WorldWideScience

Sample records for insecticide l-canavanine repels

  1. Plant insecticide L-canavanine repels Drosophila via the insect orphan GPCR DmX.

    Directory of Open Access Journals (Sweden)

    Christian Mitri

    2009-06-01

    Full Text Available For all animals, the taste sense is crucial to detect and avoid ingesting toxic molecules. Many toxins are synthesized by plants as a defense mechanism against insect predation. One example of such a natural toxic molecule is L-canavanine, a nonprotein amino acid found in the seeds of many legumes. Whether and how insects are informed that some plants contain L-canavanine remains to be elucidated. In insects, the taste sense relies on gustatory receptors forming the gustatory receptor (Gr family. Gr proteins display highly divergent sequences, suggesting that they could cover the entire range of tastants. However, one cannot exclude the possibility of evolutionarily independent taste receptors. Here, we show that L-canavanine is not only toxic, but is also a repellent for Drosophila. Using a pharmacogenetic approach, we find that flies sense food containing this poison by the DmX receptor. DmXR is an insect orphan G-protein-coupled receptor that has partially diverged in its ligand binding pocket from the metabotropic glutamate receptor family. Blockade of DmXR function with an antagonist lowers the repulsive effect of L-canavanine. In addition, disruption of the DmXR encoding gene, called mangetout (mtt, suppresses the L-canavanine repellent effect. To avoid the ingestion of L-canavanine, DmXR expression is required in bitter-sensitive gustatory receptor neurons, where it triggers the premature retraction of the proboscis, thus leading to the end of food searching. These findings show that the DmX receptor, which does not belong to the Gr family, fulfills a gustatory function necessary to avoid eating a natural toxin.

  2. Ethnobotany of plants used as insecticides, repellents and ...

    African Journals Online (AJOL)

    An ethnobotanical study on plants used for the prevention and treatment of malaria was conducted to document the indigenous knowledge particularly associated with the use and conservation of anti-malarial, insecticide and insect repellent medicinal plants. In this study, five sampling sites were selected based on the ...

  3. Efficacy of topical mosquito repellent (picaridin) plus long-lasting insecticidal nets versus long-lasting insecticidal nets alone for control of malaria : A cluster randomised controlled trial

    NARCIS (Netherlands)

    Sluydts, V.; Durnez, L.; Heng, S.; Gryseels, C.; Canier, L.; Kim, S.; Van Roey, K.; Kerkhof, K.; Khim, N.; Mao, S.; Menard, D.; Coosemans, M.

    2016-01-01

    Background Although effective topical repellents provide personal protection against malaria, whether mass use of topical repellents in addition to long-lasting insecticidal nets can contribute to a further decline of malaria is not known, particularly in areas where outdoor transmission occurs. We

  4. Insecticidal, repellent and fungicidal properties of novel trifluoromethylphenyl amides.

    Science.gov (United States)

    Tsikolia, Maia; Bernier, Ulrich R; Coy, Monique R; Chalaire, Katelyn C; Becnel, James J; Agramonte, Natasha M; Tabanca, Nurhayat; Wedge, David E; Clark, Gary G; Linthicum, Kenneth J; Swale, Daniel R; Bloomquist, Jeffrey R

    2013-09-01

    Twenty trifluoromethylphenyl amides were synthesized and evaluated as fungicides and as mosquito toxicants and repellents. Against Aedes aegypti larvae, N-(2,6-dichloro-4-(trifluoromethyl)phenyl)-3,5-dinitrobenzamide (1e) was the most toxic compound (24 h LC50 1940 nM), while against adults N-(2,6-dichloro-4-(trifluoromethyl)phenyl)-2,2,2-trifluoroacetamide (1c) was most active (24 h LD50 19.182 nM, 0.5 μL/insect). However, the 24 h LC50 and LD50 values of fipronil against Ae. aegypti larvae and adults were significantly lower: 13.55 nM and 0.787 × 10(-4) nM, respectively. Compound 1c was also active against Drosophila melanogaster adults with 24 h LC50 values of 5.6 and 4.9 μg/cm(2) for the Oregon-R and 1675 strains, respectively. Fipronil had LC50 values of 0.004 and 0.017 μg/cm(2) against the two strains of D. melanogaster, respectively. In repellency bioassays against female Ae. aegypti, 2,2,2-trifluoro-N-(2-(trifluoromethyl)phenyl)acetamide (4c) had the highest repellent potency with a minimum effective dosage (MED) of 0.039 μmol/cm(2) compared to DEET (MED of 0.091 μmol/cm(2)). Compound N-(2-(trifluoromethyl)phenyl)hexanamide (4a) had an MED of 0.091 μmol/cm(2) which was comparable to DEET. Compound 4c was the most potent fungicide against Phomopsis obscurans. Several trends were discerned between the structural configuration of these molecules and the effect of structural changes on toxicity and repellency. Para- or meta- trifluoromethylphenyl amides with an aromatic ring attached to the carbonyl carbon showed higher toxicity against Ae. aegypti larvae, than ortho- trifluoromethylphenyl amides. Ortho- trifluoromethylphenyl amides with trifluoromethyl or alkyl group attached to the carbonyl carbon produced higher repellent activity against female Ae. aegypti and Anopheles albimanus than meta- or para- trifluoromethylphenyl amides. The presence of 2,6-dichloro- substitution on the phenyl ring of the amide had an influence on larvicidal and repellent

  5. Insecticidal and repellent effects of tea tree and andiroba oils on flies associated with livestock.

    Science.gov (United States)

    Klauck, V; Pazinato, R; Stefani, L M; Santos, R C; Vaucher, R A; Baldissera, M D; Raffin, R; Boligon, A; Athayde, M; Baretta, D; Machado, G; DA Silva, A S

    2014-08-01

    This study aimed to evaluate the insecticidal and repellent effects of tea tree, Melaleuca alternifolia (Myrtales: Myrtaceae), and andiroba, Carapa guianensis (Sapindales: Meliaceae), essential oils on two species of fly. For in vitro studies, free-living adult flies were captured and reared in the laboratory. To evaluate the insecticidal effects of the oils, adult flies of Haematobia irritans (L.) and Musca domestica L. (both: Diptera: Muscidae) were separated by species in test cages (n = 10 per group), and subsequently tested with oils at concentrations of 1.0% and 5.0% using a negative control to validate the test. Both oils showed insecticidal activity. Tea tree oil at a concentration of 5.0% was able to kill M. domestica with 100.0% efficacy after 12 h of exposure. However, the effectiveness of andiroba oil at a concentration of 5.0% was only 67.0%. The insecticidal efficacy (100.0%) of both oils against H. irritans was observed at both concentrations for up to 4 h. The repellency effects of the oils at concentrations of 5.0% were tested in vivo on Holstein cows naturally infested by H. irritans. Both oils demonstrated repellency at 24 h, when the numbers of flies on cows treated with tea tree and andiroba oil were 61.6% and 57.7%, respectively, lower than the number of flies on control animals. It is possible to conclude that these essential oils have insecticidal and repellent effects against the species of fly used in this study. © 2014 The Royal Entomological Society.

  6. Identification of Repellent and Insecticidal Constituents of the Essential Oil of Artemisia rupestris L. Aerial Parts against Liposcelis bostrychophila Badonnel

    OpenAIRE

    Liu, Xin; Li, Yin; Li, He; Deng, Zhi; Zhou, Ligang; Liu, Zhi; Du, Shu

    2013-01-01

    The aim of this research was to determine the chemical composition and insecticidal and repellent activity of the essential oil of Artemisia rupestris L. aerial parts against the booklice Liposcelis bostrychophila Badonnel and isolation of insecticidal and repellent constituents from the essential oil. The essential oil of A. rupestris was obtained by hydrodistillation and analyzed by GC-MS. A total of 30 components of the essential oil of A. rupestris was identified and the principal compoun...

  7. Insecticidal and Repellent Activit ies of Laurinterol from the Okinawan Red Alga Laurencia nidifica

    Directory of Open Access Journals (Sweden)

    Takahiro Ishii

    2017-01-01

    Full Text Available An ethyl acetate (EtOAc extract of Laurencia nidifica was found to have toxic effect against brine shrimp larvae (Artemia salina. Bioassay-guided fractionation of the EtOAc extract resulted in the isolation of four known halogenated sesquiterpenes, laurinterol (1, isolaurinterol (2, aplysin (3, and a -bromocuparene (4. Their structures were established on the basis of spectral analysis and comparison with literature data. Among isolated compounds, only laurinterol showed strong toxicity against A. salina. Further experiments revealed that laurinterol also exhibited repellent activity against the maize weevil Sitophilus zeamais , insecticidal activity against the termite Reticulitermes speratus, and acetylcholinesterase (AChE inhibitory effect . This is the first report of insecticidal and repellent activities of laurinterol.

  8. Identification of Repellent and Insecticidal Constituents from Artemisia mongolica Essential Oil against Lasioderma serricorne

    Directory of Open Access Journals (Sweden)

    Chunxue You

    2015-01-01

    Full Text Available The aims of this research were to determine the chemical composition and insecticidal and repellent activities of the Artemisia mongolica essential oil against Lasioderma serricorne and to isolate active constituents from the essential oil. The essential oil of A. mongolica was obtained by hydrodistillation and 36 components were identified with GC-MS. Eucalyptol (39.88%, (S-cis-verbenol (14.93%, 4-terpineol (7.20%, (−-camphor (6.02%, and α-terpineol (4.20% were found to be major components. With a further isolation process, five constituents obtained from the essential oil were identified as eucalyptol, verbenol, 4-terpineol, camphor, and α-terpineol. In the progress of assay, it showed that L. serricorne adults had different sensitivities to the crude essential oil and isolated constituents. 4-Terpineol exhibited strongest contact activity against L. serricorne, showing the LD50 value of 8.62 μg/adult. Moreover, camphor and α-terpineol showed stronger fumigant activity (LC50=2.91 and 3.27 mg/L air, resp. against L. serricorne than crude essential oil and other constituents. In addition, the essential oil, eucalyptol, verbenol, and α-terpineol showed comparable repellency against L. serricorne adults. The results indicate that the essential oil and isolated compounds have potential to provide more efficient and safer natural insecticides or repellents for control of insects in food and Chinese medicinal materials preservation.

  9. Identification of Repellent and Insecticidal Constituents from Artemisia mongolica Essential Oil against Lasioderma serricorne

    OpenAIRE

    You, Chunxue; Guo, Shanshan; Zhang, Wenjuan; Yang, Kai; Geng, Zhufeng; Du, Shushan; Wang, Chengfang; Deng, Zhiwei

    2015-01-01

    The aims of this research were to determine the chemical composition and insecticidal and repellent activities of the Artemisia mongolica essential oil against Lasioderma serricorne and to isolate active constituents from the essential oil. The essential oil of A. mongolica was obtained by hydrodistillation and 36 components were identified with GC-MS. Eucalyptol (39.88%), (S)-cis-verbenol (14.93%), 4-terpineol (7.20%), (−)-camphor (6.02%), and α-terpineol (4.20%) were found to be major compo...

