwise inform critical decisions in a timely manner and encourage effective collaboration between groups. In this paper we present SensorDB, a web based virtual laboratory that can manage large volumes of biological time series sensor data while supporting rapid data queries and real-time user interaction. SensorDB is sensor agnostic and uses web-based, state-of-the-art cloud and storage technologies to efficiently gather, analyse and visualize data. Collaboration and data sharing between different agencies and groups is thereby facilitated. SensorDB is available online at http://sensordb.csiro.au.

  8. A Generalized Analytic Operator-Valued Function Space Integral and a Related Integral Equation

    International Nuclear Information System (INIS)

    Chang, K.S.; Kim, B.S.; Park, C.H.; Ryu, K.S.

    2003-01-01

    We introduce a generalized Wiener measure associated with a Gaussian Markov process and define a generalized analytic operator-valued function space integral as a bounded linear operator from L p into L p-ci r cumflexprime (1< p ≤ 2) by the analytic continuation of the generalized Wiener integral. We prove the existence of the integral for certain functionals which involve some Borel measures. Also we show that the generalized analytic operator-valued function space integral satisfies an integral equation related to the generalized Schroedinger equation. The resulting theorems extend the theory of operator-valued function space integrals substantially and previous theorems about these integrals are generalized by our results

  9. An Extension of the Mean Value Theorem for Integrals

    Science.gov (United States)

    Khalili, Parviz; Vasiliu, Daniel

    2010-01-01

    In this note we present an extension of the mean value theorem for integrals. The extension we consider is motivated by an older result (here referred as Corollary 2), which is quite classical for the literature of Mathematical Analysis or Calculus. We also show an interesting application for computing the sum of a harmonic series.

  10. Integral Methodological Pluralism in Science Education Research: Valuing Multiple Perspectives

    Science.gov (United States)

    Davis, Nancy T.; Callihan, Laurie P.

    2013-01-01

    This article examines the multiple methodologies used in educational research and proposes a model that includes all of them as contributing to understanding educational contexts and research from multiple perspectives. The model, based on integral theory (Wilber in a theory of everything. Shambhala, Boston, 2000) values all forms of research as…

  11. The Value of ERP Curriculum Integration: Perspectives from the Research

    Science.gov (United States)

    Hepner, Michelle; Dickson, Warren

    2013-01-01

    In the current economic conditions, many institutions face dwindling budgets and an increased focus on proving the value of the education provided. The effort and costs required to integrate Enterprise Resource Planning systems into course curricula are a significant investment of resources for any university. This paper examines the expense of…

  12. A commitment to values. A system integrates core values with leadership development.

    Science.gov (United States)

    Maxfield, M M

    1991-01-01

    The Values in Leadership program, a new leadership development program created by the Sisters of Charity Health Care Systems (SCHCS), is designed to empower effective leaders to live out personal values compatible with those of the organization. The program, designed for middle and senior managers, comprises seven educational modules- Living Our Values; Valuing Individual Differences; Leader as Servant; Leader as Visionary; Leader as Catalyst; Leader as Mentor; Formative Leadership; and Leader as Mentor; Motivational Coaching. Throughout the sessions, participants discuss the four roles of an effective leader-servant, visionary, catalyst, and mentor-which are grounded in SCHCS core values. Participants are also challenged to identify specific actions that can be integrated into their leadership styles. These actions, drawn from SCHCS leadership practices and core values, are reinforced when participants return to their jobs and write plans to incorporate these practices into their daily work.

  13. Value Priorities and Behavior: Applying a Theory of Integrated Value Systems

    Directory of Open Access Journals (Sweden)

    Shalom Schwartz

    2016-02-01

    Full Text Available A major goal of research on values has been to relate individual differences in value priorities to differences in attitudes, behavior and background variables. Past research most commonly adopted one of two approaches. Much research has selected a few single target values whose priorities were postulated to associate with the attitude, behavior and background variable of interest and then examined empirical relationships. Other research has been more exploratory.It has related lists of values to various other variables and then discussed the significant associations that emerge. The focus on relationships with single values make both these approaches insatisfying. My work has sought to overcome those approaches.It has derived what may be a nearly comprehensive set of different motivational types of values, recognized across cultures. Each value type is represented by a number of single values that are combined to form relatively reliable indexes of values priorities. Value systems can be treated as integrated wholes in their relations with behaviors and, thereby, encourages researches to abandom the prevailing single-values approaches. 

  14. Convergence theorems for Banach space valued integrable multifunctions

    Directory of Open Access Journals (Sweden)

    Nikolaos S. Papageorgiou

    1987-01-01

    Full Text Available In this work we generalize a result of Kato on the pointwise behavior of a weakly convergent sequence in the Lebesgue-Bochner spaces LXP(Ω (1≤p≤∞. Then we use that result to prove Fatou's type lemmata and dominated convergence theorems for the Aumann integral of Banach space valued measurable multifunctions. Analogous convergence results are also proved for the sets of integrable selectors of those multifunctions. In the process of proving those convergence theorems we make some useful observations concerning the Kuratowski-Mosco convergence of sets.

  15. NCX-DB: a unified resource for integrative analysis of the sodium calcium exchanger super-family.

    Science.gov (United States)

    Bode, Katrin; O'Halloran, Damien M

    2018-04-13

    Na + /Ca 2+ exchangers are low-affinity high-capacity transporters that mediate Ca 2+ extrusion by coupling Ca 2+ efflux to the influx of Na + ions. The Na + /Ca 2+ exchangers form a super-family comprised of three branches each differing in ion-substrate selectivity: Na + /Ca 2+ exchangers (NCX), Na + /Ca 2+ /K + exchangers, and Ca 2+ /cation exchangers. Their primary function is to maintain Ca 2+ homeostasis and play a particularly important role in excitable cells that experience transient Ca 2+ fluxes. Research into the role and activity of Na + /Ca 2+ exchangers has focused extensively on the cardio-vascular system, however, growing evidence suggests that Na + /Ca 2+ exchangers play a key role in neuronal processes such as memory formation, learning, oligodendrocyte differentiation, neuroprotection during brain ischemia and axon guidance. They have also been implicated in pathologies such as Alzheimer's disease, Parkinson's disease, Multiple Sclerosis and Epilepsy, however, a clear understanding of their mechanism during disease is lacking. To date, there has never been a central resource or database for Na + /Ca 2+ exchangers. With clear disease relevance and ever-increasing research on Na + /Ca 2+ exchangers from both model and non-model species, a database that unifies the data on Na + /Ca 2+ exchangers is needed for future research. NCX-DB is a publicly available database with a web interface that enables users to explore various Na + /Ca 2+ exchangers, perform cross-species sequence comparison, identify new exchangers, and stay-up to date with recent literature. NCX-DB is available on the web via an interactive user interface with an intuitive design, which is applicable for the identification and comparison of Na + /Ca 2+ exchanger proteins across diverse species.

  16. Towards an integrated theory of value, capital and money

    OpenAIRE

    Cavalieri, Duccio

    2014-01-01

    This is an analysis of the present state of the theory of capital. The paper contains a proposal to reformulate this theory in an ‘late-Marxian’ up-to-dated perspective. The central problem discussed is the integration of the theories of value and capital with those of money and finance. An augmented cost-of-production theory of value is advocated. Special attention is focused on the role of Marx’s ‘monetary expression of labour value’ (MEV), rediscovered and unduly modified by neo-Marxist...

  17. An engineering approach to an integrated value proposition design framework

    Directory of Open Access Journals (Sweden)

    Van Der Merwe, Carmen

    2015-05-01

    Full Text Available Numerous problems with product quality and time-to-market launches can be traced back to how the product lifecycle process is managed within the organisation. This article provides insight into how an integrated value proposition design framework shifts product lifecycle management from a product-centric view to a customer-centric view, through the use of good engineering practices as found in the systems engineering discipline. Combining this with methods and tools such as the Refined Kano model, Blue Ocean strategy, and the Generalised Bass model enables the organisation to enhance product and service quality while reducing the time-to-market for new value proposition launches.

  18. Integral-Value Models for Outcomes over Continuous Time

    DEFF Research Database (Denmark)

    Harvey, Charles M.; Østerdal, Lars Peter

    Models of preferences between outcomes over continuous time are important for individual, corporate, and social decision making, e.g., medical treatment, infrastructure development, and environmental regulation. This paper presents a foundation for such models. It shows that conditions on prefere...... on preferences between real- or vector-valued outcomes over continuous time are satisfied if and only if the preferences are represented by a value function having an integral form......Models of preferences between outcomes over continuous time are important for individual, corporate, and social decision making, e.g., medical treatment, infrastructure development, and environmental regulation. This paper presents a foundation for such models. It shows that conditions...

  19. NETWORK CULTURE - INTEGRAL PART OF NEW VALUES OF CIVIL SOCIETY

    OpenAIRE

    Vyacheslav Vladimirovich Sukhanov

    2014-01-01

    New technologies not only improve working conditions or communication, they are also bringing new values to  the society. This article discusses the concept of «network culture», which is now perceived by society as an integral part of values that can only exist in a civil society. We can research ( find)   this kind of society in modern time period in Russia. The article analyzes the meaning of communication, how to use it, development processes in network media.  Nowadays network culture an...

  20. Professional formation through personal involvement and value integration.

    Science.gov (United States)

    Haugland, Britt Øvrebø; Lassen, Rasmus M; Giske, Tove

    2018-03-01

    Formation is an important part of nursing education, and it is the responsibility of nurse educators to facilitate learning situations that provide students with opportunities for personal discovery. Studies have shown that awareness of one's own vulnerability can be a source of professional maturation and courageous action. The study setting is a Christian university that emphasises its value base through the perspective of diakonia in the nursing programme. Diakonia is understood as the provision of caring. Two hundred and forty-five pages of reflective journals from 124 third-year students were analysed with qualitative content analysis. The main theme of the study was Professional formation through personal involvement and value integration. Four categories emerged: 1) Diakonia as a guide to professional compassion; 2) Consciousness of one's own values; 3) The urge to act courageously; and 4) Choosing to spend the time available. The article discusses how students can integrate values in their professional lives by using all senses when learning in real-life situations and by using systematic reflection alone and together with others. Professional formation is an ongoing process, and we have found that mandatory participation, reiteration and progression are important conditions for such formation to occur. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  1. Optimal stability polynomials for numerical integration of initial value problems

    KAUST Repository

    Ketcheson, David I.

    2013-01-08

    We consider the problem of finding optimally stable polynomial approximations to the exponential for application to one-step integration of initial value ordinary and partial differential equations. The objective is to find the largest stable step size and corresponding method for a given problem when the spectrum of the initial value problem is known. The problem is expressed in terms of a general least deviation feasibility problem. Its solution is obtained by a new fast, accurate, and robust algorithm based on convex optimization techniques. Global convergence of the algorithm is proven in the case that the order of approximation is one and in the case that the spectrum encloses a starlike region. Examples demonstrate the effectiveness of the proposed algorithm even when these conditions are not satisfied.

  2. Instant InnoDB

    CERN Document Server

    Reid, Matt

    2013-01-01

    This book is a complete reference guide, designed to provide you with answers and solutions to all the common problems you encounter within InnoDB, helping you achieve higher performance and greater stability in your InnoDB databases.The ""InnoDB Quick Reference Guide"" features content for all skill levels of MySQL administrators, developers, and engineers.

  3. Mastering MariaDB

    CERN Document Server

    Razzoli, Federico

    2014-01-01

    This book is intended for intermediate users who want to learn how to administrate a MariaDB server or a set of servers. It is aimed at MariaDB users, and hence working knowledge of MariaDB is a prerequisite.

  4. NETWORK CULTURE - INTEGRAL PART OF NEW VALUES OF CIVIL SOCIETY

    Directory of Open Access Journals (Sweden)

    Vyacheslav Vladimirovich Sukhanov

    2014-06-01

    Full Text Available New technologies not only improve working conditions or communication, they are also bringing new values to  the society. This article discusses the concept of «network culture», which is now perceived by society as an integral part of values that can only exist in a civil society. We can research ( find   this kind of society in modern time period in Russia. The article analyzes the meaning of communication, how to use it, development processes in network media.  Nowadays network culture and its influence on society are almost in all spheres of state and society, as well as changes in perception of information and content generation process. Development of the Internet and Internet technologies largely set the tone for  the development of popular culture and allows you to store or to influence the national culture. Internet press today is and example which shows us, how this kind of tool can be used to influence on citizens.DOI: http://dx.doi.org/10.12731/2218-7405-2014-3-6

  5. Supply chain integration scales validation and benchmark values

    Directory of Open Access Journals (Sweden)

    Juan A. Marin-Garcia

    2013-06-01

    Full Text Available Purpose: The clarification of the constructs of the supply chain integration (clients, suppliers, external and internal, the creation of a measurement instrument based on a list of items taken from earlier papers, the validation of these scales and a preliminary benchmark to interpret the scales by percentiles based on a set of control variables (size of the plant, country, sector and degree of vertical integration. Design/methodology/approach: Our empirical analysis is based on the HPM project database (2005-2007 timeframe. The international sample is made up of 266 plants across ten countries: Austria, Canada, Finland, Germany, Italy, Japan, Korea, Spain, Sweden and the USA. In each country. We analized the descriptive statistics, internal consistency testing to purify the items (inter-item correlations, Cronbach’s alpha, squared multiple correlation, corrected item-total correlation, exploratory factor analysis, and finally, a confirmatory factor analysis to check the convergent and discriminant validity of the scales. The analyses will be done with the SPSS and EQS programme using the maximum likelihood parameter estimation method. Findings: The four proposed scales show excellent psychometric properties. Research limitations/implications: with a clearer and more concise designation of the supply chain integration measurement scales more reliable and accurate data could be taken to analyse the relations between these constructs with other variables of interest to the academic l fields. Practical implications: providing scales that are valid as a diagnostic tool for best practices, as well as providing a benchmark with which to compare the score for each individual plant against a collection of industrial companies from the machinery, electronics and transportation sectors. Originality/value: supply chain integration may be a major factor in explaining the performance of companies. The results are nevertheless inconclusive, the vast range

  6. Ultrasonographic Characterization of the db/db Mouse: An Animal Model of Metabolic Abnormalities

    Directory of Open Access Journals (Sweden)

    Francesco Faita

    2018-01-01

    Full Text Available The availability of an animal model able to reliably mirror organ damage occurring in metabolic diseases is an urgent need. These models, mostly rodents, have not been fully characterized in terms of cardiovascular, renal, and hepatic ultrasound parameters, and only sparse values can be found in literature. Aim of this paper is to provide a detailed, noninvasive description of the heart, vessels, liver, and kidneys of the db/db mouse by ultrasound imaging. Sixteen wild type and thirty-four db/db male mice (11-week-old were studied. State-of-the-art ultrasound technology was used to acquire images of cardiovascular, renal, and hepatic districts. A set of parameters describing function of the selected organs was evaluated. db/db mice are characterized by systolic and diastolic dysfunction, confirmed by strain analysis. Abdominal aortic and carotid stiffness do not seem to be increased in diabetic rodents; furthermore, they are characterized by a smaller mean diameter for both vessels. Renal microcirculation is significantly compromised, while liver steatosis is only slightly higher in db/db mice than in controls. We offer here for the first time an in vivo detailed ultrasonographic characterization of the db/db mouse, providing a useful tool for a thoughtful choice of the right rodent model for any experimental design.

  7. The Eimeria Transcript DB: an integrated resource for annotated transcripts of protozoan parasites of the genus Eimeria

    Science.gov (United States)

    Rangel, Luiz Thibério; Novaes, Jeniffer; Durham, Alan M.; Madeira, Alda Maria B. N.; Gruber, Arthur

    2013-01-01

    Parasites of the genus Eimeria infect a wide range of vertebrate hosts, including chickens. We have recently reported a comparative analysis of the transcriptomes of Eimeria acervulina, Eimeria maxima and Eimeria tenella, integrating ORESTES data produced by our group and publicly available Expressed Sequence Tags (ESTs). All cDNA reads have been assembled, and the reconstructed transcripts have been submitted to a comprehensive functional annotation pipeline. Additional studies included orthology assignment across apicomplexan parasites and clustering analyses of gene expression profiles among different developmental stages of the parasites. To make all this body of information publicly available, we constructed the Eimeria Transcript Database (EimeriaTDB), a web repository that provides access to sequence data, annotation and comparative analyses. Here, we describe the web interface, available sequence data sets and query tools implemented on the site. The main goal of this work is to offer a public repository of sequence and functional annotation data of reconstructed transcripts of parasites of the genus Eimeria. We believe that EimeriaTDB will represent a valuable and complementary resource for the Eimeria scientific community and for those researchers interested in comparative genomics of apicomplexan parasites. Database URL: http://www.coccidia.icb.usp.br/eimeriatdb/ PMID:23411718

  8. Value Chain Envy: Explaining New Entry and Vertical Integration in Popular Music

    NARCIS (Netherlands)

    Mol, J.M.; Wijnberg, N.M.; Carroll, C.

    2005-01-01

    The concepts of value creation, value capture, and value protection are employed to explain new entry and vertical integration. It is posited that if, at one stage of the value system, the share of value captured is disproportionally higher than the share of value created, value chain envy will

  9. Value chain envy : Explaining new entry and vertical integration in popular music

    NARCIS (Netherlands)

    Mol, J.M.; Wijnberg, N.M.; Carroll, C.

    The concepts of value creation, value capture, and value protection are employed to explain new entry and vertical integration. It is posited that if, at one stage of the value system, the share of value captured is disproportionally higher than the share of value created, value chain envy will

  10. Evaluation of effective J-integral value for 3-D TWC pipe in ABAQUS code

    International Nuclear Information System (INIS)

    Yang, J. S.; You, K. W.; Sung, K. B.; Jung, W. T.; Kim, B. N.

    1999-01-01

    This paper suggests a simple method to estimate the effective J-integral values in applying Leak-Before-Break (LBB) technology to nuclear piping system. In this paper, the effective J-integral estimates were calculated using energy domain integral approach with ABAQUS computer program. In this case, there existed a apparent variation of J-integral values along the crack line through the thickness of pipe. For this reason, several case studies have been performed to evaluate the effective J-integral value. From the results, it was concluded that the simple method suggested in this paper can be effectively used in estimating the effective J-integral value

  11. SilkDB: a knowledgebase for silkworm biology and genomics

    DEFF Research Database (Denmark)

    Wang, Jing; Xia, Qingyou; He, Ximiao

    2005-01-01

    The Silkworm Knowledgebase (SilkDB) is a web-based repository for the curation, integration and study of silkworm genetic and genomic data. With the recent accomplishment of a approximately 6X draft genome sequence of the domestic silkworm (Bombyx mori), SilkDB provides an integrated representati....... SilkDB is publicly accessible at http://silkworm.genomics.org.cn. Udgivelsesdato: 2005-Jan-1...

  12. Value Creation Reporting: Answering the Question ‘Value to Whom’ according to the International Integrated Reporting Framework

    Directory of Open Access Journals (Sweden)

    Soner Gokten

    2017-06-01

    Full Text Available Value Creation Reporting: Answering the Question ‘Value to Whom’ according to the International Integrated Reporting Framework The principal function of integrated reporting is the reporting of value and this phenomenon seems the most philosophical part of the International Framework. This paper discusses what the value concept refers to in the Framework: Value to investors, value to society or value to present and future generations? In this sense, we try to answer this question by highlighting the dynamics of capital formations according to interrelations between capitals and demonstrating the value creation process in the short, medium, and longer term. We show that (1 „profit” is the result of short term value creation, which indicates the „value to value chain stakeholders”, (2 „expected fair value of equity” represents the „value to investors” and (3 „longer term value” represents the „value to society” according to the International Framework. Additionally, we touch on the inadequacies of the current Framework and suggest future research opportunities within the scope of value creation reporting. To our knowledge, this study is the first to provide a detailed framework on the dynamics of capitals usage and it attempts to show the intersection of accounting and finance in terms of value creation reporting.

  13. Integrating structure, conduct and performance into value chain analysis

    NARCIS (Netherlands)

    Santana De Figueiredo Junior, H.; Meuwissen, M.P.M.; Oude Lansink, A.G.J.M.

    2014-01-01

    Value chain analysis has been adopted by several research and funding institutions for analysing local development opportunities. Development practitioners, however, are still looking for more solid grounds for value chain strategy development, especially since the expected outcomes of

  14. Value Creation through ICT Integration in Merger & Acquisition Processes

    DEFF Research Database (Denmark)

    Holm Larsen, Michael

    2005-01-01

    As deals are becoming more complex, and as technology, and the people supporting it, are becoming key drivers of merger and acquisition processes, planning of information and communication technologies in early stages of the integration process is vital to the realization of benefits of an Merger...... & Acquisition process. This statement is substantiated through review of literature from academics as well as practitioners, and case exemplifications of the financial service organization, the Nordea Group. Keywords: ICT Integration, Mergers & Acquisitions, Nordea Group....

  15. Value and Vision-based Methodology in Integrated Design

    DEFF Research Database (Denmark)

    Tollestrup, Christian

    on empirical data from workshop where the Value and Vision-based methodology has been taught. The research approach chosen for this investigation is Action Research, where the researcher plays an active role in generating the data and gains a deeper understanding of the investigated phenomena. The result...... of this thesis is the value transformation from an explicit set of values to a product concept using a vision based concept development methodology based on the Pyramid Model (Lerdahl, 2001) in a design team context. The aim of this thesis is to examine how the process of value transformation is occurring within...... is divided in three; the systemic unfolding of the Value and Vision-based methodology, the structured presentation of practical implementation of the methodology and finally the analysis and conclusion regarding the value transformation, phenomena and learning aspects of the methodology....

  16. Towards the Integration of Value and Coordination Models - Position Paper -

    NARCIS (Netherlands)

    Bodenstaff, L.; Reichert, M.U.; Wieringa, Roelf J.; Pernici, B; Gulla, J.A.

    Cross-organizational collaborations have a high complexity. Modelling these collaborations can be done from di®erent perspectives. For example, the value perspective represents expected value exchanges in a collaboration while the coordination perspective represents the order in which these

  17. Two-dimensional Value Stream Mapping: Integrating the design of the MPC system in the value stream map

    DEFF Research Database (Denmark)

    Powell, Daryl; Olesen, Peter Bjerg

    2013-01-01

    Companies use value stream mapping to identify waste, often in the early stages of a lean implementation. Though the tool helps users to visualize material and information flows and to identify improvement opportunities, a limitation of this approach is the lack of an integrated method...... for analysing and re-designing the MPC system in order to support lean improvement. We reflect on the current literature regarding value stream mapping, and use practical insights in order to develop and propose a two-dimensional value stream mapping tool that integrates the design of the MPC system within...... the material and information flow map....

  18. Is vertical integration adding value to health systems?

    Science.gov (United States)

    Weil, T P

    2000-04-01

    Vertical integration is a concept used by health systems when attempting to achieve economies of scale, greater coordination of services, and improved market penetration. This article focuses on the actual outcomes of utilizing vertical integration in the health field and then compares these findings with those reported in other industries. This analysis concludes that this organizational model does not work particularly well in the health industry, as illustrated by health alliances' poor fiscal performance when they acquire physician practices or when they start their own HMO plans.

  19. [Interprofessional ethical shared values for an integral healthcare].

    Science.gov (United States)

    Galán González-Serna, José María

    2013-01-01

    Healthcare today requires the rapport of diverse professionals to give a comprehensive response to the needs and requirements of the population's health. Codes of ethics are the normative expression of secular reflection on the ethical values of the professions. In this study we aim to identify ethical values shared by various professionals codes of conduct and propose a method for evaluating the ethical estimate. For this reason, we have reviewed codes of ethics of the medical, nursing, physiotherapy, podiatry and psychology professions, identifying 30 values. These values were classified into two groups, depending on if these are shared by the 5 professionals codes or not (VIP vs VP). In order to provide a method for estimating common values it has been designed a survey likert type. Is possible to conclude there are ethical formally shared values identifiable in professional codes of conduct and it is possible to measure the estimate of ethical values accepted by health professionals. This measurement can be an effective aid to apply management methods of human resources that make it possible to achieve the comprehensive assistance based on inter-professional teams.

  20. Added value of integrated bridge systems for shore applications

    NARCIS (Netherlands)

    Hol, R.R.; Heijden, W.F.M. van der

    1997-01-01

    As a result of fast developments in information and communication technology and the trend to reduce costs, the way of operating modem vessels will change. The introduction of integrated bridge systems contributes to solving the problem of the different 'islands of information' as can be seen in the

  1. Integrating social, economic, and ecological values across large landscapes

    Science.gov (United States)

    Jessica E. Halofsky; Megan K. Creutzburg; Miles A. Hemstrom

    2014-01-01

    The Integrated Landscape Assessment Project (ILAP) was a multiyear effort to produce information, maps, and models to help land managers, policymakers, and others conduct mid- to broad-scale (e.g., watersheds to states and larger areas) prioritization of land management actions, perform landscape assessments, and estimate cumulative effects of management actions for...

  2. Scaling CouchDB

    CERN Document Server

    Holt, Bradley

    2011-01-01

    This practical guide offers a short course on scaling CouchDB to meet the capacity needs of your distributed application. Through a series of scenario-based examples, this book lets you explore several methods for creating a system that can accommodate growth and meet expected demand. In the process, you learn about several tools that can help you with replication, load balancing, clustering, and load testing and monitoring. Apply performance tips for tuning your databaseReplicate data, using Futon and CouchDB's RESTful interfaceDistribute CouchDB's workload through load balancingLearn option

  3. Democracy and genetic privacy: the value of bodily integrity.

    Science.gov (United States)

    Beckman, Ludvig

    2005-01-01

    The right to genetic privacy is presently being incorporated in legal systems all over the world. It remains largely unclear however what interests and values this right serves to protect. There are many different arguments made in the literature, yet none takes into account the problem of how particular values can be justified given the plurality of moral and religious doctrines in our societies. In this article theories of public reason are used in order to explore how genetic privacy could be justified in a way that is sensitive to the "fact of pluralism". The idea of public reason is specified as the idea that governments should appeal only to values and beliefs that are acceptable to all reasonable citizens in the justification of rights. In examining prevalent arguments for genetic privacy--based on the value of autonomy or on the value of intimacy--it is concluded that they do not meet this requirement. In dealing with this deficiency in the literature, an argument is developed that genetic privacy is fundamental to the democratic participation of all citizens. By referring to the preconditions of democratic citizenship, genetic privacy can be justified in a way that respects the plurality of comprehensive doctrines of morality and religion in contemporary societies.

  4. Value-Based Medicine and Integration of Tumor Biology.

    Science.gov (United States)

    Brooks, Gabriel A; Bosserman, Linda D; Mambetsariev, Isa; Salgia, Ravi

    2017-01-01

    Clinical oncology is in the midst of a genomic revolution, as molecular insights redefine our understanding of cancer biology. Greater awareness of the distinct aberrations that drive carcinogenesis is also contributing to a growing armamentarium of genomically targeted therapies. Although much work remains to better understand how to combine and sequence these therapies, improved outcomes for patients are becoming manifest. As we welcome this genomic revolution in cancer care, oncologists also must grapple with a number of practical problems. Costs of cancer care continue to grow, with targeted therapies responsible for an increasing proportion of spending. Rising costs are bringing the concept of value into sharper focus and challenging the oncology community with implementation of value-based cancer care. This article explores the ways that the genomic revolution is transforming cancer care, describes various frameworks for considering the value of genomically targeted therapies, and outlines key challenges for delivering on the promise of personalized cancer care. It highlights practical solutions for the implementation of value-based care, including investment in biomarker development and clinical trials to improve the efficacy of targeted therapy, the use of evidence-based clinical pathways, team-based care, computerized clinical decision support, and value-based payment approaches.

  5. Integrating Work Environment Considerations Into Lean and Value Stream Mapping

    DEFF Research Database (Denmark)

    Edwards, Kasper

    (Spear & Bowen, 1999; Womack & Jones, 1996) and is based on standardisation, levelling, and optimisation of work flows through value stream mapping (VSM) (Rother & Shook, 2009) and eliminating waste. Lean is essentially a rationalization approach that will reduce waste and increase productivity thereby...

  6. Quality improvement in food value chains: searching for integrated solutions

    NARCIS (Netherlands)

    Bijman, J.; Bitzer, V.

    2016-01-01

    Quality improvement in food value chains offers both opportunities and challenges for farmers in Africa. This chapter introduces the key concepts that are used in the studies presented in this book. It also provides a short description of each of the chapters. Quality is an elusive concept. It has a

  7. Integrating Effectiveness, Transparency and Fairness into a Value Elicitation Process

    International Nuclear Information System (INIS)

    Fortier, Michael; Sheng, Grant

    2001-01-01

    As part of the evaluation of Canada's proposed nuclear fuel waste disposal concept, the Federal Environmental Assessment and Review Panel (FEARP) undertook an extensive, nation-wide public hearing process. The hearing process itself was contentious and has been criticized on numerous grounds. It is our contention that the fundamental weakness of the FEARP process was that it was designed as an information-based forum, as opposed to a value-based forum.' Our observations and analyses of these hearings indicate that the FEARP envisioned a different purpose and a different outcome of this process than the public in general. As a result, public acceptability for the Concept or even the assessment process itself was not garnered due to a failure in the process to identify, address and incorporate values. To address this, we proposed a seven-step value elicitation process specifically designed to assess public acceptability of the disposal concept. An unfortunate consequence of the flawed public consultation process employed by the FEARP is that it is unclear exactly what it is the public finds unacceptable. Both from discussions and observations, it is difficult to ascertain whether the unacceptability lies with the Concept itself and/or the process by which the Concept was to be assessed. As a result, there is uncertainty as to what questions should be asked and how should the 'unacceptability' be addressed. In other words, does Canada need a new concept? Does Canada need to develop a mechanism for assessing the public acceptability of the Concept? Or both? The inability of the current process to answer such fundamental questions demonstrates the importance of developing an effective public acceptability and consultation process. We submit that, to create an acceptable Public Participation mechanism, it is necessary to found the construction of such a mechanism on the principles of effectiveness, transparency and fairness. Moreover, we believe that the larger decision

  8. Integrating Effectiveness, Transparency and Fairness into a Value Elicitation Process

    Energy Technology Data Exchange (ETDEWEB)

    Fortier, Michael; Sheng, Grant [York Univ., Toronto, ON (Canada). Faculty of Environmental Studies; Collins, Alison [York Centre for Applied Sustainability, Toronto, ON (Canada)

    2001-07-01

    As part of the evaluation of Canada's proposed nuclear fuel waste disposal concept, the Federal Environmental Assessment and Review Panel (FEARP) undertook an extensive, nation-wide public hearing process. The hearing process itself was contentious and has been criticized on numerous grounds. It is our contention that the fundamental weakness of the FEARP process was that it was designed as an information-based forum, as opposed to a value-based forum.' Our observations and analyses of these hearings indicate that the FEARP envisioned a different purpose and a different outcome of this process than the public in general. As a result, public acceptability for the Concept or even the assessment process itself was not garnered due to a failure in the process to identify, address and incorporate values. To address this, we proposed a seven-step value elicitation process specifically designed to assess public acceptability of the disposal concept. An unfortunate consequence of the flawed public consultation process employed by the FEARP is that it is unclear exactly what it is the public finds unacceptable. Both from discussions and observations, it is difficult to ascertain whether the unacceptability lies with the Concept itself and/or the process by which the Concept was to be assessed. As a result, there is uncertainty as to what questions should be asked and how should the 'unacceptability' be addressed. In other words, does Canada need a new concept? Does Canada need to develop a mechanism for assessing the public acceptability of the Concept? Or both? The inability of the current process to answer such fundamental questions demonstrates the importance of developing an effective public acceptability and consultation process. We submit that, to create an acceptable Public Participation mechanism, it is necessary to found the construction of such a mechanism on the principles of effectiveness, transparency and fairness. Moreover, we believe that

  9. dbSNP

    Data.gov (United States)

    U.S. Department of Health & Human Services — dbSNP is a database of single nucleotide polymorphisms (SNPs) and multiple small-scale variations that include insertions/deletions, microsatellites, and...

  10. dbVar

    Data.gov (United States)

    U.S. Department of Health & Human Services — dbVar is a database of genomic structural variation. It accepts data from all species and includes clinical data. It can accept diverse types of events, including...

  11. Message sensation and cognition values: factors of competition or integration?

    Science.gov (United States)

    Xu, Jie

    2015-01-01

    Using the Activation Model of Information Exposure and Elaboration Likelihood Model as theoretical frameworks, this study explored the effects of message sensation value (MSV) and message cognition value (MCV) of antismoking public service announcements (PSAs) on ad processing and evaluation among young adults, and the difference between high sensation seekers and low sensation seekers in their perceptions and responses toward ads with different levels of sensation and cognition value. A 2 (MSV: high vs. low) × 2 (MCV: high vs. low) × 2 (need for sensation: high vs. low) mixed experimental design was conducted. Two physiological measures including skin conductance and heart rate were examined. Findings of this study show that MSV was not a distraction but a facilitator of message persuasiveness. These findings contribute to the activation model. In addition, need for sensation moderated the interaction effect of MSV and MCV on ad processing. Low sensation seekers were more likely to experience the interaction between MSV and MCV than high sensation seekers. Several observations related to the findings and implications for antismoking message designs are elaborated. Limitations and directions for future research are also outlined.

  12. VALUE - Validating and Integrating Downscaling Methods for Climate Change Research

    Science.gov (United States)

    Maraun, Douglas; Widmann, Martin; Benestad, Rasmus; Kotlarski, Sven; Huth, Radan; Hertig, Elke; Wibig, Joanna; Gutierrez, Jose

    2013-04-01

    Our understanding of global climate change is mainly based on General Circulation Models (GCMs) with a relatively coarse resolution. Since climate change impacts are mainly experienced on regional scales, high-resolution climate change scenarios need to be derived from GCM simulations by downscaling. Several projects have been carried out over the last years to validate the performance of statistical and dynamical downscaling, yet several aspects have not been systematically addressed: variability on sub-daily, decadal and longer time-scales, extreme events, spatial variability and inter-variable relationships. Different downscaling approaches such as dynamical downscaling, statistical downscaling and bias correction approaches have not been systematically compared. Furthermore, collaboration between different communities, in particular regional climate modellers, statistical downscalers and statisticians has been limited. To address these gaps, the EU Cooperation in Science and Technology (COST) action VALUE (www.value-cost.eu) has been brought into life. VALUE is a research network with participants from currently 23 European countries running from 2012 to 2015. Its main aim is to systematically validate and develop downscaling methods for climate change research in order to improve regional climate change scenarios for use in climate impact studies. Inspired by the co-design idea of the international research initiative "future earth", stakeholders of climate change information have been involved in the definition of research questions to be addressed and are actively participating in the network. The key idea of VALUE is to identify the relevant weather and climate characteristics required as input for a wide range of impact models and to define an open framework to systematically validate these characteristics. Based on a range of benchmark data sets, in principle every downscaling method can be validated and compared with competing methods. The results of

  13. Approximate calculation method for integral of mean square value of nonstationary response

    International Nuclear Information System (INIS)

    Aoki, Shigeru; Fukano, Azusa

    2010-01-01

    The response of the structure subjected to nonstationary random vibration such as earthquake excitation is nonstationary random vibration. Calculating method for statistical characteristics of such a response is complicated. Mean square value of the response is usually used to evaluate random response. Integral of mean square value of the response corresponds to total energy of the response. In this paper, a simplified calculation method to obtain integral of mean square value of the response is proposed. As input excitation, nonstationary white noise and nonstationary filtered white noise are used. Integrals of mean square value of the response are calculated for various values of parameters. It is found that the proposed method gives exact value of integral of mean square value of the response.

  14. From prejudice to reasonable judgement: integrating (moral) value discussions in university courses

    NARCIS (Netherlands)

    Aalberts, J.M.C.; Koster, E.; Boschhuizen, R.

    2012-01-01

    The central question addressed in this article is how (moral) values discussions in university courses can be integrated in a systematic way. Discussion of (moral) values is fundamental to the Dublin descriptor about judgement formation in use in European universities. To integrate this descriptor

  15. A Riesz Representation Theorem for the Space of Henstock Integrable Vector-Valued Functions

    Directory of Open Access Journals (Sweden)

    Tomás Pérez Becerra

    2018-01-01

    Full Text Available Using a bounded bilinear operator, we define the Henstock-Stieltjes integral for vector-valued functions; we prove some integration by parts theorems for Henstock integral and a Riesz-type theorem which provides an alternative proof of the representation theorem for real functions proved by Alexiewicz.

  16. Galileo: The Added Value for Integrity in Harsh Environments.

    Science.gov (United States)

    Borio, Daniele; Gioia, Ciro

    2016-01-16

    A global navigation satellite system (GNSS)-based navigation is a challenging task in a signal-degraded environments where GNSS signals are distorted by multipath and attenuated by fading effects: the navigation solution may be inaccurate or unavailable. A possible approach to improve accuracy and availability is the joint use of measurements from different GNSSs and quality check algorithms; this approach is investigated here using live GPS and Galileo signals. A modified receiver autonomous integrity monitoring (RAIM) algorithm, including geometry and separability checks, is proposed to detect and exclude erroneous measurements: the multi-constellation approach provides redundant measurements, and RAIM exploits them to exclude distorted observations. The synergy between combined GPS/Galileo navigation and RAIM is analyzed using live data; the performance is compared to the accuracy and availability of a GPS-only solution. The tests performed demonstrate that the methods developed are effective techniques for GNSS-based navigation in signal-degraded environments. The joint use of the multi-constellation approach and of modified RAIM algorithms improves the performance of the navigation system in terms of both accuracy and availability.

  17. Galileo: The Added Value for Integrity in Harsh Environments

    Directory of Open Access Journals (Sweden)

    Daniele Borio

    2016-01-01

    Full Text Available A global navigation satellite system (GNSS-based navigation is a challenging task in a signal-degraded environments where GNSS signals are distorted by multipath and attenuated by fading effects: the navigation solution may be inaccurate or unavailable. A possible approach to improve accuracy and availability is the joint use of measurements from different GNSSs and quality check algorithms; this approach is investigated here using live GPS and Galileo signals. A modified receiver autonomous integrity monitoring (RAIM algorithm, including geometry and separability checks, is proposed to detect and exclude erroneous measurements: the multi-constellation approach provides redundant measurements, and RAIM exploits them to exclude distorted observations. The synergy between combined GPS/Galileo navigation and RAIM is analyzed using live data; the performance is compared to the accuracy and availability of a GPS-only solution. The tests performed demonstrate that the methods developed are effective techniques for GNSS-based navigation in signal-degraded environments. The joint use of the multi-constellation approach and of modified RAIM algorithms improves the performance of the navigation system in terms of both accuracy and availability.

  18. Using patient lists to add value to integrated data repositories.

    Science.gov (United States)

    Wade, Ted D; Zelarney, Pearlanne T; Hum, Richard C; McGee, Sylvia; Batson, Deborah H

    2014-12-01

    Patient lists are project-specific sets of patients that can be queried in integrated data repositories (IDR's). By allowing a set of patients to be an addition to the qualifying conditions of a query, returned results will refer to, and only to, that set of patients. We report a variety of use cases for such lists, including: restricting retrospective chart review to a defined set of patients; following a set of patients for practice management purposes; distributing "honest-brokered" (deidentified) data; adding phenotypes to biosamples; and enhancing the content of study or registry data. Among the capabilities needed to implement patient lists in an IDR are: capture of patient identifiers from a query and feedback of these into the IDR; the existence of a permanent internal identifier in the IDR that is mappable to external identifiers; the ability to add queryable attributes to the IDR; the ability to merge data from multiple queries; and suitable control over user access and de-identification of results. We implemented patient lists in a custom IDR of our own design. We reviewed capabilities of other published IDRs for focusing on sets of patients. The widely used i2b2 IDR platform has various ways to address patient sets, and it could be modified to add the low-overhead version of patient lists that we describe. Copyright © 2014 Elsevier Inc. All rights reserved.

  19. Examining the Perceived Value of Integration of Earned Value Management with Risk Management-Based Performance Measurement Baseline

    Science.gov (United States)

    Shah, Akhtar H.

    2014-01-01

    Many projects fail despite the use of evidence-based project management practices such as Performance Measurement Baseline (PMB), Earned Value Management (EVM) and Risk Management (RM). Although previous researchers have found that integrated project management techniques could be more valuable than the same techniques used by themselves, these…

  20. Methods of integrating Islamic values in teaching biology for shaping attitude and character

    Science.gov (United States)

    Listyono; Supardi, K. I.; Hindarto, N.; Ridlo, S.