  10. The neonicotinoid insecticide imidacloprid repels pollinating flies and beetles at field-realistic concentrations.

    Directory of Open Access Journals (Sweden)

    Amy H Easton

    Full Text Available Neonicotinoids are widely used systemic insecticides which, when applied to flowering crops, are translocated to the nectar and pollen where they may impact upon pollinators. Given global concerns over pollinator declines, this potential impact has recently received much attention. Field exposure of pollinators to neonicotinoids depends on the concentrations present in flowering crops and the degree to which pollinators choose to feed upon them. Here we describe a simple experiment using paired yellow pan traps with or without insecticide to assess whether the commonly used neonicotinoid imidacloprid repels or attracts flying insects. Both Diptera and Coleoptera exhibited marked avoidance of traps containing imidacloprid at a field-realistic dose of 1 µg L(-1, with Diptera avoiding concentrations as low as 0.01 µg L(-1. This is to our knowledge the first evidence for any biological activity at such low concentrations, which are below the limits of laboratory detection using most commonly available techniques. Catch of spiders in pan traps was also slightly reduced by the highest concentrations of imidacloprid used (1 µg L(-1, but catch was increased by lower concentrations. It remains to be seen if the repellent effect on insects occurs when neonicotinoids are present in real flowers, but if so then this could have implications for exposure of pollinators to neonicotinoids and for crop pollination.

  11. Insecticidal and Repellent Properties of Subtropical Plant Extracts Against Pulse Beetle, Callosobruchus chinensis

    Directory of Open Access Journals (Sweden)

    H.T. AI Lawati

    2002-01-01

    Full Text Available Extracts of eight plants local to Oman, namely Qarat (Acacia nilotica, Mustafal (Annona squamosa, Shereesh (Azadirachta indica, Luban (Boswellia sacra, Kheshkhash (Crotolaria juncea, Zebrot (Jatropha dhofarica Yas, (Myrtus communis and Suwwad (Suaeda aegyptiaca were prepared by steeping shaded dried leaf/ seed powder of each plant in water and solvent (methanol or ethanol. The extracts were tested for their insecticidal and repellent properties against the pulse beetles, Callosobruchus chinensis. The extracts from the seeds of A. squamosa recorded l00% mortality of beetles within twenty and four hours of their exposure to methanol and ethanol extracts, respectively. The other extracts that caused high mortality were from A. nilotica, C. juncea, M. communis and S. aegzptiaca in methanol and B. sacra, J. dhofarica, S. aegptiaca and commercial neem in ethanol. Extracts of M. communis in methanol were highly repellent to the beetles compared to other extracts. Legume seeds treated with extracts of A. squamosa were not repellent, rather the beetles were attracted to them.

  12. Repels

    International Nuclear Information System (INIS)

    Maki, M.; Clarke, D.; McKeen, W.

    1991-01-01

    This paper reports on repels (Rapidly Extendible Perimeter Line Sensor) which is a recent development in transportable security technology. Repels utilizes a new coupled wave device technology (CWD) to provide the detection advantages of radio-frequency leaky cable guided radar for portable sensors. These advantages include an invisible, terrain-following detection zone, and an optimal detection characteristic for human-size targets. Repels adds the dimension of portability and set-up of an adjustable zone up to 100 m by a single person, typically within 20 minutes. Internal replaceable D-cell flashlight batteries provide power for weeks of operation. First introduced as a prototype for test and evaluation in 1988, Repels was launched as a Senstar NDI product in 1990. This paper outlines the technical principles of the Repels sensor, recent improvements from the original prototype results of early field test experience on production models, and applications. Recent advances driven by initial field tests include, for example, the use of inductively-coupled transmitter and receiver couplers, so that no radio frequency field connections are required, and simple conductors can be employed. Test and application experience in several countries has expanded from parked aircraft perimeters, military encampments, forward area surveillance, and waterside security, to dignitary protection and failed sensor stand-in. Such sensors may be used to protect facilities dealing with nuclear materials

  13. Repellant and insecticidal activities of shyobunone and isoshyobunone derived from the essential oil of Acorus calamus rhizomes.

    Science.gov (United States)

    Chen, Hai-Ping; Yang, Kai; Zheng, Li-Shi; You, Chun-Xue; Cai, Qian; Wang, Cheng-Fang

    2015-01-01

    It was found that the essential oil of Acorus calamus rhizomes showed insecticidal activity. The aim of this study was to determine the chemical composition of the essential oil from A. calamus rhizomes, evaluate insecticidal and repellant activity against Lasioderma serricorne (LS) and Tribolium castaneum (TC), and to isolate any insecticidal constituents from the essential oil. Essential oil from A. calamus was obtained by hydrodistillation and analyzed by gas chromatography (GC) flame ionization detector and GC-mass spectrometry. The insecticidal and repellant activity of the essential oil and isolated compounds was tested using a variety of methods. The main components of the essential oil were identified to be isoshyobunone (15.56%), β-asarone (10.03%), bicyclo[6.1.0]non-1-ene (9.67%), shyobunone (9.60%) and methylisoeugenol (6.69%). Among them, the two active constituents were isolated and identified as shyobunone and isoshyobunone. The essential oil showed contact toxicity against LS and TC with LD50 values of 14.40 and 32.55 μg/adult, respectively. The isolated compounds, shyobunone and isoshyobunone also exhibited strong contact toxicity against LS adults with LD50 values of 20.24 and 24.19 μg/adult, respectively, while the LD50 value of isoshyobunone was 61.90 μg/adult for TC adults. The essential oil, shyobunone and isoshyobunone were strongly repellent (98%, 90% and 94%, respectively, at 78.63 nL/cm(2), after 2 h treatment) against TC. The essential oil, shyobunone and isoshyobunone possessed insecticidal and repellant activity against LS and TC.

  14. Insecticidal and repellant activities of plants oil against stored grain pest, Tribolium castaneum (Herbst (Coleoptera:Tenebrionidae

    Directory of Open Access Journals (Sweden)

    S.R.Pugazhvendan

    2012-05-01

    Full Text Available Objective: The present investigation was aimed to assess the impact of five plants oil for their insecticidal and repellent activity against Tribolium castaneum (Herbst, a stored grain pest and they were tested in the laboratory. Method: Five plants oil Citrus autantium, Cinnamomum zeylanicum, Gaultheria fragrantissima, Lavandula officinalis, and Ocimum sanctum were evaluated for their insecticidal and repellent activities against T. castaneum by adapting the standard protocol in vitro. Results: In Tulsi oil showed powerful repellent against T. castaneum beetles at both the concentration and this property can be clearly seen from the values at 5毺 1 (-0.60 and -0.73 in 1h and 6hr respectively and 10毺 1 (-0.56 and -0.81 in 1h and 6h respectively. Tulsi oil had more repelling property than other oil tested here against T. castaneum. Maximum percentage of mortality (76 and 92% at 48h and 72 hours after treatment respectively in Tulsi oil. Wintergreen oil showed 86% mortality at 72 hours after treatment. Conclusions: The present work for botanical products to control the insect pest of stored grain T. castaneum .These results suggest the presence of actives principles in the plant oils. Further exploration of active principles and their structural elucidations are underway.

  15. Insecticidal and Repellant Activities of Four indigenous medicinal Plants Against Stored Grain Pest, Tribolium castaneum (Herbst (Coleoptera:Tenebrionidae

    Directory of Open Access Journals (Sweden)

    S.R.Pugazhvendan

    2012-05-01

    Full Text Available Objective: The present investigation was aimed to assess the impact of four indigenous plants for their insecticidal and repellent activity against Tribolium castaneum (Herbst, a stored grain pest and they were tested in the laboratory. Methods: Four widely distributed plants (Artemisia vulgaris, Sphaeranthus indicus, Tephrosia purpurea, and Prosopis juliflora were sequentially extracted with increasing polarity of organic solvents such as, hexane, chloroform and ethyl acetate were evaluated for their insecticidal and repellent activities against Tribolium castaneum by adapting the standard protocol in in vitro. Results: Data pertaining to the present investigation clearly revealed that the percentage of mortality was maximum in(72 hr 58% hexane extract of A. vulgaris, chloroform extract (72 hr 34% of S. indicus, and ethyl acetate extract (72 hr 52% of T. purpurea. Repellant activities of plant extracts were tested against T. castaneum, repellent activity was maximum in hexane extract of P. fuliflora, ( EPI value for P. fuliflora in 2.5% was – 0.11 and – 0.33 at 1hr and 6 hr respectively chloroform extract of T. purpurea (2.5% was -0.17 at 6 hr and ethyl acetate extract of S. indicus (2.5% was -0.65 at 6 hr against T. castaneum. Conclusions: The present work for botanical products to control the insect pest of stored grain Tribolium castaneum (Herbst.These results suggest the presence of actives toxic substances acting after consumption or topical application.

  16. Synergistic insecticidal and repellent effects of combined pyrethroid and repellent-impregnated bed nets using a novel long-lasting polymer-coating multi-layer technique.

    Science.gov (United States)

    Faulde, Michael K; Nehring, Oliver

    2012-08-01

    New and improved strategies for malaria control and prevention are urgently needed. As a contribution to an optimized personal protection strategy, a novel long-lasting insecticide and repellent-treated net (LLIRN) has been designed by binding combinations of permethrin plus N,N-diethyl-m-toluamide (DEET), or insect repellent 3535 (IR3535), and etofenprox plus DEET, onto fibres of bed net fabric employing a new multi-layer polymer-coating technique. Protective repellent efficacy, toxicological effectiveness and residual activity of 12 LLIRN types have been evaluated by laboratory testing against adult Aedes aegypti. The novel multi-layer LLIRN design allowed simultaneous embedding at concentrations up to 5,930 mg/m(2) for DEET, 3,408 mg/m(2) for IR3535, 2,296 mg/m(2) for permethrin and 2,349 mg/m(2) for etofenprox, respectively. IR3535 layers prevented co-binding of additional pyrethroid-containing polymer layers, thus making pyrethroids plus DEET LLIRNs an ideal combination. All LLIRNs revealed synergistic insecticidal effects which, when measured against concentration controls of the isolated compounds, were significant in all LLIRN types designed. DEET in DEET plus permethrin LLIRNs significantly (p time from 55 to 75 %, the corresponding 100 % kill time (p time of etofenprox from 42 to 50 % (p = 0.004), the 100 % kill time from 25 to 38 % (p biting protection, even at low concentrations. One hundred percent biting and probing protection of stored LLIRNs was preserved for 83 weeks with the 5,930 mg/m(2) DEET and 2,139 mg/m(2) etofenprox LLIRN, for 72 weeks with the 5,002 mg/m(2) DEET and 2,349 mg/m(2) etofenprox LLIRN, for 63 weeks with the 3,590 mg/m(2) DEET and 1,208 mg/m(2) permethrin LLRN, and for 61 weeks with the 4,711 mg/m(2) DEET and 702 mg/m(2) etofenprox LLIRN. Because 100 % bite protection with up to 75 % quicker contact toxicity of pyrethroids were documented, synergistic toxicological and repellent effects of multi-layer polymer

  17. Identification of Repellent and Insecticidal Constituents of the Essential Oil of Artemisia rupestris L. Aerial Parts against Liposcelis bostrychophila Badonnel

    Directory of Open Access Journals (Sweden)

    Zhi Long Liu

    2013-09-01

    Full Text Available The aim of this research was to determine the chemical composition and insecticidal and repellent activity of the essential oil of Artemisia rupestris L. aerial parts against the booklice Liposcelis bostrychophila Badonnel and isolation of insecticidal and repellent constituents from the essential oil. The essential oil of A. rupestris was obtained by hydrodistillation and analyzed by GC-MS. A total of 30 components of the essential oil of A. rupestris was identified and the principal compounds in the essential oil were α-terpinyl acetate (37.18%, spathulenol (10.65%, α-terpineol (10.09%, and linalool (7.56%, followed by 4-terpineol (3.92% and patchoulol (3.05%. Based on bioactivity-guided fractionation, the four active constituents were isolated from the essential oil and identified as α-terpineol, α-terpinyl acetate, 4-terpineol and linalool. The essential oil of A. rupestris exhibited contact toxicity against L. bostrychophila with LD50 value of 414.48 µg/cm2. α-Terpinyl acetate (LD50 = 92.59 µg/cm2 exhibited stronger contact toxicity against booklice than α-terpineol (LD50 = 140.30 µg/cm2, 4-terpineol (LD50 = 211.35 µg/cm2, and linalool (LD50 = 393.16 µg/cm2. The essential oil of A. rupestris (LC50 = 6.67 mg/L air also possessed fumigant toxicity against L. bostrychophila while the four constituents, 4-terpineol, α-terpineol, α-terpinyl acetate and linalool had LC50 values of 0.34, 1.12, 1.26 and 1.96 mg/L air, respectively. α-Terpinol and α-terpinyl acetate showed strong repellency against L. bostrychophila, while linalool and 4-terpinol exhibited weak repellency. The results indicate that the essential oil of A. rupestris aerial parts and its constituent compounds have potential for development into natural insecticides or fumigants as well as repellents for control of insects in stored grains.

  18. GC×GC-TOFMS Analysis of Essential Oils Composition from Leaves, Twigs and Seeds of Cinnamomum camphora L. Presl and Their Insecticidal and Repellent Activities.

    Science.gov (United States)

    Jiang, Hao; Wang, Jin; Song, Li; Cao, Xianshuang; Yao, Xi; Tang, Feng; Yue, Yongde

    2016-03-28

    Interest in essential oils with pesticidal activity against insects and pests is growing. In this study, essential oils from different parts (leaves, twigs and seeds) of Cinnamomum camphora L. Presl were investigated for their chemical composition, and insecticidal and repellent activities against the cotton aphid. The essential oils, obtained by hydrodistillation, were analyzed by GC×GC-TOFMS. A total of 96 components were identified in the essential oils and the main constituents found in the leaves and twigs were camphor, eucalyptol, linalool and 3,7-dimethyl-1,3,7-octatriene. The major components found in the seeds were eucalyptol (20.90%), methyleugenol (19.98%), linalool (14.66%) and camphor (5.5%). In the contact toxicity assay, the three essential oils of leaves, twigs and seeds exhibited a strong insecticidal activity against cotton aphids with LC50 values of 245.79, 274.99 and 146.78 mg/L (after 48 h of treatment), respectively. In the repellent assay, the highest repellent rate (89.86%) was found in the seed essential oil at the concentration of 20 μL/mL after 24 h of treatment. Linalool was found to be a significant contributor to the insecticidal and repellent activities. The results indicate that the essential oils of C. camphora might have the potential to be developed into a natural insecticide or repellent for controlling cotton aphids.

  19. Evaluation of the repellent and insecticidal activities of the leaf, stem ...

    African Journals Online (AJOL)

    Adults of C. maculatus were exposed to grains treated separately with the root, stem and leaf powders of C. odorata at different exposure periods of 12, 24, 36, and 48 hours. All the three plant parts significantly repelled C. maculatus with the root powder showing the highest percentage repellency, although this was a ...

  20. POSSIBILITIES TO USE NATURAL EXTRACTS FROM MEDICINAL AND AROMATIC PLANTS (MAP LIKE BOTANICAL REPELLENT OR INSECTICIDE COMPOUNDS AGAINST PEST INSECTS IN ECOLOGICAL CROPS (II

    Directory of Open Access Journals (Sweden)

    Irina IONESCU-MĂLĂNCUŞ

    2013-12-01

    Full Text Available Botanical insecticides have long been touted as attractive alternatives to synthetic chemical insecticides for pest management because botanicals reputedly pose little threat to the environment or to human health. The body of scientific literature documenting bioactivity of plant derivatives to arthropods pests continues to expand i.e. repellents based on essential oils extracted from Chenopodium ambrosioides, Eucalyptus saligna, Rosmarinus officinalis to mosquitoes, or cinnamon oil, sandalwood oil and turmeric oil are previously reported as insect repellents evaluatede in the laboratory conditions. With the constantly increasing problems of insecticide resistance and increasing public concerns regarding pesticide safety, new, safer active ingredients are becoming necessary to replace existing compounds on the market. The present study carried out in the period 2010-2012 comprises a review of two insect repellents, followed by some new research conducted in our laboratory on plant-derived insect repellents. The two alkaloids tested against the Colorado potato beetle, Leptinotarsa decemlineata Say in laboratory conditions was obtained by water and alchohol extraction from two vegetal species, Cichorium intybus L. (Asterales:Asteraceae and Delphinium consolida L. (Ranales:Ranunculaceae. The tests carried out in laboratory and field experimentally plots under cages permit to evaluate several other compounds for repellent activity of lacctucin alkaloids.

  1. Insecticidal and insect-repellent activities of essential oils from Verbenaceae and Anacardiaceae against Rhizopertha dominica.

    Science.gov (United States)

    Benzi, Verónica S; Murrayb, Ana P; Ferrero, Adriana A

    2009-09-01

    Essential oils extracted from leaves of Aloysia polystachya and A. citriodora (Verbenaceae) and from leaves and fruits of Schinus molle var. areira (Anacardiaceae) were tested for their repellent and toxic activities against adults of Rhizopertha dominica (Coleoptera: Bostrichidae). Topical application and filter paper assays were employed for contact toxicity studies; filter paper impregnation was also used for fumigant and repellent assays. In topical tests A. polystachya was as effective as S. molle leaves. In the case of repellent assays, A. citriodora was the most effective oil based on the class scale. A. polystachya was the most toxic plant on contact toxicity by filter paper assay (LC50 26.6 mg/cm2). Fumigant toxicity was only evaluated with fruits and leaves of S. molle, and no significant differences were found between them. Published data are included to compare the fumigant toxicity of S. molle with that of A. citridora and A. polystachya.

  2. Chemical composition, insecticidal and insect repellent activity of Schinus molle L. leaf and fruit essential oils against Trogoderma granarium and Tribolium castaneum.

    Science.gov (United States)

    Abdel-Sattar, Essam; Zaitoun, Ahmed A; Farag, Mohamed A; Gayed, Sabah H El; Harraz, Fathalla M H

    2010-02-01

    Fruit and leaf essential oils of Schinus molle showed insect repellent and insecticidal activity against Trogoderma granarium and Tribolium castaneum. In these oils, 65 components were identified by GC-MS analysis. Hydrocarbons dominated the oil composition with monoterpenes occurring in the largest amounts in fruits and leaves, 80.43 and 74.84%, respectively. p-Cymene was identified as a major component in both oils. The high yield and efficacy of S. molle essential oil against T. granarium and T. castaneum suggest that it may provide leads for active insecticidal agents.

  3. Repellent Effect and Insecticidal Activities of Bridelia ferruginea, Blighia sapida, and Khaya senegalensis Leaves Powders and Extracts against Dinoderus porcellus in Infested Dried Yam Chips

    Directory of Open Access Journals (Sweden)

    Laura Yêyinou Loko

    2017-01-01

    Full Text Available Dinoderus porcellus is considered as the most important pest of stored yam chips and compounds extracted from plants can be used for its control. The present study aimed to test the insecticidal and repellent activities of powders and extracts of leaves of Bridelia ferruginea, Blighia sapida, and Khaya senegalensis against D. porcellus. The efficacy of plant powders was compared with the synthetic pesticide Antouka (Permethrin 3 g/kg + pirimiphos 16 g/kg. The results of the experiment revealed that all plant powders were effective as repellents. Antouka was more effective as insecticidal than the plant powders and minimal weight loss was observed with B. sapida at 2%. Among treatments, propanol extract of K. senegalensis at 5% was found to elicit the highest repellent effect on D. porcellus. The LC50 results revealed that the acetone extract of K. senegalensis is the most toxic (0.29 μL/insect to the pest, while the propanol extract of B. ferruginea at 5% exhibited strong fumigant toxicity against D. porcellus, with 88.89% of pest mortality at 160 μL/L air. The findings from the current work proved that plant powders and extracts of the three plants are sources of botanical insecticides which may be used in the integrated management of D. porcellus.

  4. Relative Insecticidal Efficacy of Three Spatial Repellent Integrated Light Sources Against Aedes aegypti.

    Science.gov (United States)

    Shen, Yuan; Xue, Rui-De; Bibbs, Christopher S

    2017-12-01

    Three repellent products, OFF! Mosquito Lamp, Insecticandel, and Rescue DecoShield, were comparatively evaluated against Aedes aegypti in 130-m 2 enclosed areas with a 317-m 3 air volume. The results showed that the OFF! Mosquito Lamp with metofluthrin had a greater effect than the Insecticandel with transfluthrin, which had greater effect than the DecoShield with lemongrass oil and several other plant oils against Ae. aegypti. The OFF! Mosquito Lamp was the only product to exceed 50% mortality. An outdoor semi-field evaluation was conducted to determine the effect by distance of the product. Mosquitoes were stationed in cages at 3, 6, 9, 12, and 15 m away from the treatment in a downwind linear array and exposed for 10 min. They were recorded for knockdown after treatment and at 24 h for mortality. The OFF! Mosquito Lamp produced 100% mortality indoors and >80% knockdown and 90% mortality within 6 m while outdoors against Ae. aegypti.

  5. Insecticidal, acaricidal and repellent effects of DEET- and IR3535-impregnated bed nets using a novel long-lasting polymer-coating technique.

    Science.gov (United States)

    Faulde, Michael K; Albiez, Gunther; Nehring, Oliver

    2010-03-01

    A novel long-lasting repellent-treated net (LLRTN) has been designed by binding the skin repellents N,N-diethyl-m-toluamide (DEET), or IR3535, onto the fibres of bed net fabric using a new polymer-coating technique. The repellent toxicological effectiveness and residual activity of a factory-based repellent-impregnated fabric has been evaluated by laboratory testing against adult Aedes aegypti mosquitoes and nymphal Ixodes ricinus ticks. By using this repellent-embedding impregnation technique, concentrations exceeding 10 g/m(2) could be achieved with one single polymer layer. Both DEET- and IR3535-impregnated fabrics revealed a dose-dependent insecticidal as well as acaricidal activity. One hundred percent knockdown times of DEET-treated bed nets ranged from 187.5 +/- 31.8 to 27.5 +/- 3.5 min against A. aegypti, and between 214 +/- 47 and 22.6 +/- 5 min against nymphal I. ricinus, linked to a DEET concentration of 1.08 and 10.58 g/m(2), respectively. With IR3535, A. aegypti produced dose-dependent 100% knockdown times varying from 87.5 +/- 10.6 to 57.5 +/- 3.5 min and between 131.4 +/- 6.5 and 33.8 +/- 5 min against nymphal I. ricinus, respectively, linked to concentrations between 1.59 and 10.02 g/m(2). One hundred percent repellency measured by complete landing and biting protection of impregnated fabric by using the arm-in-cage test could be achieved at DEET concentrations exceeding 3.7 to 3.9 g/m(2), and for IR3535 concentrations over 10 g/m(2). One hundred percent landing and biting protection could be preserved with DEET-treated fabrics for 29 weeks at an initial concentration of 4.66 g/m(2), 54 weeks at 8.8 g/m(2), 58 weeks at 9.96 g/m(2) and 61 weeks at 10.48 g/m(2) for DEET, and 23 weeks for IR3535-treated fabric at a concentration of 10.02 g/m(2). Unlike repellent-treated fabric, a brand of a commercially available long-lasting insecticide-treated net tested containing 500 mg permethrin/m(2) did not protect from mosquito bites. First results on

  6. Repellent and insecticidal efficacy of a new combination of fipronil and permethrin against the main vector of canine leishmaniosis in Europe (Phlebotomus perniciosus).