    2018-03-01

    Learning is expected to develop the potential of learners to have the spiritual attitude: moral strength, self-control, personality, intelligence, noble character, as well as the skills needed by themselves, society, and nation. Implementation of role and morale in learning is an alternative way which is expected to answer the challenge. The solution offered is to inject student with religious material Islamic in learning biology. The content value of materials teaching biology includes terms of practical value, religious values, daily life value, socio-political value, and the value of art. In Islamic religious values (Qur'an and Hadith) various methods can touch human feelings, souls, and generate motivation. Integrating learning with Islamic value can be done by the deductive or inductive approach. The appropriate method of integration is the amtsal (analog) method, hiwar (dialog) method, targhib & tarhib (encouragement & warning) method, and example method (giving a noble role model / good example). The right strategy in integrating Islamic values is outlined in the design of lesson plan. The integration of Islamic values in lesson plan will facilitate teachers to build students' character because Islamic values can be implemented in every learning steps so students will be accustomed to receiving the character value in this integrated learning.

  1. Integrated manure utilization system life-cycle value assessment

    Energy Technology Data Exchange (ETDEWEB)

    Row, J.; Neabel, D. [Pembina Inst. for Appropriate Development, Drayton Valley, AB (Canada)

    2005-10-15

    A life-cycle assessment of the Alberta Research Council (ARC) and Highmark Renewables' development of an integrated manure utilization system (IMUS) were presented. The assessment focused on an evaluation of factors of primary importance to government, investors and the livestock industry. IMUS technology uses manure as a resource to produce electricity, heat, bio-based fertilizer and reusable water. Results of the assessment indicated that IMUS plants have the potential to be financially viable if a power purchase of $90 MWh on average can be purchased from a 30,000 head livestock operation. A capital cost of under $11 million is necessary, and an established biofertilizer price of $50 per tonne should be established. An IMUS plant was estimated to reduce life-cycle greenhouse gas emissions by 70 to 80 per cent when compared to land spreading. Reductions are accomplished through displacing electricity from the provincial grid and reducing nitrous oxide (N{sub 2}O) emissions from spreading of manure The IMUS plants lessen environment impacts by reducing the extraction and consumption of non-renewable resources, and by displacing an estimated 11,700 GJ of coal and natural gas per 1000 head of cattle per year. In addition, various pathogens within manure are eliminated. The plants have the potential to eliminate the environmental hazards associated with the disposal of deadstock. The systems reduce manure odour, lessen truck traffic and are expected to contribute to rural economic diversification. Barriers to further implementation of IMUS were discussed, as well as emerging opportunities for IMUS developers. It was concluded that the initial assessments of the IMUS were positive. Further investigation is needed to determine actual life-cycle performance of the operations. 18 refs., 3 tabs., 3 figs.

  2. The value of integrating policy people and space in research.

    Science.gov (United States)

    Hecker, Louise; Birla, Ravi K

    2009-03-01

    In this article, we address several tangible and intangible factors, which are difficult to quantify and often overlooked yet are crucial for research success. We discuss three dimensions which encompass: (1) policy, (2) people, and (3) space. Policies, such as rules and regulations, define the culture of any research program/initiative. Governing rules and regulations defined within these policies are dictated by cultural values. Individuals who exhibit strong leadership, promote innovation, and exercise strategic planning often determine the governing policies. People are the most valuable asset available to any institution. Ensuring the professional growth (personal and scientific) and creating an environment which supports collaborative and collegial research through teamwork are factors that are important for individuals. Space, the physical work environment, is the third dimension of our model and is often an underutilized resource. In addition to the physical layout and design of the space, creating a positive work atmosphere which supports research initiatives is equally important and can create valuable momentum to research efforts. Collectively, these three dimensions (policy, people, and space) have a significant impact on the success of any research initiative. The primary objective of this article is to create awareness and emphasize the importance of implementing these variables within research initiatives in academic settings.

  3. On the structure of the commutative Z2 graded algebra valued integrable equations

    International Nuclear Information System (INIS)

    Konopelchenko, B.G.

    1980-01-01

    Partial differential equations integrable by the linear matrix spectral problem of arbitrary order are considered for the case that the 'potentials' take their values in the commutative infinte-dimensional Z 2 graded algebra (superalgebra). The general form of the integrable equations and their Baecklund transformations are found. The infinite sets of the integrals of the motion are constructed. The hamiltonian character of the integrable equations is proved. (orig.)

  4. Note on the Choquet Integral as an Interval-Valued Aggregation Operators and Their Applications

    Directory of Open Access Journals (Sweden)

    Lee-Chae Jang

    2012-01-01

    Full Text Available The concept of an interval-valued capacity is motivated by the goal to generalize a capacity, and it can be used for representing an uncertain capacity. In this paper, we define the discrete interval-valued capacities, a measure of the entropy of a discrete interval-valued capacity, and, Choquet integral with respect to a discrete interval-valued capacity. In particular, we discuss the Choquet integral as an interval-valued aggregation operator and discuss an application of them.

  5. Scaling MongoDB

    CERN Document Server

    Chodorow, Kristina

    2011-01-01

    Create a MongoDB cluster that will to grow to meet the needs of your application. With this short and concise book, you'll get guidelines for setting up and using clusters to store a large volume of data, and learn how to access the data efficiently. In the process, you'll understand how to make your application work with a distributed database system. Scaling MongoDB will help you: Set up a MongoDB cluster through shardingWork with a cluster to query and update dataOperate, monitor, and backup your clusterPlan your application to deal with outages By following the advice in this book, you'l

  6. XMetDB

    DEFF Research Database (Denmark)

    Spjuth, Ola; Rydberg, Patrik; Willighagen, Egon L

    2016-01-01

    Xenobiotic metabolism is an active research topic but the limited amount of openly available high-quality biotransformation data constrains predictive modeling. Current database often default to commonly available information: which enzyme metabolizes a compound, but neither experimental conditions...... nor the atoms that undergo metabolization are captured. We present XMetDB, an open access database for drugs and other xenobiotics and their respective metabolites. The database contains chemical structures of xenobiotic biotransformations with substrate atoms annotated as reaction centra...... is also available. The database is open for data deposition, and a curation scheme is in place for quality control. An extensive guide on how to enter experimental data into is available from the XMetDB wiki. XMetDB formalizes how biotransformation data should be reported, and the openly available...

  7. Integration of Character Values in School Culture at Elementary Schools in Jakarta, Indonesia

    Directory of Open Access Journals (Sweden)

    Arita - Marini

    2017-04-01

    Full Text Available Character values can be integrated not only in the classroom, but also in the school culture. Some teachers are not familiar with the ways of integrating these values in the school culture. The purpose of this study was to find out about implementation of character values integration in school culture at elementary schools in Jakarta. This research was conducted in Jakarta, the capital city of Indonesia. A quantitatively descriptive method was used for this study. Questionnaires related to integration of character values in school culture consists of religious, honesty, discipline, clean and healthy, tolerance, working ethos, and nationalism culture. A total of 63 principals from 63 elementary schools in Jakarta were involved in the study. The result showed that means of character values integration in religious, honesty, discipline, clean and healthy, tolerance, working ethos, and nationalism culture were achieved 13.40, 6.16, 17.71, 13.24, 11.81, 12.33, and 10.49 or 83.75 %, 68.44 %, 98.39 %, 88.27 %, 98.42 %, 94.85 %, and 95.36 % from theoretically maximum scores. This study concludes that character values has already been integrated effectively in religious, discipline, clean and healthy, tolerance, working ethos, and nationalism culture at 63 elementary schools in Jakarta.  On the other hand, integration of character values in honesty culture hasn’t been effective at 63 elementary schools in Jakarta.

  8. Value-based integrated (renal) care: setting a development agenda for research and implementation strategies.

    Science.gov (United States)

    Valentijn, Pim P; Biermann, Claus; Bruijnzeels, Marc A

    2016-08-02

    Integrated care services are considered a vital strategy for improving the Triple Aim values for people with chronic kidney disease. However, a solid scholarly explanation of how to develop, implement and evaluate such value-based integrated renal care services is limited. The aim of this study was to develop a framework to identify the strategies and outcomes for the implementation of value-based integrated renal care. First, the theoretical foundations of the Rainbow Model of Integrated Care and the Triple Aim were united into one overarching framework through an iterative process of key-informant consultations. Second, a rapid review approach was conducted to identify the published research on integrated renal care, and the Cochrane Library, Medline, Scopus, and Business Source Premier databases were searched for pertinent articles published between 2000 and 2015. Based on the framework, a coding schema was developed to synthesis the included articles. The overarching framework distinguishes the integrated care domains: 1) type of integration, 2) enablers of integration and the interrelated outcome domains, 3) experience of care, 4) population health and 5) costs. The literature synthesis indicated that integrated renal care implementation strategies have particularly focused on micro clinical processes and physical outcomes, while little emphasis has been placed on meso organisational as well as macro system integration processes. In addition, evidence regarding patients' perceived outcomes and economic outcomes has been weak. These results underscore that the future challenge for researchers is to explore which integrated care implementation strategies achieve better health and improved experience of care at a lower cost within a specific context. For this purpose, this study's framework and evidence synthesis have set a developmental agenda for both integrated renal care practice and research. Accordingly, we plan further work to develop an implementation

  9. MongoDB high availability

    CERN Document Server

    Mehrabani, Afshin

    2014-01-01

    This book has a perfect balance of concepts and their practical implementation along with solutions to make a highly available MongoDB server with clear instructions and guidance. If you are using MongoDB in a production environment and need a solution to make a highly available MongoDB server, this book is ideal for you. Familiarity with MongoDB is expected so that you understand the content of this book.

  10. Cultivating Perspectival Acuity: The Value and Cost of Integrating Theory, Craft, Research, and Practice

    Directory of Open Access Journals (Sweden)

    Joe Manganelli

    2016-10-01

    Full Text Available This paper presents reflections on integrating theory, craft, research, and practice to improve the accuracy and resiliency of each. The reflections build toward a set of statements about the value and the cost of integrating theory, craft, research, and practice. Specifically, the authors offer the Privileged Work / Non-Privileged Work Framework and concept of cultivating Perspectival Acuity.

  11. Integrating Poverty and Environmental Concerns into Value-Chain Analysis: A Conceptual Framework

    DEFF Research Database (Denmark)

    Bolwig, Simon; Ponte, Stefano; du Toit, Andries

    2010-01-01

    Many policy prescriptions emphasise poverty reduction through closer integration of poor people or areas with global markets. Global value chain (GVC) studies reveal how firms and farms in developing countries are upgraded by being integrated in global markets, but few explicitly document...

  12. 'Ecological value added' in an integrated ecosystem-economy model. An indicator for sustainability

    International Nuclear Information System (INIS)

    Kratena, Kurt

    2004-01-01

    This paper sets up an input-output system of the relevant ecosystem flows that determine the carbon cycle in the global ecosystem. Introducing energy as the value added component in the ecosystem allows to calculate ecosystem prices expressed in 'energy values'. Linking the ecosystem with the economy in an integrated input-output model then allows to calculate prices of economic activities and of ecosystem activities. In analogy to the 'Ecological Footprint', where productive land is needed to absorb anthropogenic emissions, in this integrated input-output model additional carbon sinks are introduced for emission absorption. These carbon sinks need solar energy input, i.e. 'ecological value added'. Emission absorption as well as GDP therefore become activities valued in the numeraire of the integrated system, i.e.'energy values'. From that sustainability indicators can be derived

  13. Integration of Latino/a cultural values into palliative health care: a culture centered model.

    Science.gov (United States)

    Adames, Hector Y; Chavez-Dueñas, Nayeli Y; Fuentes, Milton A; Salas, Silvia P; Perez-Chavez, Jessica G

    2014-04-01

    Culture helps us grapple with, understand, and navigate the dying process. Although often overlooked, cultural values play a critical and influential role in palliative care. The purpose of the present study was two-fold: one, to review whether Latino/a cultural values have been integrated into the palliative care literature for Latinos/as; two, identify publications that provide recommendations on how palliative care providers can integrate Latino/a cultural values into the end-of-life care. A comprehensive systematic review on the area of Latino/a cultural values in palliative care was conducted via an electronic literature search of publications between 1930-2013. Five articles were identified for reviewing, discussing, or mentioning Latino/a cultural values and palliative care. Only one article specifically addressed Latino/a cultural values in palliative care. The four remaining articles discuss or mention cultural values; however, the cultural values were not the main focus of each article's thesis. The results of the current study highlight the lack of literature specifically addressing the importance of integrating Latino/a cultural values into the delivery of palliative care. As a result, this article introduces the Culture-Centered Palliative Care Model (CCPC). The article defines five key traditional Latino/a cultural values (i.e., familismo, personalismo, respeto, confianza, and dignidad), discusses the influence of each value on palliative health care, and ends with practical recommendations for service providers. Special attention is given to the stages of acculturation and ethnic identity.

  14. Active Teaching Methods: Personal Experience of Integrating Spiritual and Moral Values

    Science.gov (United States)

    Kasim, Tengku Sarina Aini Tengku; Yusoff, Yusmini Md

    2014-01-01

    Islamic education has always recognized spiritual and moral values as significant elements in developing a "balanced" human being. One way of demonstrating spiritual and moral concepts is through effective teaching methods that integrate and forefront these values. This article offers an investigation of how the authors' teaching…

  15. Towards an Integrated Value Adding Management Model for FM and CREM

    NARCIS (Netherlands)

    Jensen, Per Anker; van der Voordt, Theo; Kähkönen, Kalle; Keinänen, Marko

    2016-01-01

    Purpose: To present an integrated process model of adding value by Facilities Management (FM) and Corporate Real Estate Management (CREM) that is a generalisation of existing conceptual frameworks and aims to be a basis for management of added value in practice.
    Background: The growing research

  16. An Integrative Approach to Value-Added Planning: From Community Needs to Local Authority Revenue

    NARCIS (Netherlands)

    Cilliers, E.J.; Timmermans, W.

    2015-01-01

    The concept of value-added planning (as part of the Valuing Attractive Landscapes in the Urban Economy, INTERREG IVB North West Europe Project) is introduced in this paper to facilitate integrative planning, focusing on the benefits that use and non-use green spaces can provide to an urban area. The

  17. On Models with Uncountable Set of Spin Values on a Cayley Tree: Integral Equations

    International Nuclear Information System (INIS)

    Rozikov, Utkir A.; Eshkobilov, Yusup Kh.

    2010-01-01

    We consider models with nearest-neighbor interactions and with the set [0, 1] of spin values, on a Cayley tree of order k ≥ 1. We reduce the problem of describing the 'splitting Gibbs measures' of the model to the description of the solutions of some nonlinear integral equation. For k = 1 we show that the integral equation has a unique solution. In case k ≥ 2 some models (with the set [0, 1] of spin values) which have a unique splitting Gibbs measure are constructed. Also for the Potts model with uncountable set of spin values it is proven that there is unique splitting Gibbs measure.

  18. Social Information Is Integrated into Value and Confidence Judgments According to Its Reliability.

    Science.gov (United States)

    De Martino, Benedetto; Bobadilla-Suarez, Sebastian; Nouguchi, Takao; Sharot, Tali; Love, Bradley C

    2017-06-21

    How much we like something, whether it be a bottle of wine or a new film, is affected by the opinions of others. However, the social information that we receive can be contradictory and vary in its reliability. Here, we tested whether the brain incorporates these statistics when judging value and confidence. Participants provided value judgments about consumer goods in the presence of online reviews. We found that participants updated their initial value and confidence judgments in a Bayesian fashion, taking into account both the uncertainty of their initial beliefs and the reliability of the social information. Activity in dorsomedial prefrontal cortex tracked the degree of belief update. Analogous to how lower-level perceptual information is integrated, we found that the human brain integrates social information according to its reliability when judging value and confidence. SIGNIFICANCE STATEMENT The field of perceptual decision making has shown that the sensory system integrates different sources of information according to their respective reliability, as predicted by a Bayesian inference scheme. In this work, we hypothesized that a similar coding scheme is implemented by the human brain to process social signals and guide complex, value-based decisions. We provide experimental evidence that the human prefrontal cortex's activity is consistent with a Bayesian computation that integrates social information that differs in reliability and that this integration affects the neural representation of value and confidence. Copyright © 2017 De Martino et al.

  19. Integrating Values in the Care Giving Activity from the Professional Point of View

    Directory of Open Access Journals (Sweden)

    Juan Carlos Delgado-Antolín

    2014-04-01

    Full Text Available Nurses trained more and more on scientific evidence, often focus their actions based fundamentally on scientific fact, leaving aside other important knowledge that intervene in the care giving relation: communication, personal relationships, respect in the relationship, and knowing all the values implied in said relationship. It is about these values and on their importance within care upon which the author reflects in this article, until concluding on how we can integrate values to the care giving activity.

  20. Integrating values in the care giving activity from the professional point of view.

    Science.gov (United States)

    Delgado-Antolín, Juan Carlos

    2014-01-01

    Nurses trained more and more on scientific evidence, often focus their actions based fundamentally on scientific fact, leaving aside other important knowledge that intervene in the care giving relation: communication, personal relationships, respect in the relationship, and knowing all the values implied in said relationship. It is about these values and on their importance within care upon which the author reflects in this article, until concluding on how we can integrate values to the care giving activity.

  1. Value Co-creation as Part of an Integrative Vision of Innovation Management

    DEFF Research Database (Denmark)

    Gerstlberger, Wolfgang; Knudsen, Mette Præst; Tanev, Stoyan

    2009-01-01

    Value co-creation is an emerging concept in business, marketing and innovation management. Its growing interest points to the emergence of a new semantic wave in innovation research that requires the adoption of new terminology, frameworks and fields of research exploration. There is a number...... an attempt to position the value co-creation paradigm within an integrative vision for innovation management research and practices. This positioning is a challenging task as the meaning of the terms "value co-creation" and "integrative" innovation management need to be more fully clarified. We attempt...... to identify an appropriate plane of conceptual integrity that could be used to describe the innovation management field within the context of its relation to value co-creation....

  2. Integrating the Integrated Care Organisation – Optimising Resources, Operations, and Services to Create Real Value

    OpenAIRE

    Yap, Jason

    2018-01-01

    Introduction: Implementing Integrated Care to promote and protect the health of organisations is massively complex. Historically, healthcare practitioners thought in terms of single patient acute care encounters within healthcare facilities, and seek to help the patient become “apparently well” again. With an ageing population, multiple morbidities, complex socioeconomic factors, and increasing costs, we must now reconsider our paradigms.In Singapore, the focus has been on our “models of care...

  3. MariaDB cookbook

    CERN Document Server

    Bartholomew, Daniel

    2014-01-01

    A practical cookbook, filled with advanced recipes , and plenty of code and commands used for illustration,which will make your learning curve easy and quick.This book is for anyone who wants to learn more about databases in general or MariaDB in particular. Some familiarity with SQL databases is assumed, but the recipes are approachable to almost anyone with basic database skills.

  4. Integration of multiple determinants in the neuronal computation of economic values.

    Science.gov (United States)

    Raghuraman, Anantha P; Padoa-Schioppa, Camillo

    2014-08-27

    Economic goods may vary on multiple dimensions (determinants). A central conjecture in decision neuroscience is that choices between goods are made by comparing subjective values computed through the integration of all relevant determinants. Previous work identified three groups of neurons in the orbitofrontal cortex (OFC) of monkeys engaged in economic choices: (1) offer value cells, which encode the value of individual offers; (2) chosen value cells, which encode the value of the chosen good; and (3) chosen juice cells, which encode the identity of the chosen good. In principle, these populations could be sufficient to generate a decision. Critically, previous work did not assess whether offer value cells (the putative input to the decision) indeed encode subjective values as opposed to physical properties of the goods, and/or whether offer value cells integrate multiple determinants. To address these issues, we recorded from the OFC while monkeys chose between risky outcomes. Confirming previous observations, three populations of neurons encoded the value of individual offers, the value of the chosen option, and the value-independent choice outcome. The activity of both offer value cells and chosen value cells encoded values defined by the integration of juice quantity and probability. Furthermore, both populations reflected the subjective risk attitude of the animals. We also found additional groups of neurons encoding the risk associated with a particular option, the risky nature of the chosen option, and whether the trial outcome was positive or negative. These results provide substantial support for the conjecture described above and for the involvement of OFC in good-based decisions. Copyright © 2014 the authors 0270-6474/14/3311583-21$15.00/0.

  5. Integrating Turkish Work and Achievement Goals With Schwartz’s Human Values

    Directory of Open Access Journals (Sweden)

    Suna Tevrüz

    2015-05-01

    Full Text Available The purpose of this study was to examine the integration of indigenous values developed in Turkey to Schwartz’s universal values. Students (N = 593 from six universities in Istanbul responded the value scale, which consists of 10 etic PVQ items (each item representing one of 10 main Schwartz values and 23 emic WAG items (representing work-achievement goals. PROXSCAL, a multidimensional scaling method, was used to test whether etic and emic sets of values integrate and form the universal circular structure proposed in Schwartz value theory. The motivational continuum of values as a circular structure was similar to pan-cultural results, but adding another value type to the openness to change pole. While some of the items in this region represent autonomy of thought, remaining items diverge. The principle of conflicting values on opposite poles was not supported in relation to openness to change-conservation dimension. These two poles had similar priorities, contrasting with pan-cultural results, and demonstrating a culture-specific aspect of responding to motivational goals. Insights gained by emic studies will be functional in enriching understanding values, and contributing to the comprehensiveness and universality of Schwartz value theory.

  6. Customer Focused Product Design Using Integrated Model of Target Costing, Quality Function Deployment and Value Engineering

    Directory of Open Access Journals (Sweden)

    Hossein Rezaei Dolatabadi

    2013-01-01

    Full Text Available Target costing by integrating customer requirements, technical attributes and cost information into the product design phase and eliminating the non-value added functions, plays a vital role in different phases of the product life cycle. Quality Function Deployment (QFD and Value Engineering (VE are two techniques which can be used for applying target costing, successfully. The purpose of this paper is to propose an integrated model of target costing, QFD and VE to explore the role of target costing in managing product costs while promoting quality specifications meeting customers’ needs. F indings indicate that the integration of target costing, QFD and VE is an essential technique in managing the costs of production process. Findings also imply that integration of the three techniques provides a competitive cost advantage to companies.

  7. The observation of biology implemented by integrated religion values in integrated Islamic school (Decriptive Study in X Integrated Senior Hight School Tasikmalaya)

    Science.gov (United States)

    Nurjanah, E.; Adisendjaja, Y. H.; Kusumastuti, M. N.

    2018-05-01

    The learning Integrated Religious value is one of the efforts to increase the motivation of learning and building the student character. This study aims to describe the application of Biology learning integrated religion values in Integrated Islamic School. Research methods used in this research is descriptive. Participants in this study involved the headmaster, headmaster of curriculum, biology teachers, boarding school teachers, the lead of boarding schools, and students. The instruments used are interview, observation and the student questionnaire about learning biology. The results showed that learning in X school consists of two curriculums, there was the curriculum of national education and curriculum of boarding school. The curriculum of national education referred to 2013 curriculum and boarding school curriculum referred to the curriculum of Salafi boarding school (Kitab Kuning). However, in its learning process not delivered integrated. The main obstacle to implementing the learning integrated religious values are 1) the background of general teacher education did not know of any connection between biology subject and subject that are studied in boarding school; 2) schools did not form the teaching team; 3) unavailability of materials integrated religious values.

  8. A pluralist challenge to "integrative medicine": Feyerabend and Popper on the cognitive value of alternative medicine.

    Science.gov (United States)

    Kidd, Ian James

    2013-09-01

    This paper is a critique of 'integrative medicine' as an ideal of medical progress on the grounds that it fails to realise the cognitive value of alternative medicine. After a brief account of the cognitive value of alternative medicine, I outline the form of 'integrative medicine' defended by the late Stephen Straus, former director of the US National Centre for Complementary and Alternative Medicine. Straus' account is then considered in the light of Zuzana Parusnikova's recent criticism of 'integrative medicine' and her distinction between 'cognitive' and 'opportunistic' engagement with alternative medicine. Parusnikova warns that the medical establishment is guilty of 'dogmatism' and proposes that one can usefully invoke Karl Popper's 'critical rationalism' as an antidote. Using the example of Straus, I argue that an appeal to Popper is insufficient, on the grounds that 'integrative medicine' can class as a form of cognitively-productive, critical engagement. I suggest that Parusnikova's appeal to Popper should be augmented with Paul Feyerabend's emphasis upon the role of 'radical alternatives' in maximising criticism. 'Integrative medicine' fails to maximise criticism because it 'translates' alternative medicine into the theories and terminology of allopathic medicine and so erodes its capacity to provide cognitively-valuable 'radical alternatives'. These claims are then illustrated with a discussion of 'traditional' and 'medical' acupuncture. I conclude that 'integrative medicine' fails to exploit the cognitive value of alternative medicine and so should be rejected as an ideal of medical progress. Copyright © 2013 Elsevier Ltd. All rights reserved.

  9. dbSWEET: An Integrated Resource for SWEET Superfamily to Understand, Analyze and Predict the Function of Sugar Transporters in Prokaryotes and Eukaryotes.

    Science.gov (United States)

    Gupta, Ankita; Sankararamakrishnan, Ramasubbu

    2018-04-14

    SWEET (Sweet Will Eventually be Exported Transporter) proteins have been recently discovered and form one of the three major families of sugar transporters. Homologs of SWEET are found in both prokaryotes and eukaryotes. Bacterial SWEET homologs have three transmembrane segments forming a triple-helical bundle (THB) and the functional form is dimers. Eukaryotic SWEETs have seven transmembrane helical segments forming two THBs with a linker helix. Members of SWEET homologs have been shown to be involved in several important physiological processes in plants. However, not much is known regarding the biological significance of SWEET homologs in prokaryotes and in mammals. We have collected more than 2000 SWEET homologs from both prokaryotes and eukaryotes. For each homolog, we have modeled three different conformational states representing outward open, inward open and occluded states. We have provided details regarding substrate-interacting residues and residues forming the selectivity filter for each SWEET homolog. Several search and analysis options are available. The users can generate a phylogenetic tree and structure-based sequence alignment for selected set of sequences. With no metazoan SWEETs functionally characterized, the features observed in the selectivity filter residues can be used to predict the potential substrates that are likely to be transported across the metazoan SWEETs. We believe that this database will help the researchers to design mutational experiments and simulation studies that will aid to advance our understanding of the physiological role of SWEET homologs. This database is freely available to the scientific community at http://bioinfo.iitk.ac.in/bioinfo/dbSWEET/Home. Copyright © 2018. Published by Elsevier Ltd.

  10. Interval-Valued Intuitionistic Fuzzy Multicriteria Group Decision Making Based on VIKOR and Choquet Integral

    Directory of Open Access Journals (Sweden)

    Chunqiao Tan

    2013-01-01

    Full Text Available An effective decision making approach based on VIKOR and Choquet integral is developed to solve multicriteria group decision making problem with conflicting criteria and interdependent subjective preference of decision makers in a fuzzy environment where preferences of decision makers with respect to criteria are represented by interval-valued intuitionistic fuzzy sets. First, an interval-valued intuitionistic fuzzy Choquet integral operator is given. Some of its properties are investigated in detail. The extended VIKOR decision procedure based on the proposed operator is developed for solving the multicriteria group decision making problem where the interactive criteria weight is measured by Shapley value. An illustrative example is given for demonstrating the applicability of the proposed decision procedure for solving the multi-criteria group decision making problem in interval-valued intuitionistic fuzzy environment.

  11. MODEL OF INTEGRATED VALUE OF PROJECTS IN THE FIELD OF ALTERNATIVE ENERGY

    Directory of Open Access Journals (Sweden)

    Наталія Ігорівна БОРИСОВА

    2015-05-01

    Full Text Available Development of alternative energy sources requires the implementation of complex problems, the solution of which is necessary to apply the project approach. The uniqueness of alternative energy projects (AEP necessitates individual approach to evaluating the effectiveness of each. The paper contains the results of the project management features's analysis in the field of alternative energy, determining the values and developing of the value management integrated conceptual model of AEP. In assessing the effectiveness of AEP considered the socio-economic and commercial aspects. Value management integrated conceptual model of AEP was obtained by combining the classical model of the project management goals with the project values model "Five "E" and two "A". The classical model of the project management goals have been complemented with risk parameters.

  12. Comparison of integral values for measured and calculated fast neutron spectra in lithium fluoride piles

    International Nuclear Information System (INIS)

    Sekimoto, Hiroshi

    1989-01-01

    The tritium production density, kerma heat production density, dose and certain integral values of scalar neutron spectra in bare and graphite-reflected lithium-fluoride piles irradiated with D-T neutrons were evaluated from the pulse height distribution of a miniature NE213 neutron spectrometer with UFO data processing code, and compared with the values calculated with MORSE-CV Monte Carlo code. (author). 8 refs.; 1 fig.; 2 tabs

  13. RavenDB high performance

    CERN Document Server

    Ritchie, Brian

    2013-01-01

    RavenDB High Performance is comprehensive yet concise tutorial that developers can use to.This book is for developers & software architects who are designing systems in order to achieve high performance right from the start. A basic understanding of RavenDB is recommended, but not required. While the book focuses on advanced topics, it does not assume that the reader has a great deal of prior knowledge of working with RavenDB.

  14. Towards an Integrated Value Adding Management Model for FM and CREM

    DEFF Research Database (Denmark)

    Jensen, Per Anker; van der Voordt, Theo

    2016-01-01

    Purpose : To present an integrated process model of adding value by Facilities Management (FM) and Corporate Real Estate Management (CREM) that is a generalisation of existing conceptual frameworks and aims to be a basis for management of added value in practice. Background : The growing research...... frameworks are too complex and lack of common terminology and clear operationalisations of intervention-impact relationships. Approach (Theory/Methodology) :A generalised Value Adding Management process model is developed based on a common cause-effect model identified in existing conceptual frameworks...... aims at supporting the practical management and measurement of added value. A typology with six types of FM/CREM interventions is developed from earlier research. The concept of Value Adding Management is investigated and the 12 most important added value parameters are identified. Research limitations...

  15. Learning history integrated local wisdom values "babad Banyumas" to build a student’s national identity

    Directory of Open Access Journals (Sweden)

    Khoeriyah Ngismatul

    2018-01-01

    Full Text Available This study aims to build a national identity and collective memory of students through learning history that is integrated with the values of local wisdom Babad Banyumas, which is considered ideal teaches values in learning history. The study employed a qualitative descriptive research method through literature review. The results show that in Babad Banyumas have values that match the character's learning, such as: 1 Social values, it is illustrated in the Babad Banyumas that is Ki Dipati Kaleng's attitude in entertaining his guest; 2 the value of morality, this is demonstrated by Raden Baribin's attitude of confronting a power conflict with his brother; 3 The value of religiosity include spiritual attitude shown by Dipawijaya the form of asceticism beg a boon to the Supreme Court and tradition Sang Hyang every Friday night visit to the palace followed by reciting Qur'an in Surau (mosques king.

  16. Advanced Value Chain Collaboration in Ghana's Cocoa Sector: An Entry Point for Integrated Landscape Approaches?

    Science.gov (United States)

    Deans, Howard; Ros-Tonen, Mirjam A F; Derkyi, Mercy

    2017-04-15

    Value chain analyses have focused mainly on collaboration between chain actors, often neglecting collaboration "beyond the chain" with non-chain actors to tackle food security, poverty and sustainability issues in the landscapes in which these value chains are embedded. Comparing conventional and advanced value chain collaborations involving small-scale cocoa farmers in Ghana, this paper analyzes the merits of a more integrated approach toward value chain collaboration. It particularly asks whether advanced value chain collaboration targeting cocoa-producing areas potentially offers an entry point for implementing a landscape approach. The findings detail current chain actors and institutions and show how advanced value chain collaboration has a greater positive impact than conventional value chain collaboration on farmers' social, human and natural capital. The paper concludes that the integrated approach, focus on learning, and stable relationships with small-scale farmers inherent in advanced value chain collaboration makes it both more sustainable and effective at the local level than conventional approaches. However, its scope and the actors' jurisdictional powers and self-organization are too limited to be the sole tool in negotiating land use and trade-offs at the landscape level. To evolve as such would require certification beyond the farm level, partnering with other landscape stakeholders, and brokering by bridging organizations.

  17. Integrating biological and social values when prioritizing places for biodiversity conservation.

    Science.gov (United States)

    Whitehead, Amy L; Kujala, Heini; Ives, Christopher D; Gordon, Ascelin; Lentini, Pia E; Wintle, Brendan A; Nicholson, Emily; Raymond, Christopher M

    2014-08-01

    The consideration of information on social values in conjunction with biological data is critical for achieving both socially acceptable and scientifically defensible conservation planning outcomes. However, the influence of social values on spatial conservation priorities has received limited attention and is poorly understood. We present an approach that incorporates quantitative data on social values for conservation and social preferences for development into spatial conservation planning. We undertook a public participation GIS survey to spatially represent social values and development preferences and used species distribution models for 7 threatened fauna species to represent biological values. These spatially explicit data were simultaneously included in the conservation planning software Zonation to examine how conservation priorities changed with the inclusion of social data. Integrating spatially explicit information about social values and development preferences with biological data produced prioritizations that differed spatially from the solution based on only biological data. However, the integrated solutions protected a similar proportion of the species' distributions, indicating that Zonation effectively combined the biological and social data to produce socially feasible conservation solutions of approximately equivalent biological value. We were able to identify areas of the landscape where synergies and conflicts between different value sets are likely to occur. Identification of these synergies and conflicts will allow decision makers to target communication strategies to specific areas and ensure effective community engagement and positive conservation outcomes. © 2014 Society for Conservation Biology.

  18. An integrated framework of knowledge transfer and ICT issues in co-creation value networks

    NARCIS (Netherlands)

    Bagheri, S.; Kusters, R.J.; Trienekens, J.J.M.; Varajão, J.E.Q.; Cruz-Cunha, M.M.; Martinho, R.; Rijo, R.; Bjørn-Andersen, N.; Turner, R.; Alves, D.

    2016-01-01

    In dynamic value networks (VNs), knowledge serves as a basis for close collaboration of actors (i.e. firms with their partners and customers) to enhance co-creation of integrated solutions. In order to provide a technical foundation for seamless knowledge transfer among actors, VNs require

  19. Integral boundary-value problem for impulsive fractional functional differential equations with infinite delay

    Directory of Open Access Journals (Sweden)

    Archana Chauhan

    2012-12-01

    Full Text Available In this article, we establish a general framework for finding solutions for impulsive fractional integral boundary-value problems. Then, we prove the existence and uniqueness of solutions by applying well known fixed point theorems. The obtained results are illustrated with an example for their feasibility.

  20. Locus of Control and Academic Achievement: Integrating Social Learning Theory and Expectancy-Value Theory

    Science.gov (United States)

    Youse, Keith Edward

    2012-01-01

    The current study examines predictors of math achievement and college graduation by integrating social learning theory and expectancy-value theory. Data came from a nationally-representative longitudinal database tracking 12,144 students over twelve years from 8th grade forward. Models for math achievement and college graduation were tested…

  1. Integration of external estimated breeding values and associated reliabilities using correlations among traits and effects

    NARCIS (Netherlands)

    Vandenplas, J.; Colinet, F.G.; Glorieux, G.; Bertozzi, C.; Gengler, N.

    2015-01-01

    Based on a Bayesian view of linear mixed models, several studies showed the possibilities to integrate estimated breeding values (EBV) and associated reliabilities (REL) provided by genetic evaluations performed outside a given evaluation system into this genetic evaluation. Hereafter, the term

  2. GigaDB: announcing the GigaScience database

    Directory of Open Access Journals (Sweden)

    Sneddon Tam P

    2012-07-01

    Full Text Available Abstract With the launch of GigaScience journal, here we provide insight into the accompanying database GigaDB, which allows the integration of manuscript publication with supporting data and tools. Reinforcing and upholding GigaScience’s goals to promote open-data and reproducibility of research, GigaDB also aims to provide a home, when a suitable public repository does not exist, for the supporting data or tools featured in the journal and beyond.

  3. Health and Well-Being Metrics in Business: The Value of Integrated Reporting.

    Science.gov (United States)

    Pronk, Nicolaas P; Malan, Daniel; Christie, Gillian; Hajat, Cother; Yach, Derek

    2018-01-01

    Health and well-being (HWB) are material to sustainable business performance. Yet, corporate reporting largely lacks the intentional inclusion of HWB metrics. This brief report presents an argument for inclusion of HWB metrics into existing standards for corporate reporting. A Core Scorecard and a Comprehensive Scorecard, designed by a team of subject matter experts, based on available evidence of effectiveness, and organized around the categories of Governance, Management, and Evidence of Success, may be integrated into corporate reporting efforts. Pursuit of corporate integrated reporting requires corporate governance and ethical leadership and values that ultimately align with environmental, social, and economic performance. Agreement on metrics that intentionally include HWB may allow for integrated reporting that has the potential to yield significant value for business and society alike.

  4. Experiences of spirituality and spiritual values in the context of nursing - an integrative review.

    Science.gov (United States)

    Rudolfsson, Gudrun; Berggren, Ingela; da Silva, António Barbosa

    2014-01-01

    Spirituality is often mistakenly equated with religion but is in fact a far broader concept. The aim of this integrative review was to describe experiences of the positive impact of spirituality and spiritual values in the context of nursing. The analysis was guided by Whittemore and Knafl's integrative review method. The findings revealed seven themes: 'Being part of a greater wholeness', 'Togetherness - value based relationships', 'Developing inner strength', 'Ministering to patients', 'Maintaining one's sense of humanity', 'Viewing life as a gift evokes a desire to 'give back'' and 'Achieving closure - life goes on'. It is difficult to draw definite conclusions, as spirituality involves many perspectives on various levels of awareness. However, spirituality was considered more inclusive, fluid and personal. Furthermore, it emerged that spirituality and spiritual values in the context of nursing are closely intertwined with the concept of caring.

  5. Set-valued and fuzzy stochastic integral equations driven by semimartingales under Osgood condition

    Directory of Open Access Journals (Sweden)

    Malinowski Marek T.

    2015-01-01

    Full Text Available We analyze the set-valued stochastic integral equations driven by continuous semimartingales and prove the existence and uniqueness of solutions to such equations in the framework of the hyperspace of nonempty, bounded, convex and closed subsets of the Hilbert space L2 (consisting of square integrable random vectors. The coefficients of the equations are assumed to satisfy the Osgood type condition that is a generalization of the Lipschitz condition. Continuous dependence of solutions with respect to data of the equation is also presented. We consider equations driven by semimartingale Z and equations driven by processes A;M from decomposition of Z, where A is a process of finite variation and M is a local martingale. These equations are not equivalent. Finally, we show that the analysis of the set-valued stochastic integral equations can be extended to a case of fuzzy stochastic integral equations driven by semimartingales under Osgood type condition. To obtain our results we use the set-valued and fuzzy Maruyama type approximations and Bihari’s inequality.

  6. Value-based choice: An integrative, neuroscience-informed model of health goals.

    Science.gov (United States)

    Berkman, Elliot T

    2018-01-01

    Traditional models of health behaviour focus on the roles of cognitive, personality and social-cognitive constructs (e.g. executive function, grit, self-efficacy), and give less attention to the process by which these constructs interact in the moment that a health-relevant choice is made. Health psychology needs a process-focused account of how various factors are integrated to produce the decisions that determine health behaviour. I present an integrative value-based choice model of health behaviour, which characterises the mechanism by which a variety of factors come together to determine behaviour. This model imports knowledge from research on behavioural economics and neuroscience about how choices are made to the study of health behaviour, and uses that knowledge to generate novel predictions about how to change health behaviour. I describe anomalies in value-based choice that can be exploited for health promotion, and review neuroimaging evidence about the involvement of midline dopamine structures in tracking and integrating value-related information during choice. I highlight how this knowledge can bring insights to health psychology using illustrative case of healthy eating. Value-based choice is a viable model for health behaviour and opens new avenues for mechanism-focused intervention.

  7. Assessing the level of integration in the offshore wind industry value chain

    OpenAIRE

    Martinez-Neri, Ivan; Mikkelsen, Ole Stegmann; Stentoft, Jan

    2014-01-01

    The offshore wind industry (OWI) has experienced an explosive growth within the course of a decade and because of this rapid expansion, the industry has not had the opportunity to integrate well and be-come more efficient. The aim of this paper is to contribute to the understanding of the integration level of the offshore wind industry value chain. The work relies on a review of international peer-reviewed journals. The empirical basis of the paper is based on interviews with key players in t...

  8. On the Value of Monitoring Information for the Structural Integrity and Risk Management

    DEFF Research Database (Denmark)

    Thöns, Sebastian

    2018-01-01

    facilitates the assessment of the value of information associated with SHM. The principal approach for the quantification of the value of SHM is formulated by modeling the fundamental decision of performing SHM or not in conjunction with their expected utilities. The expected utilities are calculated....... The calculation of the expected utilities necessitates a comprehensive and rigorous modeling, which is introduced close to the original formulations and for which analysis characteristics and simplifications are described and derived. The framework provides the basis for the optimization of the structural risk......This article introduces an approach and framework for the quantification of the value of structural health monitoring (SHM) in the context of the structural risk and integrity management for systems.The quantification of the value of SHM builds upon the Bayesian decision and utility theory, which...

  9. Toward an integrated understanding of perceived biodiversity values and environmental conditions in a national park

    Science.gov (United States)

    van Riper, Carena J.; Kyle, Gerard T.; Sherrouse, Ben C.; Bagstad, Kenneth J.; Sutton, Stephen G.

    2016-01-01

    In spatial planning and management of protected areas, increased priority is being given to research that integrates social and ecological data. However, public viewpoints of the benefits provided by ecosystems are not easily quantified and often implicitly folded into natural resource management decisions. Drawing on a spatially explicit participatory mapping exercise and a Social Values for Ecosystem Services (SolVES) analysis tool, the present study empirically examined and integrated social values for ecosystem services and environmental conditions within Channel Islands National Park, California. Specifically, a social value indicator of perceived biodiversity was examined using on-site survey data collected from a sample of people who visited the park. This information was modeled alongside eight environmental conditions including faunal species richness for six taxa, vegetation density, categories of marine and terrestrial land cover, and distance to features relevant for decision-makers. Results showed that biodiversity value points assigned to places by the pooled sample of respondents were widely and unevenly mapped, which reflected the belief that biodiversity was embodied to varying degrees by multiple locations in the park. Models generated for two survey subgroups defined by their self-reported knowledge of the Channels Islands revealed distinct spatial patterns of these perceived values. Specifically, respondents with high knowledge valued large spaces that were publicly inaccessible and unlikely to contain on-ground biodiversity, whereas respondents with low knowledge valued places that were experienced first-hand. Accessibility and infrastructure were also important considerations for anticipating how and where people valued the protected land and seascapes of Channel Islands National Park.

  10. On set-valued functionals: Multivariate risk measures and Aumann integrals

    Science.gov (United States)

    Ararat, Cagin

    In this dissertation, multivariate risk measures for random vectors and Aumann integrals of set-valued functions are studied. Both are set-valued functionals with values in a complete lattice of subsets of Rm. Multivariate risk measures are considered in a general d-asset financial market with trading opportunities in discrete time. Specifically, the following features of the market are incorporated in the evaluation of multivariate risk: convex transaction costs modeled by solvency regions, intermediate trading constraints modeled by convex random sets, and the requirement of liquidation into the first m ≤ d of the assets. It is assumed that the investor has a "pure" multivariate risk measure R on the space of m-dimensional random vectors which represents her risk attitude towards the assets but does not take into account the frictions of the market. Then, the investor with a d-dimensional position minimizes the set-valued functional R over all m-dimensional positions that she can reach by trading in the market subject to the frictions described above. The resulting functional Rmar on the space of d-dimensional random vectors is another multivariate risk measure, called the market-extension of R. A dual representation for R mar that decomposes the effects of R and the frictions of the market is proved. Next, multivariate risk measures are studied in a utility-based framework. It is assumed that the investor has a complete risk preference towards each individual asset, which can be represented by a von Neumann-Morgenstern utility function. Then, an incomplete preference is considered for multivariate positions which is represented by the vector of the individual utility functions. Under this structure, multivariate shortfall and divergence risk measures are defined as the optimal values of set minimization problems. The dual relationship between the two classes of multivariate risk measures is constructed via a recent Lagrange duality for set optimization. In

  11. Organizational Performance: Integration of the Value, Rarity, Imitability and Organization Framework in Project Management

    Directory of Open Access Journals (Sweden)

    Ronielton Rezende Oliveira

    2017-08-01

    Full Text Available Organizational performance is often associated with competitive advantage. In strategy studie saimed at expanding communication on a global vision of organizations and their initiatives, strategic project management stands out, whichis related to the mechanisms and set of management decisions that determine long term organizational performance. This study verify how the Resource-based view adds value to organizational initiatives seeking to achieve organizational performance through projects. The study considers strategic management practiced by the project managers o asto present a conceptual framework with four propositions that demonstrate the integration of the Value, Rarity, Imitability and Organization framework with project management and its relations to organizational performance.

  12. Consumer preferences and values as an integral key to evidence-based practice.

    Science.gov (United States)

    Melnyk, Bernadette Mazurek; Fineout-Overholt, Ellen

    2006-01-01

    Although evidence-based practice (EBP) integrates the best evidence from well-designed studies with a clinician's expertise and patient preferences and values, most of what is emphasized in books and reports on EBP is the 5-step EBP process. However, the consideration of patient values and preferences in making clinical decisions is essential to deliver the highest quality of care. This article briefly reviews the status of EBP in the United States, described the ARCC mentorship model, and highlights how to engage consumers in the EBP process.

  13. A New Approach to Interval-Valued Choquet Integrals and the Problem of Ordering in Interval-Valued Fuzzy Set Applications

    Czech Academy of Sciences Publication Activity Database

    Bustince, H.; Galar, M.; Bedregal, B.; Kolesárová, A.; Mesiar, Radko

    2013-01-01

    Roč. 21, č. 6 (2013), s. 1150-1162 ISSN 1063-6706 R&D Projects: GA ČR GAP402/11/0378 Institutional support: RVO:67985556 Keywords : Interval- value d Choquet integral * Shapley value * interval- value d ordered weighted aggregation (OWA) operators * interval- value d decision making Subject RIV: BA - General Mathematics Impact factor: 6.306, year: 2013 http://library.utia.cas.cz/separaty/2013/E/mesiar-0399771.pdf

  14. Business integration unit (BIU adapter for industrial global value chain on the web

    Directory of Open Access Journals (Sweden)

    Adel Ghannam

    2016-05-01

    Full Text Available Today's manufacturing enterprises rarely live in isolation. They need to be connected in order to create products from which a group of enterprises, called global-value-chain (GVC, can derive value. Service-oriented architecture (SOA and event-driven architecture (EDA are two different paradigms that address complex integration challenges. Enterprise service bus (ESB allows for the implementation of both the SOA and the EDA concepts. This paper addresses the development of an enterprise service bus (ESB to grant the operation of GVC. A proposed business-integrator-unit (BIU is designed to be plugged in each enterprise system. The BIU contains a “business collaboration map configurator” that allows real time allocation of roles to members’ enterprises.

  15. Assessment of available integration algorithms for initial value ordinary differential equations

    International Nuclear Information System (INIS)

    Carver, M.B.; Stewart, D.G.

    1979-11-01

    There exists an extremely large number of algorithms designed for the ordinary differential equation initial value problem. The integration is normally done by a finite sum at time intervals which are chosen dynamically to satisfy an imposed error tolerance. This report describes the basic logistics of the integration process, identifies common areas of difficulty, and establishes a comprehensive test profile for integration algorithms. A number of algorithms are described, and selected published subroutines are evaluated using the test profile. It concludes that an effective library for general use need have only two such routines. The two selected are versions of the well-known Gear and Runge-Kutta-Fehlberg algorithms. Full documentation and listings are included. (auth)

  16. Advancing a Distributive-Bargaining and Integrative-Negotiation Integral System: A Values-Based Negotiation Model (VBM

    Directory of Open Access Journals (Sweden)

    Ivan Gan

    2017-09-01

    Full Text Available The proposed values-based negotiation model (VBM agrees with and extends principled negotiation’s recognition of personal values and emotions as important negotiation elements. First, building upon Martin Buber’s existentialist treatment of religion and secularism, VBM centers on religion as one of many possible sources of personal values that informs respectful and mutually beneficial interactions without needing one to necessarily be religious. Just as one need not be a Buddhist or a Hindu to practice yoga, negotiators of any theological outlook can profit from a model grounded in broad, common tenets drawn from a range of organized religions. Second, VBM distinguishes feelings from emotions because the long-lasting and intrinsically stimulated effects of feelings have greater implications on the perception of negotiated outcomes. VBM negotiators view negotiations as a constitutive prosocial process whereby parties consider the outcome important enough to invest time and energy. Negotiators who use VBM appeal to the goodness of their counterparts by doing good first so that both parties avoid a win-lose outcome. This counterintuitive move contradicts the self-centered but understandably normal human behavior of prioritizing one’s own interests before others’ interests. However, when one appeals to the goodness of one’s Buberian Thou counterparts, he or she stimulates positive emotions that promote understanding. Third, VBM provides a framework that draws upon an individual’s personal values (religious or otherwise and reconfigures the distributive-bargaining-and-integrative-negotiation distinction so that negotiators can freely apply distributive tactics to claim maximum intangible and tangible outcomes without compromising on their personal values or valuable relationships.

  17. SCIENTIFIC STUDY OF NATURE AND SCIENTIFIC STUDY OF CULTURE: INTE-GRATION TREND, PRACTICAL VALUE

    Directory of Open Access Journals (Sweden)

    Fokina Zoya Titovna

    2017-03-01

    Full Text Available This article deals with a topic of interest : studying the expanding and deepening trend of integration of natural, technical, social and humanities fields of scientific knowledge. The point of absolute opposition between the sciences dealing with nature and those dealing with culture is subjected to criticism, the forms of integration of scientific knowledge are identified: mathematization, formalization, computerization of knowledge; philosophization/dialectization and environmentalization of the scientific knowledge. It is noted that such areas of scientific knowledge as synergetics, cybernetics, system theory, information technology, sociosynergetics, historical informatics, cliometrics, informatics for economics, evolutionary economics, human ecology, etc. Many scientific fields appear on the border between the science, technology and mathematics, and social and humanities studies, while the sharp borders between the natural sciences and cultural sciences tend to disappear, although specifics of studying the social reality still exists. Within the context of integration of sciences, comprehensive approach, synergetics, cybernetics, and mathematical model approach are analyzed. The philosophy of technology, and environmental problems, which are caused by the development of technological civilization, are studied. Practical value of integration processes in science is identified. The studied data is addressed to the specialists who are interested in the modern processes of integration of sciences, and modern issues of scientific and technical development of humanity, survival of humanity under the conditions of increasing technological understanding of the nature.

  18. MongoDB and PHP

    CERN Document Server

    Francia, Steve

    2012-01-01

    What would happen if you optimized a data store for the operations application developers actually use? You'd arrive at MongoDB, the reliable document-oriented database. With this concise guide, you'll learn how to build elegant database applications with MongoDB and PHP. Written by the Chief Solutions Architect at 10gen-the company that develops and supports this open source database-this book takes you through MongoDB basics such as queries, read-write operations, and administration, and then dives into MapReduce, sharding, and other advanced topics. Get out of the relational database rut,

  19. DB Energie 2020. Implementation of sustainability strategy DB2020; DB Energie 2020. Die Umsetzung der Nachhaltigkeitsstrategie DB2020

    Energy Technology Data Exchange (ETDEWEB)

    Witschke, Hans-Juergen [DB Energie GmbH, Frankfurt am Main (Germany)

    2013-06-15

    As a worldwide provider of mobility and logistics services and one of the biggest employers in Germany, Deutsche Bahn (DB) bears a special responsibility for customers, its own staff, the environment and society as a whole. In order to meet this responsibility, it has made the consistent implementation of the DB Energie 2020 sustainability concept an essential element of its business strategy. Following this line of business provides DB with good opportunities on the one hand but also carries risks and challenges on the other. (orig.)

  20. The Implementation Of Character Education Values In Integrated Physical Education Subject In Elementary School

    Directory of Open Access Journals (Sweden)

    Suherman Ayi

    2018-01-01

    Full Text Available The issue of this research emphasizes on the implementation of character building values through physical education learning in elementary school. The effort in developing this character building practice is essential to be done in order to tackle moral and character crises, which already occur in both individual and collective levels reflected in educational institution from elementary school to higher education. Hence, to form culture and national character, educational program and process are inseparable from environmental factor including the values of society, culture, and humanity. Physical education subject that is based on 2013 Curriculum has significant difference compared to the previous physical education subject. This is due to the fact that integrated physical education has its own uniqueness in terms of planning, systematic implementation, and instructional medium. This research aims at producing guidance in implementing character values integrated in physical education in elementary school. The method used in this research is research and development (R&D method, which includes preliminary research, model designing, limited trial, and extensive trial, as well as validation and dissemination. The findings of the research show that character values can be implemented in physical education in elementary schools in Sumedang Regency.

  1. Choquet Integral of Fuzzy-Number-Valued Functions: The Differentiability of the Primitive with respect to Fuzzy Measures and Choquet Integral Equations

    Directory of Open Access Journals (Sweden)

    Zengtai Gong

    2014-01-01

    Full Text Available This paper deals with the Choquet integral of fuzzy-number-valued functions based on the nonnegative real line. We firstly give the definitions and the characterizations of the Choquet integrals of interval-valued functions and fuzzy-number-valued functions based on the nonadditive measure. Furthermore, the operational schemes of above several classes of integrals on a discrete set are investigated which enable us to calculate Choquet integrals in some applications. Secondly, we give a representation of the Choquet integral of a nonnegative, continuous, and increasing fuzzy-number-valued function with respect to a fuzzy measure. In addition, in order to solve Choquet integral equations of fuzzy-number-valued functions, a concept of the Laplace transformation for the fuzzy-number-valued functions in the sense of Choquet integral is introduced. For distorted Lebesgue measures, it is shown that Choquet integral equations of fuzzy-number-valued functions can be solved by the Laplace transformation. Finally, an example is given to illustrate the main results at the end of the paper.

  2. Innovation in Hungary - The Impact of EU Accession and Integration into Global Value Chains

    Directory of Open Access Journals (Sweden)

    Szalavetz Andrea

    2014-11-01

    Full Text Available This paper argues that EU accession has brought about minimal changes in the patterns of innovation in Hungary. The reason why is not that the ‘EU factor’ is of minor importance; rather, it is Hungary's inability to use EU resources effectively, so as to fully benefit from EU membership. The Hungarian story also demonstrates that the EU cannot block member states from reversing reform or abusing the opportunities EU membership offers to them. We contend that globalization (global value chain integration has more effectively contributed to Hungary's knowledge-based upgrading than Europeanization (in the sense of policy transfer; access to EU Structural & Cohesion Funds, and integration in the European Research Area. This argument is substantiated with a case study on innovation strategy design and implementation, which illustrates the ambiguous impact of Europeanization, which is contrasted with our investigation of integration in global value chains, conducted through interviews of foreign-owned manufacturing companies about their R&D-based upgrading experience.

  3. Valuing fire planning alternatives in forest restoration: using derived demand to integrate economics with ecological restoration.

    Science.gov (United States)

    Rideout, Douglas B; Ziesler, Pamela S; Kernohan, Nicole J

    2014-08-01

    Assessing the value of fire planning alternatives is challenging because fire affects a wide array of ecosystem, market, and social values. Wildland fire management is increasingly used to address forest restoration while pragmatic approaches to assessing the value of fire management have yet to be developed. Earlier approaches to assessing the value of forest management relied on connecting site valuation with management variables. While sound, such analysis is too narrow to account for a broad range of ecosystem services. The metric fire regime condition class (FRCC) was developed from ecosystem management philosophy, but it is entirely biophysical. Its lack of economic information cripples its utility to support decision-making. We present a means of defining and assessing the deviation of a landscape from its desired fire management condition by re-framing the fire management problem as one of derived demand. This valued deviation establishes a performance metric for wildland fire management. Using a case study, we display the deviation across a landscape and sum the deviations to produce a summary metric. This summary metric is used to assess the value of alternative fire management strategies on improving the fire management condition toward its desired state. It enables us to identify which sites are most valuable to restore, even when they are in the same fire regime condition class. The case study site exemplifies how a wide range of disparate values, such as watershed, wildlife, property and timber, can be incorporated into a single landscape assessment. The analysis presented here leverages previous research on environmental capital value and non-market valuation by integrating ecosystem management, restoration, and microeconomics. Copyright © 2014 Elsevier Ltd. All rights reserved.

  4. 48 CFR 352.234-1 - Notice of earned value management system-pre-award Integrated Baseline Review.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Notice of earned value management system-pre-award Integrated Baseline Review. 352.234-1 Section 352.234-1 Federal Acquisition... provision: Notice of Earned Value Management System—Pre-Award Integrated Baseline Review (October 2008) The...

  5. 48 CFR 352.234-2 - Notice of earned value management system-post-award Integrated Baseline Review.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Notice of earned value management system-post-award Integrated Baseline Review. 352.234-2 Section 352.234-2 Federal Acquisition... provision: Notice of Earned Value Management System—Post-Award Integrated Baseline Review (October 2008) (a...

  6. Expectation values of local fields for a two-parameter family of integrable models and related perturbed conformal field theories

    International Nuclear Information System (INIS)

    Baseilhac, P.; Fateev, V.A.

    1998-01-01

    We calculate the vacuum expectation values of local fields for the two-parameter family of integrable field theories introduced and studied by Fateev (1996). Using this result we propose an explicit expression for the vacuum expectation values of local operators in parafermionic sine-Gordon models and in integrable perturbed SU(2) coset conformal field theories. (orig.)

  7. Integration: valuing stakeholder input in setting priorities for socially sustainable egg production.

    Science.gov (United States)

    Swanson, J C; Lee, Y; Thompson, P B; Bawden, R; Mench, J A

    2011-09-01

    Setting directions and goals for animal production systems requires the integration of information achieved through internal and external processes. The importance of stakeholder input in setting goals for sustainable animal production systems should not be overlooked by the agricultural animal industries. Stakeholders play an integral role in setting the course for many aspects of animal production, from influencing consumer preferences to setting public policy. The Socially Sustainable Egg Production Project (SSEP) involved the development of white papers on various aspects of egg production, followed by a stakeholder workshop to help frame the issues for the future of sustainable egg production. Representatives from the environmental, food safety, food retail, consumer, animal welfare, and the general farm and egg production sectors participated with members of the SSEP coordination team in a 1.5-d workshop to explore socially sustainable egg production. This paper reviews the published literature on values integration methodologies and the lessons learned from animal welfare assessment models. The integration method used for the SSEP stakeholder workshop and its outcome are then summarized. The method used for the SSEP stakeholder workshop can be used to obtain stakeholder input on sustainable production in other farm animal industries.

  8. Estimating cross-validatory predictive p-values with integrated importance sampling for disease mapping models.

    Science.gov (United States)

    Li, Longhai; Feng, Cindy X; Qiu, Shi

    2017-06-30

    An important statistical task in disease mapping problems is to identify divergent regions with unusually high or low risk of disease. Leave-one-out cross-validatory (LOOCV) model assessment is the gold standard for estimating predictive p-values that can flag such divergent regions. However, actual LOOCV is time-consuming because one needs to rerun a Markov chain Monte Carlo analysis for each posterior distribution in which an observation is held out as a test case. This paper introduces a new method, called integrated importance sampling (iIS), for estimating LOOCV predictive p-values with only Markov chain samples drawn from the posterior based on a full data set. The key step in iIS is that we integrate away the latent variables associated the test observation with respect to their conditional distribution without reference to the actual observation. By following the general theory for importance sampling, the formula used by iIS can be proved to be equivalent to the LOOCV predictive p-value. We compare iIS and other three existing methods in the literature with two disease mapping datasets. Our empirical results show that the predictive p-values estimated with iIS are almost identical to the predictive p-values estimated with actual LOOCV and outperform those given by the existing three methods, namely, the posterior predictive checking, the ordinary importance sampling, and the ghosting method by Marshall and Spiegelhalter (2003). Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

  9. Measurement of definite integral of sinusoidal signal absolute value third power using digital stochastic method

    Directory of Open Access Journals (Sweden)

    Beljić Željko

    2017-01-01

    Full Text Available In this paper a special case of digital stochastic measurement of the third power of definite integral of sinusoidal signal’s absolute value, using 2-bit AD converters is presented. This case of digital stochastic method had emerged from the need to measure power and energy of the wind. Power and energy are proportional to the third power of wind speed. Anemometer output signal is sinusoidal. Therefore an integral of the third power of sinusoidal signal is zero. Two approaches are proposed for the third power calculation of the wind speed signal. One approach is to use absolute value of sinusoidal signal (before AD conversion for which there is no need of multiplier hardware change. The second approach requires small multiplier hardware change, but input signal remains unchanged. For the second approach proposed minimal hardware change was made to calculate absolute value of the result after AD conversion. Simulations have confirmed theoretical analysis. Expected precision of wind energy measurement of proposed device is better than 0,00051% of full scale. [Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. TR32019

  10. Experiences of Spirituality and Spiritual Values in the Context of Nursing – An Integrative Review

    Science.gov (United States)

    Rudolfsson, Gudrun; Berggren, Ingela; da Silva, António Barbosa

    2014-01-01

    Spirituality is often mistakenly equated with religion but is in fact a far broader concept. The aim of this integrative review was to describe experiences of the positive impact of spirituality and spiritual values in the context of nursing. The analysis was guided by Whittemore and Knafl’s integrative review method. The findings revealed seven themes: ‘Being part of a greater wholeness’, ‘Togetherness − value based relationships’, ‘Developing inner strength’, ‘Ministering to patients’, ‘Maintaining one’s sense of humanity’, ‘Viewing life as a gift evokes a desire to ‘give back’’ and ‘Achieving closure − life goes on’. It is difficult to draw definite conclusions, as spirituality involves many perspectives on various levels of awareness. However, spirituality was considered more inclusive, fluid and personal. Furthermore, it emerged that spirituality and spiritual values in the context of nursing are closely intertwined with the concept of caring. PMID:25598856

  11. Economic value of biological control in integrated pest management of managed plant systems.

    Science.gov (United States)

    Naranjo, Steven E; Ellsworth, Peter C; Frisvold, George B

    2015-01-07

    Biological control is an underlying pillar of integrated pest management, yet little focus has been placed on assigning economic value to this key ecosystem service. Setting biological control on a firm economic foundation would help to broaden its utility and adoption for sustainable crop protection. Here we discuss approaches and methods available for valuation of biological control of arthropod pests by arthropod natural enemies and summarize economic evaluations in classical, augmentative, and conservation biological control. Emphasis is placed on valuation of conservation biological control, which has received little attention. We identify some of the challenges of and opportunities for applying economics to biological control to advance integrated pest management. Interaction among diverse scientists and stakeholders will be required to measure the direct and indirect costs and benefits of biological control that will allow farmers and others to internalize the benefits that incentivize and accelerate adoption for private and public good.

  12. Assessing the level of integration in the offshore wind industry value chain

    DEFF Research Database (Denmark)

    Martinez-Neri, Ivan; Mikkelsen, Ole Stegmann; Stentoft, Jan

    2014-01-01

    of the integration level of the offshore wind industry value chain. The work relies on a review of international peer-reviewed journals. The empirical basis of the paper is based on interviews with key players in the industry. The scope of this study covers the wind turbine generator, foundations, subsea cables......, offshore substation, installation vessels and the wind farm developer. The preliminary findings are that the different indus-trial sectors participating in the OWI are not aware of the maturity level of the sector. The fact that some developers are disintegrating the already integrated supply of some...... components highlights the importance of being aware of the industry’s maturity level to take appropriate decisions. On the other hand the strategic alliances taking part in various sectors of the OWI show that some of the players know that they have to join and share the expenses of much needed R...

  13. NGSmethDB 2017: enhanced methylomes and differential methylation

    Science.gov (United States)

    Lebrón, Ricardo; Gómez-Martín, Cristina; Carpena, Pedro; Bernaola-Galván, Pedro; Barturen, Guillermo; Hackenberg, Michael; Oliver, José L.

    2017-01-01

    The 2017 update of NGSmethDB stores whole genome methylomes generated from short-read data sets obtained by bisulfite sequencing (WGBS) technology. To generate high-quality methylomes, stringent quality controls were integrated with third-part software, adding also a two-step mapping process to exploit the advantages of the new genome assembly models. The samples were all profiled under constant parameter settings, thus enabling comparative downstream analyses. Besides a significant increase in the number of samples, NGSmethDB now includes two additional data-types, which are a valuable resource for the discovery of methylation epigenetic biomarkers: (i) differentially methylated single-cytosines; and (ii) methylation segments (i.e. genome regions of homogeneous methylation). The NGSmethDB back-end is now based on MongoDB, a NoSQL hierarchical database using JSON-formatted documents and dynamic schemas, thus accelerating sample comparative analyses. Besides conventional database dumps, track hubs were implemented, which improved database access, visualization in genome browsers and comparative analyses to third-part annotations. In addition, the database can be also accessed through a RESTful API. Lastly, a Python client and a multiplatform virtual machine allow for program-driven access from user desktop. This way, private methylation data can be compared to NGSmethDB without the need to upload them to public servers. Database website: http://bioinfo2.ugr.es/NGSmethDB. PMID:27794041

  14. Method for integrating a train of fast, nanosecond wide pulses

    International Nuclear Information System (INIS)

    Rose, C.R.

    1987-01-01

    This paper describes a method used to integrate a train of fast, nanosecond wide pulses. The pulses come from current transformers in a RF LINAC beamline. Because they are ac signals and have no dc component, true mathematical integration would yield zero over the pulse train period or an equally erroneous value because of a dc baseline shift. The circuit used to integrate the pulse train first stretches the pulses to 35 ns FWHM. The signals are then fed into a high-speed, precision rectifier which restores a true dc baseline for the following stage - a fast, gated integrator. The rectifier is linear over 55dB in excess of 25 MHz, and the gated integrator is linear over a 60 dB range with input pulse widths as short as 16 ns. The assembled system is linear over 30 dB with a 6 MHz input signal

  15. THE METHODOLOGY OF DEVELOPING VALUE INDICATORS TO INTEGRALLY ASSESS RESOURCE POTENTIAL IN AGRICULTURAL UNITS

    Directory of Open Access Journals (Sweden)

    Elena TIMOFTI

    2014-06-01

    Full Text Available The problem of increasing the economic efficiency of resource use in agricultural production is very important. Its solution directly depends on the economic security of the country and its constant supply with agricultural products.There are three basic factors in agricultural production: nature (land, labour and capital, which have differentmeasure units. Comparability is necessary to express the value of the integral potential that gives the possibility totake into account the main resources involved in producing and obtaining results from the agricultural sector.

  16. A fuzzy inventory model with acceptable shortage using graded mean integration value method

    Science.gov (United States)

    Saranya, R.; Varadarajan, R.

    2018-04-01

    In many inventory models uncertainty is due to fuzziness and fuzziness is the closed possible approach to reality. In this paper, we proposed a fuzzy inventory model with acceptable shortage which is completely backlogged. We fuzzily the carrying cost, backorder cost and ordering cost using Triangular and Trapezoidal fuzzy numbers to obtain the fuzzy total cost. The purpose of our study is to defuzzify the total profit function by Graded Mean Integration Value Method. Further a numerical example is also given to demonstrate the developed crisp and fuzzy models.

  17. Integrated Campaign Probabilistic Cost, Schedule, Performance, and Value for Program Office Support

    Science.gov (United States)

    Cornelius, David; Sasamoto, Washito; Daugherty, Kevin; Deacon, Shaun

    2012-01-01

    This paper describes an integrated assessment tool developed at NASA Langley Research Center that incorporates probabilistic analysis of life cycle cost, schedule, launch performance, on-orbit performance, and value across a series of planned space-based missions, or campaign. Originally designed as an aid in planning the execution of missions to accomplish the National Research Council 2007 Earth Science Decadal Survey, it utilizes Monte Carlo simulation of a series of space missions for assessment of resource requirements and expected return on investment. Interactions between simulated missions are incorporated, such as competition for launch site manifest, to capture unexpected and non-linear system behaviors. A novel value model is utilized to provide an assessment of the probabilistic return on investment. A demonstration case is discussed to illustrate the tool utility.

  18. Integration of Conflicts Resolution Values in Learning of History: a Case Study in Kerinci

    Directory of Open Access Journals (Sweden)

    Firza Firza

    2018-04-01

    Full Text Available Conflict is categorized as something always exist in society, people cannot be separated from conflict. Conflict causes stunted progress and development of human thought. Thus, conflicts must be immediately resolved to create a society of peace and harmony. Conflict resolution is a cultural form exists in society. Kerinci people are so familiar with conflict resolution with the term of Mandawah. In the conflict resolution of Mandawah, it is contained in traditional values that are relevant to the life of nowadays’ society. Schools do not only teach learners to master learning, but also to shape the affective aspects. Integration of conflicts resolution values in learning history is needed to improve harmonization in the life of the Kerinci society.

  19. Klaim-DB: A Modeling Language for Distributed Database Applications

    DEFF Research Database (Denmark)

    Wu, Xi; Li, Ximeng; Lluch Lafuente, Alberto

    2015-01-01

    and manipulation of structured data, with integrity and atomicity considerations. We present the formal semantics of KlaimDB and illustrate the use of the language in a scenario where the sales from different branches of a chain of department stores are aggregated from their local databases. It can be seen......We present the modelling language, Klaim-DB, for distributed database applications. Klaim-DB borrows the distributed nets of the coordination language Klaim but essentially re-incarnates the tuple spaces of Klaim as databases, and provides high-level language abstractions for the access...... that raising the abstraction level and encapsulating integrity checks (concerning the schema of tables, etc.) in the language primitives for database operations benefit the modelling task considerably....

  20. Information and analytical support of integrated reporting: evaluation of the stakeholders’ influence on the change of the created value

    Directory of Open Access Journals (Sweden)

    Yu. V. Novozhilova

    2017-01-01

    Full Text Available Information and analytical support of integrated reporting needs constant improvement, depending on the growing needs of the stakeholders. The main objective of integrated reporting is to explain how the organization creates value over time. The stakeholders play a key role in the process of value creation. Firms accumulate stakeholders’ resources and transform them, thereby meeting the needs of the parties and achieving their own goals. Building relationships with their stakeholders, organization establishes impact leverage to create value. Thus, the created value depends on the successful interaction with stakeholders. Therefore, the article is devoted to problem of information and analytical support of integrated reporting to the evaluation of created value, which is influenced by the stakeholders. The article emphasizes that an integrated quantitative measurement of value change is a complex and unresolved currently task. Integrated evaluation - a systematic analytical study, in the course of which is given summarizing evaluation of the effectiveness company. Such assessment activity is important and has a multi-purpose orientation under market conditions. The annual reports of companies are practically no integrated indicators characterizing created value. The author believes that integrated reporting should become a platform for the realization of the possibility of an integrated assessment of the created value. The results of the study are the development the methods of computation the “integrated index overall impact by the stakeholders on the company’s created value” and its testing on the example of the annual reports of the organization, which discloses information on the level of international best practice. The methodology of the research bases on such methods as analysis, synthesis, abstraction, simulation, comprehensive approach to knowledge, logical methods of research. Private indicators for the computation the

  1. dbCAN2: a meta server for automated carbohydrate-active enzyme annotation

    DEFF Research Database (Denmark)

    Zhang, Han; Yohe, Tanner; Huang, Le

    2018-01-01

    of plant and plant-associated microbial genomes and metagenomes being sequenced, there is an urgent need of automatic tools for genomic data mining of CAZymes. We developed the dbCAN web server in 2012 to provide a public service for automated CAZyme annotation for newly sequenced genomes. Here, dbCAN2...... (http://cys.bios.niu.edu/dbCAN2) is presented as an updated meta server, which integrates three state-of-the-art tools for CAZome (all CAZymes of a genome) annotation: (i) HMMER search against the dbCAN HMM (hidden Markov model) database; (ii) DIAMOND search against the CAZy pre-annotated CAZyme...

  2. Alkannin Inhibited Hepatic Inflammation in Diabetic Db/Db Mice

    Directory of Open Access Journals (Sweden)

    Wenhua Xue

    2018-03-01

    Full Text Available Background/Aims: The current study was designed to investigate the protective role of alkannin (ALK on liver injury in diabetic C57BL/KsJ-db/db mice and explore its potential mechanisms. Methods: An oral glucose tolerance test (OGTT was performed. The levels of insulin, alanine aminotransferase (ALT, aspartate aminotransaminase (AST, total cholesterol (TC and triglyceride (TG were determined by commercial kits. The pro-inflammatory cytokines interleukin (IL-1β, IL-6 and tumour necrosis factor (TNF-α were determined by ELISA. The levels of the ROCK/NF-κB pathway were determined by Western blotting. Results: The contents of pro-inflammatory cytokines interleukin (IL-1β, IL-6 and tumour necrosis factor (TNF-α were inhibited by ALK, metformin or fasudil in diabetic db/db mice. Further, Western blotting analysis showed that the expression of Rho, ROCK1, ROCK2, p-NF-κBp65, and p-IκBα was significantly reversed by ALK treatment. In human hepatic HepG2 cells, the hepatoprotective effects of ALK were further characterized. With response to palmitic acid-challenge, increased amounts of insulin, ALT, AST, TG, and TC were observed, whereas ALK pretreatment significantly inhibited their leakage in HepG2 cells without appreciable cytotoxic effects. The inflammation condition was recovered with ALK treatment as shown by changes of IL-1β, IL-6 and TNF-α. Further, Western blotting analysis also suggested that ALK improves hepatic inflammation in a Rho-kinase pathway. Conclusion: The present study successfully investigated the role of Rho-kinase signalling in diabetic liver injury. ALK exhibited hepatoprotective effects in diabetic db/db mice, and it might act through improving hepatic inflammation through the Rho-kinase pathway.

  3. footprintDB: a database of transcription factors with annotated cis elements and binding interfaces.

    Science.gov (United States)

    Sebastian, Alvaro; Contreras-Moreira, Bruno

    2014-01-15

    Traditional and high-throughput techniques for determining transcription factor (TF) binding specificities are generating large volumes of data of uneven quality, which are scattered across individual databases. FootprintDB integrates some of the most comprehensive freely available libraries of curated DNA binding sites and systematically annotates the binding interfaces of the corresponding TFs. The first release contains 2422 unique TF sequences, 10 112 DNA binding sites and 3662 DNA motifs. A survey of the included data sources, organisms and TF families was performed together with proprietary database TRANSFAC, finding that footprintDB has a similar coverage of multicellular organisms, while also containing bacterial regulatory data. A search engine has been designed that drives the prediction of DNA motifs for input TFs, or conversely of TF sequences that might recognize input regulatory sequences, by comparison with database entries. Such predictions can also be extended to a single proteome chosen by the user, and results are ranked in terms of interface similarity. Benchmark experiments with bacterial, plant and human data were performed to measure the predictive power of footprintDB searches, which were able to correctly recover 10, 55 and 90% of the tested sequences, respectively. Correctly predicted TFs had a higher interface similarity than the average, confirming its diagnostic value. Web site implemented in PHP,Perl, MySQL and Apache. Freely available from http://floresta.eead.csic.es/footprintdb.

  4. Integration of external estimated breeding values and associated reliabilities using correlations among traits and effects.

    Science.gov (United States)

    Vandenplas, J; Colinet, F G; Glorieux, G; Bertozzi, C; Gengler, N

    2015-12-01

    Based on a Bayesian view of linear mixed models, several studies showed the possibilities to integrate estimated breeding values (EBV) and associated reliabilities (REL) provided by genetic evaluations performed outside a given evaluation system into this genetic evaluation. Hereafter, the term "internal" refers to this given genetic evaluation system, and the term "external" refers to all other genetic evaluations performed outside the internal evaluation system. Bayesian approaches integrate external information (i.e., external EBV and associated REL) by altering both the mean and (co)variance of the prior distributions of the additive genetic effects based on the knowledge of this external information. Extensions of the Bayesian approaches to multivariate settings are interesting because external information expressed on other scales, measurement units, or trait definitions, or associated with different heritabilities and genetic parameters than the internal traits, could be integrated into a multivariate genetic evaluation without the need to convert external information to the internal traits. Therefore, the aim of this study was to test the integration of external EBV and associated REL, expressed on a 305-d basis and genetically correlated with a trait of interest, into a multivariate genetic evaluation using a random regression test-day model for the trait of interest. The approach we used was a multivariate Bayesian approach. Results showed that the integration of external information led to a genetic evaluation for the trait of interest for, at least, animals associated with external information, as accurate as a bivariate evaluation including all available phenotypic information. In conclusion, the multivariate Bayesian approaches have the potential to integrate external information correlated with the internal phenotypic traits, and potentially to the different random regressions, into a multivariate genetic evaluation. This allows the use of different

  5. Value Chain, Stakeholders Analysis and Technology: A Holistic and Integrated Approach for Determining the Cumulative Added Value of Education

    Science.gov (United States)

    Ben Khudair, Saud Abdullah; Abdalla, Abdalla Khidir

    2016-01-01

    The research problem addressed in this study focused on the students' assessment issue. Although the assessment of student learning should form part of the curriculum of school programs, many educational institutions do not make student assessment part of their teaching and learning routines. A holistic and integrated framework, which encompasses…

  6. Dicty_cDB: SLJ310 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5' similar to Arabidopsis thaliana sequence At1g48030 lipoamide dehydrogenase precursor see http://mips... At1g48030 lipoamide dehydrogenase precursor see http://mips.gsf.de/proj/thal/db/index.html, mRNA sequence.

  7. A new method to determine J0-integral values (ASTM E 813) without any auxiliary equipment

    International Nuclear Information System (INIS)

    Ullrich, G.; Krompholz, K.

    1987-01-01

    In this contribution the path independent J-integral according to J.R. Rice, respective J.D. Landes and J.A. Begley due to ASTME 813 is calculated by the product J pl = d v J el for 3 point bend type specimen. Here d v is the load point displacement up to the point of the onset of stable crack growth V, which is taken from the load versus load point displacement diagram and J el a value which is equivalent to K 2 /E, where K is the stress intensity factor (ASTME 399) and E is Young's modulus. The advantage of the new procedure is the simplicity of the test arrangement and of the evaluation with the determination of initiation point V without computer or other auxiliary equipment. (orig.) [de

  8. Uniqueness and Asymptotic Behavior of Positive Solutions for a Fractional-Order Integral Boundary Value Problem

    Directory of Open Access Journals (Sweden)

    Min Jia

    2012-01-01

    Full Text Available We study a model arising from porous media, electromagnetic, and signal processing of wireless communication system -tαx(t=f(t,x(t,x'(t,x”(t,…,x(n-2(t,  0integrals, A is a function of bounded variation, and dA can be a changing-sign measure. The existence, uniqueness, and asymptotic behavior of positive solutions to the singular nonlocal integral boundary value problem for fractional differential equation are obtained. Our analysis relies on Schauder's fixed-point theorem and upper and lower solution method.

  9. Comparison of integral cross section values of several cross section libraries in the SAND-II format

    International Nuclear Information System (INIS)

    Zijp, W.L.; Nolthenius, H.J.

    1978-01-01

    A comparison of some integral cross section values for several cross section libraries in the SAND-II format is presented. The integral cross section values are calculated with aid of the spectrum functions for a Watt fission spectrum, a 1/E spectrum and a Maxwellian spectrum. The libraries which are considered here are CCC-112B, ENDF/B-IV, DETAN74, LAPENAS and CESNEF. These 5 cross section libraries used have all the SAND-II format. (author)

  10. Communicating value from a service dominant logic perspective: the explicitness of the customer's resource integrating role in advertising

    OpenAIRE

    Leroi-Werelds, Sara; Streukens, Sandra; Merken, Anne; Janssens, Wim

    2013-01-01

    Recent research in marketing in general and service logic in particular has indicated that the customer is responsible for his own value creation. The customer has to integrate the resources provided by the firm (goods, services) with other resources by applying his own skills. The customer thus acts as a resource integrator. This paper examines the effects of explicitly stating this customer’s resource integrating role in the advertised message. The results of this study show that the inclus...