    Science.gov (United States)

    Dumont, Pascal; Fankhauser, Becky; Bouhsira, Emilie; Lienard, Emmanuel; Jacquiet, Philippe; Beugnet, Frederic; Franc, Michel

    2015-01-27

    Two successive laboratory experiments (A and B) were conducted to confirm the efficacy of a new fipronil and permethrin combination to repel and kill Phlebotomus perniciosus sandflies when applied once topically on dogs. Due to the difficulty to get enough available dogs and sandflies in one run, the study was divided into 2 experiments which had exactly the same design, and were conducted at the same place, with the same technicians. They compared dogs treated with a combination containing 67.6 mg/mL fipronil + 504.8 mg/mL permethrin (Frontect/Frontline Tri-Act, Merial) to untreated dogs. The treatments were applied topically once on Day 0. Sandfly exposures were performed on Days 1, 7, 14, 21 and 29 with 80 P. perniciosus female sandflies. After 60 min, sandflies were assessed for vitality and engorgement status. Live sandflies were kept in an insectary and observed for mortality counts 4 h after the exposure period ended. Percent sandfly repellency on treated dogs was 98.2, 98.5, 99.2, 90.9 and 90.3%, for Days 1, 7, 14, 21, and 29, respectively. There was a significant difference (p ≤ 0.05) between the treated and control groups in both experiments and for the pooled data on every assessment day. Insecticidal efficacy on treated dogs at 4 h post-exposure on Days 1, 7, 14, 21 and 29 was 98.7, 99.7, 96.8, 93.4, and 78.9%, respectively. There was a significant difference between the treated and control groups for live sandflies observed at 4 h post-exposure for all assessment days (p  80%) against P. perniciosus which lasted for 29 days after application. The repellent effect was accompanied by a significant insecticidal effect on sandflies. The results suggest that in endemic areas, the application of the fipronil-permethrin combination could be integrated into canine leishmaniosis prevention program.

  7. Repellent and insecticidal efficacy of a combination of dinotefuran, pyriproxyfen and permethrin (Vectra® 3D against Culex pipiens in dogs

    Directory of Open Access Journals (Sweden)

    Emilie Bouhsira

    2016-09-01

    Compared to control dogs, the spot-on formulation provided a repellent efficacy (anti-feeding effect against mosquitoes of 98.9%, 98.8%, 98.6%, 96.7% and 97.9% on Days 1, 7, 14, 21 and 28 respectively. There was a significant difference (p ≤ 0.05 between the treated and controlled groups on every assessment day. The insecticidal efficacy on treated dogs at 90 min was 34.7%, 50.3%, 39.7%, 22.8% and 11.4% on Days 1, 7, 14, 21 and 28 respectively. There was a significant difference between the treated and controlled groups for live mosquitoes for all assessment days (p 96% against Culex pipiens which lasted for 28 days. The results suggest that the Vectra® 3D spot-on solution could be used as an effective mosquito control strategy in dogs and is therefore recommended for use in a dirofilariosis prevention programme.

  8. Repellent effectiveness of seven plant essential oils, sunflower oil and natural insecticides against horn flies on pastured dairy cows and heifers.

    Science.gov (United States)

    Lachance, S; Grange, G

    2014-06-01

    Plant essential oils (basil, geranium, balsam fir, lavender, lemongrass, peppermint, pine and tea tree), mixed with either sunflower oil or ethyl alcohol, were applied at 5% concentrations to the sides of Holstein cattle. Pastured cattle treated with essential oils diluted in sunflower oil had less flies than the untreated control for a 24-h period. However, the essential oil treatments were not significantly different than the carrier oil alone. Barn-held heifers treated with essential oils and sunflower oil alone had significantly less flies than the untreated control for up to 8 h after treatment. Basil, geranium, lavender, lemongrass and peppermint repelled more flies than sunflower oil alone for a period ranging from 1.5 to 4 h after treatments applied to heifers. All essential oils repelled > 75% of the flies on the treated area for 6 and 8 h on pastured cows and indoor heifers, respectively. Geranium, lemongrass and peppermint stayed effective for a longer duration. Essential oils mixed with ethyl alcohol demonstrated less repellence than when mixed with the carrier oil. Safer's soap, natural pyrethrins without piperonyl butoxide and ethyl alcohol alone were not efficient at repelling flies. Essential oils could be formulated for use as fly repellents in livestock production. © 2013 The Royal Entomological Society.

  9. Repelling mosquitoes with essential oils

    Science.gov (United States)

    Riley, L.

    2017-12-01

    Mosquitoes carry diseases than can lead to serious illness and death. According to the World Health Organization, mosquitoes infect over 300 million people a year with Malaria and Dengue Fever, two life threatening diseases vectored by mosquitoes. Although insecticides are the most effective way to control mosquitoes, they are not always environmentally friendly. Therefore, alternative tactics should be considered. In this study, we looked at the repellency of various essential oils on female Aedes aegypti through a series of laboratory assays.

  10. Mosquito repellency of novel Trifluoromethylphenyl amides

    Science.gov (United States)

    Human diseases caused by mosquito-transmitted pathogens include malaria, dengue and yellow fever and are responsible for several million human deaths every year, according to the World Health Organization (WHO). Our current research projects focus on the development of new insecticides and repellent...

  11. Insecticidal, repellent, antimicrobial activity and phytotoxicity of essential oils: With special reference to limonene and its suitability for control of insect pests

    Directory of Open Access Journals (Sweden)

    M.A. IBRAHIM

    2008-12-01

    Full Text Available The interest in the use of monoterpenes for insect pest and pathogen control originates from the need for pesticide products with less negative environmental and health impacts than highly effective synthetic pesticides. The expanding literature on the possibility of the use of these monoterpenes is reviewed and focused on the effects of limonene on various bioorganisms. Limonene is used as insecticide to control ectoparasites of pet animals, but it has activity against many insects, mites, and microorganisms. Possible attractive effects of limonene to natural enemies of pests may offer novel applications to use natural compounds for manipulation of beneficial animals in organic agriculture. However, in few cases limonene-treated plants have become attractive to plant damaging insects and phytotoxic effects on cultivated plants have been observed. As a plant-based natural product limonene and other monoterpenes might have use in pest and weed control in organic agriculture after phytotoxicity on crop plants and, effects on non-target soil animals and natural enemies of pest have been investigated

  12. Mixture for Controlling Insecticide-Resistant Malaria Vectors

    OpenAIRE

    Pennetier, Cédric; Costantini, Carlo; Corbel, Vincent; Licciardi, Séverine; Dabire, R. K.; Lapied, B.; Chandre, Fabrice; Hougard, Jean-Marc

    2008-01-01

    The spread of resistance to pyrethroids in the major Afrotropical malaria vectors Anopheles gambiae s.s. necessitates the development of new strategies to control resistant mosquito populations. To test the efficacy of nets treated with repellent and insecticide against susceptible and insecticide-resistant An. gambiae mosquito populations, we impregnated mosquito bed nets with an insect repellent mixed with a low dose of organophosphorous insecticide and tested them in a rice-growing area ne...

  13. Trifluoromethylphenyl amides as novel insecticides and fungicides

    Science.gov (United States)

    Because of increased resistance to insecticides in arthropods, it is necessary to identify new chemicals that may have novel modes of action. Following an extensive literature search for compounds with insecticidal and mosquito repellent activity, we have designed and synthesized a set of 20 trifluo...

  14. Water repellents and water-repellent preservatives for wood

    Science.gov (United States)

    R. Sam. Williams; William C. Feist

    1999-01-01

    Water repellents and water-repellent preservatives increase the durability of wood by enabling the wood to repel liquid water. This report focuses on water-repellent finishes for wood exposed outdoors above ground. The report includes a discussion of the effects of outdoor exposure on wood, the characteristics of water repellent and water-repellent preservative...

  15. [Study on essential oils of medicinal plants in insect repellent].

    Science.gov (United States)

    Zhao, Hong-Zheng; Luo, Jiao-Yang; Liu, Qiu-Tao; Lv, Ze-Liang; Yang, Shi-Hai; Yang, Mei-Hua

    2016-01-01

    Mosquitoes are seriously harmful to human health for transmitting some mortal diseases. Among the methods of mosquito control, synthetical insecticides are the most popular. However, as a result of longterm use of these insecticides, high resistant mosquitos and heavy environmental pollution appear. Thus, eco-friendly prevention measures are taken into the agenda. Essential oils extracted from medicinal plants have repellent and smoked killing effects on mosquitoes. With abundant medical plants resources and low toxicity, they have the potential of being developed as a new type of mosquito and insect repellent agent. The recent application advances of essential oils of medicinal plants in insect repellent and its application limitations are overviewed. This review will provide references for the future development and in-depth study of essential oils. Copyright© by the Chinese Pharmaceutical Association.

  16. Field evaluation of picaridin repellents reveals differences in repellent sensitivity between Southeast Asian vectors of malaria and arboviruses.

    Directory of Open Access Journals (Sweden)

    Karel Van Roey

    2014-12-01

    Full Text Available Scaling up of insecticide treated nets has contributed to a substantial malaria decline. However, some malaria vectors, and most arbovirus vectors, bite outdoors and in the early evening. Therefore, topically applied insect repellents may provide crucial additional protection against mosquito-borne pathogens. Among topical repellents, DEET is the most commonly used, followed by others such as picaridin. The protective efficacy of two formulated picaridin repellents against mosquito bites, including arbovirus and malaria vectors, was evaluated in a field study in Cambodia. Over a period of two years, human landing collections were performed on repellent treated persons, with rotation to account for the effect of collection place, time and individual collector. Based on a total of 4996 mosquitoes collected on negative control persons, the overall five hour protection rate was 97.4% [95%CI: 97.1-97.8%], not decreasing over time. Picaridin 20% performed equally well as DEET 20% and better than picaridin 10%. Repellents performed better against Mansonia and Culex spp. as compared to aedines and anophelines. A lower performance was observed against Aedes albopictus as compared to Aedes aegypti, and against Anopheles barbirostris as compared to several vector species. Parity rates were higher in vectors collected on repellent treated person as compared to control persons. As such, field evaluation shows that repellents can provide additional personal protection against early and outdoor biting malaria and arbovirus vectors, with excellent protection up to five hours after application. The heterogeneity in repellent sensitivity between mosquito genera and vector species could however impact the efficacy of repellents in public health programs. Considering its excellent performance and potential to protect against early and outdoor biting vectors, as well as its higher acceptability as compared to DEET, picaridin is an appropriate product to evaluate the

  17. Field evaluation of picaridin repellents reveals differences in repellent sensitivity between Southeast Asian vectors of malaria and arboviruses.