  11. Integrated crop management of SRC plantations to maximise crop value, wildlife benefits and other added value opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Sage, R; Tucker, K

    1998-07-01

    This report summaries the results of a study aiming to develop an integrated approach to pest management (IPM) for the short rotation cultivation (SRC) of willows and poplars. Details are given of crop and site characteristics, non-destructive assessment of SRC biomass, the quantification of crop shadiness, and the effects of wind exposure on crop growth. The section on invertebrates covers invertebrates colonising UK SRC plantations, invertebrates which are or can become pests, natural control agents of SRC pests, the abundance and distribution of chrysomelids between sites, preferences exhibited by chrysomelids for different varieties, overwintering and dispersal of chrysomelids into SRC, and IPM of insects. The section on vertebrate fauna addresses birds in winter, the breeding birds of SRC, gamebird use of SRC, and mammals and other vertebrates of SRC. A section on ground flora deals with changes in ground flora with time, ground flora introductions, the effects of weeds on the growth of SRC, and an overview of integrated crop management in SRC plantations.

  12. Simulating the value of electric-vehicle-grid integration using a behaviourally realistic model

    Science.gov (United States)

    Wolinetz, Michael; Axsen, Jonn; Peters, Jotham; Crawford, Curran

    2018-02-01

    Vehicle-grid integration (VGI) uses the interaction between electric vehicles and the electrical grid to provide benefits that may include reducing the cost of using intermittent renwable electricity or providing a financial incentive for electric vehicle ownerhip. However, studies that estimate the value of VGI benefits have largely ignored how consumer behaviour will affect the magnitude of the impact. Here, we simulate the long-term impact of VGI using behaviourally realistic and empirically derived models of vehicle adoption and charging combined with an electricity system model. We focus on the case where a central entity manages the charging rate and timing for participating electric vehicles. VGI is found not to increase the adoption of electric vehicles, but does have a a small beneficial impact on electricity prices. By 2050, VGI reduces wholesale electricity prices by 0.6-0.7% (0.7 MWh-1, 2010 CAD) relative to an equivalent scenario without VGI. Excluding consumer behaviour from the analysis inflates the value of VGI.

  13. The prognostic value of amplitude-integrated EEG in full-term neonates with seizures.

    Directory of Open Access Journals (Sweden)

    Dandan Zhang

    Full Text Available Neonatal seizures pose a high risk for adverse outcome in survived infants. While the prognostic value of amplitude-integrated electroencephalogram (aEEG is well established in neonates with encephalopathy and asphyxia, neonatal seizure studies focusing on the direct correlation between early aEEG measurement and subsequent neurologic outcome are scarce. In this study, the prognostic value of aEEG features was systematically analyzed in 143 full-term neonates to identify prognostic indicators of neurodevelopmental outcome. Neonatal aEEG features of background pattern, cyclicity, and seizure activity, as well as the etiology of neonatal seizures, were significantly associated with neurodevelopmental outcome at one year of age. aEEG background pattern was highly associated with neurologic outcomes (χ² = 116.9, followed by aEEG cyclicity (χ² = 87.2 and seizure etiology (χ² = 79.3. Multiple linear regression showed that the four predictors explained 71.2% of the variation in neurological outcome, with standardized β coefficients of 0.44, 0.24, 0.22, and 0.14 for the predictors of aEEG background pattern, cyclicity, etiology, and aEEG seizure activity, respectively. This clinically applicable scoring system based on etiology and three aEEG indices would allow pediatricians to assess the risk for neurodevelopmental impairment and facilitate an early intervention in newborns developing seizures.

  14. [Evaluation of thermal comfort in a student population: predictive value of an integrated index (Fanger's predicted mean value].

    Science.gov (United States)

    Catenacci, G; Terzi, R; Marcaletti, G; Tringali, S

    1989-01-01

    Practical applications and predictive values of a thermal comfort index (Fanger's PRV) were verified on a sample school population (1236 subjects) by studying the relationships between thermal sensations (subjective analysis), determined by means of an individual questionnaire, and the values of thermal comfort index (objective analysis) obtained by calculating the PMV index individually in the subjects under study. In homogeneous conditions of metabolic expenditure rate and thermal impedence from clothing, significant differences were found between the two kinds of analyses. At 22 degrees C mean radiant and operative temperature, the PMV values averaged 0 and the percentage of subjects who experienced thermal comfort did not exceed 60%. The high level of subjects who were dissatisfied with their environmental thermal conditions confirms the doubts regarding the use of the PMV index as a predictive indicator of thermal comfort, especially considering that the negative answers were not homogeneous nor attributable to the small thermal fluctuations (less than 0.5 degree C) measured in the classrooms.

  15. Basalt aquifer identification, correlation and sampling activities. History of Wells DB-8, DB-9, DB-10 and DB-11

    International Nuclear Information System (INIS)

    Webster, C.T.

    1979-07-01

    Research core wells have been completed to assist in the characterization of the groundwater regime of the upper confined aquifers found within the basalts of the Hanford Site. These wells were drilled on the Hanford Site for the Long-Term Transuranic Defense Waste Program. They were constructed to assure the Department of Energy that waste management operations will not provide an avenue for offsite migration of radionuclides. This second report details results of confined aquifer drilling activities. The purpose of this report is to document the drilling history of the wells by presenting as-built well construction diagrams and tables listing hole history data, coring records and bit records. Four wells were cored to a maximum depth of 1100 feet and water samples were taken from selected confined aquifers. Full depth was reached on all wells and core recovery was 94% of all formations drilled. Well DB-8 was abandoned after a well screen was destroyed while setting it in the well. Two wells, DB-9 and DB-10 were screened in the Mabton interbed and water was produced from this interval in both wells. Well DB-11 was used to explore for artesian water from the Priest Rapids flow unit on the western edge of the Hanford Site. The water was found at a depth of 1045 feet and now produces makeup water for all Hanford drilling

  16. PK-PD Integration Modeling and Cutoff Value of Florfenicol against Streptococcus suis in Pigs

    Directory of Open Access Journals (Sweden)

    Zhixin Lei

    2018-01-01

    Full Text Available The aims of the present study were to establish optimal doses and provide an alternate COPD for florfenicol against Streptococcus suis based on pharmacokinetic-pharmacodynamic integration modeling. The recommended dose (30 mg/kg b.w. were administered in healthy pigs through intramuscular and intravenous routes for pharmacokinetic studies. The main pharmacokinetic parameters of Cmax, AUC0-24h, AUC, Ke, t1/2ke, MRT, Tmax, and Clb, were estimated as 4.44 μg/ml, 88.85 μg⋅h/ml, 158.56 μg⋅h/ml, 0.048 h-1, 14.46 h, 26.11 h, 4 h and 0.185 L/h⋅kg, respectively. The bioavailability of florfenicol was calculated to be 99.14% after I.M administration. A total of 124 Streptococcus suis from most cities of China were isolated to determine the minimum inhibitory concentration (MIC of florfenicol. The MIC50 and MIC90 were calculated as 1 and 2 μg/ml. A serotype 2 Streptococcus suis (WH-2, with MIC value similar to MIC90, was selected as a representative for an in vitro and ex vivo pharmacodynamics study. The MIC values of WH-2 in TSB and plasma were 2 μg/ml, and the MBC/MIC ratios were 2 in TSB and plasma. The MPC was detected to be 3.2 μg/ml. According to inhibitory sigmoid Emax model, plasma AUC0-24h/MIC values of florfenicol versus Streptococcus suis were 37.89, 44.02, and 46.42 h for the bactericidal, bacteriostatic, and elimination activity, respectively. Monte Carlo simulations the optimal doses for bactericidal, bacteriostatic, and elimination effects were calculated as 16.5, 19.17, and 20.14 mg/kg b.w. for 50% target attainment rates (TAR, and 21.55, 25.02, and 26.85 mg/kg b.w. for 90% TAR, respectively. The PK-PD cutoff value (COPD analyzed from MCS for florfenicol against Streptococcus suis was 1 μg/ml which could provide a sensitivity cutoff value. These results contributed an optimized alternative to clinical veterinary medicine and showed that the dose of 25.02 mg/kg florfenicol for 24 h could have a bactericidal action against

  17. Integrating social and value dimensions into sustainability assessment of lignocellulosic biofuels.

    Science.gov (United States)

    Raman, Sujatha; Mohr, Alison; Helliwell, Richard; Ribeiro, Barbara; Shortall, Orla; Smith, Robert; Millar, Kate

    2015-11-01

    The paper clarifies the social and value dimensions for integrated sustainability assessments of lignocellulosic biofuels. We develop a responsible innovation approach, looking at technology impacts and implementation challenges, assumptions and value conflicts influencing how impacts are identified and assessed, and different visions for future development. We identify three distinct value-based visions. From a techno-economic perspective, lignocellulosic biofuels can contribute to energy security with improved GHG implications and fewer sustainability problems than fossil fuels and first-generation biofuels, especially when biomass is domestically sourced. From socio-economic and cultural-economic perspectives, there are concerns about the capacity to support UK-sourced feedstocks in a global agri-economy, difficulties monitoring large-scale supply chains and their potential for distributing impacts unfairly, and tensions between domestic sourcing and established legacies of farming. To respond to these concerns, we identify the potential for moving away from a one-size-fits-all biofuel/biorefinery model to regionally-tailored bioenergy configurations that might lower large-scale uses of land for meat, reduce monocultures and fossil-energy needs of farming and diversify business models. These configurations could explore ways of reconciling some conflicts between food, fuel and feed (by mixing feed crops with lignocellulosic material for fuel, combining livestock grazing with energy crops, or using crops such as miscanthus to manage land that is no longer arable); different bioenergy applications (with on-farm use of feedstocks for heat and power and for commercial biofuel production); and climate change objectives and pressures on farming. Findings are based on stakeholder interviews, literature synthesis and discussions with an expert advisory group.

  18. Sharing mutants and experimental information prepublication using FgMutantDb (https://scabusa.org/FgMutantDb).

    Science.gov (United States)

    Baldwin, Thomas T; Basenko, Evelina; Harb, Omar; Brown, Neil A; Urban, Martin; Hammond-Kosack, Kim E; Bregitzer, Phil P

    2018-06-01

    There is no comprehensive storage for generated mutants of Fusarium graminearum or data associated with these mutants. Instead, researchers relied on several independent and non-integrated databases. FgMutantDb was designed as a simple spreadsheet that is accessible globally on the web that will function as a centralized source of information on F. graminearum mutants. FgMutantDb aids in the maintenance and sharing of mutants within a research community. It will serve also as a platform for disseminating prepublication results as well as negative results that often go unreported. Additionally, the highly curated information on mutants in FgMutantDb will be shared with other databases (FungiDB, Ensembl, PhytoPath, and PHI-base) through updating reports. Here we describe the creation and potential usefulness of FgMutantDb to the F. graminearum research community, and provide a tutorial on its use. This type of database could be easily emulated for other fungal species. Published by Elsevier Inc.

  19. FROM ENFORCEMENT TO INTEGRATION: INFUSING ADMINISTRATIVE DECISION-MAKING WITH HUMAN RIGHTS VALUES

    Directory of Open Access Journals (Sweden)

    Jennifer Raso

    2015-02-01

    Full Text Available This article proposes an integration approach to realize human rights values within administrative agencies.  Using social assistance as a factual context, it examines how rights enforcement has become the dominant mechanism for reforming government benefits programs.  Rights enforcement is ineffective at achieving the values underlying human rights codes, however, even where enforcement occurs at administrative tribunals.  Attention must therefore be directed towards efforts to infuse individual and institutional discretion with human rights values.  Given their quasi-constitutional status, such values have a key role to play in shaping the design of administrative agencies and the everyday decisions of front-line workers.    Dans ce document, l’auteur propose une approche axée sur l’intégration des droits afin d’assurer le respect des valeurs qui sous-tendent les droits de la personne à l’intérieur des organismes administratifs. En se servant de l’aide sociale comme toile de fond, l’auteur explique que la plupart des décisions discrétionnaires prises dans le cadre de l’exécution des droits ne sont pas contestées.  Les mécanismes d’exécution des droits ne permettent pas d’assurer le respect des valeurs qui sous-tendent les droits de la personne, notamment en ce qui concerne les programmes d’avantages sociaux du gouvernement. En conséquence, il faut tenter d’intégrer ces valeurs aux décisions administratives discrétionnaires prises au niveau tant personnel qu’institutionnel. En raison de leur statut quasi constitutionnel, ces valeurs ont un rôle clé à jouer pour façonner la conception des organismes administratifs et les décisions que les travailleurs de première ligne sont appelés à prendre tous les jours.

  20. Determination of Component Contents of Blend Oil Based on Characteristics Peak Value Integration.

    Science.gov (United States)

    Xu, Jing; Hou, Pei-guo; Wang, Yu-tian; Pan, Zhao

    2016-01-01

    Edible blend oil market is confused at present. It has some problems such as confusing concepts, randomly named, shoddy and especially the fuzzy standard of compositions and ratios in blend oil. The national standard fails to come on time after eight years. The basic reason is the lack of qualitative and quantitative detection of vegetable oils in blend oil. Edible blend oil is mixed by different vegetable oils according to a certain proportion. Its nutrition is rich. Blend oil is eaten frequently in daily life. Different vegetable oil contains a certain components. The mixed vegetable oil can make full use of their nutrients and make the nutrients more balanced in blend oil. It is conducive to people's health. It is an effectively way to monitor blend oil market by the accurate determination of single vegetable oil content in blend oil. The types of blend oil are known, so we only need for accurate determination of its content. Three dimensional fluorescence spectra are used for the contents in blend oil. A new method of data processing is proposed with calculation of characteristics peak value integration in chosen characteristic area based on Quasi-Monte Carlo method, combined with Neural network method to solve nonlinear equations to obtain single vegetable oil content in blend oil. Peanut oil, soybean oil and sunflower oil are used as research object to reconcile into edible blend oil, with single oil regarded whole, not considered each oil's components. Recovery rates of 10 configurations of edible harmonic oil is measured to verify the validity of the method of characteristics peak value integration. An effective method is provided to detect components content of complex mixture in high sensitivity. Accuracy of recovery rats is increased, compared the common method of solution of linear equations used to detect components content of mixture. It can be used in the testing of kinds and content of edible vegetable oil in blend oil for the food quality detection

  1. Valuing flexibility: The case of an Integrated Gasification Combined Cycle power plant

    International Nuclear Information System (INIS)

    Abadie, Luis M.; Chamorro, Jose M.

    2008-01-01

    In this paper we analyze the choice between two technologies for producing electricity. In particular, the firm has to decide whether and when to invest either in a Natural Gas Combined Cycle (NGCC) power plant or in an Integrated Gasification Combined Cycle (IGCC) power plant, which may burn either coal or natural gas. Instead of assuming that fuel prices follow standard geometric Brownian motions, here they are assumed to show mean reversion, specifically to follow an inhomogeneous geometric Brownian motion. First we consider the opportunity to invest in a NGCC power plant. We derive the optimal investment rule as a function of natural gas price and the remaining life of the right to invest. In addition, the analytical solution for a perpetual option to invest is obtained. Then we turn to the IGCC power plant. We analyse the valuation of an operating plant when there are switching costs between modes of operation, and the choice of the best operation mode. This serves as an input to evaluate the option to invest in this plant. Finally we derive the value of an opportunity to invest either in a NGCC or IGCC power plant, i.e. to choose between an inflexible and a flexible technology, respectively. Depending on the opportunity's time to maturity, we derive the pairs of coal and gas prices for which it is optimal to invest in NGCC, in IGCC, or simply not to invest. Numerical computations involve the use of one- and two-dimensional binomial lattices that support a mean-reverting process for coal and gas prices. Basic parameter values are taken from an actual IGCC power plant currently in operation. Sensitivity of some results with respect to the underlying stochastic process for fuel price is also checked

  2. Advancing a Distributive-Bargaining and Integrative-Negotiation Integral System: A Values-Based Negotiation Model (VBM)

    OpenAIRE

    Ivan Gan

    2017-01-01

    The proposed values-based negotiation model (VBM) agrees with and extends principled negotiation’s recognition of personal values and emotions as important negotiation elements. First, building upon Martin Buber’s existentialist treatment of religion and secularism, VBM centers on religion as one of many possible sources of personal values that informs respectful and mutually beneficial interactions without needing one to necessarily be religious. Just as one need not be a Buddhist or a Hindu...

  3. Integrating Bioethics in Sciences’ curricula using values in science and socio-scientific issues

    Directory of Open Access Journals (Sweden)

    C. Sousa

    2017-04-01

    Full Text Available The  The main objective of the present work is selection of ethical issues that should be addressed with first year undergraduate and K-12 students. Since K-12 Sciences’ curriculum, in Portugal, does not include bioethics content in any discipline explicitly, teachers need to make an effort to include it. Some online materials are available to use in high school classes and will be discussed. My proposal combines inquiry learning-teaching methods with the aim of promoting the discussion of bioethics issues in accordance to UNESCO Bioethics Core Curriculum already adopted by twenty universities throughout the world (Darwish 2015. Some of the issues that are addressed are: ecology and environment ethics, infectious diseases and vaccination, water for all, intellectual property, genomes and patents, biotechnological advances (genetic modified organisms and synthesis of genomes, future generations, climate hanges and natural resources, biomedical advances and human rights, authorship and contributions in scientific publications, and biobanks. In conclusion, this study may constitute an example to facilitate the implementation, by K-12 teachers, of active inquiry strategies, using features of science such as values and socio-scientific issues, and focused on the discussion of concrete ethical issues facing humanity. It also constitutes a proposal of integrating Bioethics in undergraduate sciences’ curricula.

  4. Optimum value engineering and integrated design methods for reducing the cost of R-2000 houses

    Energy Technology Data Exchange (ETDEWEB)

    Proskiw, G. [Proskiw Engineering Ltd., Winnipeg, MB (Canada); Parekh, A. [Natural Resources Canada, Ottawa, ON (Canada)

    2009-07-01

    Opportunities exist to reduce the incremental cost of R-2000 construction by using optimum value engineering (OVE) and integrated design (ID) techniques. OVE is a construction philosophy in which components and systems are designed to meet their intended purposes without excessive or unnecessary use of resources. This paper summarized a study that was designed to identify opportunities for reducing the costs of R-2000 houses while improving their performance. These included detailed energy and cost analysis of various OVE/ID options which were then applied to a sample of 18 representative new home designs from British Columbia, Manitoba, and New Brunswick. The paper described the OVE/ID measures studied, cost analysis, measure utilization and energy analysis. It also included a detailed discussion of individual OVE/ID measures. Examples of some of these measures were the elimination of floor system cross-bridging; support of non-load bearing partition walls; engineered wood beams; drywall clips at corners; and non-load bearing partition walls. It was concluded that significant opportunities exist to reduce the incremental cost of R-2000 houses through careful application of OVE and ID practices. 5 refs., 4 tabs., 1 fig.

  5. Value chain envy : explaining new entry and vertical integration in popular music

    NARCIS (Netherlands)

    Mol, Joeri M.; Wijnberg, Nachoem M.

    2002-01-01

    The desirability of establishing a value chain at a particular stage in a value system can be considered to depend on the relation between the value that can be created and the value that can be captured at that particular stage. Value chain envy motivates firms to invade the more desirable stages

  6. Toward a Broader Understanding of Teacher Technology Integration Beliefs and Values

    Science.gov (United States)

    Kimmons, Royce; Hall, Cassidy

    2016-01-01

    In authentic K-12 settings, technology integration is influenced by the decisions and perspectives of a variety of stakeholders, but current research and practice related to teacher technology integration tends to revolve only around pedagogical and technical skill factors influencing integration, thereby ignoring the institutional realities that…

  7. [Integrity].

    Science.gov (United States)

    Gómez Rodríguez, Rafael Ángel

    2014-01-01

    To say that someone possesses integrity is to claim that that person is almost predictable about responses to specific situations, that he or she can prudentially judge and to act correctly. There is a closed interrelationship between integrity and autonomy, and the autonomy rests on the deeper moral claim of all humans to integrity of the person. Integrity has two senses of significance for medical ethic: one sense refers to the integrity of the person in the bodily, psychosocial and intellectual elements; and in the second sense, the integrity is the virtue. Another facet of integrity of the person is la integrity of values we cherish and espouse. The physician must be a person of integrity if the integrity of the patient is to be safeguarded. The autonomy has reduced the violations in the past, but the character and virtues of the physician are the ultimate safeguard of autonomy of patient. A field very important in medicine is the scientific research. It is the character of the investigator that determines the moral quality of research. The problem arises when legitimate self-interests are replaced by selfish, particularly when human subjects are involved. The final safeguard of moral quality of research is the character and conscience of the investigator. Teaching must be relevant in the scientific field, but the most effective way to teach virtue ethics is through the example of the a respected scientist.

  8. The IRPVM-DB database

    International Nuclear Information System (INIS)

    Davies, L.M.; Gillemot, F.; Yanko, L.; Lyssakov, V.

    1997-01-01

    The IRPVM-DB (International Reactor Pressure Vessel Material Database) initiated by the IAEA IWG LMNPP is going to collect the available surveillance and research data world-wide on RPV material ageing. This paper presents the purpose of the database; it summarizes the type and the relationship of data included; it gives information about the data access and protection; and finally, it summarizes the state of art of the database. (author). 1 ref., 2 figs

  9. The IRPVM-DB database

    Energy Technology Data Exchange (ETDEWEB)

    Davies, L M [Davies Consultants, Oxford (United Kingdom); Gillemot, F [Atomic Energy Research Inst., Budapest (Hungary); Yanko, L [Minatom (Russian Federation); Lyssakov, V [International Atomic Energy Agency, Vienna (Austria)

    1997-09-01

    The IRPVM-DB (International Reactor Pressure Vessel Material Database) initiated by the IAEA IWG LMNPP is going to collect the available surveillance and research data world-wide on RPV material ageing. This paper presents the purpose of the database; it summarizes the type and the relationship of data included; it gives information about the data access and protection; and finally, it summarizes the state of art of the database. (author). 1 ref., 2 figs.

  10. NGSmethDB 2017: enhanced methylomes and differential methylation.

    Science.gov (United States)

    Lebrón, Ricardo; Gómez-Martín, Cristina; Carpena, Pedro; Bernaola-Galván, Pedro; Barturen, Guillermo; Hackenberg, Michael; Oliver, José L

    2017-01-04

    The 2017 update of NGSmethDB stores whole genome methylomes generated from short-read data sets obtained by bisulfite sequencing (WGBS) technology. To generate high-quality methylomes, stringent quality controls were integrated with third-part software, adding also a two-step mapping process to exploit the advantages of the new genome assembly models. The samples were all profiled under constant parameter settings, thus enabling comparative downstream analyses. Besides a significant increase in the number of samples, NGSmethDB now includes two additional data-types, which are a valuable resource for the discovery of methylation epigenetic biomarkers: (i) differentially methylated single-cytosines; and (ii) methylation segments (i.e. genome regions of homogeneous methylation). The NGSmethDB back-end is now based on MongoDB, a NoSQL hierarchical database using JSON-formatted documents and dynamic schemas, thus accelerating sample comparative analyses. Besides conventional database dumps, track hubs were implemented, which improved database access, visualization in genome browsers and comparative analyses to third-part annotations. In addition, the database can be also accessed through a RESTful API. Lastly, a Python client and a multiplatform virtual machine allow for program-driven access from user desktop. This way, private methylation data can be compared to NGSmethDB without the need to upload them to public servers. Database website: http://bioinfo2.ugr.es/NGSmethDB. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

  11. Value of integrated PET/CT in clinical staging of patients with lung cancer

    International Nuclear Information System (INIS)

    Zhao Jun; Guan Yihui; Zuo Chuantao; Hua Fengchun; Lin Xiangtong

    2004-01-01

    Objectives: The purpose of this study was to evaluate the value of combined fluorine-18 fluorodeoxyglucose positron emission tomography and computed tomography (FDG PET/CT) in patients with lung cancer, and to compare the results of PET/CT with those of FDG PET and CT alone. Methods: Forty-two patients were studied in this group. 3D whole body images were acquired using Siemens Biograph Sensetionl6 PET/CT scanner. Attenuation corrected PET images, CT and fusion images were interpreted. Reports were compared for each patient including identified the number of lesions, their anatomical localization and certainty of diagnosis. Results: PET/CT increased the number of lesions reported as being definitely abnormal or normal (+22%). In 12 patients (28.6%), the PET/CT report positively impacted surgical management when compared to the PET report alone. 6 patients were correctly downstaged negating further treatment or imaging, 3 patient was upstaged to inoperable and in another 3 ones improved localization by PET/CT led to an altered surgical incision with decreased morbidity. Lesion-based evaluation showed sensitivity for regional lymph node involvement of 61% for CT alone, 88% for FDG PET alone, and 96% for integrated PET/CT imaging respectively. In addition, PET/CT could identify some benign disease, including lung tuberculosis, cyst of liver and kidney, calculus etc. Conclusion: PET/CT improves anatomical localization and increases the certainty in reporting abnormal and normal lesions. PET/CT imaging is superior to CT alone and has additional benefit over FDG PET alone, and is accurate in clinical staging for lung cancer. (authors)

  12. Comparison of integral cross section values of several cross section libraries in the SAND-II format

    International Nuclear Information System (INIS)

    Zijp, W.L.; Nolthenius, H.J.

    1976-09-01

    A comparison of some integral cross-section values for several cross-section libraries in the SAND-II format is presented. The integral cross-section values are calculated with the aid of the spectrum functions for a Watt fission spectrum, a 1/E spectrum and a Maxwellian spectrum. The libraries which are considered here are CCC-112B, ENDF/B-IV, DETAN74, LAPENAS and CESNEF. These 5 cross-section libraries used have all the SAND-II format. Discrepancies between cross-sections in the different libraries are indicated but not discussed

  13. Values and principles of person-centered integrated care: a systematic literature review (SIG meeting)

    OpenAIRE

    Zonneveld, Nick; Miller, Robin; Minkman, Mirella

    2017-01-01

    Introduction: In recent years many knowledge about integrated health services has been developed. So far research has focused on operational themes and interventions on the one side, which help decision makers in practice. On the other hand, a number of studies about generic elements of person-centered and integrated care have been published, resulting in valuable conceptual models and frameworks [1-9]. A third area of research is how to measure integrated care.However, if we want to further ...

  14. The WTO Agreement on government procurement as a tool for Ukraine’s integration into the global value chains

    OpenAIRE

    GUZHVA IGOR

    2015-01-01

    The article deals with the features of modern internationalization of production and economic relations among economic entities around the world based on the global value chains formation. The essence and the basic provisions of the multilateral WTO Agreement on Government Procurement as the integration tool of Ukraine’s industries into the global value chains are revealed. The Ukraine’s government procurement reforming progress towards the relevant WTO rules and regulations full implementati...

  15. Designing an integrated model based on the indicators Quality and Earned Value for risk management in Information Technology Projects

    OpenAIRE

    TATLARI, Mohammad Reza; KAZEMİPOOR, Hamed

    2015-01-01

    There are two effective factors on Information Technology (IT) projects risk including quality and earned value so that by controlling these two factors and their increased level in IT projects, the corresponding risk can be decreased. Therefore in present study, an integrated model was designed based on quality and earned value indicators for risk management in IT projects on a new and efficient approach. The proposed algorithm included the steps such as preparing a list of several indicator...

  16. Global Value Chain Integration and Productivity : Evidence from Enterprise Surveys in Namibia, South Africa, and Swaziland

    OpenAIRE

    Winkler, Deborah; Farole, Thomas

    2015-01-01

    In order to adequately measure a firm’s participation in GVCs in this context, it is important to first identify the different forms through which GVC integration can affect domestic firms’ productivity. Integrating a country’s domestic suppliers into GVCs increases the possibility for productivity gains through exporting to a buyer abroad or supplying to a multinational in the country. Bu...

  17. Integral methods of solving boundary-value problems of nonstationary heat conduction and their comparative analysis

    Science.gov (United States)

    Kot, V. A.

    2017-11-01

    The modern state of approximate integral methods used in applications, where the processes of heat conduction and heat and mass transfer are of first importance, is considered. Integral methods have found a wide utility in different fields of knowledge: problems of heat conduction with different heat-exchange conditions, simulation of thermal protection, Stefantype problems, microwave heating of a substance, problems on a boundary layer, simulation of a fluid flow in a channel, thermal explosion, laser and plasma treatment of materials, simulation of the formation and melting of ice, inverse heat problems, temperature and thermal definition of nanoparticles and nanoliquids, and others. Moreover, polynomial solutions are of interest because the determination of a temperature (concentration) field is an intermediate stage in the mathematical description of any other process. The following main methods were investigated on the basis of the error norms: the Tsoi and Postol’nik methods, the method of integral relations, the Gudman integral method of heat balance, the improved Volkov integral method, the matched integral method, the modified Hristov method, the Mayer integral method, the Kudinov method of additional boundary conditions, the Fedorov boundary method, the method of weighted temperature function, the integral method of boundary characteristics. It was established that the two last-mentioned methods are characterized by high convergence and frequently give solutions whose accuracy is not worse that the accuracy of numerical solutions.

  18. Are societies with a high value on the Active Ageing Index more age-integrated?

    NARCIS (Netherlands)

    P.A. Dykstra (Pearl); M. Fleischmann (Maria)

    2017-01-01

    textabstractCombining round four data from the European Social Survey (ESS) with indicators of Active Ageing, Dykstra and Fleischmann examine conditions conducive to age integration. It uses both a behavioural and an attitudinal measure of age integration: the prevalence of cross-age friendships

  19. Are societies with a high value on the Active Ageing Index more age-integrated?

    NARCIS (Netherlands)

    P.A. Dykstra (Pearl); M. Fleischmann (Maria)

    2016-01-01

    textabstractCombining round four data from the European Social Survey (ESS) with indicators of Active Ageing, we examine conditions conducive to age integration. We use both a behavioural and an attitudinal measure of age integration: the prevalence of cross-age friendships and low levels of ageism.

  20. Concepts of intrinsic value and integrity of plants in organic plant breeding and propagation

    NARCIS (Netherlands)

    Lammerts Van Bueren, E.; Struik, P.C.; Tiemens-Hulscher, M.; Jacobsen, E.

    2003-01-01

    The natural approach taken by organic agriculture obviates the use of synthetic agrochemicals and emphasizes farming in accordance with agroecological principles. Also implicit in this approach is an appreciation for the integrity of living farm organisms, with the integrity being evaluated from a

  1. On McShane integrability of Banach space-valued functions

    Czech Academy of Sciences Publication Activity Database

    Kurzweil, Jaroslav; Schwabik, Štefan

    2004-01-01

    Roč. 29, č. 2 (2004), s. 763-780 ISSN 0147-1937 R&D Projects: GA ČR GA201/01/1199 Institutional research plan: CEZ:AV0Z1019905 Keywords : McShane integral * vector integration Subject RIV: BA - General Mathematics

  2. Connection between Feynman integrals having different values of the space-time dimension

    International Nuclear Information System (INIS)

    Tarasov, O.V.

    1996-05-01

    A systematic algorithm for obtaining recurrence relations for dimensionally regularized Feynman integrals w.r.t. the space-time dimension d is proposed. The relation between d and d-2 dimensional integrals is given in terms of a differential operator for which an explicit formula can be obtained for each Feynman diagram. We show how the method works for one-, two- and three-loop integrals. The new recurrence relations w.r.t. d are complementary to the recurrence relations which derive from the method of integration by parts. We find that the problem of the irreducible numerators in Feynman integrals can be naturally solved in the framework of the proposed generalized recurrence relations. (orig.)

  3. USING INTEGRATED MARKETING COMMUNICATION TO CREATE LONGTERM VALUE FOR A SUSTAINABLE ORGANIZATION. CASE STUDY: THE BAKERY INDUSTRY IN ROMANIA

    Directory of Open Access Journals (Sweden)

    OANCEA OLIMPIA ELENA MIHAELA

    2015-07-01

    Full Text Available Integrated marketing communication is considered to be a major development domain during the last decennium of the 20th century. Today, consumers use as many information sources as possible, and the value of integrated marketing communication has grown considerably. Very well targeted, integrated marketing communication campaigns rely on the strengths of the existing communicational tools, to favorably influence the behavior of the target public. The concept of integrated marketing communication was viewed for a long time as being an important management aspect, since by the efficacy of the integrated marketing communication tools, such as advertising, public relations, direct marketing, sales promotion, sales personnel, one can optimize the impact of communication on the target public. Integrated marketing communication has the role of building and consolidating profitable relations with the actual and potential clients and of generating synergy through the coordination of all the communicational mix tools into a coherent programme that can have a maximum effect. Integrated marketing communication can offer a real sustainable competitive advantage to any organization that profitably uses the potential of this communication. For this reason, the aim of the present paper consisted, on the one hand, in the evaluation of the extent to which the baking industry producers in Romania use integrated marketing communication tools, and, on the other hand, in the identification of the ways of measuring the efficacy of each communicational tool used by them.

  4. On Solutions of the Integrable Boundary Value Problem for KdV Equation on the Semi-Axis

    International Nuclear Information System (INIS)

    Ignatyev, M. Yu.

    2013-01-01

    This paper is concerned with the Korteweg–de Vries (KdV) equation on the semi-axis. The boundary value problem with inhomogeneous integrable boundary conditions is studied. We establish some characteristic properties of solutions of the problem. Also we construct a wide class of solutions of the problem using the inverse spectral method.

  5. Technological and cross-border mixture value chain of science and engineering of multi-integrative mechatronics-integronics-adaptronics

    Science.gov (United States)

    Gheorghe, Gh. Ion; Popan, Gheorghe

    2013-10-01

    This scientific paper presents in national premiere and in original concept of the author, the scientific national and the author's original concept, the technological and cross-border mixture value chain of science and engineering of multi-integrative Mechatronics-Integronics-Adaptronics, as high-tech vector support development, for viability and sustainability of a new intelligent and competitive labour market.

  6. Public values for integration in natural disaster management and planning: A case study from Victoria, Australia.

    Science.gov (United States)

    Rawluk, Andrea; Ford, Rebecca M; Neolaka, Fendi L; Williams, Kathryn J

    2017-01-01

    Values can be useful for identifying what is important to individuals and communities, yet there is currently not a coherent way to conceptualize, identify, and organize the breadth of values that can be affected by a natural disaster. This research proposes a conceptual framework for how to conceptualize, identify, and organize values, and proposes a concrete, tangible value called the valued entity. The framework is applied in two studies of bushfire in Victoria, Australia: 112 submissions from individuals to the 2009 Victorian Bushfires Royal Commission and interviews with 30 members of the public in bushfire risk landscapes. Our findings suggest that: what people value ranges from abstract to concrete; prevalent abstract values include benevolence and universalism; prevalent mid-level valued attributes include natural attributes of landscapes and human life and welfare; prevalent valued entities are people and properties close to the person. Comparison between the two studies suggests people with more recent experience with bushfire refer less to the importance of natural places and natural attributes. The conceptual framework can act as a boundary object to facilitate researchers and policy-makers understanding the breadth of values affected by natural disaster events and management actions and how governance can better consider values at different scales. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  7. Transformasi Skema Basis Data Relasional Menjadi Model Data Berorientasi Dokumen pada MongoDB

    Directory of Open Access Journals (Sweden)

    I Gede Winaya

    2016-01-01

    Full Text Available MongoDB is a database that uses document-oriented data storage models. In fact, to  migrate from a relational database to NoSQL databases such as MongoDB is not an easy matter especially if the data are extremely complex. Based on the documentation that has been done by several global companies related to the use of MongoDB, it can be concluded that the process of migration from RDBMS to MongoDB require quite a long time. One process that takes quite a lot is transformation of relational database schema into a document-oriented data model on MongoDB.             This research discusses the development transformation system of relational database schema to the document oriented data model in MongoDB. The process of transformation is done by utilizing the structure and relationships between tables in the scheme as the main parameters of the modeling algorithm. In the process of the modeling documents, it necessary to adjustments the specifications of MongoDB document that formed document model can be implemented in MongoDB.             Document models are formed from transformation process can be a single document, embedded document, referenced document or combination of these. Document models are formed depending on the type, rules, and the value of the relationships cardinality between tables in the relational database schema.

  8. Getting started with MariaDB

    CERN Document Server

    Bartholomew, Daniel

    2013-01-01

    A practical, hands-on, beginner-friendly guide to installing and using MariaDB.Getting Started with MariaDB is for anyone who wants to learn more about databases in general or MariaDB in particular. No prior database experience is required. It is assumed that you have basic knowledge of software installation, editing files with a text editor, and using the command line and terminal.

  9. Cooley building opens in Houston. Demonstrates value of fully integrated marketing communications.

    Science.gov (United States)

    Rees, Tom

    2002-01-01

    The Texas Heart Institute at St. Luke's Episcopal HospiTal in Houston dedicated its new 10-story Denton A. Cooley Building in January. The structure opened with a fanfare, thanks to a well-integrated marketing communications program.

  10. Capturing the Integration of Practice-Based Learning with Beliefs, Values, and Attitudes using Modified Concept Mapping.

    Science.gov (United States)

    Mcnaughton, Susan; Barrow, Mark; Bagg, Warwick; Frielick, Stanley

    2016-01-01

    Practice-based learning integrates the cognitive, psychomotor, and affective domains and is influenced by students' beliefs, values, and attitudes. Concept mapping has been shown to effectively demonstrate students' changing concepts and knowledge structures. This article discusses how concept mapping was modified to capture students' perceptions of the connections between the domains of thinking and knowing, emotions, behavior, attitudes, values, and beliefs and the specific experiences related to these, over a period of eight months of practice-based clinical learning. The findings demonstrate that while some limitations exist, modified concept mapping is a manageable way to gather rich data about students' perceptions of their clinical practice experiences. These findings also highlight the strong integrating influence of beliefs and values on other areas of practice, suggesting that these need to be attended to as part of a student's educational program.

  11. How Patent Function Integration with R&D Influence the Value of Patents

    DEFF Research Database (Denmark)

    Beukel, Karin; Valentin, Finn

    Patent strategies are endogenous to firm appropriability. However, to what extent does firm’s R&D teams’ engagement with patent experts influence the value of patents? We estimate the relationship between firm’s R&D use of patent functions on patent value in Biotech firms. Controlling...... for characteristics of scientific team, firm effects, and other patent value indicators, we find that having a firm specific (in-house) internal patent function is a driver of patent value. In addition, we find that the way in which patent functions create patent value differs dependent on whether the firm has...... internal patent function or not. In-house patent functions create value through narrow patents, whereas, firms with no in-house patent function create valuable patents by the use of broader scoped patents. Our results point to a strong effect of firm specific patent functions, but also explain how firms...

  12. CouchDB the definitive guide

    CERN Document Server

    Anderson, J; Slater, Noah

    2010-01-01

    Three of CouchDB's creators show you how to use this document-oriented database as a standalone application framework or with high-volume, distributed applications. With its simple model for storing, processing, and accessing data, CouchDB is ideal for web applications that handle huge amounts of loosely structured data. That alone would stretch the limits of a relational database, yet CouchDB offers an open source solution that's reliable, scales easily, and responds quickly. CouchDB works with self-contained data that has loose or ad-hoc connections. It's a model that fits many real-world

  13. The value chain of a commune as an attempt to integrate various theoretical concepts

    OpenAIRE

    Dziemianowicz Wojciech

    2016-01-01

    This article deals with the topic of the local development factors within the value chain of the commune (gmina). The concept of the value chain examines development factors in three groups: the leader, the internal environment and the external environment; it also takes into account the time factor. This article also presents the usefulness of three theoretical and conceptual approaches in reference to the idea of the value chain: the theory of development path dependency, the network theory...

  14. Exendin-4 improves resistance to Listeria monocytogenes infection in diabetic db/db mice

    OpenAIRE

    Liu, Hsien Yueh; Chung, Chih-Yao; Yang, Wen-Chin; Liang, Chih-Lung; Wang, Chi-Young; Chang, Chih-Yu; Chang, Cicero Lee-Tian

    2012-01-01

    The incidence of diabetes mellitus is increasing among companion animals. This disease has similar characteristics in both humans and animals. Diabetes is frequently identified as an independent risk factor for infections associated with increased mortality. In the present study, homozygous diabetic (db/db) mice were infected with Listeria (L.) monocytogenes and then treated with the anti-diabetic drug exendin-4, a glucagon-like peptide 1 analogue. In aged db/db mice, decreased CD11b+ macroph...

  15. From Synergy to Complexity: The Trend Toward Integrated Value Chain and Landscape Governance.

    Science.gov (United States)

    Ros-Tonen, Mirjam A F; Reed, James; Sunderland, Terry

    2018-05-30

    This Editorial introduces a special issue that illustrates a trend toward integrated landscape approaches. Whereas two papers echo older "win-win" strategies based on the trade of non-timber forest products, ten papers reflect a shift from a product to landscape perspective. However, they differ from integrated landscape approaches in that they emanate from sectorial approaches driven primarily by aims such as forest restoration, sustainable commodity sourcing, natural resource management, or carbon emission reduction. The potential of such initiatives for integrated landscape governance and achieving landscape-level outcomes has hitherto been largely unaddressed in the literature on integrated landscape approaches. This special issue addresses this gap, with a focus on actor constellations and institutional arrangements emerging in the transition from sectorial to integrated approaches. This editorial discusses the trends arising from the papers, including the need for a commonly shared concern and sense of urgency; inclusive stakeholder engagement; accommodating and coordinating polycentric governance in landscapes beset with institutional fragmentation and jurisdictional mismatches; alignment with locally embedded initiatives and governance structures; and a framework to assess and monitor the performance of integrated multi-stakeholder approaches. We conclude that, despite a growing tendency toward integrated approaches at the landscape level, inherent landscape complexity renders persistent and significant challenges such as balancing multiple objectives, equitable inclusion of all relevant stakeholders, dealing with power and gender asymmetries, adaptive management based on participatory outcome monitoring, and moving beyond existing administrative, jurisdictional, and sectorial silos. Multi-stakeholder platforms and bridging organizations and individuals are seen as key in overcoming such challenges.

  16. Negotiating interests or values and reaching integrative agreements: the importance of time pressure and temporary impasses

    NARCIS (Netherlands)

    Harinck, F.; de Dreu, C.K.W.

    2004-01-01

    Negotiation research and theory tends to focus on interests and ignores values. This experiment compared the influence of negotiations about interests with negotiations about values under low or high time pressure. Results showed that (1) individuals got locked into early impasses more often under

  17. Integrating Work and Basic Values into the Spherical Model of Interests

    Science.gov (United States)

    Sodano, Sandro M.

    2011-01-01

    Two prominent models of values, one in work and the other in life, were examined as they each related to the dimensions underlying the Spherical Model of Interests (Tracey & Rounds, 1996) as measured by the Personal Globe Inventory (PGI; Tracey, 2002). The technique of external property vector fitting was utilized to plot the value constructs onto…

  18. Critical Competencies for the Innovativeness of Value Creation Champions : Identifying Challenges and Work-integrated Solutions

    NARCIS (Netherlands)

    Kinkel, Steffen; Schemmann, Brita; Lichtner, Ralph

    2017-01-01

    Medium-sized manufacturers of technical products with a high degree of in-house value adding activities – so-called value creation champions – are very important to the success of German industry and to safeguarding attractive jobs in Germany. Key to their success is their distinct innovativeness.

  19. Portulaca oleracea Ameliorates Diabetic Vascular Inflammation and Endothelial Dysfunction in db/db Mice

    Science.gov (United States)

    Lee, An Sook; Lee, Yun Jung; Lee, So Min; Yoon, Jung Joo; Kim, Jin Sook; Kang, Dae Gill; Lee, Ho Sub

    2012-01-01

    Type 2 diabetes is associated with significantly accelerated rates of micro- and macrovascular complications such as diabetic vascular inflammation and endothelial dysfunction. In the present study, we investigated the protective effect of the aqueous extract of Portulaca oleracea L. (AP), an edible plant used as a folk medicine, on diabetic vascular complications. The db/db mice were treated with AP (300 mg/kg/day, p.o.) for 10 weeks, and AP treatment markedly lowered blood glucose, plasma triglyceride, plasma level of LDL-cholesterol, and systolic blood pressure in diabetic db/db mice. Furthermore, AP significantly increased plasma level of HDL-cholesterol and insulin level. The impairment of ACh- and SNP-induced vascular relaxation of aortic rings were ameliorated by AP treatment in diabetic db/db mice. This study also showed that overexpression of VCAM-1, ICAM-1, E-selectin, MMP-2, and ET-1 were observed in aortic tissues of untreated db/db mice, which were significantly suppressed by treatment with AP. We also found that the insulin immunoreactivity of the pancreatic islets remarkably increased in AP treated db/db mice compared with untreated db/db mice. Taken together, AP suppresses hyperglycemia and diabetic vascular inflammation, and prevents the development of diabetic endothelial dysfunction for the development of diabetes and its vascular complications. PMID:22474522

  20. [The value of sports for handicapped patients. Achieving social integration--building bridges by paralympic sports].

    Science.gov (United States)

    Steadward, R D

    2000-11-01

    It is important to reflect back on the enormous changes that have taken place in society over the past century that have affected the quality of life of disabled persons and societal attitudes towards disability. Although great progress has been made, these people remain marginalized and disadvantaged, and despite all the efforts of volunteers, professionals, and governments, we cannot categorically state that they are fully socially integrated. The term disability continues to carry an enormous stigma, and therefore it is important to examine the concept of social integration and the issues around it as they affect disabled persons and the role of the International Paralympic Committee (IPC) movement in achieving this end.

  1. Vertical Integration as a Remedy to Imbalances in the 'Porterian' Value System: The Dutch Financial Securities Industry at the Beginning of the 20th Century

    NARCIS (Netherlands)

    Hermans, J.; Wijnberg, N.; de Wit, O.; van den Ende, J.

    2004-01-01

    The way of accounting for vertical integration, of this paper is based on the ‘Porterian’ value system and focuses on the relation between the creation and appropriation of value. The essence of a value system is that at each stage in the system value is created and added to the value created at

  2. The value chain of a commune as an attempt to integrate various theoretical concepts

    Directory of Open Access Journals (Sweden)

    Dziemianowicz Wojciech

    2016-06-01

    Full Text Available This article deals with the topic of the local development factors within the value chain of the commune (gmina. The concept of the value chain examines development factors in three groups: the leader, the internal environment and the external environment; it also takes into account the time factor. This article also presents the usefulness of three theoretical and conceptual approaches in reference to the idea of the value chain: the theory of development path dependency, the network theory, and the concept of smart specializations.

  3. A Framework for Integrating Transboundary Values, Landscape Connectivity, and ′Protected Areas′ Values Within a Forest Management Area in Northern Alberta

    Directory of Open Access Journals (Sweden)

    Jim Witiw

    2015-01-01

    Full Text Available Daishowa-Marubeni International (DMI is an integrated forest products company with operations in northern Alberta, Canada. As part of its sustainable forestry practices, it has embarked on a comprehensive plan to maintain biodiversity and landscape connectivity values within its area of operation. In addition to identification of High Conservation Value Forests (HCVF as part of an internal forest planning system and to assist forest certification interests, DMI has developed a plan for a Continuous Reserve Network (CRN. This paper describes the rationale behind DMI′s decision to identify a framework for both HCVF and the CRN. The company believes this CRN is a novel approach to ensuring visibility of connected landscape processes. DMI has introduced the concept to government, local sawmill stakeholders, and its public advisory committee, with a goal towards implementing the CRN within the area of its forest tenure as part of its forest management plan. The CRN represents nearly 44% of DMI′s tenure area, and thus makes a significant contribution to landscape connectivity and forest biodiversity. The case study represents an example where values and goals of legislated protected areas are also captured by management prescriptions within non-harvestable areas and timber-producing forests associated with an ecosystem-based approach to sustainable forest management.

  4. Influence of the resonance integral value on the fuel cycle characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Graziani, G; Trauwaert, E

    1972-04-24

    The problem that is considered here is to determine what can be done about a variation in resonance integral when the complete geometry of the reactor and of the fuel elements are fixed, leaving as only free parameters the amount of heavy metal and the enrichment to put in the fuel pins.

  5. Human well-being values of environmental flows enhancing social equity in integrated water resources management

    NARCIS (Netherlands)

    Meijer, K.S.

    2007-01-01

    This dissertation discusses how the importance of river flow-sustained ecosystems for local communities can be quantified for the purpose of balancing water supply and demand in Integrated Water Resources Management. Due to the development of water resources, for example through the construction of

  6. Missing Link: Integrated Individual Leadership Development, Employee Engagement, and Customer Value-Added Improvement

    Science.gov (United States)

    Heldenbrand, Lois; Simms, Michael S.

    2012-01-01

    Long-term care is a key public issue that affects all of us in some way at some time of our lives. Nowhere is performance improvement and quality management more imperative. Through an 8-month field study and follow-up case study, we discuss how using an integrated approach to individual leadership development, employee engagement, and customer…

  7. Application of Life Cycle Assessment for Corporate Sustainability : Integrating environmental sustainability in business for value creation

    NARCIS (Netherlands)

    Manda, B.M.K.

    2014-01-01

    The main objective of this research is to make a contribution to bridge the gap between sustainability science and business management by improving the integration of sustainability in core business of corporations. The core business of corporations is to provide products and services to meet

  8. The added value of simultaneous EEG and amplitude-integrated EEG recordings in three newborn infants

    NARCIS (Netherlands)

    de Vries, Nathalie K. S.; ter Horst, Hendrik J.; Bos, Arend F.

    2007-01-01

    Amplitude-integrated electroencephalograms (aEEGs) recorded by cerebral function monitors (CFMs) are used increasingly to monitor the cerebral activity of newborn infants with encephalopathy. Recently, new CFM devices became available which also reveal the original EEG signals from the same leads.

  9. From Volume to Value: Prospects and Pitfalls in Organising Integrated Dry Eye Practice Units

    NARCIS (Netherlands)

    J.P. Goh (Jody Paige); D.F. de Korne (Dirk); L. Tong (Louis)

    2017-01-01

    markdownabstractWith the advent of aging populations, chronic multifactorial diseases will dominate and strain existing models of health care. A model of healthcare delivery that emphasizes seamless, integrated, team-based care and remuneration for patient outcomes, have proven advantageous in

  10. Integral Boundary Value Problems for Fractional Impulsive Integro Differential Equations in Banach Spaces

    Directory of Open Access Journals (Sweden)

    A. Anguraj

    2014-02-01

    Full Text Available We study in this paper,the existence of solutions for fractional integro differential equations with impulsive and integral conditions by using fixed point method. We establish the Sufficient conditions and unique solution for given problem. An Example is also explained to the main results.

  11. Understanding Risk and Protective Factors for Child Maltreatment: The Value of Integrated, Population-Based Data

    Science.gov (United States)

    Putnam-Hornstein, Emily; Needell, Barbara; Rhodes, Anne E.

    2013-01-01

    In this article, we argue for expanded efforts to integrate administrative data systems as a "practical strategy" for developing a richer understanding of child abuse and neglect. Although the study of child maltreatment is often critiqued for being atheoretical, we believe that a more pressing concern is the absence of population-based and…

  12. R[2, 4; 2: 6] rational one-step numerical integrator for initial value ...

    African Journals Online (AJOL)

    Abstract. A method of order six is proposed for solving singular initial value problems in ordinary differential equations. It compares favourably with existing schemes. Journal of the Nigerian Association of Mathematical Physics Vol. 9 2005: pp. 285-294 ...

  13. Integration of information for research and education: changes in the value chain?

    NARCIS (Netherlands)

    Roosendaal, Hans E.; Geurts, Petrus A.T.M.; van der Vet, P.E.

    2002-01-01

    Changes in the value chain induced by the use of ICT are discussed. ICT will lead to innovation not only in the research information system but also in the educational information system or even the education system at large.

  14. Technical Performance Measurement, Earned Value, and Risk Management: An Integrated Diagnostic Tool for Program Management

    National Research Council Canada - National Science Library

    Pisano, N

    2002-01-01

    ...) and in private industry. Currently-reported earned value data contains invaluable planning and budget information with proven techniques for program management, however, shortcomings of the system are its emphasis...

  15. Comparison of calculated integral values using measured and calculated neutron spectra for fusion neutronics analyses

    International Nuclear Information System (INIS)

    Sekimoto, H.

    1987-01-01

    The kerma heat production density, tritum production density, and dose in a lithium-fluoride pile with a deuterium-tritum neutron source were calculated with a data processing code, UFO, from the pulse height distribution of a miniature NE213 neutron spectrometer, and compared with the values calculated with a Monte Carlo code, MORSE-CV. Both the UFO and MORSE-CV values agreed with the statistical error (less than 6%) of the MORSE-CV calculations, except for the outer-most point in the pile. The MORSE-CV values were slightly smaller than the UFO values for almost all cases, and this tendency increased with increasing distance from the neutron source

  16. Psychological distance boosts value-behavior correspondence in ultimatum bargaining and integrative negotiation

    NARCIS (Netherlands)

    Giacomantonio, M.; de Dreu, C.K.W.; Shalvi, S.; Sligte, D.; Leder, S.

    2010-01-01

    The present research examined how construal level and social motivation interact in influencing individuals’ behavior in social decision making settings. Consistent with recent work on psychological distance and value-behavior correspondence (Eyal, Sagristano, Trope, Liberman, & Chaiken, 2009), it

  17. Antidiabetic and Antiobesity Effects of Artemether in db/db Mice

    Directory of Open Access Journals (Sweden)

    Yu Guo

    2018-01-01

    Full Text Available This study is designed to investigate the effect of artemether on type 2 diabetic db/db mice. The experiments consisted of three groups: normal control (NC, db/+, 1% methylcellulose, intragastric administration, diabetic control (DM, db/db, 1% methylcellulose, intragastric administration, and artemether treated (artemether, db/db, 200 mg/kg of artemether, intragastric administration. The treatment lasted for two weeks. The food intake, body weight, and fasting blood glucose of mice were measured every three days. At the start and end of the experiment, the intraperitoneal glucose tolerance test (IPGTT and insulin tolerance test (IPITT were performed. We determined the serum insulin and glucagon levels by ELISA kits and calculated insulin resistance index (HOME-IR. HE staining was used to observe the morphologies of pancreas and liver in mice. The damage of pancreatic beta cells was evaluated by TUNEL staining and immunofluorescence. We found the following: (1 compared with the DM group, the food intake and weight increase rate of artemether group significantly reduced (P<0.05; (2 compared with pretreatment, artemether significantly reduced the fasting blood glucose levels, and the areas under the curves (AUCs of IPGTT were decreased significantly, increasing the tolerance to glucose of db/db mice. (P<0.05; (3 artemether improved hyperinsulinemia and decreased the AUCs of IPITT and HOME-IR, increasing the insulin sensitivity of db/db mice. (4 Artemether significantly ameliorated islet vacuolar degeneration and hepatic steatosis in db/db mice. (5 Artemether reduced the apoptosis of pancreatic beta cells and increased insulin secretion in db/db mice compared with DM group (P<0.05. Our results indicated that artemether significantly improved glucose homeostasis and insulin resistance and had the potential activity to prevent obesity, reduced the severity of fatty liver, and protected pancreatic beta cells, promising to treat type 2 diabetes.

  18. Integrating technical analysis and public values in risk-based decision making

    International Nuclear Information System (INIS)

    Bohnenblust, Hans; Slovic, Paul

    1998-01-01

    Simple technical analysis cannot capture the complex scope of preferences or values of society and individuals. However, decision making needs to be sustained by formal analysis. The paper describes a policy framework which incorporates both technical analysis and aspects of public values. The framework can be used as a decision supporting tool and helps decision makers to make more informed and more transparent decisions about safety issues

  19. PhilDB: the time series database with built-in change logging

    Directory of Open Access Journals (Sweden)

    Andrew MacDonald

    2016-03-01

    Full Text Available PhilDB is an open-source time series database that supports storage of time series datasets that are dynamic; that is, it records updates to existing values in a log as they occur. PhilDB eases loading of data for the user by utilising an intelligent data write method. It preserves existing values during updates and abstracts the update complexity required to achieve logging of data value changes. It implements fast reads to make it practical to select data for analysis. Recent open-source systems have been developed to indefinitely store long-period high-resolution time series data without change logging. Unfortunately, such systems generally require a large initial installation investment before use because they are designed to operate over a cluster of servers to achieve high-performance writing of static data in real time. In essence, they have a ‘big data’ approach to storage and access. Other open-source projects for handling time series data that avoid the ‘big data’ approach are also relatively new and are complex or incomplete. None of these systems gracefully handle revision of existing data while tracking values that change. Unlike ‘big data’ solutions, PhilDB has been designed for single machine deployment on commodity hardware, reducing the barrier to deployment. PhilDB takes a unique approach to meta-data tracking; optional attribute attachment. This facilitates scaling the complexities of storing a wide variety of data. That is, it allows time series data to be loaded as time series instances with minimal initial meta-data, yet additional attributes can be created and attached to differentiate the time series instances when a wider variety of data is needed. PhilDB was written in Python, leveraging existing libraries. While some existing systems come close to meeting the needs PhilDB addresses, none cover all the needs at once. PhilDB was written to fill this gap in existing solutions. This paper explores existing time

  20. IBM DB2 97 Advanced Administration Cookbook

    CERN Document Server

    Neagu, Adrian

    2012-01-01

    This cookbook has recipes written in a simple, easy to understand format, with lots of screenshots and insightful tips and hints. If you are a DB2 Database Administrator who wants to understand and get hands on with the underlying aspects of database administration, then this book is for you. This book assumes that you have a basic understanding of DB2 database concepts.

  1. Getting started with OrientDB

    CERN Document Server

    Tesoriero, Claudio

    2013-01-01

    A standard tutorial aimed at making you an OrientDB expert, through the use of practical examples, explained in a step-by-step format.Getting Started with OrientDB 1.3.0 is great for database designers, developers, and systems engineers. It is assumed that you are familiar with NoSQL concepts, Java, and networking principles.

  2. An interval-valued 2-tuple linguistic group decision-making model based on the Choquet integral operator

    Science.gov (United States)

    Liu, Bingsheng; Fu, Meiqing; Zhang, Shuibo; Xue, Bin; Zhou, Qi; Zhang, Shiruo

    2018-01-01

    The Choquet integral (IL) operator is an effective approach for handling interdependence among decision attributes in complex decision-making problems. However, the fuzzy measures of attributes and attribute sets required by IL are difficult to achieve directly, which limits the application of IL. This paper proposes a new method for determining fuzzy measures of attributes by extending Marichal's concept of entropy for fuzzy measure. To well represent the assessment information, interval-valued 2-tuple linguistic context is utilised to represent information. Then, we propose a Choquet integral operator in an interval-valued 2-tuple linguistic environment, which can effectively handle the correlation between attributes. In addition, we apply these methods to solve multi-attribute group decision-making problems. The feasibility and validity of the proposed operator is demonstrated by comparisons with other models in illustrative example part.

  3. Decommissioning Facility Characterization DB System

    International Nuclear Information System (INIS)

    Park, S. K.; Ji, Y. H.; Park, J. H.; Chung, U. S.

    2010-01-01

    Basically, when a decommissioning is planed for a nuclear facility, an investigation into the characterization of the nuclear facility is first required. The results of such an investigation are used for calculating the quantities of dismantled waste and estimating the cost of the decommissioning project. In this paper, it is presented a computer system for the characterization of nuclear facilities, called DEFACS (DEcommissioning FAcility Characterization DB System). This system consists of four main parts: a management coding system for grouping items, a data input system, a data processing system and a data output system. All data is processed in a simplified and formatted manner in order to provide useful information to the decommissioning planner. For the hardware, PC grade computers running Oracle software on Microsoft Windows OS were selected. The characterization data results for the nuclear facility under decommissioning will be utilized for the work-unit productivity calculation system and decommissioning engineering system as basic sources of information

  4. Decommissioning Facility Characterization DB System

    Energy Technology Data Exchange (ETDEWEB)

    Park, S. K.; Ji, Y. H.; Park, J. H.; Chung, U. S. [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2010-10-15

    Basically, when a decommissioning is planed for a nuclear facility, an investigation into the characterization of the nuclear facility is first required. The results of such an investigation are used for calculating the quantities of dismantled waste and estimating the cost of the decommissioning project. In this paper, it is presented a computer system for the characterization of nuclear facilities, called DEFACS (DEcommissioning FAcility Characterization DB System). This system consists of four main parts: a management coding system for grouping items, a data input system, a data processing system and a data output system. All data is processed in a simplified and formatted manner in order to provide useful information to the decommissioning planner. For the hardware, PC grade computers running Oracle software on Microsoft Windows OS were selected. The characterization data results for the nuclear facility under decommissioning will be utilized for the work-unit productivity calculation system and decommissioning engineering system as basic sources of information

  5. Integration of living values into physics learning based on local potentials

    Science.gov (United States)

    Sarah, S.; Prasetyo, Z. K.; Wilujeng, I.

    2018-05-01

    Living values are the principles and beliefs that influence the way of life and behavior of people in society. These values are defined to determine the individuals’ characteristics in the physical, intellectual, social-emotional, and spiritual dimensions. Such values could be acquired through physics learning. Therefore, the study concerned here was aimed at determining the difference in the living values acquired between students of the grade officially termed Grade X at a state senior high school referred to as SMAN 1 Selomerto, Central Java, Indonesia, who learned physics by using content based on local potentials and those who learned physics without using that content. A quasi-experiment with the control group pre-test post-test design was conducted to collect the data. The data were analyzed by using tests of normality, homogeneity, and different. The results indicate no difference in the living values acquired between students learning physics by using local-potential content and those learning physics without using that content.

  6. Integrating the value of salespeople and systems: adapting the benefits dependency network

    OpenAIRE

    Rogers, Beth; Stone, Merlin; Foss, B.

    2008-01-01

    Business-to-business (B2B) companies invest in customer relationship management (CRM), integrated with sales force automation (SFA) to achieve a return on investment, through improved sales force productivity, sales revenue, costs, customer satisfaction, process accuracy and customer knowledge. However, the devil is in the detail. CRM and SFA are multi-faceted. There are two main obstacles to successful implementation. One is the need for the customer to get some benefit out of the system; th...

  7. The Value of Partial Resource Pooling: Should a Service Network Be Integrated or Product-Focused?

    OpenAIRE

    Bar{\\i}\\c{s} Ata; Jan A. Van Mieghem

    2009-01-01

    We investigate how dynamic resource substitution in service systems impacts capacity requirements and responsiveness. Inspired by the contrasting network strategies of FedEx and United Parcel Service (UPS), we study when two service classes (e.g., express or regular) should be served by dedicated resources (e.g., air or ground) or by an integrated network (e.g., air also serves regular). Using call center terminology, the question is whether to operate two independent queues or one N-network....

  8. On The Integral Representation of Strictly Continuous Set-Valued Maps

    Directory of Open Access Journals (Sweden)

    Anaté K. Lakmon

    2015-11-01

    Full Text Available Let T be a completely regular topological space and C(T be the space of bounded, continuous real-valued functions on T. C(T is endowed with the strict topology (the topology generated by seminorms determined by continuous functions vanishing at in_nity. R. Giles ([13], p. 472, Theorem 4.6 proved in 1971 that the dual of C(T can be identi_ed with the space of regular Borel measures on T. We prove this result for positive, additive set-valued maps with values in the space of convex weakly compact non-empty subsets of a Banach space and we deduce from this result the theorem of R. Giles ([13], theorem 4.6, p.473.

  9. On the value of SHM in the context of service life integrity management

    DEFF Research Database (Denmark)

    Qin, Jianjun; Thöns, Sebastian; Faber, Michael Havbro

    2015-01-01

    This paper addresses the optimization of structural health monitoring(SHM) before its implementation on the basis of its Value of Information (VoI). The approach for the quantification of the value of SHM builds upon a service life cost assessment and generic structural performance model...... in conjunction with the observation, i.e. monitoring, of deterioration increments. The structural performance is described with a generic deterioration model to be calibrated to the relevant structural deterioration mechanism, such as e.g. fatigue and corrosion. The generic deterioration model allows...... for the incorporation of monitored damage increments and accounts for the precision of the data by considering the statistical uncertainties, i.e. the amount of monitoring data due to the monitoring period, and by considering the measurement uncertainty. The value of structural health monitoring is then quantified...

  10. Assessing Consumer Values and the Supply-Chain Market for the Integrated Water Heater/Dehumidifier

    Energy Technology Data Exchange (ETDEWEB)

    Ashdown, BG

    2005-01-11

    This paper presents a case study of the potential market for the dual-service residential integrated water heater/dehumidifier (WHD). Its principal purpose is to evaluate the extent to which this integrated appliance might penetrate the residential market sector, given current market trends, producer and consumer attributes, and technical parameters. The report's secondary purpose is to gather background information leading to a generic framework for conducting market analyses of technologies. This framework can be used to assess market readiness as well as factor preferred product attributes into the design to drive consumer demand for this product. This study also supports analysis for prototype design. A full market analysis for potential commercialization should be conducted after prototype development. The integrated WHD is essentially a heat-pump water heater (HPWH) with components and controls that allow dedicated dehumidification. Adequate residential humidity control is a growing issue for newly constructed residential homes, which are insulated so well that mechanical ventilation may be necessary to meet fresh air requirements. Leveraging its successful experience with the energy-efficient design improvement for the residential HPWH, the Oak Ridge National Laboratory's (ORNL's) Engineering Science and Technology Division's (ESTD's) Building Equipment Group designed a water-heating appliance that combines HPWH efficiency with dedicated dehumidification. This integrated appliance could be a low-cost solution for dehumidification and efficient electric water heating. ORNL is partnering with Western Carolina University, Asheville-Buncombe Technical Community College, American Carolina Stamping Company, and Clemson University to develop this appliance and assess its market potential. For practical purposes, consumers are indifferent to how water is heated but are very interested in product attributes such as initial first cost

  11. Mental illness stigma and ethnocultural beliefs, values, and norms: an integrative review.

    Science.gov (United States)

    Abdullah, Tahirah; Brown, Tamara L

    2011-08-01

    The current literature on the problem of mental illness stigma in the United States must be expanded to better account for the role of culture. This article examines the relationship between mental illness stigma and culture for Americans of American Indian, Asian, African, Latino, Middle Eastern, and European descent. In this review, culture refers to the shared beliefs, values, and norms of a given racial or ethnic group. The reviewed literature indicates that there are differences in stigma among the various cultural groups; however, explanations as to why these differences exist are scant. Qualitative and quantitative studies indicate that cultural values are important with regard to stigma, particularly for Asian Americans and African Americans. Less is known about the interaction between cultural values and mental illness stigma for other cultural groups. Continued research in the area requires better organization and more exploration of the role of cultural history and values as they relate to mental illness stigma. To that end, a detailed, systematic approach to future research in the area is proposed. Copyright © 2011 Elsevier Ltd. All rights reserved.

  12. Motivations, Values, and Conflict Resolution: Students' Integration of Personal and Professional Identities

    Science.gov (United States)

    Osteen, Philip J.

    2011-01-01

    Edicts within the Council on Social Work Education's 2008 Educational Policy and Accreditation Standards address the importance of understanding the intersection of personal and professional values. Twenty MSW students, chosen on the basis of diverse cultural and personal characteristics, were interviewed about their motivations for pursuing a MSW…

  13. Self-efficacy, values, and complementarity in dyadic interactions: integrating interpersonal and social-cognitive theory.

    Science.gov (United States)

    Locke, Kenneth D; Sadler, Pamela

    2007-01-01

    Dyadic interactions were analyzed using constructs from social-cognitive theory (self-efficacy and subjective values) and interpersonal theory (interpersonal circumplex [IPC] and complementarity). In Study 1, the authors developed a measure of efficacy for interpersonal actions associated with each IPC region--the Circumplex Scales of Interpersonal Efficacy (CSIE). In Study 2, the authors used the CSIE and the Circumplex Scales of Interpersonal Values (which assesses the subjective value of interpersonal events associated with each IPC region) to predict the dominance expressed and satisfaction experienced by members of 101 same-sex dyads trying to solve a murder mystery. Structural equation modeling analyses supported both social-cognitive and interpersonal theory. A social-cognitive person-variable (dominance efficacy) and an interpersonal dyadic-variable (reciprocity) together predicted dominant behaviors. Likewise, both a social-cognitive variable (friendliness values) and an interpersonal variable (correspondence of friendliness efficacy) predicted satisfaction. Finally, both shared performance outcomes and dynamic interpersonal processes predicted convergence of collective efficacy beliefs within dyads.

  14. Integrating Mission-Based Values into Accounting Curriculum: Catholic Social Teaching and Introductory Accounting

    Science.gov (United States)

    Hise, Joan Vane; Koeplin, John P.

    2010-01-01

    This paper presents several reasons why mission-based values, in this case Catholic Social Teaching (CST), should be incorporated into a university business curriculum. The CST tenets include the sanctity of human life; call to family, community, and participation; rights and responsibilities; option for the poor and vulnerable; the dignity of…

  15. An analytical framework for evaluating the value of enhanced customisation: an integrated operations-marketing perspective

    DEFF Research Database (Denmark)

    Wong, Hartanto; Eyers, Daniel

    2011-01-01

    In this paper we present a formal approach to evaluate the value of enhanced customisation. The suggested approach is based on a new perspective addressing the important alignment between the operations and marketing functions, under which we are able to obtain a more holistic understanding...

  16. Integrating Poverty and Environmental Concerns into Value-Chain Analysis: A Strategic Framework and Practical Guide

    DEFF Research Database (Denmark)

    Riisgaard, Lone; Bolwig, Simon; Ponte, Stefano

    2010-01-01

    This article aims to guide the design and implementation of action-research projects in value-chain analysis by presenting a strategic framework focused on small producers and trading and processing firms in developing countries. Its stepwise approach – building on the conceptual framework set ou...... purpose of increasing the rewards and/or reducing the risks....

  17. Value Co-Creation through Learning Styles Segmentation and Integrated Course Design

    Science.gov (United States)

    Young, Mark; Collins, Marianne K.

    2014-01-01

    This paper describes an innovative Principles of Marketing course design and delivery which matches learning and teaching styles, while reducing multi-section variation. Value co-creation is encouraged by instructors and students collaborating in the creation of customized learning experiences which facilitates both teaching style and learning…

  18. CancerLectinDB: a database of lectins relevant to cancer.

    Science.gov (United States)

    Damodaran, Deepa; Jeyakani, Justin; Chauhan, Alok; Kumar, Nirmal; Chandra, Nagasuma R; Surolia, Avadhesha

    2008-04-01

    The role of lectins in mediating cancer metastasis, apoptosis as well as various other signaling events has been well established in the past few years. Data on various aspects of the role of lectins in cancer is being accumulated at a rapid pace. The data on lectins available in the literature is so diverse, that it becomes difficult and time-consuming, if not impossible to comprehend the advances in various areas and obtain the maximum benefit. Not only do the lectins vary significantly in their individual functional roles, but they are also diverse in their sequences, structures, binding site architectures, quaternary structures, carbohydrate affinities and specificities as well as their potential applications. An organization of these seemingly independent data into a common framework is essential in order to achieve effective use of all the data towards understanding the roles of different lectins in different aspects of cancer and any resulting applications. An integrated knowledge base (CancerLectinDB) together with appropriate analytical tools has therefore been developed for lectins relevant for any aspect of cancer, by collating and integrating diverse data. This database is unique in terms of providing sequence, structural, and functional annotations for lectins from all known sources in cancer and is expected to be a useful addition to the number of glycan related resources now available to the community. The database has been implemented using MySQL on a Linux platform and web-enabled using Perl-CGI and Java tools. Data for individual lectins pertain to taxonomic, biochemical, domain architecture, molecular sequence and structural details as well as carbohydrate specificities. Extensive links have also been provided for relevant bioinformatics resources and analytical tools. Availability of diverse data integrated into a common framework is expected to be of high value for various studies on lectin cancer biology. CancerLectinDB can be accessed through

  19. Wood-based bioenergy value chain in mountain urban districts: An integrated environmental accounting framework

    International Nuclear Information System (INIS)

    Nikodinoska, Natasha; Buonocore, Elvira; Paletto, Alessandro; Franzese, Pier Paolo

    2017-01-01

    Highlights: • The Sarentino bioenergy value chain (North Italy) was investigated. • A multi-method environmental accounting framework was implemented. • Environmental costs and impacts of a forest bioenergy chain were assessed. • Indicators show a good environmental performance and sustainability. • Linking wood industry and energy production could lower the environmental burden. - Abstract: Using wood biomass for bioenergy production in mountain urban settlements can represent a win–win strategy when it combines a continuous energy provision to households with a sustainable management of local forests, also boosting rural development and stakeholders’ cooperation. In this study, we implemented a multi-method environmental accounting framework aimed at investigating environmental costs and impacts of a bioenergy value chain located in Sarentino Valley (North Italy). This assessment framework encompasses material, energy, and emergy demands as well as main emissions generated at each step of the chain: (1) forestry, (2) logistics, and (3) conversion. The resulting global to local ratios of abiotic material calculated for forestry, logistics, and conversion subsystems show that the global (direct and indirect) consumption of abiotic matter was respectively 3.6, 3.2, and 7.6 times higher than the direct material demand. The Energy Return on Energy Investment (EROI) of wood biomass and wood chips production (37.1 and 22.4) shows a high energy performance of these processes, while the EROI of heat generation (11.35) reflects a higher support of human-driven inputs. The emergy renewable fraction, ranging from 77% to 37% across the value chain, shows a high use of local renewable resources in the bioenergy value chain. The total CO_2 emissions of the bioenergy value chain (4088 t CO_2 yr"−"1) represent only 7.1% of the CO_2 sequestration potential of the Sarentino Valley forest ecosystem, highlighting the capability of the local forests to offset the CO_2

  20. Integrating ethical values into fraud triangle theory in assessing employee fraud: Evidence from the Malaysian banking industry

    Directory of Open Access Journals (Sweden)

    Jamaliah Said

    2017-06-01

    Full Text Available This study attempts to integrate ethical values into the fraud triangle theory in the context of Malaysian banking industry. Primary data were collected through the survey of 108 questionnaires administered to the employees of the top three largest banks in Malaysia. The findings revealed that ethical values were negatively related to employee fraud, and two elements of fraud triangle theory, namely, opportunity and rationalization, were positively related to employee fraud. This implies that high ethical value is crucial to mitigate employee fraud. To minimize employee fraud, the banking industry should reduce opportunities and employee negative rationalization through strong internal control. This study contributes to literature on the occurrences of employee fraud, which is not widely discussed, especially in the context of the banking industry in developing countries.

  1. Expected value analysis for integrated supplier selection and inventory control of multi-product inventory system with fuzzy cost

    Science.gov (United States)

    Sutrisno, Widowati, Tjahjana, R. Heru

    2017-12-01

    The future cost in many industrial problem is obviously uncertain. Then a mathematical analysis for a problem with uncertain cost is needed. In this article, we deals with the fuzzy expected value analysis to solve an integrated supplier selection and supplier selection problem with uncertain cost where the costs uncertainty is approached by a fuzzy variable. We formulate the mathematical model of the problems fuzzy expected value based quadratic optimization with total cost objective function and solve it by using expected value based fuzzy programming. From the numerical examples result performed by the authors, the supplier selection problem was solved i.e. the optimal supplier was selected for each time period where the optimal product volume of all product that should be purchased from each supplier for each time period was determined and the product stock level was controlled as decided by the authors i.e. it was followed the given reference level.

  2. Setting value optimization method in integration for relay protection based on improved quantum particle swarm optimization algorithm

    Science.gov (United States)

    Yang, Guo Sheng; Wang, Xiao Yang; Li, Xue Dong

    2018-03-01

    With the establishment of the integrated model of relay protection and the scale of the power system expanding, the global setting and optimization of relay protection is an extremely difficult task. This paper presents a kind of application in relay protection of global optimization improved particle swarm optimization algorithm and the inverse time current protection as an example, selecting reliability of the relay protection, selectivity, quick action and flexibility as the four requires to establish the optimization targets, and optimizing protection setting values of the whole system. Finally, in the case of actual power system, the optimized setting value results of the proposed method in this paper are compared with the particle swarm algorithm. The results show that the improved quantum particle swarm optimization algorithm has strong search ability, good robustness, and it is suitable for optimizing setting value in the relay protection of the whole power system.

  3. Health economics evidence for medical nutrition: are these interventions value for money in integrated care?

    Science.gov (United States)

    Walzer, Stefan; Droeschel, Daniel; Nuijten, Mark; Chevrou-Séverac, Hélène

    2014-01-01

    Health care decision-makers have begun to realize that medical nutrition plays an important role in the delivery of care, and it needs to be seen as a sole category within the overall health care reimbursement system to establish the value for money. Indeed, improving health through improving patients' nutrition may contribute to the cost-effectiveness and financial sustainability of health care systems. Medical nutrition is regulated by a specific bill either in Europe or in the United States, which offers specific legislations and guidelines (as provided to patients with special nutritional needs) and indications for nutritional support. Given that the efficacy of medical nutrition has been proven, one can wonder whether the heterogeneous nature of its coverage/reimbursement across countries might be due to the lack of health-related economic evidence or value-for-money of nutritional interventions. This paper aims to address this knowledge gap by performing a systematic literature review on health economics evidence regarding medical nutrition, and by summarizing the results of these publications related to the value for money of medical nutrition interventions. A systematic literature search was initiated and executed based on a predefined search protocol following the population, intervention, comparison, and outcomes (PICO) criteria. Following the systematic literature search of recently published literature on health economics evidence regarding medical nutrition, this study aims to summarize the results of those publications that are related to the value for money of medical nutrition interventions. The evaluations were conducted by analyzing different medical nutrition according to their indications, the economic methodology or perspective adopted, the cost source and utility measures, selected efficiency measures, as well as the incremental cost-effectiveness ratio. A total of 225 abstracts were identified for the detailed review, and the data were

  4. Impaired Muscle Regeneration in Ob/ob and Db/db Mice

    Directory of Open Access Journals (Sweden)

    Mai-Huong Nguyen

    2011-01-01

    Full Text Available In obesity and type 2 diabetes, efficient skeletal muscle repair following injury may be required, not only for restoring muscle structure and function, but also for maintaining exercise capacity and insulin sensitivity. The hypothesis of this study was that muscle regeneration would be impaired in ob/ob and db/db mice, which are common mouse models of obesity and type 2 diabetes. Muscle injury was produced by cardiotoxin injection, and regeneration was assessed by morphological and immunostaining techniques. Muscle regeneration was delayed in ob/ob and db/db mice, but not in a less severe model of insulin resistance – feeding a high-fat diet to wild-type mice. Angiogenesis, cell proliferation, and myoblast accumulation were also impaired in ob/ob and db/db mice, but not the high-fat diet mice. The impairments in muscle regeneration were associated with impaired macrophage accumulation; macrophages have been shown previously to be required for efficient muscle regeneration. Impaired regeneration in ob/ob and db/db mice could be due partly to the lack of leptin signaling, since leptin is expressed both in damaged muscle and in cultured muscle cells. In summary, impaired muscle regeneration in ob/ob and db/db mice was associated with reduced macrophage accumulation, angiogenesis, and myoblast activity, and could have implications for insulin sensitivity in the skeletal muscle of obese and type 2 diabetic patients.

  5. Basic Evaluation and the Virtuous Realisation of Values: The Integrative Model of Aristotle

    Directory of Open Access Journals (Sweden)

    Markus Riedenauer

    2016-12-01

    Full Text Available Human affectivity is a research topic situated at the intersection of psychology, philosophical anthropology, theory of action and ethics. This article reconstructs the Aristotelian theory of emotions in the context of his theory of aspiration (o/recij and in terms of their function as primary evaluators of situations, which forms the basis for virtue ethics. The Aristotelian model integrates desire, motivation and morality for a rational being in community. Affects (pa/Jh reveal the profile of relevance of the world to a person as an indispensable basis for the work of practical reason. They are analysed in the dimensions of their cognitive core, their social, bodily, and motivational aspects. Affectivity constitutes a primary evaluative response to situations and thereby disposes human beings to realise their call to morally good, virtuous and fulfilling action.

  6. Anterior cingulate cortex instigates adaptive switches in choice by integrating immediate and delayed components of value in ventromedial prefrontal cortex.

    Science.gov (United States)

    Economides, Marcos; Guitart-Masip, Marc; Kurth-Nelson, Zeb; Dolan, Raymond J

    2014-02-26

    Actions can lead to an immediate reward or punishment and a complex set of delayed outcomes. Adaptive choice necessitates the brain track and integrate both of these potential consequences. Here, we designed a sequential task whereby the decision to exploit or forego an available offer was contingent on comparing immediate value and a state-dependent future cost of expending a limited resource. Crucially, the dynamics of the task demanded frequent switches in policy based on an online computation of changing delayed consequences. We found that human subjects choose on the basis of a near-optimal integration of immediate reward and delayed consequences, with the latter computed in a prefrontal network. Within this network, anterior cingulate cortex (ACC) was dynamically coupled to ventromedial prefrontal cortex (vmPFC) when adaptive switches in choice were required. Our results suggest a choice architecture whereby interactions between ACC and vmPFC underpin an integration of immediate and delayed components of value to support flexible policy switching that accommodates the potential delayed consequences of an action.