    Science.gov (United States)

    Van Roey, Karel; Sokny, Mao; Denis, Leen; Van den Broeck, Nick; Heng, Somony; Siv, Sovannaroth; Sluydts, Vincent; Sochantha, Tho; Coosemans, Marc; Durnez, Lies

    2014-12-01

    Scaling up of insecticide treated nets has contributed to a substantial malaria decline. However, some malaria vectors, and most arbovirus vectors, bite outdoors and in the early evening. Therefore, topically applied insect repellents may provide crucial additional protection against mosquito-borne pathogens. Among topical repellents, DEET is the most commonly used, followed by others such as picaridin. The protective efficacy of two formulated picaridin repellents against mosquito bites, including arbovirus and malaria vectors, was evaluated in a field study in Cambodia. Over a period of two years, human landing collections were performed on repellent treated persons, with rotation to account for the effect of collection place, time and individual collector. Based on a total of 4996 mosquitoes collected on negative control persons, the overall five hour protection rate was 97.4% [95%CI: 97.1-97.8%], not decreasing over time. Picaridin 20% performed equally well as DEET 20% and better than picaridin 10%. Repellents performed better against Mansonia and Culex spp. as compared to aedines and anophelines. A lower performance was observed against Aedes albopictus as compared to Aedes aegypti, and against Anopheles barbirostris as compared to several vector species. Parity rates were higher in vectors collected on repellent treated person as compared to control persons. As such, field evaluation shows that repellents can provide additional personal protection against early and outdoor biting malaria and arbovirus vectors, with excellent protection up to five hours after application. The heterogeneity in repellent sensitivity between mosquito genera and vector species could however impact the efficacy of repellents in public health programs. Considering its excellent performance and potential to protect against early and outdoor biting vectors, as well as its higher acceptability as compared to DEET, picaridin is an appropriate product to evaluate the epidemiological

  18. Repellents and New “Spaces of Concern” in Global Health

    Science.gov (United States)

    Kelly, Ann H.; Koudakossi, Hermione N. Boko; Moore, Sarah J.

    2017-01-01

    ABSTRACT Today, malaria prevention hinges upon two domestic interventions: insecticide-treated bed nets and indoor residual spraying. As mosquitoes grow resistant to these tools, however, novel approaches to vector control have become a priority area of malaria research and development. Spatial repellency, a volumetric mode of action that seeks to reduce disease transmission by creating an atmosphere inimical to mosquitoes, represents one way forward. Drawing from research that sought to develop new repellent chemicals in conversation with users from sub-Saharan Africa and the United States, we consider the implications of a non-insecticidal paradigm of vector control for how we understand the political ecology of malaria. PMID:28594568

  19. A Fat strange Repeller

    Institute of Scientific and Technical Information of China (English)

    申影; 何阅; 姜玉梅; 何大韧

    2004-01-01

    This article reports an observation on a fat strange repeller, which appears after a characteristic crisis observed in a kicked rotor subjected to a piecewise continuous force field. The discontinuity border in the definition range of the two-dimensional mapping, which describes the system, oscillates as the discrete time develops. At a threshold of a control parameter a fat chaotic attractor suddenly transfers to a fat transient set. The strange repeller, which appears after the crisis, is also a fat fractal. This is the reason why super-transience happens

  20. Chemical and Plant-Based Insect Repellents: Efficacy, Safety, and Toxicity.

    Science.gov (United States)

    Diaz, James H

    2016-03-01

    Most emerging infectious diseases today are arthropod-borne and cannot be prevented by vaccinations. Because insect repellents offer important topical barriers of personal protection from arthropod-borne infectious diseases, the main objectives of this article were to describe the growing threats to public health from emerging arthropod-borne infectious diseases, to define the differences between insect repellents and insecticides, and to compare the efficacies and toxicities of chemical and plant-derived insect repellents. Internet search engines were queried with key words to identify scientific articles on the efficacy, safety, and toxicity of chemical and plant-derived topical insect repellants and insecticides to meet these objectives. Data sources reviewed included case reports; case series; observational, longitudinal, and surveillance studies; and entomological and toxicological studies. Descriptive analysis of the data sources identified the most effective application of insect repellents as a combination of topical chemical repellents, either N-diethyl-3-methylbenzamide (formerly N, N-diethyl-m-toluamide, or DEET) or picaridin, and permethrin-impregnated or other pyrethroid-impregnated clothing over topically treated skin. The insecticide-treated clothing would provide contact-level insecticidal effects and provide better, longer lasting protection against malaria-transmitting mosquitoes and ticks than topical DEET or picaridin alone. In special cases, where environmental exposures to disease-transmitting ticks, biting midges, sandflies, or blackflies are anticipated, topical insect repellents containing IR3535, picaridin, or oil of lemon eucalyptus (p-menthane-3, 8-diol or PMD) would offer better topical protection than topical DEET alone. Copyright © 2016 Wilderness Medical Society. Published by Elsevier Inc. All rights reserved.

  1. Factors influencing the use of topical repellents: implications for the effectiveness of malaria elimination strategies

    NARCIS (Netherlands)

    Gryseels, C.; Uk, S.; Sluydts, V.; Durnez, L.; Phoeuk, P.; Suon, S.; Set, S.; Heng, S.; Siv, S.; Gerrets, R.; Tho, S.; Coosemans, M.; Peeters Grietens, K.

    2015-01-01

    In Cambodia, despite an impressive decline in prevalence over the last 10 years, malaria is still a public health problem in some parts of the country. This is partly due to vectors that bite early and outdoors reducing the effectiveness of measures such as Long-Lasting Insecticidal Nets. Repellents

  2. Field evaluation of the Off! Clip-on Mosquito Repellent (metofluthrin) against Aedes albopictus and Aedes taeniorhynchus (Diptera: Culicidae) in northeastern Florida.

    Science.gov (United States)

    Xue, Rui-De; Qualls, Whitney A; Smith, Michael L; Gaines, Marcia K; Weaver, James H; Debboun, Mustapha

    2012-05-01

    Repellent efficacy of the Off! Clip-on Mosquito Repellent device (S. C. Johnson and Son, Inc., Racine, WI) containing Metofluthrin was evaluated on six human volunteers against the container-breeding mosquito Aedes albopictus (Skuse) and the salt marsh mosquito Aedes taeniorhynchus (Wiedemann) at two field locations in northeastern Florida. The device repelled mosquitoes by releasing a vaporized form of the pyrethroid insecticide metofluthrin ([AI] 31.2%) and provided 70% protection from Ae. albopictus bites for > 3 h. For the second field trial, a repellent device that was used in the first trial was tested after being open for >1 wk. This device provided 79% protection from Ae. taeniorhynchus bites for 3 h. Our field results showed that the repellent device was 70 and 79% effective at repelling Ae. albopictus and Ae. taeniorhynchus from human test subjects in both field locations in northeastern Florida.

  3. Sharks senses and shark repellents.

    Science.gov (United States)

    Hart, Nathan S; Collin, Shaun P

    2015-01-01

    Despite over 70 years of research on shark repellents, few practical and reliable solutions to prevent shark attacks on humans or reduce shark bycatch and depredation in commercial fisheries have been developed. In large part, this deficiency stems from a lack of fundamental knowledge of the sensory cues that drive predatory behavior in sharks. However, the widespread use of shark repellents is also hampered by the physical constraints and technical or logistical difficulties of deploying substances or devices in an open-water marine environment to prevent an unpredictable interaction with a complex animal. Here, we summarize the key attributes of the various sensory systems of sharks and highlight residual knowledge gaps that are relevant to the development of effective shark repellents. We also review the most recent advances in shark repellent technology within the broader historical context of research on shark repellents and shark sensory systems. We conclude with suggestions for future research that may enhance the efficacy of shark repellent devices, in particular, the continued need for basic research on shark sensory biology and the use of a multi-sensory approach when developing or deploying shark repellent technology. © 2014 International Society of Zoological Sciences, Institute of Zoology/Chinese Academy of Sciences and Wiley Publishing Asia Pty Ltd.

  4. ethnobotany of plants used as insecticides, repellents and anti

    African Journals Online (AJOL)

    ADMIN

    elimination of physical, mental and/or social imbalance ... other problem associated with the use of DDT is its ... cope with these kinds of problems alternative ways .... Papaya. T. 20. S. Abortion. Dodonea angustifolia L. Sapindaceae. Kitikta. Sh.

  5. Insecticidal, Repellent and Fungicidal Properties of Novel Trifluoromethylphenyl Amides

    Science.gov (United States)

    2013-01-01

    inhibition even at the higher concentration of 30.0 lM. Captan is an excellent fungicide with a multisite mode of action that is ap- plied to crops such as...trifluoroacetamide (1c) was most active (24 h LD50 19.182 nM, 0.5 lL/insect). However, the 24 h LC50 and LD50 values of fipronil against Ae. aegypti...adults with 24 h LC50 values of 5.6 and 4.9 lg/cm2 for the Oregon- R and 1675 strains, respectively. Fipronil had LC50 values of 0.004 and 0.017 lg/cm2

  6. Insect Repellents: Reducing Insect Bites

    Science.gov (United States)

    ... Borne Illnesses Federal Trade Commission Action on Deceptive Marketing of Mosquito Repellent Wrist Band Joint Statement on ... Requests Frequent Questions Follow. Facebook Twitter YouTube Flickr Instagram Last updated on May 29, 2018

  7. Can topical insect repellents reduce malaria? A cluster-randomised controlled trial of the insect repellent N,N-diethyl-m-toluamide (DEET in Lao PDR.

    Directory of Open Access Journals (Sweden)

    Vanessa Chen-Hussey

    Full Text Available BACKGROUND: Mosquito vectors of malaria in Southeast Asia readily feed outdoors making malaria control through indoor insecticides such as long-lasting insecticidal nets (LLINs and indoor residual spraying more difficult. Topical insect repellents may be able to protect users from outdoor biting, thereby providing additional protection above the current best practice of LLINs. METHODS AND FINDINGS: A double blind, household randomised, placebo-controlled trial of insect repellent to reduce malaria was carried out in southern Lao PDR to determine whether the use of repellent and long-lasting insecticidal nets (LLINs could reduce malaria more than LLINs alone. A total of 1,597 households, including 7,979 participants, were recruited in June 2009 and April 2010. Equal group allocation, stratified by village, was used to randomise 795 households to a 15% DEET lotion and the remainder were given a placebo lotion. Participants, field staff and data analysts were blinded to the group assignment until data analysis had been completed. All households received new LLINs. Participants were asked to apply their lotion to exposed skin every evening and sleep under the LLINs each night. Plasmodium falciparum and P. vivax cases were actively identified by monthly rapid diagnostic tests. Intention to treat analysis found no effect from the use of repellent on malaria incidence (hazard ratio: 1.00, 95% CI: 0.99-1.01, p = 0.868. A higher socio-economic score was found to significantly decrease malaria risk (hazard ratio: 0.72, 95% CI: 0.58-0.90, p = 0.004. Women were also found to have a reduced risk of infection (hazard ratio: 0.59, 95% CI: 0.37-0.92, p = 0.020. According to protocol analysis which excluded participants using the lotions less than 90% of the time found similar results with no effect from the use of repellent. CONCLUSIONS: This randomised controlled trial suggests that topical repellents are not a suitable intervention in addition to

  8. Irritant and repellent responses of Anopheles harrisoni and Anopheles minimus upon exposure to bifenthrin or deltamethrin using an excito-repellency system and a live host.