  7. Model integrating the processes of consumer perceived value creation and consumer relationship development

    OpenAIRE

    Vaitkienė, Rimgailė; Pilibaitytė, Vestina

    2008-01-01

    Straipsnyje analizuojamos vertės vartotojui kūrimo bei santykių vystymo procesų sąsajos. Jame apžvelgiama santykių nauda, kaip vertės vartotojui dedamoji, santykių su vartotojais vystymo procesas bei jo etapai, vertės vartotojui kūrimo procesas santykių marketingo kontekste bei pateikiamas vertės vartotojui kūrimo ir santykių su vartotojais vystymo procesus integruojantis modelis. The article analyses the links between the consumer perceived value creation and relationship development proc...

  8. MongoDB the definitive guide

    CERN Document Server

    Chodorow, Kristina

    2010-01-01

    How does MongoDB help you manage a huMONGOus amount of data collected through your web application? With this authoritative introduction, you'll learn the many advantages of using document-oriented databases, and discover why MongoDB is a reliable, high-performance system that allows for almost infinite horizontal scalability. Written by engineers from 10gen, the company that develops and supports this open source database, MongoDB: The Definitive Guide provides guidance for database developers, advanced configuration for system administrators, and an overview of the concepts and use cases f

  9. The Integrated Approach for Sustainable Performance Evaluation in Value Chain of Vietnam Textile and Apparel Industry

    Directory of Open Access Journals (Sweden)

    Thi-Nham Le

    2017-03-01

    Full Text Available The impressive growth of the Vietnam textile and apparel industry has led to some concerns due to its insufficient value chain and fierce competition within the industry. Thus, performance evaluation is significant issue to estimate the values of companies over time. Firstly, the grey prediction is used to forecast future data for 20 largest enterprises in six years (2016–2021 based on actual indicators. Then, the paper uses Malmquist productivity index and its decomposition into efficiency and technical change to measure the past productivity growth. Finally, window analysis is applied to significantly detect the trends of performance in 12 years (2010–2021 from large number of inputs and outputs. The results are found that how technology changes is the determinant for productivity growth and undeveloped technology causes a huge barrier to industry. In addition, the results are illustrated that textile companies are predicted to be more stable due to the importance of supplying materials for the entire industry. This paper aims to prove in-depth analysis can be conducted through combined models and also provide some recommendations for enhancing the sustainability performance of the industry.

  10. Integration of value stream map and strategic layout planning into DMAIC approach to improve carpeting process

    Directory of Open Access Journals (Sweden)

    Ayman Nagi

    2017-04-01

    Full Text Available Purpose: This paper presents an implementation of the Six Sigma DMAIC approach implementing lean tools and facilities layout techniques to reduce the occurrence of different types of nonconformities in the carpeting process. Such carpeting process can be found in several industries such as construction, aviation, and automotive. Design/methodology/approach: The improvement process was built through a sequential implementation of appropriate interconnected tools at each phase of the DMAIC approach. Utilized tools included: Pareto analysis, control charts, Ishikawa chart, 5-whys, failure mode and effect analysis, process capability ratio, value stream mapping, and strategic layout planning. Findings: The carpeting process capability, quality of the product, customer satisfaction, and cost of poor quality were significantly improved. Explicitly, the sigma level was improved from 2.297 to 2.886 and the defects per million opportunities (DPMO was reduced from 21615 to 3905. Originality/value: This paper has approved the capability of the Six Sigma DMAIC approach to analyze, investigate, and remove the root causes of the carpeting (preparation-installation process nonconformities .

  11. Integration of value stream map and strategic layout planning into DMAIC approach to improve carpeting process

    Energy Technology Data Exchange (ETDEWEB)

    Nagi, A.; Altarazi, S.

    2017-07-01

    This paper presents an implementation of the Six Sigma DMAIC approach implementing lean tools and facilities layout techniques to reduce the occurrence of different types of nonconformities in the carpeting process. Such carpeting process can be found in several industries such as construction, aviation, and automotive. Design/methodology/approach: The improvement process was built through a sequential implementation of appropriate interconnected tools at each phase of the DMAIC approach. Utilized tools included: Pareto analysis, control charts, Ishikawa chart, 5-whys, failure mode and effect analysis, process capability ratio, value stream mapping, and strategic layout planning. Findings: The carpeting process capability, quality of the product, customer satisfaction, and cost of poor quality were significantly improved. Explicitly, the sigma level was improved from 2.297 to 2.886 and the defects per million opportunities (DPMO) was reduced from 21615 to 3905. Originality/value: This paper has approved the capability of the Six Sigma DMAIC approach to analyze, investigate, and remove the root causes of the carpeting (preparation-installation) process nonconformities.

  12. Integration of value stream map and strategic layout planning into DMAIC approach to improve carpeting process

    International Nuclear Information System (INIS)

    Nagi, A.; Altarazi, S.

    2017-01-01

    This paper presents an implementation of the Six Sigma DMAIC approach implementing lean tools and facilities layout techniques to reduce the occurrence of different types of nonconformities in the carpeting process. Such carpeting process can be found in several industries such as construction, aviation, and automotive. Design/methodology/approach: The improvement process was built through a sequential implementation of appropriate interconnected tools at each phase of the DMAIC approach. Utilized tools included: Pareto analysis, control charts, Ishikawa chart, 5-whys, failure mode and effect analysis, process capability ratio, value stream mapping, and strategic layout planning. Findings: The carpeting process capability, quality of the product, customer satisfaction, and cost of poor quality were significantly improved. Explicitly, the sigma level was improved from 2.297 to 2.886 and the defects per million opportunities (DPMO) was reduced from 21615 to 3905. Originality/value: This paper has approved the capability of the Six Sigma DMAIC approach to analyze, investigate, and remove the root causes of the carpeting (preparation-installation) process nonconformities.

  13. Feasibility and normal values of an integrated conductivity (Nanoduct™) sweat test system in healthy newborns.

    Science.gov (United States)

    Kuehni, Claudia E; Schindler, Matthias; Mazur, Agnieszka; Malzacher, Andreas; Hornung, René; Barben, Juerg

    2017-07-01

    Nanoduct™ is a simple and practical sweat analysis system measuring conductivity in situ. It requires only three microlitres of sweat, making it especially applicable to newborns. We measured conductivity in 260 healthy term infants at the age of four days, and again at four weeks to determine the proportion of successful tests, test duration, and normal values for sweat conductivity in newborns. Sufficient sweat was collected in 159/260 of four-day olds (61%), and in 225/239 of four-week olds (94%). Mean (sd) test duration was 27 (5) and 25 (5) min. Mean (sd, range) conductivity was 53mmol/l (16, 8-114) at age four days, and 36 (9, 12-64) at four weeks. Determination of sweat conductivity using Nanoduct™ cannot be recommended for four-day old newborns. However, at the age of four weeks the success rate is high (94%), and conductivity values at that age are comparable to older healthy children. Copyright © 2017 European Cystic Fibrosis Society. Published by Elsevier B.V. All rights reserved.

  14. Dicty_cDB: CFC194 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available equences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...nts: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  15. Dicty_cDB: AFE360 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein ...(bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A..

  16. Dicty_cDB: AFF743 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Sequences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...oducing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  17. Dicty_cDB: AFG687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...n Score E Sequences producing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  18. Dicty_cDB: SFC807 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available icant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome prot...ng significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  19. Integrating cultural values, beliefs, and customs into pregnancy and postpartum care: lessons learned from a Hawaiian public health nursing project.

    Science.gov (United States)

    Mayberry, L J; Affonso, D D; Shibuya, J; Clemmens, D

    1999-06-01

    Determining the elements of culturally competent health care is an important goal for nurses. This goal is particularly integral in efforts to design better preventive health care strategies for pregnant and postpartum women from multiple cultural and ethnic backgrounds. Learning about the values, beliefs, and customs surrounding health among the targeted groups is essential, but integrating this knowledge into the actual health care services delivery system is more difficult. The success of a prenatal and postpartum program developed for native Hawaiian, Filipino, and Japanese women in Hawaii has been attributed to the attention on training, direct care giving, and program monitoring participation by local cultural and ethnic healers and neighborhood leaders living in the community, with coordination by public health nurses. This article profiles central design elements with examples of specific interventions used in the Malama Na Wahine or Caring for Pregnant Women program to illustrate a unique approach to the delivery of culturally competent care.

  20. Integrated vendor-buyer inventory models with inflation and time value of money in controllable lead time

    Directory of Open Access Journals (Sweden)

    Prashant Jindal

    2016-01-01

    Full Text Available In the global critical economic scenario, inflation plays a vital role in deciding optimal pricing of goods in any business entity. This article presents two single-vendor single-buyer integrated supply chain inventory models with inflation and time value of money. Shortage is allowed during the lead-time and it is partially backlogged. Lead time is controllable and can be reduced using crashing cost. In the first model, we consider the demand of lead time follows a normal distribution, and in the second model, it is considered distribution-free. For both cases, our objective is to minimize the integrated system cost by simultaneously optimizing the order quantity, safety factor, lead time and number of lots. The discounted cash flow and classical optimization technique are used to derive the optimal solution for both cases. Numerical examples including the sensitivity analysis of system parameters is provided to validate the results of the supply chain models.

  1. System visualization of integrated biofuels and high value chemicals developed within the MacroAlgaeBiorefinery (MAB3) project

    DEFF Research Database (Denmark)

    Seghetta, Michele; Hasler, Berit; Bastianoni, Simone

    MacroAlgaeBiorefinery (MAB3) may functions as production platform and raw material supplier for future sustainable production chains of biofuels and high value chemicals. Biofuels are interesting energy source but challenges in terms of the composition of the biomass and resulting energy...... efficiencies has to be compensated for to make the biofuel prices competitive in replacing fossil fuel. Since it is difficult to increase the yield of the single biorefinery, the overall system productivity can be improved integrating different sub-systems. In this study, macroalgae cultivation in Denmark...... is integrated with a biogas biorefinery, a bioethanol biorefinery and a fish feed industry. The modeled system is able to adapt itself to different amount and quality of feedstock and to maximize valuable outputs (e.g. bio-fuels and chemical). Macroalgae are harvested and utilized as feedstock in bioethanol...

  2. Temporal Dynamics of Sensorimotor Networks in Effort-Based Cost-Benefit Valuation: Early Emergence and Late Net Value Integration.

    Science.gov (United States)

    Harris, Alison; Lim, Seung-Lark

    2016-07-06

    Although physical effort can impose significant costs on decision-making, when and how effort cost information is incorporated into choice remains contested, reflecting a larger debate over the role of sensorimotor networks in specifying behavior. Serial information processing models, in which motor circuits simply implement the output of cognitive systems, hypothesize that effort cost factors into decisions relatively late, via integration with stimulus values into net (combined) value signals in dorsomedial frontal cortex (dmFC). In contrast, ethology-inspired approaches suggest a more active role for the dorsal sensorimotor stream, with effort cost signals emerging rapidly after stimulus onset. Here we investigated the time course of effort cost integration using event-related potentials in hungry human subjects while they made decisions about expending physical effort for appetitive foods. Consistent with the ethological perspective, we found that effort cost was represented from as early as 100-250 ms after stimulus onset, localized to dorsal sensorimotor regions including middle cingulate, somatosensory, and motor/premotor cortices. However, examining the same data time-locked to motor output revealed net value signals combining stimulus value and effort cost approximately -400 ms before response, originating from sensorimotor areas including dmFC, precuneus, and posterior parietal cortex. Granger causal connectivity analysis of the motor effector signal in the time leading to response showed interactions between these sensorimotor regions and ventrolateral prefrontal cortex, a structure associated with adjusting behavior-response mappings. These results suggest that rapid activation of sensorimotor regions interacts with cognitive valuation systems, producing a net value signal reflecting both physical effort and reward contingencies. Although physical effort imposes a cost on choice, when and how effort cost influences neural correlates of decision

  3. The value of Avicenna's heritage in development of modern integrative medicine in Uzbekistan

    Directory of Open Access Journals (Sweden)

    Dilfuza Djamaldinovna Buranova

    2015-12-01

    Full Text Available The heritage of Abu Ali al-Husayn ibn Abd Allah ibn Sina (known in Europe as Avicenna, hereinafter referred to as Avicenna; around 980-1037 cehas been used in the practice of doctors of various specialties in the treatment of various diseases for many centuries. Extensive clinical experience accumulated over a long time is actively used in modern medicine. Avicenna has had an invaluable contribution to world medicine. He is the largest representative of advanced sociohumanitarian ideas among the peoples of Central Asia. He was a philosopher and physician, scientist and mathematician, poet, and specialist in literature. The rich heritage of the scientist takes a worthy place in the history of medicine in particular, and world civilization in general. Avicenna introduced the main contribution to the treasury of the universal culture by his work in medicine. Avicenna brought together the achievements of Hippocrates (c. 460-370 bce,Galen (c. 130-200 ce,and healers of Egypt, Persia, and India, and he supplemented them with own research results, brilliant discoveries, and hypotheses. Avicenna left many works, among them the especially popular Canon of Medicine. He paid great attention to the prevention of diseases rather than their treatment, which is important today. In his works he gives advice on the use of herbal medicines and biologically active points for various diseases. This article highlights some topical issues of multifaceted heritage of Avicenna for modern medicine and identified promising areas for the development of integrative medicine in Uzbekistan.

  4. Assessing the Value of Moving More-The Integral Role of Qualified Health Professionals.

    Science.gov (United States)

    Arena, Ross; McNeil, Amy; Lavie, Carl J; Ozemek, Cemal; Forman, Daniel; Myers, Jonathan; Laddu, Deepika R; Popovic, Dejana; Rouleau, Codie R; Campbell, Tavis S; Hills, Andrew P

    2018-04-01

    Being physically active or, in a broader sense, simply moving more throughout each day is one of the most important components of an individual's health plan. In conjunction with regular exercise training, taking more steps in a day and sitting less are also important components of one's movement portfolio. Given this priority, health care professionals must develop enhanced skills for prescribing and guiding individualized movement programs for all their patients. An important component of a health care professional's ability to prescribe movement as medicine is competency in assessing an individual's risk for untoward events if physical exertion was increased. The ability to appropriately assess one's risk before advising an individual to move more is integral to clinical decision-making related to subsequent testing if needed, exercise prescription, and level of supervision with exercise training. At present, there is a lack of clarity pertaining to how a health care professional should go about assessing an individual's readiness to move more on a daily basis in a safe manner. Therefore, this perspectives article clarifies key issues related to prescribing movement as medicine and presents a new process for clinical assessment before prescribing an individualized movement program. Copyright © 2018 Elsevier B.V. All rights reserved.

  5. Numerical Weather Prediction and Relative Economic Value framework to improve Integrated Urban Drainage- Wastewater management

    DEFF Research Database (Denmark)

    Courdent, Vianney Augustin Thomas

    domains during which the IUDWS can be coupled with the electrical smart grid to optimise its energy consumption. The REV framework was used to determine which decision threshold of the EPS (i.e. number of ensemble members predicting an event) provides the highest benefit for a given situation...... in cities where space is scarce and large-scale construction work a nuisance. This the-sis focuses on flow domain predictions of IUDWS from numerical weather prediction (NWP) to select relevant control objectives for the IUDWS and develops a framework based on the relative economic value (REV) approach...... to evaluate when acting on the forecast is beneficial or not. Rainfall forecasts are extremely valuable for estimating near future storm-water-related impacts on the IUDWS. Therefore, weather radar extrapolation “nowcasts” provide valuable predictions for RTC. However, radar nowcasts are limited...

  6. Integrating societal perspectives and values for improved stewardship of a coastal ecosystem engineer

    Directory of Open Access Journals (Sweden)

    Steven B. Scyphers

    2014-09-01

    Full Text Available Oyster reefs provide coastal societies with a vast array of ecosystem services, but are also destructively harvested as an economically and culturally important fishery resource, exemplifying a complex social-ecological system (SES. Historically, societal demand for oysters has led to destructive and unsustainable levels of harvest, which coupled with multiple other stressors has placed oyster reefs among the most globally imperiled coastal habitats. However, more recent studies have demonstrated that large-scale restoration is possible and that healthy oyster populations can be sustained with effective governance and stewardship. However, both of these require significant societal support or financial investment. In our study, we explored relationships among how coastal societies (1 perceive and value oyster ecosystem services, (2 recognize and define problems associated with oyster decline, and (3 perceive or support stewardship initiatives. We specifically focused on the SES of eastern oysters (Crassostrea virginica and coastal societies in the northern Gulf of Mexico, a region identified as offering among the last and best opportunities to sustainably balance conservation objectives with a wild fishery. We found that, in addition to harvest-related benefits, oysters were highly valued for providing habitat, mitigating shoreline erosion, and improving water quality or clarity. Our results also showed that although most respondents recognized that oyster populations have declined, many respondents characterized the problem differently than most scientific literature does. Among a variety of initiatives for enhancing sustainability, spawning sanctuaries and reef restoration were well supported in all states, but support for harvest reductions was less consistent. Our study suggests that public support for maintaining both harvest and ecosystem services exists at societal levels and that enhancing public awareness regarding the extent and causes

  7. The Kepler DB, a Database Management System for Arrays, Sparse Arrays and Binary Data

    Science.gov (United States)

    McCauliff, Sean; Cote, Miles T.; Girouard, Forrest R.; Middour, Christopher; Klaus, Todd C.; Wohler, Bill

    2010-01-01

    The Kepler Science Operations Center stores pixel values on approximately six million pixels collected every 30-minutes, as well as data products that are generated as a result of running the Kepler science processing pipeline. The Kepler Database (Kepler DB) management system was created to act as the repository of this information. After one year of ight usage, Kepler DB is managing 3 TiB of data and is expected to grow to over 10 TiB over the course of the mission. Kepler DB is a non-relational, transactional database where data are represented as one dimensional arrays, sparse arrays or binary large objects. We will discuss Kepler DB's APIs, implementation, usage and deployment at the Kepler Science Operations Center.

  8. The Kepler DB: a database management system for arrays, sparse arrays, and binary data

    Science.gov (United States)

    McCauliff, Sean; Cote, Miles T.; Girouard, Forrest R.; Middour, Christopher; Klaus, Todd C.; Wohler, Bill

    2010-07-01

    The Kepler Science Operations Center stores pixel values on approximately six million pixels collected every 30 minutes, as well as data products that are generated as a result of running the Kepler science processing pipeline. The Kepler Database management system (Kepler DB)was created to act as the repository of this information. After one year of flight usage, Kepler DB is managing 3 TiB of data and is expected to grow to over 10 TiB over the course of the mission. Kepler DB is a non-relational, transactional database where data are represented as one-dimensional arrays, sparse arrays or binary large objects. We will discuss Kepler DB's APIs, implementation, usage and deployment at the Kepler Science Operations Center.

  9. Integrated circuit detector technology in abdominal CT: added value in obese patients.

    Science.gov (United States)

    Morsbach, Fabian; Bickelhaupt, Sebastian; Rätzer, Susan; Schmidt, Bernhard; Alkadhi, Hatem

    2014-02-01

    The purpose of this article was to assess the effect of an integrated circuit (IC) detector for abdominal CT on image quality. In the first study part, an abdominal phantom was scanned with various extension rings using a CT scanner equipped with a conventional discrete circuit (DC) detector and on the same scanner with an IC detector (120 kVp, 150 effective mAs, and 75 effective mAs). In the second study part, 20 patients were included who underwent abdominal CT both with the IC detector and previously at similar protocol parameters (120 kVp tube current-time product and 150 reference mAs using automated tube current modulation) with the DC detector. Images were reconstructed with filtered back projection. Image quality in the phantom was higher for images acquired with the IC compared with the DC detector. There was a gradually increasing noise reduction with increasing phantom sizes, with the highest (37% in the largest phantom) at 75 effective mAs (p < 0.001). In patients, noise was overall significantly (p = 0.025) reduced by 6.4% using the IC detector. Similar to the phantom, there was a gradual increase in noise reduction to 7.9% in patients with a body mass index of 25 kg/m(2) or lower (p = 0.008). Significant correlation was found in patients between noise and abdominal diameter in DC detector images (r = 0.604, p = 0.005), whereas no such correlation was found for the IC detector (r = 0.427, p = 0.060). Use of an IC detector in abdominal CT improves image quality and reduces image noise, particularly in overweight and obese patients. This noise reduction has the potential for dose reduction in abdominal CT.

  10. Getting Started with CouchDB

    CERN Document Server

    Brown, MC

    2012-01-01

    CouchDB is a new breed of database for the Internet, geared to meet the needs of today's dynamic web applications. With this concise introduction, you'll learn how CouchDB's simple model for storing, processing, and accessing data makes it ideal for the type of data and rapid response users now demand from your applications-and how easy CouchDB is to set up, deploy, maintain, and scale. The code-packed examples in this book will help you learn how to work with documents, populate a simple database, replicate data from one database to another, and a host of other tasks. Install CouchDB on Lin

  11. Expected value based fuzzy programming approach to solve integrated supplier selection and inventory control problem with fuzzy demand

    Science.gov (United States)

    Sutrisno; Widowati; Sunarsih; Kartono

    2018-01-01

    In this paper, a mathematical model in quadratic programming with fuzzy parameter is proposed to determine the optimal strategy for integrated inventory control and supplier selection problem with fuzzy demand. To solve the corresponding optimization problem, we use the expected value based fuzzy programming. Numerical examples are performed to evaluate the model. From the results, the optimal amount of each product that have to be purchased from each supplier for each time period and the optimal amount of each product that have to be stored in the inventory for each time period were determined with minimum total cost and the inventory level was sufficiently closed to the reference level.

  12. SIMILARITIES BETWEEN THE KNOWLEDGE CREATION AND CONVERSION MODEL AND THE COMPETING VALUES FRAMEWORK: AN INTEGRATIVE APPROACH

    Directory of Open Access Journals (Sweden)

    PAULO COSTA

    2016-12-01

    Full Text Available ABSTRACT Contemporaneously, and with the successive paradigmatic revolutions inherent to management since the XVII century, we are witnessing a new era marked by the structural rupture in the way organizations are perceived. Market globalization, cemented by quick technological evolutions, associated with economic, cultural, political and social transformations characterize a reality where uncertainty is the only certainty for organizations and managers. Knowledge management has been interpreted by managers and academics as a viable alternative in a logic of creation and conversation of sustainable competitive advantages. However, there are several barriers to the implementation and development of knowledge management programs in organizations, with organizational culture being one of the most preponderant. In this sense, and in this article, we will analyze and compare The Knowledge Creation and Conversion Model proposed by Nonaka and Takeuchi (1995 and Quinn and Rohrbaugh's Competing Values Framework (1983, since both have convergent conceptual lines that can assist managers in different sectors to guide their organization in a perspective of productivity, quality and market competitiveness.

  13. Integrating kidney transplantation into value-based care for people with renal failure.

    Science.gov (United States)

    Hippen, Benjamin E; Maddux, Franklin W

    2018-01-01

    Healthcare reimbursement is increasingly tied to value instead of volume, with special attention paid to resource-intensive populations such as patients with renal disease. To this end, Medicare has sponsored pilot projects to encourage providers to develop care coordination and population health management strategies to provide quality care while reducing resource utilization. In this Personal Viewpoint essay, we argue in favor of expanding one such pilot project-the Comprehensive ESRD Care (CEC) initiative-to include patients with advanced chronic kidney disease and kidney transplant recipients. The implementation of the Medicare Access and CHIP Reauthorization Act (MACRA) offers a time-sensitive incentive for transplant centers in particular to align with extant CECs. An "expanded" CEC model proffers opportunity for robust cooperation between general nephrology practices, dialysis providers, and transplant centers to develop care coordination strategies for all patients with renal disease, realign incentives for all clinical stakeholders to increase kidney transplantation rates, and reduce total costs of care. © 2017 The American Society of Transplantation and the American Society of Transplant Surgeons.

  14. Integrity within the University Community. Its Ethical Values, Attitudes and Behaviours

    Directory of Open Access Journals (Sweden)

    Mirela Arsith

    2010-06-01

    Full Text Available The hypothesis, that our paper is based on, is that the university community plays an important role both in the process of shaping the students’ professional and transversal competences and in the shaping of their moral dimension. Ethical values, such as credibility, respect, equity, correctness, tolerance, might generate attitudes, such as participative interest, responsibility assumption, moral norms, dialogue willingness etc. The personal and professional development of the students from “Danubius” University of Galati, should be conditioned both by their solid knowledge, their competences of their specialization, and by their interiorethical behaviours. The future graduates should focus their future activity on a professional deontology and on the projection of the possible consequences of their actions and decisions within the individual, social and natural environment they are going to work in. The aim of our paper is to identify and analyze the strategiesof ethically shaping the students who will be specialists in communication and public relations. Our paper will demonstrate the importance of the ethical dimension within this specialization which will provide the competences of the social influence. This has multiple outcomes within the social field, having significantethical implications.

  15. Adding value while saving dollars: unleashing the potential of a national, integrated approach to home and community care.

    Science.gov (United States)

    Petch, Teresa; Shamian, Judith

    2009-01-01

    This commentary by Victorian Order of Nurses Canada, written in response to "Getting What We Pay For? The Value-for-Money Challenge," by McGrail, Zierler and Ip, answers four key questions about Canada's home and community care sector: (1) What are our objectives? (2) Where do we achieve good value now? (3) Where and why are we failing? and (4) What will help us do better? We conclude that although the home and community care sector offers great promise in meeting the evolving health and social needs of Canadians, it is not living up to its potential. We propose the development of a national, integrated approach to home and community care to help Canadians remain healthy and independent in their homes. This would represent a wise financial investment for governments and would contribute to the long-term health of Canadians.

  16. Cost management in the internal value chain of integrated application of activity-based costing, Kaizen concept and target costing

    Directory of Open Access Journals (Sweden)

    Pešić-Tomić Vesna

    2014-01-01

    Full Text Available The objective of this paper is an effort to view the possibilities of integrated use of target costing, activity based costing and Kaizen concept in the internal value chain as the central link of the entire chain. The idea is to stimulate the company management to think about the costs, position they take in the structure of price cost and their influence on forming the sales price since it is very important to produce right product for the consumer, of desired quality and functionality but along with as low production costs as possible. It is therefore needed to construct the right design of a product and provide its production at the shortest possible time along with as low costs as possible which will impact the efficiency of the entire value chain.

  17. An analysis of structure strength and ergonomic value of mechanical systems of integrated kidney and thyroid diagnosis device

    International Nuclear Information System (INIS)

    M-Awwaluddin Tri Hardjanto; Abdul Jalil

    2016-01-01

    The has been performed to ensure the security of the device, understand the patient's as well as operator problem and complaints, as part of the efforts to improve the performance of these devices. The analysis is done by calculating the strength of arm, the main frame chairs, and frame backrest patients, as well as analyzing the static anthropometry data for Indonesian man to determine the size of the dental chair and adjusting the size of the seat. We also use the dynamic anthropometry data for Indonesian man to determine the layout and range of movement of the operator while operating the integrated device The analysis showed that the structure is safe because the actual stress that occurs is still below the limit value of 248 MPa. The device also has good ergonomic value so that it can be bulk produced. (author)

  18. The potential value of integrated natriuretic peptide and echo-guided heart failure management.

    Science.gov (United States)

    Scali, Maria Chiara; Simioniuc, Anca; Dini, Frank Lloyd; Marzilli, Mario

    2014-07-18

    mechanism predominant in that individual patient. A monocular, specialistic, unidimensional approach to HF can miss its pathogenetic and clinical complexity, which only can be overcome with an integrated, versatile and tailored approach.

  19. Efficient Operation of a Multi-purpose Reservoir in Chile: Integration of Economic Water Value for Irrigation and Hydropower

    Science.gov (United States)

    Olivares, M. A.; Gonzalez Cabrera, J. M., Sr.; Moreno, R.

    2016-12-01

    Operation of hydropower reservoirs in Chile is prescribed by an Independent Power System Operator. This study proposes a methodology that integrates power grid operations planning with basin-scale multi-use reservoir operations planning. The aim is to efficiently manage a multi-purpose reservoir, in which hydroelectric generation is competing with other water uses, most notably irrigation. Hydropower and irrigation are competing water uses due to a seasonality mismatch. Currently, the operation of multi-purpose reservoirs with substantial power capacity is prescribed as the result of a grid-wide cost-minimization model which takes irrigation requirements as constraints. We propose advancing in the economic co-optimization of reservoir water use for irrigation and hydropower at the basin level, by explicitly introducing the economic value of water for irrigation represented by a demand function for irrigation water. The proposed methodology uses the solution of a long-term grid-wide operations planning model, a stochastic dual dynamic program (SDDP), to obtain the marginal benefit function for water use in hydropower. This marginal benefit corresponds to the energy price in the power grid as a function of the water availability in the reservoir and the hydrologic scenarios. This function allows capture technical and economic aspects to the operation of hydropower reservoir in the power grid and is generated with the dual variable of the power-balance constraint, the optimal reservoir operation and the hydrologic scenarios used in SDDP. The economic value of water for irrigation and hydropower are then integrated into a basin scale stochastic dynamic program, from which stored water value functions are derived. These value functions are then used to re-optimize reservoir operations under several inflow scenarios.

  20. Towards a globally optimized crop distribution: Integrating water use, nutrition, and economic value

    Science.gov (United States)

    Davis, K. F.; Seveso, A.; Rulli, M. C.; D'Odorico, P.

    2016-12-01

    Human demand for crop production is expected to increase substantially in the coming decades as a result of population growth, richer diets and biofuel use. In order for food production to keep pace, unprecedented amounts of resources - water, fertilizers, energy - will be required. This has led to calls for `sustainable intensification' in which yields are increased on existing croplands while seeking to minimize impacts on water and other agricultural resources. Recent studies have quantified aspects of this, showing that there is a large potential to improve crop yields and increase harvest frequencies to better meet human demand. Though promising, both solutions would necessitate large additional inputs of water and fertilizer in order to be achieved under current technologies. However, the question of whether the current distribution of crops is, in fact, the best for realizing sustainable production has not been considered to date. To this end, we ask: Is it possible to increase crop production and economic value while minimizing water demand by simply growing crops where soil and climate conditions are best suited? Here we use maps of yields and evapotranspiration for 14 major food crops to identify differences between current crop distributions and where they can most suitably be planted. By redistributing crops across currently cultivated lands, we determine the potential improvements in calorie (+12%) and protein (+51%) production, economic output (+41%) and water demand (-5%). This approach can also incorporate the impact of future climate on cropland suitability, and as such, be used to provide optimized cropping patterns under climate change. Thus, our study provides a novel tool towards achieving sustainable intensification that can be used to recommend optimal crop distributions in the face of a changing climate while simultaneously accounting for food security, freshwater resources, and livelihoods.

  1. A MongoDB-Based Management of Planar Spatial Data with a Flattened R-Tree

    Directory of Open Access Journals (Sweden)

    Longgang Xiang

    2016-07-01

    Full Text Available This paper addresses how to manage planar spatial data using MongoDB, a popular NoSQL database characterized as a document-oriented, rich query language and high availability. The core idea is to flatten a hierarchical R-tree structure into a tabular MongoDB collection, during which R-tree nodes are represented as collection documents and R-tree pointers are expressed as document identifiers. By following this strategy, a storage schema to support R-tree-based create, read, update, and delete (CRUD operations is designed and a module to manage planar spatial data by consuming and maintaining flattened R-tree structure is developed. The R-tree module is then seamlessly integrated into MongoDB, so that users could manipulate planar spatial data with existing command interfaces oriented to geodetic spatial data. The experimental evaluation, using real-world datasets with diverse coverage, types, and sizes, shows that planar spatial data can be effectively managed by MongoDB with our flattened R-tree and, therefore, the application extent of MongoDB will be greatly enlarged. Our work resulted in a MongoDB branch with R-tree support, which has been released on GitHub for open access.

  2. Evaluation of How Integrative Oncology Services Are Valued between Hematology/Oncology Patients and Hematologists/Oncologists at a Tertiary Care Center

    Directory of Open Access Journals (Sweden)

    D. M. Hansra

    2018-01-01

    Full Text Available Evidence regarding opinions on integrative modalities by patients and physicians is lacking. Methods. A survey study was conducted assessing how integrative modalities were valued among hematology/oncology patients and hematologists and oncologists at a major tertiary medical center. Results. 1008 patients and 55 physicians were surveyed. With the exception of support groups, patients valued nutrition services, exercise therapy, spiritual/religious counseling, supplement/herbal advice, support groups, music therapy, and other complimentary medicine services significantly more than physicians (P≤0.05. Conclusion. With the exception of support groups, patients value integrative modalities more than physicians. Perhaps with increasing education, awareness, and acceptance by providers and traditional institutions, integrative modalities could be equally valued between patients and providers. It is possible that increased availability and utilization of integrative oncology modalities at tertiary hospital sites could improve patient satisfaction, quality of life, and other clinical endpoints.

  3. Dicty_cDB: SSG705 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NA Score E Sequences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...quences producing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  4. Dicty_cDB: VFA863 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore E Sequences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...gnificant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 83

  5. Dicty_cDB: CFG253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete...ences producing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  6. Proteases in Plasma and Kidney of db/db Mice as Markers of Diabetes-Induced Nephropathy

    Science.gov (United States)

    Hadler-Olsen, E.; Winberg, J.-O.; Reinholt, F. P.; Larsen, T.; Uhlin-Hansen, L.; Jenssen, T.; Berg, E.; Kolset, S. O.

    2011-01-01

    Db/db mice are overweight, dyslipidemic and develop diabetic complications, relevant for similar complications in human type 2 diabetes. We have used db/db and db/+ control mice to investigate alterations in proteinase expression and activity in circulation and kidneys by SDS-PAGE zymography, electron microscopy, immunohistochemistry, Western blotting, and in situ zymography. Plasma from db/db mice contained larger amounts of serine proteinases compared to db/+ mice. Kidneys from the db/db mice had a significantly larger glomerular surface area and somewhat thicker glomerular basement membranes compared to the db/+ mice. Furthermore, kidney extracts from db/+ mice contained metalloproteinases with M r of approximately 92000, compatible with MMP-9, not observed in db/db mice. These results indicate that higher levels of serine proteinases in plasma may serve as potential markers for kidney changes in db/db mice, whereas a decrease in MMP-9 in the kidney may be related to the glomerular changes. PMID:22363890

  7. Cascadia, an ultracompact seismic instrument with over 200dB of dynamic range

    Science.gov (United States)

    Parker, Tim; Devanney, Peter; Bainbridge, Geoff; Townsend, Bruce

    2017-04-01

    Integration of geophysical instrumentation is clearly a way to lower overall station cost, make installations less complex, reduce installation time, increase station utility and value to a wider group of researchers, data miners and monitoring groups. Initiatives to expand early earthquake warning networks and observatories can use these savings for increasing station density. Integration of mature instrument systems such as broadband sensors and accelerometers used in strong motion studies has to be done with care to preserve the low noise and low frequency performance while providing over 200dB of dynamic range. Understanding the instrument complexities and deployment challenges allows the engineering teams to optimize the packaging to make installation and servicing cost effective, simple, routine and ultimately more reliable. We discuss early results from testing both in the lab and in the field of a newly released instrument called the Cascadia that integrates a broadband seismometer with a class A (USGS rating) accelerometer in a small stainless steel sonde suited for dense arrays in either ad hoc direct bury field deployments or in observatory quality shallow boreholes.

  8. Dicty_cDB: AFM869 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Dictyostelium discoideum slug cDNA, clone SLH341. 404 e-128 3 ( AF305060 ) Dictyostelium discoideum Wiscott-...ucing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-

  9. The Predictive Value of Integrated Pulmonary Index after Off-Pump Coronary Artery Bypass Grafting: A Prospective Observational Study

    Directory of Open Access Journals (Sweden)

    Evgenia V. Fot

    2017-08-01

    Full Text Available BackgroundThe early warning scores may increase the safety of perioperative period. The objective of this study was to assess the diagnostic and predictive role of Integrated Pulmonary Index (IPI after off-pump coronary artery bypass grafting (OPCAB.Materials and MethodsForty adult patients undergoing elective OPCAB were enrolled into a single-center prospective observational study. We assessed respiratory function using IPI that includes oxygen saturation, end-tidal CO2, respiratory rate, and pulse rate. In addition, we evaluated blood gas analyses and hemodynamics, including ECG, invasive arterial pressure, and cardiac index. The measurements were performed after transfer to the intensive care unit, after spontaneous breathing trial and at 2, 6, 12, and 18 h after extubation.Results and DiscussionThe value of IPI registered during respiratory support correlated weakly with cardiac index (rho = 0.4; p = 0.04 and ScvO2 (rho = 0.4, p = 0.02. After extubation, IPI values decreased significantly, achieving a minimum by 18 h. The IPI value ≤9 at 6 h after extubation was a predictor of complicated early postoperative period (AUC = 0.71; p = 0.04 observed in 13 patients.ConclusionIn off-pump coronary surgery, the IPI decreases significantly after tracheal extubation and may predict postoperative complications.

  10. Efficacy of Acetylshikonin in Preventing Obesity and Hepatic Steatosis in db/db Mice

    Directory of Open Access Journals (Sweden)

    Mei-Ling Su

    2016-07-01

    Full Text Available Zicao (Lithospermum erythrorhizon has been used in clinics as a traditional Chinese medicine for thousands of years. Acetylshikonin (AS is the main ingredient of Zicao, Xinjiang, China. The objective of this study was to investigate the anti-obesity and anti-nonalcoholic fatty liver disease (NAFLD efficacy of AS in a model of spontaneous obese db/db mice. Mice were divided into Wild Type (WT groups and db/db groups, which received no treatment or treatment with 100 mg/kg/day clenbuterol (CL hydrochloride or 540 mg/kg/day AS by oral gavage for eight weeks. The results provided the evidence that AS prevented obesity and NAFLD including reduction in body weight, food efficiency ratio, serum triglyceride (TG and free fatty acid (FFA levels in db/db mice. Administration of AS markedly suppressed the levels of hepatic alanine aminotransferase (ALT, aspartate aminotransferase (AST and pro-inflammatory cytokines in treated groups when compared with that of db/db groups. Further investigation of the lipid synthesis-related protein using Western blotting revealed that hepatic protein expression of sterol regulatory element-binding protein-1 (SREBP-1, fatty acid synthetase (FAS and 3-hydroxy-3-methylglutaryl-coenzyme A reductase (HMGCR were significantly downregulated by AS treatment. These findings suggest that AS exerts anti-obesity and anti-NAFLD effects through the regulation of lipid metabolism and anti-inflammatory effects.

  11. Dicty_cDB: VFD730 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available omology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wisco...otein Score E Sequences producing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wisco...tt-Aldrich syndrome protein (wasA) gene, complete cds. 4...tt-A... 83 3e-15 AC117076_18( AC117076 |pid:none) Dictyostelium discoideum chromoso

  12. Validity of leptin receptor-deficiency (db/db) type 2 diabetes mellitus mice as a model of secondary osteoporosis

    Science.gov (United States)

    Huang, Le; You, Yong-Ke; Zhu, Tracy Y.; Zheng, Li-Zhen; Huang, Xiao-Ru; Chen, Hai-Yong; Yao, Dong; Lan, Hui-Yao; Qin, Ling

    2016-06-01

    This study aimed to evaluate the validation of the leptin receptor-deficient mice model for secondary osteoporosis associated with type 2 diabetes mellitus (T2DM) at bone micro-architectural level. Thirty three 36-week old male mice were divided into four groups: normal control (db/m) (n = 7), leptin receptor-deficient T2DM (db/db) (n = 8), human C-reactive protein (CRP) transgenic normal control (crp/db/m) (n = 7), and human CRP transgenic T2DM (crp/db/db) (n = 11). Lumber vertebrae (L5) and bilateral lower limbs were scanned by micro-CT to analyze trabecular and cortical bone quality. Right femora were used for three-point bending to analyze the mechanical properties. Trabecular bone quality at L5 was better in db/db or crp/db/db group in terms of bone mineral density (BMD), bone volume fraction, connectivity density, trabecular number and separation (all p  0.05). Maximum loading and energy yield in mechanical test were similar among groups while the elastic modulus in db/db and crp/db/db significantly lower than db/m. The leptin-receptor mice is not a proper model for secondary osteoporosis associated with T2DM.

  13. Zinc Prevents the Development of Diabetic Cardiomyopathy in db/db Mice

    Directory of Open Access Journals (Sweden)

    Shudong Wang

    2017-03-01

    Full Text Available Diabetic cardiomyopathy (DCM is highly prevalent in type 2 diabetes (T2DM patients. Zinc is an important essential trace metal, whose deficiency is associated with various chronic ailments, including vascular diseases. We assessed T2DM B6.BKS(D-Leprdb/J (db/db mice fed for six months on a normal diet containing three zinc levels (deficient, adequate, and supplemented, to explore the role of zinc in DCM development and progression. Cardiac function, reflected by ejection fraction, was significantly decreased, along with increased left ventricle mass and heart weight to tibial length ratio, in db/db mice. As a molecular cardiac hypertrophy marker, atrial natriuretic peptide levels were also significantly increased. Cardiac dysfunction and hypertrophy were accompanied by significantly increased fibrotic (elevated collagen accumulation as well as transforming growth factor β and connective tissue growth factor levels and inflammatory (enhanced expression of tumor necrosis factor alpha, interleukin-1β, caspase recruitment domain family member 9, and B-cell lymphoma/leukemia 10, and activated p38 mitogen-activated protein kinase responses in the heart. All these diabetic effects were exacerbated by zinc deficiency, and not affected by zinc supplementation, respectively. Mechanistically, oxidative stress and damage, mirrored by the accumulation of 3-nitrotyrosine and 4-hydroxy-2-nonenal, was significantly increased along with significantly decreased expression of Nrf2 and its downstream antioxidants (NQO-1 and catalase. This was also exacerbated by zinc deficiency in the db/db mouse heart. These results suggested that zinc deficiency promotes the development and progression of DCM in T2DM db/db mice. The exacerbated effects by zinc deficiency on the heart of db/db mice may be related to further suppression of Nrf2 expression and function.

  14. A Direct Approach to Determine the External Disturbing Gravity Field by Applying Green Integral with the Ground Boundary Value

    Directory of Open Access Journals (Sweden)

    TIAN Jialei

    2015-11-01

    Full Text Available By using the ground as the boundary, Molodensky problem usually gets the solution in form of series. Higher order terms reflect the correction between a smooth surface and the ground boundary. Application difficulties arise from not only computational complexity and stability maintenance, but also data-intensiveness. Therefore, in this paper, starting from the application of external gravity disturbance, Green formula is used on digital terrain surface. In the case of ignoring the influence of horizontal component of the integral, the expression formula of external disturbance potential determined by boundary value consisted of ground gravity anomalies and height anomaly difference are obtained, whose kernel function is reciprocal of distance and Poisson core respectively. With this method, there is no need of continuation of ground data. And kernel function is concise, and suitable for the stochastic computation of external disturbing gravity field.

  15. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB714 (Link to dictyBase) - - - Contig-U12859-1 VFB714F (Link... to Original site) VFB714F 545 - - - - - - Show VFB714 Library VF (Link to library) Clone ID VFB714 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12859-1 Original site URL http://dict... Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36936 |U36936.1 Dict...Score E Sequences producing significant alignments: (bits) Value U36936_1( U36936 |pid:none) Dictyostelium d

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB585 (Link to dictyBase) - - - Contig-U09875-1 VFB585Z (Link... to Original site) - - VFB585Z 664 - - - - Show VFB585 Library VF (Link to library) Clone ID VFB585 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09875-1 Original site URL http://dict...Score E Sequences producing significant alignments: (bits) Value N AC116551 |AC116551.2 Dictyostelium discoi...ces producing significant alignments: (bits) Value AC116551_43( AC116551 |pid:none) Dictyostelium discoideum

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB668 (Link to dictyBase) - G00394 DDB0168247 Contig-U09555-1...brary) Clone ID VFB668 (Link to dictyBase) Atlas ID - NBRP ID G00394 dictyBase ID DDB0168247 Link to Contig ...Contig-U09555-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VF/VFB6-...uences producing significant alignments: (bits) Value N AC117072 |AC117072.2 Dictyostelium discoideum chromo...tein Score E Sequences producing significant alignments: (bits) Value AC117076_25

  18. Dicty_cDB: VFN613 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gnments: (bits) Value ( P49349 ) RecName: Full=Farnesyl pyrophosphate synthetase; ... 182 1e-44 EU399544_1( EU399544 |pid:none) Ganod...erma lucidum farnesyl-diphosp... 178 1e-43 AY083165_1( AY083165 |pid:none) Malus x

  19. Dicty_cDB: SLH341 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 ( AF305060 ) Dictyostelium discoideum Wiscott-Aldrich syndrome... 404 0.0 5 ( B...ts) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 83 8e-15 AC117076_18( AC1170

  20. Dicty_cDB: SSL103 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, c...ctyostelium discoideum Wiscott-A... 306 4e-82 FN392319_1421( FN392319 |pid:none) Pichia pastoris GS115 chrom

  1. Dicty_cDB: VFN644 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone:ddv28g12, 3' ... 404 0.0 5 ( AF305060 ) Dictyostelium discoideum Wiscott-...ng significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A..

  2. Dicty_cDB: SFG565 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete cds. 626 0.0 8 AC1170...bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 254 4e-77 AC117076_18( AC1

  3. Dicty_cDB: SFK712 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available deum cDNA clone:dda5o08, 3' e... 404 e-125 2 ( AF305060 ) Dictyostelium discoideum Wiscott-Aldrich syndrome....ore E Sequences producing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  4. Dicty_cDB: SHE721 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available E Sequences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 83 8e-15 AC117076_18( AC117076 |pid:none

  5. Dicty_cDB: SFC789 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldri...ne) Dictyostelium discoideum Wiscott-A... 34 0.031 protein update 2009. 1. 7 PSORT psg: 0.84 gvh: 0.42 alm:

  6. Dicty_cDB: VFE551 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complet...ictyostelium discoideum Wiscott-A... 112 4e-24 AC117076_18( AC117076 |pid:none) D

  7. Dicty_cDB: VSC304 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 05060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete cds. 622 0...bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 167 1e-44 AC117076_18( AC1

  8. Dicty_cDB: SFF823 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gy vs DNA Score E Sequences producing significant alignments: (bits) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott...id:none) Dictyostelium discoideum Wiscott-A... 83 3e-15 AC117076_18( AC117076 |pid:none) Dictyostelium disco

  9. Dicty_cDB: CFG349 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available its) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, com...060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 247 4e-64 DQ985464_1( DQ985464 |pid:none) S

  10. Dicty_cDB: VSB586 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0.085 own update 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N K00918 |K00918.1 param...ecium species 7,227 mt dna dimer: replication init. region. 46 3e-04 2 BF779692 |BF

  11. Dicty_cDB: VHI203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s producing significant alignments: (bits) Value AF325215_2( AF325215 |pid:none) Lymphocytic choriomeningitis...5090 |pid:none) Schistosoma japonicum SJCHGC03255 ... 36 2.8 EU480452_2( EU480452 |pid:none) Lymphocytic choriomeningitis...325214_2( AF325214 |pid:none) Lymphocytic choriomeningitis virus... 35 8.2 BX2941

  12. Dicty_cDB: SHE462 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AY125003_1( AY125003 |pid:none) Calathe...a foliosa NADH dehydrogenas... 32 7.2 AY656084_1( AY656084 |pid:none) Calathea metallica v

  13. Dicty_cDB: VHB386 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 10.b1_C08.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxus cDNA clone CHUL5210,... (bits) Value N X98286 |X98286.1 D.discoideum mRNA for P-type ATPase. 1285 0.0 1 EL476977 |EL476977.1 CHUL52

  14. Dicty_cDB: VHE489 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Value N EL477374 |EL477374.1 CHUL5577.b1_A04.ab1 CHU(LMS) puzzle sunflower Helianthus paradoxuscDNA clone ...CHUL5577, mRNA sequence. 52 0.015 1 EL474819 |EL474819.1 CHUL2764.b1_G19.ab1 CHU(LMS) puzzle

  15. Dicty_cDB: CHA471 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (bits) Value N CN208744 |CN208744.1 Tor9242 Gametophyte rehydration Library Tortula ruralis cDNA, mRNAseque...' end, mRNA sequence. 56 7e-04 1 CN207181 |CN207181.1 Tor7599 Gametophyte rehydration Library Tortula rurali

  16. Dicty_cDB: CHK317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nments: (bits) Value N AL844507 |AL844507.1 Plasmodium falciparum chromosome 8. 66 2e-13 2 BV429546 |BV429546.1 S237P6409FA7.T0 Portu...gueseWaterDog Canis familiaris STS genomic, sequence tag

  17. Dicty_cDB: AFM791 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ts) Value AB170103_1( AB170103 |pid:none) Macaca fascicularis brain cDNA clo... 246 e-130 EU684308_1( EU6843...08 |pid:none) Exorista civilis heat shock protei... 275 e-125 ( P36415 ) RecName: Full=Heat shock cognate 70

  18. Dicty_cDB: SHI292 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nt alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 106 4e-22 BC1384...82_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 104 2e-21 (Q9JLC8) RecName: Full=Sacsi

  19. Dicty_cDB: SHB534 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 99 2e-19... BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 97 6e-19 (Q9JLC8) RecName: Full=Sacsi

  20. Dicty_cDB: SHH148 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ents: (bits) Value N CB292163 |CB292163.1 UCRCS01_04ac07_g1 Washington Navel orange cold acclimated flavedo ...WORKING DRAFT SEQUENCE, in ordered pieces. 34 0.27 2 CB292162 |CB292162.1 UCRCS01_04ac07_b1 Washington Navel orange cold acclimate

  1. Dicty_cDB: SSJ683 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ha balearica EST, clone Timarcha4E2. 44 4e-10 3 AJ235271 |AJ235271.1 Rickettsia pro...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N AJ537862 |AJ537862.1 Timarc

  2. Dicty_cDB: VHL846 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |pid:none) Rickettsia massiliae MTU5, compl... 226 2e-57 CP001635_813( CP001635 |pid:none) Variovorax parad...Value CP000087_1092( CP000087 |pid:none) Rickettsia bellii RML369-C, com... 229 2e-58 CP000683_198( CP000683

  3. Dicty_cDB: SLJ468 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ignificant alignments: (bits) Value N AF312775 |AF312775.1 Tetrahymena thermophila macronuclear immobiliza...tion antigen LD (SerLD) mRNA, complete cds. 30 0.46 4 BG632067 |BG632067.1 GH02610.

  4. Dicty_cDB: VSJ487 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available izophrenia region contig 2 section 3 of 3 of the complete sequence. 40 0.11 5 AC098...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N AE014303 |AE014303.1 Homo sapiens chromosome 13q34 sch

  5. Getting started with LevelDB

    CERN Document Server

    Dent, Andy

    2013-01-01

    The book is a concise guide for using LevelDB. It explains database concepts and the use of C++, ranging from the basics all the way to high level topics in an easy to follow, step-by-step format.The book is meant for developers who want an embedded database for their applications. Experienced programmers can pick up on the sophisticated data mapping patterns and tuning tips.Getting Started with LevelDB requires a minimal background in programming in C++ or Objective-C for OS/X or iOS and familiarity with XCode. Therefore it teaches enough C++ to use LevelDB without presuming any C++ knowledge

  6. Living the values - respect, integrity, care and imagination: Investing in co-design to pave the way for consumers to be project partners in paediatric health service innovation

    OpenAIRE

    Moss, Perrin William; Dunlop, Emma

    2018-01-01

    Introduction: In 2016, Children’s Health Queensland (CHQ) launched its new organisational values; respect, integrity, care and imagination, as well as pursuing a more integrated approach to service delivery.  Delivering paediatric healthcare across the continuum in a state as diverse as Queensland presents many inherent challenges.  Through a successful Integrated Care Innovation Fund grant for CHQ to deliver telementoring to general practitioners in Attention Deficit Hyperactivity Disorder, ...

  7. An application of the value tree analysis methodology within the integrated risk informed decision making for the nuclear facilities

    International Nuclear Information System (INIS)

    Borysiewicz, Mieczysław; Kowal, Karol; Potempski, Sławomir

    2015-01-01

    A new framework of integrated risk informed decision making (IRIDM) has been recently developed in order to improve the risk management of the nuclear facilities. IRIDM is a process in which qualitatively different inputs, corresponding to different types of risk, are jointly taken into account. However, the relative importance of the IRIDM inputs and their influence on the decision to be made is difficult to be determined quantitatively. An improvement of this situation can be achieved by application of the Value Tree Analysis (VTA) methods. The aim of this article is to present the VTA methodology in the context of its potential usage in the decision making on nuclear facilities. The benefits of the VTA application within the IRIDM process were identified while making the decision on fuel conversion of the research reactor MARIA. - Highlights: • New approach to risk informed decision making on nuclear facilities was postulated. • Value tree diagram was developed for decision processes on nuclear installations. • An experiment was performed to compare the new approach with the standard one. • Benefits of the new approach were reached in fuel conversion of a research reactor. • The new approach makes the decision making process more transparent and auditable

  8. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC154 (Link to dictyBase) - - - Contig-U16363-1 VFC154Z (Link... to Original site) - - VFC154Z 551 - - - - Show VFC154 Library VF (Link to library) Clone ID VFC154 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16363-1 Original site URL http://dict...s: (bits) Value N U82513 |U82513.1 Dictyostelium discoideum random slug cDNA25 protein (rsc25) mRNA, partial...producing significant alignments: (bits) Value U82513_1( U82513 |pid:none) Dictyostelium discoideum random s

  9. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB595 (Link to dictyBase) - - - Contig-U09552-1 VFB595E (Link...) Clone ID VFB595 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U09552-1 Ori...KLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICTFISGYAENFLEENKTL EDIIKVVDDFCKILPAAYKTDCVA...A: VEGSGECLVCEFISEKIVTYLEANQTETQILQYLDNDCKLLKSDNWISTCQNLIQEYEPQ IIAVVEGFMAPSELCQKIKFCSSSSSTNDFDFIGSSTTDCEICT... Sequences producing significant alignments: (bits) Value N U66367 |U66367.1 Dictyostelium discoideum SapA (

  10. Dicty_cDB: CFG115 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFG115 (Link to dictyBase) - - - Contig-U03237-1 CFG115E (Link...) Clone ID CFG115 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U03237-1 Ori...k*NNMNGFLKSQLENKTNATTTTTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICT...TTTRYCNNDESCNDENLCTN EMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDNDKCTDNICNPETGTCSF RRRICTDNNDCTMDWCNQLTGECVYQ...ng significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 256

  11. Dicty_cDB: VFH641 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFH641 (Link to dictyBase) - - - Contig-U16151-1 VFH641E (Link... Clone ID VFH641 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16151-1 Original site URL http://dict...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...KLLGVQTQAKQTRATWKIVVGDGAGAVTFKLATNGGTTEGDFTTTLTSKVLS GSDPKEVGTYYMDVTVPTGTTCTGTNGICT...nificant alignments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum

  12. Dicty_cDB: VHO533 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL...157766_4( AL157766 |pid:none) 96 2e-18 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 94 8e-18 (Q9JLC8) RecName: Full=Sacsin; 94 8e-18 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA

  13. Dicty_cDB: SHJ732 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (bits) Value N CR022830 |CR022830.1 Forward strand read from insert in 3'HPRT insertion targeting andchromosome engineering... read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP10i04. 38 0.010 2 CR019...573 |CR019573.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clo

  14. An integrated biorefinery concept for conversion of sugar beet pulp into value-added chemicals and pharmaceutical intermediates.

    Science.gov (United States)

    Cárdenas-Fernández, Max; Bawn, Maria; Hamley-Bennett, Charlotte; Bharat, Penumathsa K V; Subrizi, Fabiana; Suhaili, Nurashikin; Ward, David P; Bourdin, Sarah; Dalby, Paul A; Hailes, Helen C; Hewitson, Peter; Ignatova, Svetlana; Kontoravdi, Cleo; Leak, David J; Shah, Nilay; Sheppard, Tom D; Ward, John M; Lye, Gary J

    2017-09-21

    Over 8 million tonnes of sugar beet are grown annually in the UK. Sugar beet pulp (SBP) is the main by-product of sugar beet processing which is currently dried and sold as a low value animal feed. SBP is a rich source of carbohydrates, mainly in the form of cellulose and pectin, including d-glucose (Glu), l-arabinose (Ara) and d-galacturonic acid (GalAc). This work describes the technical feasibility of an integrated biorefinery concept for the fractionation of SBP and conversion of these monosaccharides into value-added products. SBP fractionation is initially carried out by steam explosion under mild conditions to yield soluble pectin and insoluble cellulose fractions. The cellulose is readily hydrolysed by cellulases to release Glu that can then be fermented by a commercial yeast strain to produce bioethanol at a high yield. The pectin fraction can be either fully hydrolysed, using physico-chemical methods, or selectively hydrolysed, using cloned arabinases and galacturonases, to yield Ara-rich and GalAc-rich streams. These monomers can be separated using either Centrifugal Partition Chromatography (CPC) or ultrafiltration into streams suitable for subsequent enzymatic upgrading. Building on our previous experience with transketolase (TK) and transaminase (TAm) enzymes, the conversion of Ara and GalAc into higher value products was explored. In particular the conversion of Ara into l-gluco-heptulose (GluHep), that has potential therapeutic applications in hypoglycaemia and cancer, using a mutant TK is described. Preliminary studies with TAm also suggest GluHep can be selectively aminated to the corresponding chiral aminopolyol. The current work is addressing the upgrading of the remaining SBP monomer, GalAc, and the modelling of the biorefinery concept to enable economic and Life Cycle Analysis (LCA).

  15. Protective effects of astragaloside IV on db/db mice with diabetic retinopathy.

    Directory of Open Access Journals (Sweden)

    Yuzhi Ding

    Full Text Available Diabetic retinopathy (DR is a common diabetic eye disease which is well-known as the result of microvascular retinal changes. Although the potential biological functions of astragaloside IV (AS IV have long been described in traditional system of medicine, its protective effect on DR remains unclear. This study aims to investigate the function and mechanism of AS IV on type 2 diabetic db/db mice.Db/db mice were treated with AS IV (4.5 mg/kg or 9 mg/kg or physiological saline by oral gavage for 20 weeks along with db/m mice. In each group, retinal ganglion cell (RGC function was measured by pattern electroretinogram (ERG and apoptosis was determined by Terminal deoxynucleotidyl transferase dUTP nick end labeling (TUNEL staining. Blood and retina aldose reductase (AR activity were quantified by chemiluminescence analysis. The expressions of phosporylated-ERK1/2, NF-κB were determined by Western blot analysis. Furthermore, the expression of related downstream proteins were quantified by Label-based Mouse Antibody Array.Administration of AS IV significantly improved the amplitude in pattern ERG and reduced the apoptosis of RGCs.in db/db mice. Furthermore, downregulation of AR activity, ERK1/2 phosphorylation, NF-κB and related cytokine were observed in AS IV treatment group.Our study indicated that AS IV, as an inhibitor of AR, could prevent the activation of ERK1/2 phosporylation and NF-kB and further relieve the RGCs disfunction in db/db mice with DR. It has provided a basis for investigating the clinical efficacy of AR inhibitors in preventing DR.

  16. Is the Evaluation of the Students' Values Possible? An Integrated Approach to Determining the Weights of Students' Personal Goals Using Multiple-Criteria Methods

    Science.gov (United States)

    Dadelo, Stanislav; Turskis, Zenonas; Zavadskas, Edmundas Kazimieras; Kacerauskas, Tomas; Dadeliene, Ruta

    2016-01-01

    To maximize the effectiveness of a decision, it is necessary to support decision-making with integrated methods. It can be assumed that subjective evaluation (considering only absolute values) is only remotely connected with the evaluation of real processes. Therefore, relying solely on these values in process management decision-making would be a…

  17. Dicty_cDB: CFE213 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE213 (Link to dictyBase) - - - Contig-U16381-1 CFE213F (Link... to Original site) CFE213F 111 - - - - - - Show CFE213 Library CF (Link to library) Clone ID CFE213 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict... E Sequences producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dict...yostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 9e-24 3 X51892 |X51892.1 Dict

  18. Dicty_cDB: SSB373 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB373 (Link to dictyBase) - G00609 DDB0216216 Contig-U04543-1...nk to library) Clone ID SSB373 (Link to dictyBase) Atlas ID - NBRP ID G00609 dictyBase ID DDB0216216 Link to... Contig Contig-U04543-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Value N AB016728 |AB016728.1 Dictyostelium discoideum sapA mRNA for saposin A, co... 44 7e-04 12 AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strain AX4, comp

  19. Dicty_cDB: VSE812 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSE812 (Link to dictyBase) - - - Contig-U14773-1 VSE812E (Link... to Original site) - - - - - - VSE812E 721 Show VSE812 Library VS (Link to library) Clone ID VSE812 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14773-1 Original site URL http://dict...re E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...9 AF401554_1( AF401554 |pid:none) Ictalurus punctatus ribosomal prot... 132 1e-29 protein update 2009. 7.31

  20. Dicty_cDB: CHN208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHN208 (Link to dictyBase) - - - Contig-U11696-1 - (Link to Or...iginal site) CHN208F 157 - - - - - - Show CHN208 Library CH (Link to library) Clone ID CHN208 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dictycdb.b...ces producing significant alignments: (bits) Value N AC149612 |AC149612.1 Ictalurus punctatus clone CH212-98...nuclear 20.0 %: mitochondrial 8.0 %: vacuolar 4.0 %: peroxisomal >> prediction fo

  1. Dicty_cDB: SSD329 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSD329 (Link to dictyBase) - - - Contig-U16581-1 SSD329F (Link... to Original site) SSD329F 444 - - - - - - Show SSD329 Library SS (Link to library) Clone ID SSD329 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...A Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoide... DNA sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictal

  2. Dicty_cDB: CFE853 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE853 (Link to dictyBase) - - - Contig-U16381-1 CFE853F (Link... to Original site) CFE853F 109 - - - - - - Show CFE853 Library CF (Link to library) Clone ID CFE853 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...uences producing significant alignments: (bits) Value N X51892 |X51892.1 Dictyost...elium discoideum SP60 gene for spore coat protein. 80 6e-21 2 X52105 |X52105.1 Dictyostelium discoideum SP60

  3. Dicty_cDB: CFH668 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH668 (Link to dictyBase) - - - Contig-U13860-1 - (Link to Or...iginal site) - - CFH668Z 651 - - - - Show CFH668 Library CF (Link to library) Clone ID CFH668 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13860-1 Original site URL http://dictycdb.b...s) Value N AC116987 |AC116987.2 Dictyostelium discoideum chromosome 2 map 3527441-3568052 strain AX4, comple...te sequence. 58 1e-11 6 AC116305 |AC116305.2 Dictyostelium discoideum chromosome

  4. Dicty_cDB: AFL826 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFL826 (Link to dictyBase) - - - - AFL826P (Link to Original s...ite) AFL826F 588 AFL826Z 766 AFL826P 1334 - - Show AFL826 Library AF (Link to library) Clone ID AFL826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t... Score E Sequences producing significant alignments: (bits) Value N ( BJ346543 ) Dictyostelium discoideum cD...NA clone:dda24d08, 3' ... 1100 0.0 1 ( BJ341682 ) Dictyostelium discoideum cDNA c

  5. Dicty_cDB: SFD117 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFD117 (Link to dictyBase) - - - Contig-U16381-1 SFD117F (Link... to Original site) SFD117F 107 - - - - - - Show SFD117 Library SF (Link to library) Clone ID SFD117 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...s producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dictyoste...lium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 2e-21 3 X51892 |X51892.1 Dict

  6. Dicty_cDB: AFL289 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFL289 (Link to dictyBase) - - - - AFL289F (Link to Original s...ite) AFL289F 123 - - - - - - Show AFL289 Library AF (Link to library) Clone ID AFL289 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/... E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 82 5e-29 2 X52105 |X52105.1 Dictyostelium discoideu

  7. Dicty_cDB: SSG427 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG427 (Link to dictyBase) - - - - SSG427Z (Link to Original s...ite) - - SSG427Z 372 - - - - Show SSG427 Library SS (Link to library) Clone ID SSG427 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...E Sequences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyostelium discoideum glyco....1 Sequence 481 from Patent WO0168912. 48 0.090 1 BE470067 |BE470067.1 IpHdk03092 Head kidney cDNA library Ict

  8. Dicty_cDB: AFK740 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK740 (Link to dictyBase) - - - Contig-U16381-1 AFK740F (Link... to Original site) AFK740F 107 - - - - - - Show AFK740 Library AF (Link to library) Clone ID AFK740 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...es producing significant alignments: (bits) Value N X51892 |X51892.1 Dictyosteliu...m discoideum SP60 gene for spore coat protein. 80 6e-21 2 X52105 |X52105.1 Dictyostelium discoideum SP60 gen

  9. Dicty_cDB: SLF689 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF689 (Link to dictyBase) - - - Contig-U16284-1 SLF689Z (Link... to Original site) - - SLF689Z 320 - - - - Show SLF689 Library SL (Link to library) Clone ID SLF689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16284-1 Original site URL http://dict...DNA Score E Sequences producing significant alignments: (bits) Value N ( AC116305 ) Dictyostelium discoideum... chromosome 2 map 1005175... 478 e-131 1 ( AU053477 ) Dictyostelium discoideum slug cDNA, clone SLI726. 478 e-131 1 ( AU053102 ) Dict

  10. Dicty_cDB: CFH744 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH744 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH744F 118 - - - - - - Show CFH744 Library CF (Link to library) Clone ID CFH744 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ng significant alignments: (bits) Value N X51892 |X51892.1 Dictyostelium discoide...um SP60 gene for spore coat protein. 80 1e-23 3 AC115685 |AC115685.1 Dictyostelium discoideum chromosome 2 m

  11. Dicty_cDB: SSI473 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI473 (Link to dictyBase) - - - - SSI473Z (Link to Original s...ite) - - SSI473Z 416 - - - - Show SSI473 Library SS (Link to library) Clone ID SSI473 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...uences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyost...Hdk03092 Head kidney cDNA library Ictalurus punctatus cDNA 5' similar to Dual specificity phosphatase 10 (DU

  12. Dicty_cDB: CHD152 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHD152 (Link to dictyBase) - - - - - (Link to Original site) C...HD152F 603 - - - - - - Show CHD152 Library CH (Link to library) Clone ID CHD152 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHD...Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum...UF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to

  13. Dicty_cDB: SLH678 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH678 (Link to dictyBase) - - - Contig-U04159-1 SLH678E (Link... to Original site) - - - - - - SLH678E 373 Show SLH678 Library SL (Link to library) Clone ID SLH678 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04159-1 Original site URL http://dict... producing significant alignments: (bits) Value N ( AU039970 ) Dictyostelium discoideum slug cDNA, clone SLG...865. 323 e-129 2 ( AU039381 ) Dictyostelium discoideum slug cDNA, clone SLH678. 3

  14. Dicty_cDB: SSF689 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF689 (Link to dictyBase) - - - Contig-U16581-1 SSF689F (Link... to Original site) SSF689F 443 - - - - - - Show SSF689 Library SS (Link to library) Clone ID SSF689 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...core E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum ...A sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictaluru

  15. Dicty_cDB: CFH713 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH713 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH713F 133 - - - - - - Show CFH713 Library CF (Link to library) Clone ID CFH713 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-23 3 AC115685 |AC115685.1 Dict

  16. Dicty_cDB: SSC836 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC836 (Link to dictyBase) - - - - SSC836E (Link to Original s...ite) - - - - - - SSC836E 502 Show SSC836 Library SS (Link to library) Clone ID SSC836 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...t alignments: (bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) g...ene, complete cds. 779 0.0 1 AC116984 |AC116984.2 Dictyostelium discoideum chromo

  17. Dicty_cDB: CFH518 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH518 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH518F 131 - - - - - - Show CFH518 Library CF (Link to library) Clone ID CFH518 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-22 3 AC115685 |AC115685.1 Dictyos

  18. Dicty_cDB: VHI285 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI285 (Link to dictyBase) - - - Contig-U16073-1 - (Link to Or...iginal site) VHI285F 136 - - - - - - Show VHI285 Library VH (Link to library) Clone ID VHI285 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16073-1 Original site URL http://dictycdb.b... DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ423035 ) Dict...yostelium discoideum cDNA clone:ddv47i22, 5' ... 72 2e-27 3 ( BJ419916 ) Dictyostelium discoideum cD

  19. Dicty_cDB: CHQ307 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHQ307 (Link to dictyBase) - - - Contig-U16403-1 CHQ307P (Link... to Original site) CHQ307F 441 CHQ307Z 669 CHQ307P 1090 - - Show CHQ307 Library CH (Link to library) Clone ID CHQ307 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16403-1 Original site URL http://dict...EDPATQLSSLKFESDKEKEQALLWAFLASYLPEDKGS LQKEFVKHVEYTLAQTKSECTDF--- ---fvmplvmkictslvlvlkrstk*rklfmmenshqtldglv...0.0 own update 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N M77492 |M77492.1 Dict

  20. Dicty_cDB: CFI225 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFI225 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFI225F 133 - - - - - - Show CFI225 Library CF (Link to library) Clone ID CFI225 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N X51892 |X51892.1 Dict...yostelium discoideum SP60 gene for spore coat protein. 80 2e-23 3 AC115685 |AC115685.1 Dict

  1. Dicty_cDB: AFK156 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK156 (Link to dictyBase) - - - - AFK156P (Link to Original s...ite) AFK156F 599 AFK156Z 448 AFK156P 1047 - - Show AFK156 Library AF (Link to library) Clone ID AFK156 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.t...4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dict... tolerance against environmental stress. 92 7e-24 3 AY342298 |AY342298.1 Ictaluru

  2. Dicty_cDB: CFH557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH557 (Link to dictyBase) - - - - - (Link to Original site) C...FH557F 132 - - - - - - Show CFH557 Library CF (Link to library) Clone ID CFH557 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFH...roducing significant alignments: (bits) Value N AC115685 |AC115685.1 Dictyosteliu...m discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 3e-28 3 X51892 |X51892.1 Dict

  3. Dicty_cDB: CFI560 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFI560 (Link to dictyBase) - - - - CFI560P (Link to Original s...ite) CFI560F 593 CFI560Z 259 CFI560P 832 - - Show CFI560 Library CF (Link to library) Clone ID CFI560 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...ences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyoste...RNA sequence. 42 6e-04 2 AY342298 |AY342298.1 Ictalurus punctatus ER-resident chaperone calreticulin mRNA, c

  4. Dicty_cDB: VFH144 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFH144 (Link to dictyBase) - - - - VFH144P (Link to Original s...ite) VFH144F 641 VFH144Z 312 VFH144P 953 - - Show VFH144 Library VF (Link to library) Clone ID VFH144 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...nces producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostel...RNA sequence. 42 8e-04 2 AY342298 |AY342298.1 Ictalurus punctatus ER-resident chaperone calreticulin mRNA, c

  5. Dicty_cDB: SSA564 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA564 (Link to dictyBase) - - - - SSA564F (Link to Original s...ite) SSA564F 653 - - - - - - Show SSA564 Library SS (Link to library) Clone ID SSA564 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...NNTLKPKQTTKGFNIGGQPGNPTN*l--- Frame C: tlkfvmplvmkictslvlvlkrstk*rklfmmenshqtldgl...bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) gene, complete c

  6. Dicty_cDB: VHA386 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHA386 (Link to dictyBase) - - - Contig-U11201-1 - (Link to Or...iginal site) - - VHA386Z 730 - - - - Show VHA386 Library VH (Link to library) Clone ID VHA386 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11201-1 Original site URL http://dictycdb.b...Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08646 |L08646.1 Dict...19 1 CX835130 |AF255664_1 major vault protein [Ictalurus punctatus], mRNA sequenc

  7. Dicty_cDB: SLD420 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLD420 (Link to dictyBase) - - - Contig-U16325-1 SLD420E (Link... to Original site) - - - - - - SLD420E 434 Show SLD420 Library SL (Link to library) Clone ID SLD420 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16325-1 Original site URL http://dict... 7 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AF066071 ) Dict...yostelium discoideum SP85 (pspB) gene, comple... 860 0.0 1 ( AC117075 ) Dictyostelium

  8. Dicty_cDB: AFE742 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFE742 (Link to dictyBase) - - - - AFE742F (Link to Original s...ite) AFE742F 585 - - - - - - Show AFE742 Library AF (Link to library) Clone ID AFE742 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreti...NA clone hj81f04, mRNA sequence. 36 3e-04 3 AY342298 |AY342298.1 Ictalurus puncta

  9. Dicty_cDB: VFJ256 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFJ256 (Link to dictyBase) - - - Contig-U10140-1 VFJ256E (Link...) Clone ID VFJ256 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10140-1 Ori...*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICTDLCLC AYTDHGHCGVLTEEGFIENEKSIIRLG...iiikiih iiyivdmpiqlldhgkvimsf*nln*fiqfllqi*liqklklnpyqdnikfqvi**lnf* dhwlrkd*nq*fylv*l*vx*KMNKLHLPIKENHHQXIKSIELIKNEFPEILICT...pdate 2002.12.18 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ432755 ) Dict

  10. Dicty_cDB: SHA393 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHA393 (Link to dictyBase) - - - Contig-U11503-1 SHA393E (Link... Clone ID SHA393 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dict...lated Amino Acid sequence ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICTSLKDAVXRAFLLI...yhcysyfg Translated Amino Acid sequence (All Frames) Frame A: ekqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGCG FNNXPICT...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AF020283_1( AF020283 |pid:none) Dict

  11. Dicty_cDB: SHF448 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF448 (Link to dictyBase) - - - Contig-U11503-1 SHF448E (Link...) Clone ID SHF448 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Ori...quence qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKD...mnvnlkimrigltqlxisyrfy Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAV...nts: (bits) Value N AC115680 |AC115680.3 Dictyostelium discoideum chromosome 2 map 4915084-5005461 strain AX

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB752 (Link to dictyBase) - - - Contig-U14717-1 VFB752E (Link...) Clone ID VFB752 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14717-1 Ori...s: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain AX4,... complete sequence. 1215 0.0 11 AC115594 |AC115594.2 Dictyostelium discoideum chr...omosome 2 map 4071862-4101005 strain AX4, complete sequence. 113 3e-47 8 AC116920 |AC116920.2 Dictyostelium

  13. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB614 (Link to dictyBase) - - - Contig-U16382-1 VFB614Z (Link... to Original site) - - VFB614Z 219 - - - - Show VFB614 Library VF (Link to library) Clone ID VFB614 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site URL http://dict...ments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum chromosome 2 ...tin mRNA ITL-1, 3' end. 339 9e-90 1 AC116986 |AC116986.2 Dictyostelium discoideum chromosome 2 map 2234041-2

  14. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB667 (Link to dictyBase) - - - Contig-U13894-1 VFB667Z (Link... to Original site) - - VFB667Z 633 - - - - Show VFB667 Library VF (Link to library) Clone ID VFB667 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13894-1 Original site URL http://dict... update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC117075 |AC117075.2 Dict...chondrial 4.0 %: vacuolar 4.0 %: peroxisomal >> prediction for VFB667 is cyt 5' e

  15. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC191 (Link to dictyBase) - - - Contig-U16281-1 VFC191F (Link... to Original site) VFC191F 350 - - - - - - Show VFC191 Library VF (Link to library) Clone ID VFC191 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16281-1 Original site URL http://dict...ts) Value N AC116305 |AC116305.2 Dictyostelium discoideum chromosome 2 map 1005175-1418323 strain AX4, compl... 186 3e-46 AC116305_8( AC116305 |pid:none) Dictyostelium discoideum chromosom...

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB776 (Link to dictyBase) - - - Contig-U13978-1 VFB776P (Link... to Original site) VFB776F 513 VFB776Z 602 VFB776P 1115 - - Show VFB776 Library VF (Link to library) Clone ID VFB776 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13978-1 Original site URL http://dict...ences producing significant alignments: (bits) Value N L41839 |L41839.1 Dictyoste....00 48.0 %: cytoplasmic 32.0 %: nuclear 16.0 %: cytoskeletal 4.0 %: peroxisomal >> predict

  17. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB826 (Link to dictyBase) - - - Contig-U16584-1 VFB826F (Link... to Original site) VFB826F 430 - - - - - - Show VFB826 Library VF (Link to library) Clone ID VFB826 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16584-1 Original site URL http://dict... (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657875-4914984 strain AX4, c...vesicles of secretory system 4.0 %: endoplasmic reticulum >> prediction for VFB82

  18. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB632 (Link to dictyBase) - - - Contig-U16585-1 VFB632Z (Link... to Original site) - - VFB632Z 181 - - - - Show VFB632 Library VF (Link to library) Clone ID VFB632 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16585-1 Original site URL http://dict...g significant alignments: (bits) Value N AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657...%: cytoplasmic 12.0 %: mitochondrial 8.0 %: cytoskeletal 4.0 %: peroxisomal >> prediction for VFB632 is nuc

  19. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC124 (Link to dictyBase) - - - Contig-U12017-1 VFC124Z (Link... to Original site) - - VFC124Z 496 - - - - Show VFC124 Library VF (Link to library) Clone ID VFC124 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12017-1 Original site URL http://dict...e E Sequences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dictyostelium discoideum... chromosome 2 map 1685067-2090751 strain AX4, complete sequence. 835 0.0 2 U67089 |U67089.1 Dict

  20. Dicty_cDB: VHN647 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ignments: (bits) Value CP001577_292( CP001577 |pid:none) Micromonas sp. RCC299 chromosome... 106 2e-21 (Q9NZJ4) RecName: Full=Sacsi...n; &AL157766_4( AL157766 |pid:none) 105 5e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsi..... 103 2e-20 (Q9JLC8) RecName: Full=Sacsin; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsi

  1. Dicty_cDB: VHK791 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ificant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL15...142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 103 1e-20 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA ...(cDNA cl... 103 1e-20 (Q9JLC8) RecName: Full=Sacsin; 103 1e-20 AB006708_10( AB006

  2. Dicty_cDB: VHO809 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL1...57766 |pid:none) 105 5e-21 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 1e-20 B...C138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsin

  3. Dicty_cDB: VHD239 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lignments: (bits) Value BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 112 3e-23 BC13...8482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 112 4e-23 (Q9NZJ4) RecName: Full=Sacsin; &...AL157766_4( AL157766 |pid:none) 112 4e-23 (Q9JLC8) RecName: Full=Sacsin; 112 4e-2

  4. Dicty_cDB: VHC102 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ucing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 1...05 4e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsi...n; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 CP0015

  5. Dicty_cDB: VHB767 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vs Protein Score E Sequences producing significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &...AL157766_4( AL157766 |pid:none) 111 7e-23 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 109 3e-22 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl...... 108 3e-22 (Q9JLC8) RecName: Full=Sacsin; 108 3e-22 BC142916_1( BC142916 |pid:none) Danio rerio hypothetic

  6. Dicty_cDB: VHK810 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available g significant alignments: (bits) Value (Q9NZJ4) RecName: Full=Sacsin; &AL157766_4( AL157766 |pid:none) 105 5...e-21 BC138482_1( BC138482 |pid:none) Mus musculus sacsin, mRNA (cDNA cl... 103 2e-20 (Q9JLC8) RecName: Full=Sacsi...n; 103 2e-20 BC171956_1( BC171956 |pid:none) Mus musculus sacsin, mRNA (cDNA

  7. Dicty_cDB: SLJ818 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available its) Value N AF312775 |AF312775.1 Tetrahymena thermophila macronuclear immobilization antigen LD (SerLD) mRN...Y9928, primer: M13 forward, sequence 1. 30 0.014 4 AF312772 |AF312772.1 Tetrahymena thermophila macronuclear immobilization...r RE70748 full insert cDNA. 42 0.096 2 AF312771 |AF312771.1 Tetrahymena thermophila macronuclear immobilization...mena thermophila macronuclear immobilization antigen LA (SerLA) mRNA, complete cds. 30 0.12 3 AC116673 |AC11

  8. Dicty_cDB: SFC123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFC123 (Link to dictyBase) - - - Contig-U16368-1 SFC123E (Link...) Clone ID SFC123 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Ori...CVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICT...CRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICTIINGHPTCIR...(bits) Value N D13973 |D13973.1 Dictyostelium discoideum DNA for Dp87 protein, complete cds. 1643 0.0 5 BJ17

  9. Dicty_cDB: VHB884 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *nlygsnql yss*np*ktsfnsktrwnk**c*snin*yfnyyf*wyfcwyekywlnynykiliin*lii ikiiiikiiiivlhyfkdaxk*in*kf Translated... 2004.12.24 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N DQ538352 |DQ538352.1 Bienertia si... aralocaspica phosphoenolpyruvate carboxylase mRNA, partial cds. 48 2e-07 2 DQ538354 |DQ538354.1 Suaeda eltoni...lmekk**n** kh*f*lnhqvkelqns*rni*krlai*virkh*myqecyhiy*i*lmlqnniiwldqlen hsstmkmi*si...tfry*nd**thknykcnlginkt*nsstr**npstfcfns*nlygsnql yss*np*ktsfnsktrwnk**c*snin*yfnyyf*wyfcwyekywlnynykiliin*lii ikiiiikiiiivlhyfkda

  10. Dicty_cDB: SSC874 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e E Sequences producing significant alignments: (bits) Value CP000678_461( CP000678 |pid:none) Methanobrevibacter smith...one) Methanobrevibacter smithii ATCC... 39 0.54 CP000678_1585( CP000678 |pid:none) Methanobrevibacter smithi...592 |pid:none) Ostreococcus lucimarinus CCE9901 ... 37 2.0 CP000678_411( CP000678 |pid:none) Methanobrevibacter smith...AE017226_1351( AE017226 |pid:none) Treponema denticola ATCC 35405,... 39 0.41 CP000678_1188( CP000678 |pid:n

  11. ProCarDB: a database of bacterial carotenoids.

    Science.gov (United States)

    Nupur, L N U; Vats, Asheema; Dhanda, Sandeep Kumar; Raghava, Gajendra P S; Pinnaka, Anil Kumar; Kumar, Ashwani

    2016-05-26

    Carotenoids have important functions in bacteria, ranging from harvesting light energy to neutralizing oxidants and acting as virulence factors. However, information pertaining to the carotenoids is scattered throughout the literature. Furthermore, information about the genes/proteins involved in the biosynthesis of carotenoids has tremendously increased in the post-genomic era. A web server providing the information about microbial carotenoids in a structured manner is required and will be a valuable resource for the scientific community working with microbial carotenoids. Here, we have created a manually curated, open access, comprehensive compilation of bacterial carotenoids named as ProCarDB- Prokaryotic Carotenoid Database. ProCarDB includes 304 unique carotenoids arising from 50 biosynthetic pathways distributed among 611 prokaryotes. ProCarDB provides important information on carotenoids, such as 2D and 3D structures, molecular weight, molecular formula, SMILES, InChI, InChIKey, IUPAC name, KEGG Id, PubChem Id, and ChEBI Id. The database also provides NMR data, UV-vis absorption data, IR data, MS data and HPLC data that play key roles in the identification of carotenoids. An important feature of this database is the extension of biosynthetic pathways from the literature and through the presence of the genes/enzymes in different organisms. The information contained in the database was mined from published literature and databases such as KEGG, PubChem, ChEBI, LipidBank, LPSN, and Uniprot. The database integrates user-friendly browsing and searching with carotenoid analysis tools to help the user. We believe that this database will serve as a major information centre for researchers working on bacterial carotenoids.