    Science.gov (United States)

    Kongmee, Monthathip; Boonyuan, Wasana; Achee, Nicole L; Prabaripai, Atchariya; Lerdthusnee, Kriangkrai; Chareonviriyaphap, Theeraphap

    2012-03-01

    Feeding responses of Anopheles harrisoni and An. minimus were evaluated following exposure to 2 pyrethroid insecticides, bifenthrin or deltamethrin, using an excito-repellency test system in the presence and absence of live host cues. The results demonstrated that contact irritancy was the primary action of bifenthrin or deltamethrin in both mosquito species. There was no noncontact repellency effect elicited by either insecticide. Anopheles minimus showed rapid escape response with high mortality rates following direct contact with deltamethrin in the absence of a host and delayed escape responses when a host was present. Similarly, exposure of An. minimus to bifenthrin also elicited a delayed escape response in the presence of a host but with lower mortality rates. In experiments using An. harrisoni, the presence or absence of a host had no significant effect on behavioral responses to either insecticide (P > 0.05). We conclude that deltamethrin elicited stronger irritant chemical effects than bifenthrin but that behavioral responses in vector populations are dampened in the presence of an available host. This information is useful for estimating probability of pathogen transmission when using irritant chemicals in proximity to a blood-meal source.

  9. The potentiality of botanicals and their products as an alternative to chemical insecticides to sandflies (Diptera: Psychodidae): a review.

    Science.gov (United States)

    Dinesh, Diwakar Singh; Kumari, Seema; Kumar, Vijay; Das, Pradeep

    2014-03-01

    Use of chemical pesticides is the current method for controlling sandflies. However, resistance is being developed in sandflies against the insecticide of choice that is DDT (dichlorodiphenyl trichloroethane). Botanicals have potential to act as an alternative to chemical insecticides as the crude extracts and active molecules of some plants show insecticidal effect to sandflies. This will lead to safe, easy and environment friendly method for control of sandflies. Therefore, information regarding botanicals acting as alternative to chemical insecticide against sandflies assumes importance in the context of development of resistance to insecticides as well as to prevent environment from contamination. This review deals with some plants and their products having repellent and insecticidal effect to sandflies in India and abroad. Different methods of extraction and their bioassay on sandflies have been emphasized in the text. Various extracts of some plants like Ricinus communis (Euphorbiaceae), Solanum jasminoides (Solanaceae), Bougainvillea glabra (Nyctaginaceae), Capparis spinosa (Capparidaceae), Acalypha fruticosa (Euphorbiaceae) and Tagetes minuta (Asteraceae) had shown repellent/insecticidal effect on sandflies. This review will be useful in conducting the research work to find out botanicals of Indian context having insecticidal effect on sandflies.

  10. Contact and Repellent Activities of the Essential Oil from Juniperus formosana against Two Stored Product Insects

    Directory of Open Access Journals (Sweden)

    Shanshan Guo

    2016-04-01

    Full Text Available The chemical composition of the essential oil from Juniperus formosana leaves and its contact and repellent activities against Tribolium castaneum and Liposcelis bostrychophila adults were investigated. The essential oil of J. formosana leaves was obtained by hydrodistillation and analyzed by GC-MS. A total of 28 components were identified and the main compounds in the essential oil were α-pinene (21.66%, 4-terpineol (11.25%, limonene (11.00% and β-phellandrene (6.63%. The constituents α-pinene, 4-terpineol and d-limonene were isolated from the essential oil. It was found that the essential oil exhibited contact activity against T. castaneum and L. bostrychophila adults (LD50 = 29.14 μg/adult and 81.50 µg/cm2, respectively. The compound 4-terpineol exhibited the strongest contact activity (LD50 = 7.65 μg/adult. In addition, data showed that at 78.63 nL/cm2, the essential oil and the three isolated compounds strongly repelled T. castaneum adults. The compounds α-pinene and d-limonene reached the same level (Class V of repellency as DEET (p = 0.396 and 0.664 against L. bostrychophila at 63.17 nL/cm2 after 2 h treatment. The results indicate that the essential oil and the isolated compounds have potential to be developed into natural insecticides and repellents to control insects in stored products.

  11. Insecticide solvents: interference with insecticidal action.

    Science.gov (United States)

    Brattsten, L B; Wilkinson, C F

    1977-06-10

    Several commercial solvent mixtures commonly used as insecticide carriers in spray formulations increase by more than threefold the microsomal N-demethylation of p-chloro N-methylaniline in midgut preparations of southern army-worm (Spodoptera eridania) larvae exposed orally to the test solvents. Under laboratory conditions, the same solvent mixtures exhibit a protective action against the in vivo toxicity of the insecticide carbaryl to the larvae. The data are discussed with respect to possible solvent-insecticide interactions occurring under field conditions and, more broadly, to potential toxicological hazards of these solvents to humans.

  12. Evidence for inhibition of cholinesterases in insect and mammalian nervous systems by the insect repellent deet

    Directory of Open Access Journals (Sweden)

    Dimitrov Mitko

    2009-08-01

    Full Text Available Abstract Background N,N-Diethyl-3-methylbenzamide (deet remains the gold standard for insect repellents. About 200 million people use it every year and over 8 billion doses have been applied over the past 50 years. Despite the widespread and increased interest in the use of deet in public health programmes, controversies remain concerning both the identification of its target sites at the olfactory system and its mechanism of toxicity in insects, mammals and humans. Here, we investigated the molecular target site for deet and the consequences of its interactions with carbamate insecticides on the cholinergic system. Results By using toxicological, biochemical and electrophysiological techniques, we show that deet is not simply a behaviour-modifying chemical but that it also inhibits cholinesterase activity, in both insect and mammalian neuronal preparations. Deet is commonly used in combination with insecticides and we show that deet has the capacity to strengthen the toxicity of carbamates, a class of insecticides known to block acetylcholinesterase. Conclusion These findings question the safety of deet, particularly in combination with other chemicals, and they highlight the importance of a multidisciplinary approach to the development of safer insect repellents for use in public health.

  13. SHORT COMMUNICATION Repellency property of long chain ...

    African Journals Online (AJOL)

    Repellency property of long chain aliphatic methyl ketones against Anopheles gambiae s.s ... tained from huge diversity of plant species are an important source of safe .... dry and then introduced with the hand covered by a glove in .... citronellal in repelling bees from basil (Oci- ... Journal of American Mosquito Control As-.

  14. Cosmicflows-3: Cold Spot Repeller?

    Energy Technology Data Exchange (ETDEWEB)

    Courtois, Hélène M.; Graziani, Romain; Dupuy, Alexandra [University of Lyon, UCB Lyon 1, CNRS/IN2P3, IPN, Lyon (France); Tully, R. Brent [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States); Hoffman, Yehuda [Racah Institute of Physics, Hebrew University, Jerusalem, 91904 (Israel); Pomarède, Daniel [Institut de Recherche sur les Lois Fondamentales de l’Univers, CEA, Université Paris-Saclay, F-91191 Gif-sur-Yvette (France)

    2017-09-20

    The three-dimensional gravitational velocity field within z ∼ 0.1 has been modeled with the Wiener filter methodology applied to the Cosmicflows-3 compilation of galaxy distances. The dominant features are a basin of attraction and two basins of repulsion. The major basin of attraction is an extension of the Shapley concentration of galaxies. One basin of repulsion, the Dipole Repeller, is located near the anti-apex of the cosmic microwave background dipole. The other basin of repulsion is in the proximate direction toward the “Cold Spot” irregularity in the cosmic microwave background. It has been speculated that a vast void might contribute to the amplitude of the Cold Spot from the integrated Sachs–Wolfe effect.

  15. Phenological stage effect on phenolic composition and repellent potential of Mentha pulegium against Tribolium castaneum and Lasioderma serricorne

    Directory of Open Access Journals (Sweden)

    Nidhal Salem

    2018-01-01

    Full Text Available Objective: To elucidate for the first time the phenological stage effect on polyphenol, flavonoid and proanthocyanidin contents of pennyroyal (Mentha pulegium as well as their antioxidant capacities and insecticidal potentials against Tribolium castaneum and Lasioderma serricorne. Methods: Crude methanol extracts from pennyroyal (Mentha pulegium aerial parts were evaluated for their antiradical, reducing power activities and repellent potentials against selected coleopteran insects during different phenological stages. Results: Phenolic contents of pennyroyal aerial parts and their antioxidant effects were significantly dependent on maturity stage of the plant. The maximum of phenol production was reached during the full flowering stage. Apigenin was the major phenol in Mentha pulegium with an amount of 6.01 mg/g of dry vegetable matter during this period. Nevertheless, at fructification stage, the highest antioxidant activity was not related to high phenolic content. The repulsive effect of pennyroyal extract showed that Lasioderma serricorne was more susceptible to pennyroyal extract than Tribolium castaneum with corresponding median repellent dose values of 0.124 and 0.006 mg/mL respectively. Moreover, great differences in insect repulsion depending on extract concentrations, exposure time and developmental stage was observed. For the lowest concentration (0.125 mg/mL, the repellent effect against Tribolium reached its maximum (90% during the fructification stage (after 24 h of exposure while this repellent effect was 80% during the vegetative stage. Conclusions: Due to the strong insecticidal potential of pennyroyal extracts, this study highlights the therapeutic properties of this plant and encourages its use as a safer, environmental-friendly and efficient insecticide in food industry.

  16. Assessment of Adiantum incisum, Alternanthera pungens and Trichodesma indicum as bio-insecticides against stored grain pests

    International Nuclear Information System (INIS)

    Safdar, N.; Yasmin, A.

    2017-01-01

    This study investigated the insecticidal potential of Adiantum incisum Forssk (Pteridaceae), Alternanthera pungens Kunth (Amaranthaceae) and Trichodesma indicum L. (Boraginaceae). Aqueous, methanolic and n-hexane extracts of whole plants (roots, stem and leaves) were prepared using maceration technique. Insecticidal activities of aqueous, methanolic and n-hexane extracts of three plants (10, 20 and 30 mg/mL) were evaluated by impregnated filter paper insecticidal assay. Methanol and hexane extracts of Adiantum incisum gave effective LD 50 (15.3 mg/mL) against Callosobruchus chinensis and Sitophilus oryzae (LD5022 mg/mL) after 24 hours respectively. Present research elucidates the important phytochemicals (alkaloids, saponins and tannins) in three plants by FTIR and good insecticidal activity (LD50 < 25 mg/mL in 24 hours) against Callosobruchus chinensis and Sitophilus oryzae. Current study promotes further investigations for using these plant extracts as anti-feedants, repellents, fumigants and formulation of non-toxic bio-insecticides. (author)

  17. Using Insect Repellents Safely and Effectively

    Science.gov (United States)

    ... Directory Planning, Budget and Results Jobs and Internships Headquarters Offices Regional Offices Labs and Research Centers Related ... repellent product label. This registration number means the company provided EPA with technical information on the effectiveness ...

  18. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2002-01-01

    Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...

  19. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2001-01-01

    Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...

  20. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2003-01-01

    Behavioral, neurochemical, and immunocytochemical studies are characterizing the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and/or permethrin (PM...

  1. 3 Insecticide Use Practice

    African Journals Online (AJOL)

    Administrator

    500,000 metric tonnes in the 1964/1965 season. Problems ... insecticides on the open market. ... effective in the management of insect pests of cocoa. .... Effectiveness and profitability of pest ... Youth in Agriculture; Programme Policy, Strategy.

  2. Insecticides and Biological Control

    Science.gov (United States)

    Furness, G. O.

    1972-01-01

    Use of insecticides has been questioned due to their harmful effects on edible items. Biological control of insects along with other effective practices for checking spread of parasites on crops are discussed. (PS)

  3. Insect Repellents: Protect Your Child from Insect Bites

    Science.gov (United States)

    ... Español Text Size Email Print Share Choosing an Insect Repellent for Your Child Page Content Mosquitoes, biting ... sunscreen needs to be reapplied often. Reactions to Insect Repellents If you suspect that your child is ...

  4. Pest repelling properties of ant pheromones

    DEFF Research Database (Denmark)

    Offenberg, Joachim

    2014-01-01

    Ants control pests via predation and physical deterrence; however, ant communication is based on chemical cues which may serve as warning signals to potential prey and other intruders. The presence of ant pheromones may, thus, be sufficient to repel pests from ant territories. This mini-review sh......-review shows that four out of five tested ant species deposit pheromones that repel herbivorous prey from their host plants.......Ants control pests via predation and physical deterrence; however, ant communication is based on chemical cues which may serve as warning signals to potential prey and other intruders. The presence of ant pheromones may, thus, be sufficient to repel pests from ant territories. This mini...

  5. Attracting and repelling in homogeneous signal processes

    International Nuclear Information System (INIS)

    Downarowicz, T; Grzegorek, P; Lacroix, Y

    2010-01-01

    Attracting and repelling are discussed on two levels: in abstract signal processes and in signal processes arising as returns to a fixed set in an ergodic dynamical system. In the first approach, among other things, we give three examples in which the sum of two Poisson (hence neutral—neither attracting nor repelling) processes comes out either neutral or attracting, or repelling, depending on how the two processes depend on each other. The main new result of the second type concerns so-called 'composite events' in the form of a union of all cylinders over blocks belonging to the δ-ball in the Hamming distance around a fixed block. We prove that in a typical ergodic nonperiodic process the majority of such 'composite events' reveal strong attracting. We discuss the practical interpretation of this result

  6. Moisture variability resulting from water repellency in Dutch soils

    NARCIS (Netherlands)

    Dekker, L.W.

    1998-01-01

    The present study suggests that many soils in the Netherlands, in natural as well as in agricultural areas, may be water repellent to some degree, challenging the common perception that soil water repellency is only an interesting aberration. When dry, water repellent soils resist or retard

  7. Mosquito repellent activity of piper guineense and xylopia ...

    African Journals Online (AJOL)

    The activity of eucalyptus oil (positive control), a commercial repellent, at 30% was only able to protect for 2h. Both oils used could be applied as repellents where protection from mosquito bite is sought for, over a short period of time. Keywords: Piper guineense, Xylopia aethiopica, volatile oils, Aedes aegypti, repellency

  8. Water repellent soils: a state-of-the-art

    Science.gov (United States)

    Leonard F. DeBano

    1981-01-01

    Water repellency in soils was first described by Schreiner and Shorey (1910), who found that some soils in California could not be wetted and thereby were not suitable for agriculture. Waxy organic substances were responsible for the water repellency. Other studies in the early 1900's on the fairy ring phenomenon suggested that water repellency could be caused by...

  9. Ceramic coatings for water-repellent textiles

    Science.gov (United States)

    Colleoni, C.; Esposito, F.; Guido, E.; Migani, V.; Trovato, V.; Rosace, G.

    2017-10-01

    In recent years, ceramic coatings have been widely studied for their potential performance in many scientific and technological fields. Ceramic coatings are also used as a textile-finishing agent to impart several properties such as anti-bacterial, anti-abrasion, flame retardant. In this study, fluoro free water repellent finishings have been developed to assess the features of the silica films on the textile fabrics. The water repellency of the treated samples has been evaluated by different tests such as water contact angle, water uptake and drop test.

  10. Field assessment of a novel spatial repellent for malaria control: a feasibility and acceptability study in Mondulkiri, Cambodia.

    Science.gov (United States)

    Liverani, Marco; Charlwood, Jacques Derek; Lawford, Harriet; Yeung, Shunmay

    2017-10-13

    Large-scale use of insecticide-treated nets and indoor residual spraying have contributed to a significant decrease in malaria transmission worldwide. Further reduction and progress towards elimination, however, require complementary control measures which can address the remaining gaps in protection from mosquito bites. Following the development of novel pyrethroids with high knockdown effects on malaria vectors, programmatic use of spatial repellents has been suggested as one potential strategy to fill the gaps. This report explores social and contextual factors that may influence the relevance, uptake and sustainable use of a spatial repellent in two remote villages in Mondulkiri province, Cambodia, with endemic malaria transmission. The repellent consisted of polyethylene emanators, held in an open plastic frame and impregnated with 10% metofluthrin. In a baseline survey, 90.9% of households in Ou Chra (n = 30/33) and 96.6% in Pu Cha (n = 57/59) were interviewed. Behavioural data were collected for all household occupants (n = 448). In both villages, there were times and places in which people remained exposed to mosquito bites. Prior to the installation of the repellent, 50.6 and 59.5% of respondents noted that bites occurred "very often" inside the house and in the outdoor area surrounding the house, respectively. Indoor biting was reported to occur more frequently in the evening, followed by at night, while outdoor biting occurred more frequently in the early morning. In a follow-up survey, spatial repellents were well received in both villages, although 63.2% of respondents would not replace bed nets with repellents. Most participants (96.6%) were willing to use the product again; the mean willingness to pay was US$ 0.3 per unit. A preference for local procurement methods emerged. Widespread use of spatial repellents would not fill all protective gaps, but, if their entomological efficacy can be ascertained, outdoor application has the potential to

  11. Low hybrid onion seed yields relate to honey bee visits and insecticide use

    Directory of Open Access Journals (Sweden)

    Rachael Long

    2011-07-01

    Full Text Available Onion thrips, previously considered of minor importance to hybrid onion seed production in California, vector the newly introduced iris yellow spot virus, a serious pathogen of onions that can cause significant yield losses. Insecticide use to control onion thrips has increased in onion seed fields, coincident with a steep decrease in yields, especially in Colusa County. We examined a number of possible contributing factors and found a strong positive correlation between honey bee activity and onion seed set, indicating that a lack of pollination may be contributing to the reduced yields. In addition, honey bee visits to onion flowers were negatively correlated with the number of insecticides applied per field and field size. Reduced onion seed yields in recent years could be associated with the increase in insecticide use, which may be repelling or killing honey bees, important pollinators of this crop.

  12. Botanical Insecticides in Plant Protection

    OpenAIRE

    Grdiša, Martina; Gršić, Kristina

    2013-01-01

    Botanical insecticides are natural compounds with insecticidal properties and their use in crop protection is as old as agricultural practice. Although they have been in use for over one hundred years, the advent of synthetic insecticides has unfortunately displaced their use today. Due to fast action, low cost, easy application and efficiency against a wide range of harmful species, synthetic insecticides have become an important part of pest management in modern agricultural systems....

  13. Protection Ability Comparison of Several Mosquito Repellent Lotion Incorporated with Essential Oils of Mosquito Repellent Plants

    Directory of Open Access Journals (Sweden)

    Pramono Putro Utomo

    2014-12-01

    Full Text Available Most mosquito repellent lotions available on the market today contain the active ingredient diethyltoluamide (DEET which is very harmful to the skin. Natural mosquito repellent research using various essential oils (geranium oil, lemon oil, citronella oil and lavender oil as the active ingredient and the addition of aloe vera gel as a moisturizer has been done on a laboratory scale. The purpose of this study was to compare the protection ability of the mosquito repellent plants in Indonesia. The results showed that geranium oil, lemongrass oil, lavender oil and lemon oil could act as mosquito repellent. Best lotion formula all containing 15% essential oils have the effectiveness above 50% until the sixth hour were geranium oil, citronella oil and lavender oil while lemon oil only giving effectiveness above 50% until the second hour.

  14. Analysing the Repellents Using EDXRF Method

    International Nuclear Information System (INIS)

    Khin Mi Mi; Khin Yi; Sein Htoon

    2004-05-01

    Determination of elemental contents in neem oil was evaluated using EDXRF.The comparsion on elemental concentrations of mosquito repellents cream, lotion and neem oil had been made. Where the neem oil was applied to the exposed body, it was found that the neem oil gives the protection action from the bites of mosquitoes

  15. experimental investigation of flow pattern around repelling

    African Journals Online (AJOL)

    A. Mahdieh NajafAbadi and M. M. Bateni

    2017-09-01

    Sep 1, 2017 ... FLOW-3D® software used to simulate flow pattern. The simulation was .... separated into separation zone, shear layer, vortices zone, end point of vorticity zone and primary flow zone. In the figure, b1 and b2 denote ... closer to the wall for the attractive spur dike. For case of the repelling spur dike, transverse.

  16. Effectiveness of Gel Repellents on Feral Pigeons

    Directory of Open Access Journals (Sweden)

    Birte Stock

    2013-12-01

    Full Text Available Millions of feral pigeons (Columba livia live in close association with the human population in our cities. They pose serious health risks to humans and lead to high economic loss due to damage caused to buildings. Consequently, house owners and city authorities are not willing to allow pigeons on their buildings. While various avian repellents are regularly introduced onto the market, scientific proof of efficacy is lacking. This study aimed at testing the effectiveness of two avian gel repellents and additionally examined their application from animal welfare standpoint. The gels used an alleged tactile or visual aversion of the birds, reinforced by additional sensory cues. We mounted experimental shelves with the installed repellents in a pigeon loft and observed the behavior of free-living feral pigeons towards the systems. Both gels showed a restricted, transient repellent effect, but failed to prove the claimed complete effectiveness. Additionally, the gels’ adhesive effect remains doubtful in view of animal welfare because gluing of plumage presents a risk to feral pigeons and also to other non-target birds. This study infers that both gels lack the promised complete efficacy, conflict with animal welfare concerns and are therefore not suitable for feral pigeon management in urban areas.

  17. (snail repellent paint) on land snails

    African Journals Online (AJOL)

    STORAGESEVER

    2009-10-19

    Oct 19, 2009 ... the above treatments has shown that repellent band and methaldehyde with 5 ± 1.3 and 10.6 ± 0.9 percentage ..... does not readily dissolve in water, which minimizes its dispersal ... limpets and macroalgae, J. Exp. Mar. Biol.