  12. The Development of the TPR-DB as Grounded Theory Method

    DEFF Research Database (Denmark)

    Carl, Michael; Schaeffer, Moritz

    2018-01-01

    and refine the emerging concepts and categories and to validate the developing theories, the TPR-DB has been extended with further translation studies in different languages and translation modes. In this respect, it shares many features with Grounded Theory Method. This method was discovered in 1967...... and used in qualitative research in social science ad many other research areas. We analyze the TPR-DB development as a Grounded Theory Method....... on quantitative assessment of well-defined research questions on cognitive processes in human translation production, the integration of the data into the TPR-DB allowed for broader qualitative and exploratory research which has led to new codes, categories and research themes. In a constant effort to develop...

  13. Real-Time processing of Big Data with ScyllaDB

    CERN Multimedia

    CERN. Geneva; Martinez Pedreira, Miguel

    2018-01-01

    ScyllaDB: achieving 1 million operations/sec with stable and consistent real time latencies This talk will present ScyllaDB, a highly available Real-time Big Data Database that can achieve high throughput without compromising latencies or availability. ScyllaDB is API-compatible with Apache Cassandra but employs a different internal architecture to make sure that operational capacity is increased while the maintenance burden is reduced. It provides everything that a new-world database must provide: horizontal (infinite) scaling, no single point of failure, high availability and excellent performance, while keeping a sensible amount of operational efforts. Some of the key points that make ScyllaDB very efficient are its fully asynchronous operations and the smart integration with the kernel and hardware. You will learn about what makes ScyllaDB special in the crowded space of NoSQL solutions and how it can be used to power a wide variety of workloads: from real time bidding to the experiment data from the ALI...

  14. dbEM: A database of epigenetic modifiers curated from cancerous and normal genomes

    Science.gov (United States)

    Singh Nanda, Jagpreet; Kumar, Rahul; Raghava, Gajendra P. S.

    2016-01-01

    We have developed a database called dbEM (database of Epigenetic Modifiers) to maintain the genomic information of about 167 epigenetic modifiers/proteins, which are considered as potential cancer targets. In dbEM, modifiers are classified on functional basis and comprise of 48 histone methyl transferases, 33 chromatin remodelers and 31 histone demethylases. dbEM maintains the genomic information like mutations, copy number variation and gene expression in thousands of tumor samples, cancer cell lines and healthy samples. This information is obtained from public resources viz. COSMIC, CCLE and 1000-genome project. Gene essentiality data retrieved from COLT database further highlights the importance of various epigenetic proteins for cancer survival. We have also reported the sequence profiles, tertiary structures and post-translational modifications of these epigenetic proteins in cancer. It also contains information of 54 drug molecules against different epigenetic proteins. A wide range of tools have been integrated in dbEM e.g. Search, BLAST, Alignment and Profile based prediction. In our analysis, we found that epigenetic proteins DNMT3A, HDAC2, KDM6A, and TET2 are highly mutated in variety of cancers. We are confident that dbEM will be very useful in cancer research particularly in the field of epigenetic proteins based cancer therapeutics. This database is available for public at URL: http://crdd.osdd.net/raghava/dbem.

  15. Validity of Basic Electronic 1 Module Integrated Character Value Based on Conceptual Change Teaching Model to Increase Students Physics Competency in STKIP PGRI West Sumatera

    Science.gov (United States)

    Hidayati, A.; Rahmi, A.; Yohandri; Ratnawulan

    2018-04-01

    The importance of teaching materials in accordance with the characteristics of students became the main reason for the development of basic electronics I module integrated character values based on conceptual change teaching model. The module development in this research follows the development procedure of Plomp which includes preliminary research, prototyping phase and assessment phase. In the first year of this research, the module is validated. Content validity is seen from the conformity of the module with the development theory in accordance with the demands of learning model characteristics. The validity of the construct is seen from the linkage and consistency of each module component developed with the characteristic of the integrated learning model of character values obtained through validator assessment. The average validation value assessed by the validator belongs to a very valid category. Based on the validator assessment then revised the basic electronics I module integrated character values based on conceptual change teaching model.

  16. Dicty_cDB: VHD492 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD492 (Link to dictyBase) - - - Contig-U15308-1 - (Link to Original site) - - VHD492...Z 675 - - - - Show VHD492 Library VH (Link to library) Clone ID VHD492 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHD4-D/VHD492Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHD492 (VHD492Q) /CSM/VH/VHD4-D/VHD492Q.Seq.d/ XXXXXXXXXXCTTCATC...xkiipink Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHD492 (VHD492Q) /CSM/VH/VHD4-D/VHD492

  17. Dicty_cDB: SSD492 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSD492 (Link to dictyBase) - - - Contig-U11368-1 SSD492E (Link... to Original site) - - - - - - SSD492E 768 Show SSD492 Library SS (Link to library) Clone ID SSD492 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSD4-D/SSD492Q.Seq.d/ Representative seq. ID SSD492...E (Link to Original site) Representative DNA sequence >SSD492 (SSD492Q) /CSM/SS/SSD4-D/SSD492Q.Seq.d/ CTGAA...nificant alignments: (bits) Value SSD492 (SSD492Q) /CSM/SS/SSD4-D/SSD492Q.Seq.d/ 1481 0.0 AHH144 (AHH144Q) /

  18. Dicty_cDB: CHD492 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHD492 (Link to dictyBase) - - - - CHD492P (Link to Original site) CHD492F 531 CHD492...Z 728 CHD492P 1239 - - Show CHD492 Library CH (Link to library) Clone ID CHD492 (Link...sukuba.ac.jp/CSM/CH/CHD4-D/CHD492Q.Seq.d/ Representative seq. ID CHD492P (Link to... Original site) Representative DNA sequence >CHD492 (CHD492Q) /CSM/CH/CHD4-D/CHD492Q.Seq.d/ ATATACAATTTAATTT...A Score E Sequences producing significant alignments: (bits) Value CHD492 (CHD492Q) /CSM/CH/CHD4-D/CHD492

  19. Dicty_cDB: SLD492 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLD492 (Link to dictyBase) - - - Contig-U11049-1 SLD492P (Link to Original site) SLD492...F 347 SLD492Z 454 SLD492P 801 - - Show SLD492 Library SL (Link to library) Clone ID SLD492... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLD4-D/SLD492Q.Seq.d/ Representative seq. ID SLD492...P (Link to Original site) Representative DNA sequence >SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492...nces producing significant alignments: (bits) Value SLD492 (SLD492Q) /CSM/SL/SLD4-D/SLD492

  20. Dicty_cDB: CFD492 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD492 (Link to dictyBase) - - - Contig-U10808-1 CFD492P (Link to Original site) CFD492...F 583 CFD492Z 527 CFD492P 1110 - - Show CFD492 Library CF (Link to library) Clone ID CFD492...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD4-D/CFD492Q.Seq.d/ Representative seq. ID CFD492...P (Link to Original site) Representative DNA sequence >CFD492 (CFD492Q) /CSM/CF/CFD4-D/CFD492...omology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD492 (CFD492

  1. Dicty_cDB: VHI137 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available alignments: (bits) Value AY698035_1( AY698035 |pid:none) Desmognathus marmoratus isolate 69... 40 0.067 AY6...12344_1( AY612344 |pid:none) Desmognathus marmoratus voucher KH... 40 0.088 DQ018662_1( DQ018662 |pid:none) ...Plethodon dunni isolate 75356 NADH... 37 0.57 AY612348_1( AY612348 |pid:none) Desmog...nathus quadramaculatus vouch... 36 1.3 AY698038_1( AY698038 |pid:none) Desmognathus marmoratus isolate T0...... 36 1.3 AY698041_1( AY698041 |pid:none) Desmognathus marmoratus isolate T0... 36 1.3 CP000270_2676( CP000

  2. Dicty_cDB: VHP481 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available g significant alignments: (bits) Value AY698035_1( AY698035 |pid:none) Desmognath...us marmoratus isolate 69... 40 0.060 AY612344_1( AY612344 |pid:none) Desmognathus marmoratus voucher KH... 4...0 0.079 DQ018662_1( DQ018662 |pid:none) Plethodon dunni isolate 75356 NADH... 38 0.30 AY612348_1( AY612348 |pid:none) Desmog...nathus quadramaculatus vouch... 36 1.1 AY698038_1( AY698038 |pid:none) Desmog...nathus marmoratus isolate T0... 36 1.1 AY698041_1( AY698041 |pid:none) Desmognathus marmoratus i

  3. Dicty_cDB: VHN394 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ents: (bits) Value AY698035_1( AY698035 |pid:none) Desmognathus marmoratus isolate 69... 40 0.067 AY612344_1...on dunni isolate 75356 NADH... 37 0.57 AY612348_1( AY612348 |pid:none) Desmognath...us quadramaculatus vouch... 36 1.3 AY698038_1( AY698038 |pid:none) Desmognathus marmoratus isolate T0... 36 ...1.3 AY698041_1( AY698041 |pid:none) Desmognathus marmoratus isolate T0... 36 1.3 CP000270_2676( CP000270 |pi...( AY612344 |pid:none) Desmognathus marmoratus voucher KH... 40 0.087 DQ018662_1( DQ018662 |pid:none) Plethod

  4. Dicty_cDB: SLH220 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH220 (Link to dictyBase) - - - Contig-U15409-1 SLH220F (Link to Original site) SLH2...20F 510 - - - - - - Show SLH220 Library SL (Link to library) Clone ID SLH220 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH220Q.Seq.d/ Representative seq. ID SLH22...0F (Link to Original site) Representative DNA sequence >SLH220 (SLH220Q) /CSM/SL/SLH2-A/SLH220Q.Seq.d/ GAAGA...gnificant alignments: (bits) Value SLH220 (SLH220Q) /CSM/SL/SLH2-A/SLH220Q.Seq.d/

  5. Dicty_cDB: SLH284 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH284 (Link to dictyBase) - - - Contig-U15748-1 SLH284P (Link to Original site) SLH2...84F 544 SLH284Z 467 SLH284P 1011 - - Show SLH284 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH284Q.Seq.d/ Representative seq. ID SLH2...84P (Link to Original site) Representative DNA sequence >SLH284 (SLH284Q) /CSM/SL/SLH2-D/SLH2...DNA Score E Sequences producing significant alignments: (bits) Value SLH284 (SLH284Q) /CSM/SL/SLH2-D/SLH284Q

  6. Dicty_cDB: SLH245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH245 (Link to dictyBase) - - - Contig-U01321-1 SLH245F (Link to Original site) SLH2...45F 294 - - - - - - Show SLH245 Library SL (Link to library) Clone ID SLH245 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH245Q.Seq.d/ Representative seq. ID SLH24...5F (Link to Original site) Representative DNA sequence >SLH245 (SLH245Q) /CSM/SL/SLH2-B/SLH245Q.Seq.d/ CACCA...significant alignments: (bits) Value SLH245 (SLH245Q) /CSM/SL/SLH2-B/SLH245Q.Seq.d/ 513 e-145 SLF841 (SLF841

  7. Dicty_cDB: SLH275 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH275 (Link to dictyBase) - - - Contig-U16280-1 SLH275Z (Link... to Original site) - - SLH275Z 543 - - - - Show SLH275 Library SL (Link to library) Clone ID SLH275 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH275Q.Seq.d/ Representative seq. ID SLH27...5Z (Link to Original site) Representative DNA sequence >SLH275 (SLH275Q) /CSM/SL/SLH2-D/SLH275Q.Seq.d/ XXXXX...ignificant alignments: (bits) Value SLH275 (SLH275Q) /CSM/SL/SLH2-D/SLH275Q.Seq.d/ 1076 0.0 SLH850 (SLH850Q)

  8. Dicty_cDB: SLH229 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH229 (Link to dictyBase) - - - Contig-U15799-1 SLH229Z (Link... to Original site) - - SLH229Z 269 - - - - Show SLH229 Library SL (Link to library) Clone ID SLH229 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH229Q.Seq.d/ Representative seq. ID SLH22...9Z (Link to Original site) Representative DNA sequence >SLH229 (SLH229Q) /CSM/SL/SLH2-B/SLH229Q.Seq.d/ XXXXX...E Sequences producing significant alignments: (bits) Value SLH229 (SLH229Q) /CSM/SL/SLH2-B/SLH2

  9. Dicty_cDB: SLH247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH247 (Link to dictyBase) - - - Contig-U16280-1 SLH247Z (Link... to Original site) - - SLH247Z 632 - - - - Show SLH247 Library SL (Link to library) Clone ID SLH247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH247Q.Seq.d/ Representative seq. ID SLH24...7Z (Link to Original site) Representative DNA sequence >SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ XXXXX...ant alignments: (bits) Value SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ 1253 0.0 SLA487 (SLA487Q) /CSM/S

  10. Dicty_cDB: SLH273 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH273 (Link to dictyBase) - - - Contig-U16280-1 SLH273P (Link to Original site) SLH2...73F 241 SLH273Z 294 SLH273P 535 - - Show SLH273 Library SL (Link to library) Clone ID SLH2... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH273Q.Seq.d/ Representative seq. ID SLH2...73P (Link to Original site) Representative DNA sequence >SLH273 (SLH273Q) /CSM/SL/SLH2-D/SLH2...ducing significant alignments: (bits) Value SLH273 (SLH273Q) /CSM/SL/SLH2-D/SLH273Q.Seq.d/ 868 0.0 SSK467 (S

  11. Dicty_cDB: SLH288 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH288 (Link to dictyBase) - - - Contig-U16287-1 SLH288P (Link to Original site) SLH2...88F 594 SLH288Z 688 SLH288P 1282 - - Show SLH288 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH288Q.Seq.d/ Representative seq. ID SLH2...88P (Link to Original site) Representative DNA sequence >SLH288 (SLH288Q) /CSM/SL/SLH2-D/SLH2...hsiikikkkkikkkasiinn*kkkkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH288 (SLH2

  12. Dicty_cDB: SLH234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH234 (Link to dictyBase) - - - Contig-U08154-1 SLH234F (Link to Original site) SLH2...34F 535 - - - - - - Show SLH234 Library SL (Link to library) Clone ID SLH234 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH234Q.Seq.d/ Representative seq. ID SLH23...4F (Link to Original site) Representative DNA sequence >SLH234 (SLH234Q) /CSM/SL/SLH2-B/SLH234Q.Seq.d/ ACAAA...DCTTV--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH2

  13. Dicty_cDB: SLH211 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH211 (Link to dictyBase) - - - Contig-U16162-1 SLH211Z (Link... to Original site) - - SLH211Z 427 - - - - Show SLH211 Library SL (Link to library) Clone ID SLH211 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH211Q.Seq.d/ Representative seq. ID SLH21...1Z (Link to Original site) Representative DNA sequence >SLH211 (SLH211Q) /CSM/SL/SLH2-A/SLH211Q.Seq.d/ XXXXX...equences producing significant alignments: (bits) Value SLI277 (SLI277Q) /CSM/SL/SLI2-D/SLI277Q.Seq.d/ 767 0.0 SLH211 (SLH2

  14. Dicty_cDB: SLH239 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH239 (Link to dictyBase) - G22492 DDB0190970 Contig-U04169-1 SLH2...39F (Link to Original site) SLH239F 460 - - - - - - Show SLH239 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH239Q.Seq.d/ ...Representative seq. ID SLH239F (Link to Original site) Representative DNA sequence >SLH239 (SLH239Q) /CSM/SL/SLH2-B/SLH2...uences producing significant alignments: (bits) Value SLH239 (SLH239Q) /CSM/SL/SLH2-B/SLH239Q.Seq.d/ 640 0.0

  15. Dicty_cDB: SLH204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH204 (Link to dictyBase) - - - Contig-U15479-1 SLH204Z (Link... to Original site) - - SLH204Z 657 - - - - Show SLH204 Library SL (Link to library) Clone ID SLH204 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH204Q.Seq.d/ Representative seq. ID SLH20...4Z (Link to Original site) Representative DNA sequence >SLH204 (SLH204Q) /CSM/SL/SLH2-A/SLH204Q.Seq.d/ XXXXX...g significant alignments: (bits) Value N ( AU039226 ) Dictyostelium discoideum slug cDNA, clone SLH204. 930

  16. Dicty_cDB: SLH249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH249 (Link to dictyBase) - G24226 DDB0215670 Contig-U04170-1 SLH2...49E (Link to Original site) - - - - - - SLH249E 689 Show SLH249 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH249Q.Seq.d/ ...Representative seq. ID SLH249E (Link to Original site) Representative DNA sequence >SLH249 (SLH249Q) /CSM/SL/SLH2-C/SLH2...re E Sequences producing significant alignments: (bits) Value SLH249 (SLH249Q) /CSM/SL/SLH2-C/SLH2

  17. Dicty_cDB: SLH295 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH295 (Link to dictyBase) - - - Contig-U15436-1 SLH295E (Link to Original site) SLH2...95F 644 SLH295Z 632 SLH295P 1276 SLH295E 1045 Show SLH295 Library SL (Link to library) Clone ID SLH2...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH295Q.Seq.d/ Representative seq. ID SLH2...95E (Link to Original site) Representative DNA sequence >SLH295 (SLH295Q) /CSM/SL/SLH2-D/SLH2...q*wfnpclqiiipinflikiskkkkkkkkkkkkkk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH2

  18. Dicty_cDB: SLH231 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH231 (Link to dictyBase) - - - Contig-U16382-1 SLH231F (Link to Original site) SLH2...31F 431 - - - - - - Show SLH231 Library SL (Link to library) Clone ID SLH231 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH231Q.Seq.d/ Representative seq. ID SLH23...1F (Link to Original site) Representative DNA sequence >SLH231 (SLH231Q) /CSM/SL/SLH2-B/SLH231Q.Seq.d/ AAAAA...Score E Sequences producing significant alignments: (bits) Value SLH231 (SLH231Q) /CSM/SL/SLH2-B/SLH231Q.Seq

  19. Dicty_cDB: SLH274 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH274 (Link to dictyBase) - G22493 DDB0218769 Contig-U04171-1 SLH2...74F (Link to Original site) SLH274F 340 - - - - - - Show SLH274 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-D/SLH274Q.Seq.d/ ...Representative seq. ID SLH274F (Link to Original site) Representative DNA sequence >SLH274 (SLH274Q) /CSM/SL/SLH2-D/SLH2...core E Sequences producing significant alignments: (bits) Value SLH274 (SLH274Q) /CSM/SL/SLH2-D/SLH274Q.Seq.

  20. Dicty_cDB: SLH265 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH265 (Link to dictyBase) - - - Contig-U13901-1 SLH265Z (Link... to Original site) - - SLH265Z 631 - - - - Show SLH265 Library SL (Link to library) Clone ID SLH265 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH265Q.Seq.d/ Representative seq. ID SLH26...5Z (Link to Original site) Representative DNA sequence >SLH265 (SLH265Q) /CSM/SL/SLH2-C/SLH265Q.Seq.d/ XXXXX... alignments: (bits) Value SLH265 (SLH265Q) /CSM/SL/SLH2-C/SLH265Q.Seq.d/ 1059 0.0 VFL442 (VFL442Q) /CSM/VF/V

  1. Dicty_cDB: SLH207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH207 (Link to dictyBase) - - - Contig-U11514-1 SLH207P (Link to Original site) SLH2...07F 689 SLH207Z 675 SLH207P 1364 - - Show SLH207 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH207Q.Seq.d/ Representative seq. ID SLH2...07P (Link to Original site) Representative DNA sequence >SLH207 (SLH207Q) /CSM/SL/SLH2-A/SLH2...**yi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH207 (SLH207Q) /CSM/SL/SLH2-A/SLH2

  2. Dicty_cDB: SLH238 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH238 (Link to dictyBase) - G22491 DDB0188118 Contig-U04168-1 SLH2...38F (Link to Original site) SLH238F 383 - - - - - - Show SLH238 Library SL (Link to library) Clone ID SLH2...riginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH238Q.Seq.d/ ...Representative seq. ID SLH238F (Link to Original site) Representative DNA sequence >SLH238 (SLH238Q) /CSM/SL/SLH2-B/SLH2...e E Sequences producing significant alignments: (bits) Value SLH238 (SLH238Q) /CSM/SL/SLH2-B/SLH2

  3. Dicty_cDB: SLH208 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH208 (Link to dictyBase) - - - Contig-U10711-1 SLH208P (Link to Original site) SLH2...08F 517 SLH208Z 692 SLH208P 1209 - - Show SLH208 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH208Q.Seq.d/ Representative seq. ID SLH2...08P (Link to Original site) Representative DNA sequence >SLH208 (SLH208Q) /CSM/SL/SLH2-A/SLH2...wfr*fpfkimei*llnnstsltlpppplsiihil*lql*ye Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH2

  4. Dicty_cDB: SLH264 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH264 (Link to dictyBase) - - - Contig-U16382-1 SLH264Z (Link... to Original site) - - SLH264Z 532 - - - - Show SLH264 Library SL (Link to library) Clone ID SLH264 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-C/SLH264Q.Seq.d/ Representative seq. ID SLH26...4Z (Link to Original site) Representative DNA sequence >SLH264 (SLH264Q) /CSM/SL/SLH2-C/SLH264Q.Seq.d/ XXXXX...g significant alignments: (bits) Value N ( AU039244 ) Dictyostelium discoideum slug cDNA, clone SLH2

  5. Dicty_cDB: SLH223 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH223 (Link to dictyBase) - - - Contig-U16450-1 SLH223Z (Link... to Original site) - - SLH223Z 404 - - - - Show SLH223 Library SL (Link to library) Clone ID SLH223 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH223Q.Seq.d/ Representative seq. ID SLH22...3Z (Link to Original site) Representative DNA sequence >SLH223 (SLH223Q) /CSM/SL/SLH2-A/SLH223Q.Seq.d/ XXXXX...logy vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH223 (SLH2

  6. Dicty_cDB: SLH203 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH203 (Link to dictyBase) - - - Contig-U10734-1 SLH203Z (Link... to Original site) - - SLH203Z 683 - - - - Show SLH203 Library SL (Link to library) Clone ID SLH203 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH203Q.Seq.d/ Representative seq. ID SLH20...3Z (Link to Original site) Representative DNA sequence >SLH203 (SLH203Q) /CSM/SL/SLH2-A/SLH203Q.Seq.d/ XXXXX...ing significant alignments: (bits) Value SLH203 (SLH203Q) /CSM/SL/SLH2-A/SLH203Q.

  7. Dicty_cDB: SSH414 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSH414 (Link to dictyBase) - - - Contig-U16581-1 SSH414Z (Link... to Original site) - - SSH414Z 448 - - - - Show SSH414 Library SS (Link to library) Clone ID SSH414 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...ogy vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium... SAMPLING. 44 1.7 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  8. Dicty_cDB: VFH244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFH244 (Link to dictyBase) - - - - VFH244F (Link to Original s...ite) VFH244F 594 - - - - - - Show VFH244 Library VF (Link to library) Clone ID VFH244 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostel...is centranthoides cDNA clone hj81f04, mRNA sequence. 36 3e-04 3 AY342298 |AY342298.1 Ictalurus punctatus ER-

  9. Dicty_cDB: SSF210 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF210 (Link to dictyBase) - - - Contig-U16581-1 SSF210P (Link... to Original site) SSF210F 183 SSF210Z 197 SSF210P 380 - - Show SSF210 Library SS (Link to library) Clone ID SSF210 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...nt alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 339...01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ictacalcin, mRNA s

  10. Dicty_cDB: SSD571 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSD571 (Link to dictyBase) - - - Contig-U16581-1 SSD571Z (Link... to Original site) - - SSD571Z 415 - - - - Show SSD571 Library SS (Link to library) Clone ID SSD571 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...omology vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dict...Brassica oleracea genomic clone BONRK12, DNA sequence. 50 0.025 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

  11. Dicty_cDB: AFF681 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF681 (Link to dictyBase) - - - - AFF681P (Link to Original s...ite) AFF681F 592 AFF681Z 173 AFF681P 765 - - Show AFF681 Library AF (Link to library) Clone ID AFF681 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts....0 own update 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dict... 36 7e-04 3 AY342298 |AY342298.1 Ictalurus punctatus ER-resident chaperone calreticulin mRNA, complete cds.

  12. Dicty_cDB: CFH521 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH521 (Link to dictyBase) - - - Contig-U16381-1 - (Link to Or...iginal site) CFH521F 134 - - - - - - Show CFH521 Library CF (Link to library) Clone ID CFH521 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dictycdb.b...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dict.... 82 2e-29 3 X51892 |X51892.1 Dictyostelium discoideum SP60 gene for spore coat protein. 82 4e-29 2 X52105 |X52105.1 Dict

  13. Dicty_cDB: CFH244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH244 (Link to dictyBase) - - - Contig-U16381-1 CFH244F (Link... to Original site) CFH244F 124 - - - - - - Show CFH244 Library CF (Link to library) Clone ID CFH244 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...ts) Value N AC115685 |AC115685.1 Dictyostelium discoideum chromosome 2 map 4718821-4752388 strain AX4, compl...ete sequence. 82 2e-29 3 X51892 |X51892.1 Dictyostelium discoideum SP60 gene for spore coat protein. 82 4e-29 2 X52105 |X52105.1 Dict

  14. Dicty_cDB: SSG335 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG335 (Link to dictyBase) - - - Contig-U16509-1 SSG335F (Link... to Original site) SSG335F 200 - - - - - - Show SSG335 Library SS (Link to library) Clone ID SSG335 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...y vs DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium d...iscoideum mRNA. 64 1e-17 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Icta

  15. Dicty_cDB: SSG316 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG316 (Link to dictyBase) - - - Contig-U16509-1 SSG316F (Link... to Original site) SSG316F 231 - - - - - - Show SSG316 Library SS (Link to library) Clone ID SSG316 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideu...m mRNA. 64 3e-12 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  16. Dicty_cDB: SLB690 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available r Dp87... 45 9e-04 AC117267_7( AC117267 |pid:none) Dictyostelium discoideum chromosom... 40 0.037 AY574051_1( AY574051 |pid:none) Ict...SL (Link to library) SLB690 (Link to dictyBase) - - - Contig-U16325-1 SLB690Z (Link... to Original site) - - SLB690Z 481 - - - - Show SLB690 Library SL (Link to library) Clone ID SLB690 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16325-1 Original site URL http://dict...t alignments: (bits) Value N ( AF066071 ) Dictyostelium discoideum SP85 (pspB) gene, comple... 831 0.0 1 ( AC117075 ) Dict

  17. Dicty_cDB: SSE149 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSE149 (Link to dictyBase) - - - Contig-U01658-1 | Contig-U165... library) Clone ID SSE149 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U016...58-1 | Contig-U16509-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/S...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 64 1e-17 2 AC100496...egans clone T13G4, complete sequence. 36 5.0 2 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus p

  18. Dicty_cDB: AFF235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFF235 (Link to dictyBase) - - - - AFF235F (Link to Original s...ite) AFF235F 602 - - - - - - Show AFF235 Library AF (Link to library) Clone ID AFF235 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...date 2001.11.24 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N U36937 |U36937.1 Dict... 3 CK420742 |CK420742.1 AUF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to ER

  19. Dicty_cDB: AHA115 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AH (Link to library) AHA115 (Link to dictyBase) - - - - - (Link to Original site) A...HA115F 669 - - - - - - Show AHA115 Library AH (Link to library) Clone ID AHA115 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AH/AHA...(bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cds. 1243 0.0 2 BD24838... 7e-04 1 CK420742 |CK420742.1 AUF_IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar

  20. Dicty_cDB: CHP827 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP827 (Link to dictyBase) - - - Contig-U15898-1 - (Link to Or...iginal site) CHP827F 148 - - - - - - Show CHP827 Library CH (Link to library) Clone ID CHP827 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15898-1 Original site URL http://dictycdb.b...ments: (bits) Value N AC116984 |AC116984.2 Dictyostelium discoideum chromosome 2 map 2567470-3108875 strain ...18q21 clone:RP11-866E20, WORKING DRAFT SEQUENCE, 18 unordered pieces. 42 0.073 4 CK406764 |CK406764.1 AUF_IfLvr_212_c09 Ict

  1. Dicty_cDB: VFH121 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFH121 (Link to dictyBase) - - - - VFH121P (Link to Original s...ite) VFH121F 632 VFH121Z 144 VFH121P 776 - - Show VFH121 Library VF (Link to library) Clone ID VFH121 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...nificant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cd...es cDNA clone hj81f04, mRNA sequence. 36 7e-04 3 CB937139 |CB937139.1 IpCGJx13_12_E07_23 IpCGJx13 Ictalurus

  2. Dicty_cDB: SSJ546 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSJ546 (Link to dictyBase) - - - Contig-U16581-1 SSJ546F (Link... to Original site) SSJ546F 445 - - - - - - Show SSJ546 Library SS (Link to library) Clone ID SSJ546 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...DNA Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoi...2, DNA sequence. 50 0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

  3. Dicty_cDB: SSE436 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSE436 (Link to dictyBase) - - - Contig-U16509-1 SSE436P (Link... to Original site) SSE436F 222 SSE436Z 178 SSE436P 400 - - Show SSE436 Library SS (Link to library) Clone ID SSE436 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16509-1 Original site URL http://dict...Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dict...EQUENCING IN PROGRESS ***, 5 unordered pieces. 42 0.13 3 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ict

  4. Dicty_cDB: VFH167 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFH167 (Link to dictyBase) - - - Contig-U16272-1 VFH167P (Link... to Original site) VFH167F 641 VFH167Z 348 VFH167P 989 - - Show VFH167 Library VF (Link to library) Clone ID VFH167 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...omology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dictyoste...) Homo sapiens cDNA FLJ35376 fis, cl... 320 5e-86 AF401554_1( AF401554 |pid:none) Ictalurus punctatus riboso

  5. Dicty_cDB: SFJ801 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFJ801 (Link to dictyBase) - - - - SFJ801P (Link to Original s...ite) SFJ801F 633 SFJ801Z 345 SFJ801P 978 - - Show SFJ801 Library SF (Link to library) Clone ID SFJ801 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.ts...t alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mRNA, complete cds. 1021...IpTrk_27_j08 Trunk kidney cDNA library Ictalurus punctatus cDNA 5' similar to ER-resident chaperone calretic

  6. Dicty_cDB: SHK620 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHK620 (Link to dictyBase) - - - Contig-U13939-1 - (Link to Or...iginal site) SHK620F 395 - - - - - - Show SHK620 Library SH (Link to library) Clone ID SHK620 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13939-1 Original site URL http://dictycdb.b...pdate 2002.12. 9 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF337815 |AF337815.1 Dict...omene cDNA clone Hm_pupb_01C06 5', mRNA sequence. 48 0.15 1 CK405838 |CK405838.1 AUF_IfSpn_234_g03 Ict

  7. Dicty_cDB: SSF105 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF105 (Link to dictyBase) - - - Contig-U16581-1 SSF105F (Link... to Original site) SSF105F 432 - - - - - - Show SSF105 Library SS (Link to library) Clone ID SSF105 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...g significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 387 e-126 3 BZ46365...028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  8. Dicty_cDB: VHH893 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHH893 (Link to dictyBase) - - - Contig-U15693-1 - (Link to Or...iginal site) - - VHH893Z 385 - - - - Show VHH893 Library VH (Link to library) Clone ID VHH893 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15693-1 Original site URL http://dictycdb.b... Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF188717 |AF188717.1 Dict...anio rerio alanyl-tRNA synthetase... 48 9e-05 DQ353802_1( DQ353802 |pid:none) Ictalurus punctatus isolate C1

  9. Dicty_cDB: CHD534 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHD534 (Link to dictyBase) - - - Contig-U15540-1 CHD534E (Link...) Clone ID CHD534 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Ori...nts: (bits) Value N AC114263 |AC114263.2 Dictyostelium discoideum chromosome 2 ma...p 215673-367476 strain AX4, complete sequence. 40 1e-05 6 AC117081 |AC117081.2 Dictyostelium discoideum chro...mosome 2 map 5862124-6045772 strain AX4, complete sequence. 40 2e-05 5 AJ277590 |AJ277590.1 Dictyostelium di

  10. Dicty_cDB: SSI468 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu

  11. Dicty_cDB: CHD405 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHD405 (Link to dictyBase) - - - Contig-U15984-1 CHD405E (Link... Clone ID CHD405 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15984-1 Original site URL http://dict...ts) Value N AC115599 |AC115599.2 Dictyostelium discoideum chromosome 2 map 422909...8-4354721 strain AX4, complete sequence. 42 3e-11 9 AC115598 |AC115598.2 Dictyostelium discoideum chromosome... 2 map 581427-735498 strain AX4, complete sequence. 50 4e-11 11 CK417372 |CK417372.1 AUF_IpInt_56_d19 Intestine cDNA library Ict

  12. Dicty_cDB: SSK129 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSK129 (Link to dictyBase) - - - Contig-U16021-1 SSK129Z (Link... to Original site) - - SSK129Z 372 - - - - Show SSK129 Library SS (Link to library) Clone ID SSK129 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16021-1 Original site URL http://dict...Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116957 |AC116957.2 Dict...419632 |CK419632.1 AUF_IpOva_21_i24 Ovary cDNA library Ictalurus punctatus cDNA 5', mRNA sequence. 36 0.54 2

  13. Dicty_cDB: SSC474 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC474 (Link to dictyBase) - - - Contig-U07719-1 SSC474P (Link... to Original site) SSC474F 368 SSC474Z 238 SSC474P 606 - - Show SSC474 Library SS (Link to library) Clone ID SSC474 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U07719-1 Original site URL http://dict...logy vs DNA Score E Sequences producing significant alignments: (bits) Value N ( AU071762 ) Dictyostelium di...scoideum slug cDNA, clone SSC474. 448 e-121 1 ( AU060185 ) Dictyostelium discoideum slug cDNA, clone SLA535.

  14. Dicty_cDB: AFE557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFE557 (Link to dictyBase) - - - - AFE557F (Link to Original s...ite) AFE557F 540 - - - - - - Show AFE557 Library AF (Link to library) Clone ID AFE557 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...ificant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calr...|CB937139.1 IpCGJx13_12_E07_23 IpCGJx13 Ictalurus punctatus cDNA clone IpCGJx13_12_E07 5', mRNA sequence. 52

  15. Dicty_cDB: VSK112 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSK112 (Link to dictyBase) - - - Contig-U16538-1 VSK112P (Link... to Original site) VSK112F 515 VSK112Z 357 VSK112P 872 - - Show VSK112 Library VS (Link to library) Clone ID VSK112 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16538-1 Original site URL http://dict... 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y17042 |Y17042.1 Dict...095O23 F, DNA sequence. 36 0.071 2 BM439182 |BM439182.1 IpLvr02248 Liver cDNA library Ict

  16. Dicty_cDB: SSD250 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSD250 (Link to dictyBase) - - - Contig-U14716-1 SSD250E (Link... to Original site) - - - - - - SSD250E 491 Show SSD250 Library SS (Link to library) Clone ID SSD250 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U14716-1 Original site URL http://dict...t alignments: (bits) Value N U20432 |U20432.1 Dictyostelium discoideum TagB (tagB) gene, complete cds. 151 1...cName: Full=Cytochrome b-c1 complex subunit 7; AltNam... 45 0.001 DQ399515_1( DQ399515 |pid:none) Ictalurus

  17. Dicty_cDB: SSG552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSG552 (Link to dictyBase) - - - Contig-U16581-1 - (Link to Or...iginal site) SSG552F 449 - - - - - - Show SSG552 Library SS (Link to library) Clone ID SSG552 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dictycdb.b...A Score E Sequences producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoide.... 44 1.7 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ictacalc

  18. Dicty_cDB: SSF865 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF865 (Link to dictyBase) - - - Contig-U16581-1 SSF865Z (Link... to Original site) - - SSF865Z 436 - - - - Show SSF865 Library SS (Link to library) Clone ID SSF865 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16581-1 Original site URL http://dict...s producing significant alignments: (bits) Value N D16417 |D16417.1 Dictyostelium discoideum mRNA. 387 e-115...0.027 1 BM028890 |BM028890.1 IpSkn01670 Skin cDNA library Ictalurus punctatus cDNA 5' similar to Ict

  19. Dicty_cDB: VSH207 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSH207 (Link to dictyBase) - - - Contig-U12548-1 VSH207P (Link... to Original site) VSH207F 228 VSH207Z 107 VSH207P 335 - - Show VSH207 Library VS (Link to library) Clone ID VSH207 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12548-1 Original site URL http://dict...ents: (bits) Value N ( AU267072 ) Dictyostelium discoideum vegetative cDNA clone:VS... 206 2e-58 2 ( AC116982 ) Dict...yostelium discoideum chromosome 2 map 3622643... 206 4e-49 1 ( AU267073 ) Dict

  20. Dicty_cDB: AFH386 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFH386 (Link to dictyBase) - - - - AFH386F (Link to Original s...ite) AFH386F 623 - - - - - - Show AFH386 Library AF (Link to library) Clone ID AFH386 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...s producing significant alignments: (bits) Value N U36937 |U36937.1 Dictyostelium discoideum calreticulin mR...is centranthoides cDNA clone hj81f04, mRNA sequence. 36 4e-04 3 AY342298 |AY342298.1 Ictalurus punctatus ER-