  18. Anticholinesterase insecticide retrospective.

    Science.gov (United States)

    Casida, John E; Durkin, Kathleen A

    2013-03-25

    The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down

  19. The mode of action of spatial repellents and their impact on vectorial capacity of Anopheles gambiae sensu stricto.

    Directory of Open Access Journals (Sweden)

    Sheila B Ogoma

    Full Text Available Malaria vector control relies on toxicity of insecticides used in long lasting insecticide treated nets and indoor residual spraying. This is despite evidence that sub-lethal insecticides reduce human-vector contact and malaria transmission. The impact of sub-lethal insecticides on host seeking and blood feeding of mosquitoes was measured. Taxis boxes distinguished between repellency and attraction inhibition of mosquitoes by measuring response of mosquitoes towards or away from Transfluthrin coils and humans. Protective effective distance of coils and long-term effects on blood feeding were measured in the semi-field tunnel and in a Peet Grady chamber. Laboratory reared pyrethroid susceptible Anopheles gambiae sensu stricto mosquitoes were used. In the taxis boxes, a higher proportion of mosquitoes (67%-82% were activated and flew towards the human in the presence of Transfluthrin coils. Coils did not hinder attraction of mosquitoes to the human. In the semi-field Tunnel, coils placed 0.3 m from the human reduced feeding by 86% (95% CI [0.66; 0.95] when used as a "bubble" compared to 65% (95% CI [0.51; 0.76] when used as a "point source". Mosquitoes exposed to coils inside a Peet Grady chamber were delayed from feeding normally for 12 hours but there was no effect on free flying and caged mosquitoes exposed in the semi-field tunnel. These findings indicate that airborne pyrethroids minimize human-vector contact through reduced and delayed blood feeding. This information is useful for the development of target product profiles of spatial repellent products that can be used to complement mainstream malaria vector control tools.

  20. The mode of action of spatial repellents and their impact on vectorial capacity of Anopheles gambiae sensu stricto.

    Science.gov (United States)

    Ogoma, Sheila B; Ngonyani, Hassan; Simfukwe, Emmanuel T; Mseka, Antony; Moore, Jason; Maia, Marta F; Moore, Sarah J; Lorenz, Lena M

    2014-01-01

    Malaria vector control relies on toxicity of insecticides used in long lasting insecticide treated nets and indoor residual spraying. This is despite evidence that sub-lethal insecticides reduce human-vector contact and malaria transmission. The impact of sub-lethal insecticides on host seeking and blood feeding of mosquitoes was measured. Taxis boxes distinguished between repellency and attraction inhibition of mosquitoes by measuring response of mosquitoes towards or away from Transfluthrin coils and humans. Protective effective distance of coils and long-term effects on blood feeding were measured in the semi-field tunnel and in a Peet Grady chamber. Laboratory reared pyrethroid susceptible Anopheles gambiae sensu stricto mosquitoes were used. In the taxis boxes, a higher proportion of mosquitoes (67%-82%) were activated and flew towards the human in the presence of Transfluthrin coils. Coils did not hinder attraction of mosquitoes to the human. In the semi-field Tunnel, coils placed 0.3 m from the human reduced feeding by 86% (95% CI [0.66; 0.95]) when used as a "bubble" compared to 65% (95% CI [0.51; 0.76]) when used as a "point source". Mosquitoes exposed to coils inside a Peet Grady chamber were delayed from feeding normally for 12 hours but there was no effect on free flying and caged mosquitoes exposed in the semi-field tunnel. These findings indicate that airborne pyrethroids minimize human-vector contact through reduced and delayed blood feeding. This information is useful for the development of target product profiles of spatial repellent products that can be used to complement mainstream malaria vector control tools.

  1. The Effect of Early Mosquito Insecticides Exposure on Spraque Dawley Rat Testis: A Histopathological Feature Towards Malignancy?

    Science.gov (United States)

    Indah Winarni, Tri; Auzan Aziman, Milzam; Abshar Andar, Anindyo; Pawitra, Ika

    2017-02-01

    The incidence of health problems associated with endocrine-disruption have increased. Many studies suggesting that endocrine disruptor chemicals (EDC) do contribute to cancer through estrogen-related receptors. Many chemicals have EDCs properties including insecticides. Early life exposure to EDCs can increased the risk of testicular cancer have been reported in the last decade. This study was aimed to determine the effect of insecticides exposure on histopathological tumor cell development of germ and Leydig cell. True experiment research design with posttest only control group design was applied. Sprague Dawley (SD) rat (n = 25) were randomly divided into 5 groups (control group, 25 mg β estradiol 3-benzoate, spiral mosquito coil repellent, 3 ml of liquid mosquito repellent, and 4 ml of liquid mosquito repellent). The exposure were administered for 20 days started at aged 3 days. At the age of 100 days (older adult), testis was stained using Hematoxyllin Eosin (HE) and histological features predicting malignancy were observed. The number of tumor cell development in both testicular germ cells and Leydig cells significantly increased in all treated group compared to those of control and the changes towards malignancy were also observed in all treated group. Exposure to mosquito insecticides causes significant changes in testicular germ and Leydig cell histological features that leads to malignancy.

  2. Limitation of using synthetic human odours to test mosquito repellents

    Directory of Open Access Journals (Sweden)

    Mbeyela Edgar

    2009-07-01

    Full Text Available Abstract Background Gold-standard tests of mosquito repellents involve exposing human volunteers to host-seeking mosquitoes, to assess the protective efficacy of the repellents. These techniques are not exposure-free and cannot be performed prior to toxicological evaluation. It is postulated that synthetic lures could provide a useful assay that mimics in-vivo conditions for use in high-throughput screening for mosquito repellents. Methods This paper reports on a semi-field evaluation of repellents using a synthetic blend of human derived attractants for the malaria vector, Anopheles gambiae sensu stricto Different concentrations of known repellents, N, N diethyl-3-methylbenzamide (deet and Para-methane-3, 8, diol (PMD were added into traps baited with the synthetic blend, and resulting changes in mosquito catches were measured. Results All test concentrations of deet (0.001% to 100% reduced the attractiveness of the synthetic blend. However, PMD was repellent only at 0.25%. Above this concentration, it significantly increased the attractiveness of the blend. There was no relationship between the repellent concentrations and the change in mosquito catches when either deet (r2 = 0.033, P = 0.302 or PMD (r2 = 0.020, P = 0.578 was used. Conclusion It is concluded that while some repellents may reduce the attractiveness of synthetic human odours, others may instead increase their attractiveness. Such inconsistencies indicate that even though the synthetic attractants may provide exposure-free and consistent test media for repellents, careful selection and multiple-repellent tests are necessary to ascertain their suitability for use in repellent screening. The synthetic odour blend tested here is not yet sufficiently refined to serve as replacement for humans in repellent testing, but may be developed further and evaluated in different formats for exposure free repellent testing purposes.

  3. Repellency and toxicity of aromatic plant extracts against the mosquito Culex pipiens molestus (Diptera: Culicidae).

    Science.gov (United States)

    Traboulsi, Abdallah F; El-Haj, Samih; Tueni, Marie; Taoubi, Khalil; Nader, Natalie Abi; Mrad, Abir

    2005-06-01

    The insecticidal activities of essential oil extracts from leaves, flowers and roots of aromatic plants against fourth-instar larvae of the mosquito Culex pipiens molestus Forskal were determined. Extracts of Foeniculum vulgare Mill were the most toxic, followed by those of Ferula hermonis Boiss, Citrus sinensis Osbeck, Pinus pinea L, Laurus nobilis L and Eucalyptus spp with LC50 values of 24.5, 44.0, 60.0, 75.0, 117.0 and 120.0 mg litre(-1), respectively. Combination tests between the LC50 and the maximum sub-lethal concentration (MSLC) were determined. Over 20 major components were identified in extracts from each plant species tested. Five essential oils and nine pure components were studied for their repellency against mosquito bites. Terpineol and 1,8-cineole were the most effective against Culex pipiens molestus bites offering complete protection for 1.6 and 2 h, respectively.

  4. Repellency of 29 Synthetic and Natural Commercial Topical Insect Repellents Against Aedes aegypti (Diptera: Culicidae) in Central Mexico.

    Science.gov (United States)

    Kuri-Morales, Pablo A; Correa-Morales, Fabián; González-Acosta, Cassandra; Sánchez-Tejeda, Gustavo; Moreno-Garcia, Miguel; Dávalos-Becerril, Eduardo; Juárez-Franco, Marissa F; Benitez-Alva, José Ismael; González-Roldán, Jesús F

    2017-09-01

    In Mexico, the use of repellents to prevent insects from landing and biting is a common practice. However, variation in the efficiency of natural and synthetic repellents has been observed. In this study, we evaluated the repellency and protection time of 16 synthetic and 13 natural-based commercial products against Aedes aegypti (L.) from an endemic dengue area (Jojutla, Morelos) in Central Mexico. The "arm exposure" cage test was used to assess the efficacy of the repellents. Tests were conducted by three adult volunteers. Results showed that DEET (N, N-Diethyl-3-methylbenzamide) repellents provided the highest protection and duration times against Ae. aegypti. However, low repellency and short-time protection was observed (when compared with the manufacturers' protection times). Natural-based products did not repel (either landing or biting) mosquitoes for >30 min. These results show that most of the repellent products did not provide satisfactory levels of personal protection against mosquito bites. Frequent reapplication of repellents (synthetic and natural-based) may compensate for their short duration of action. Repellent efficacy data must be integrated into the decision-making process for an optimal response to the local (or specific region) situation. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Evaporation and skin penetration characteristics of mosquito repellent formulations

    International Nuclear Information System (INIS)

    Reifenrath, W.G.; Hawkins, G.S.; Kurtz, M.S.

    1989-01-01

    Formulations of the mosquito repellent N,N-diethyl-3-methylbenzamide (deet) in combination with a variety of additives were developed to control repellent evaporation and percutaneous penetration. Deet was also formulated with the repellent dimethyl phthalate to study the interaction of the two compounds on the skin. The evaporation and penetration processes were evaluated on whole and split-thickness pig skin using radiolabeled repellents with an in vitro apparatus. Under essentially still air and air flow conditions, one of the deet formulations resulted in significantly reduced total evaporation and percutaneous penetration of deet as compared to unformulated repellent. When deet and dimethyl phthalate were combined, neither repellent affected the total amount of evaporation and penetration of the other compound. However, initial percutaneous penetration and evaporation rates were slightly less and decayed less rapidly than when both chemicals were tested separately at the same dose. These results indicated a degree of competition of the two compounds for the same avenues of loss

  6. Nootkatone is a repellent for Formosan subterranean termite (Coptotermes formosanus).

    Science.gov (United States)

    Zhu, B C; Henderson, G; Chen, F; Maistrello, L; Laine, R A

    2001-03-01

    We examined the behavior of Formosan subterranean termites toward one of the components of vetiver grass oil, the roots of which manufacture insect repellents. We found nootkatone, a sesquiterpene ketone, isolated from vetiver oil is a strong repellent and toxicant to Formosan subterranean termites. The lowest effective concentration tested was 10 micrograms/g substrate. This is the first report of nootkatone being a repellent to insects.

  7. Soil water repellency at old crude oil spill sites

    International Nuclear Information System (INIS)

    Roy, J.L.

    1999-08-01

    This thesis presents the current state of knowledge regarding the cause of soil water repellency and characterizes disaggregated nonwettable surface soils found at old crude oil spill sites. Pollution-induced water repellency generally develops following prolonged exposures of soil to liquid- or vapour-phase petroleum hydrocarbons. The condition varies significantly in terms of severity and persistence. Soil water repellency retards plant growth and disturbs the hydrological balance of ecosystems. Disaggregated water-repellent soils are also very susceptible to dispersal by erosion, posing a threat to the productivity of surrounding soils. The author described the probable causes of soil water repellency under the following three main themes: (1) accumulation of hydrophobic organic material in soil, (2) redistribution and re-organisation of this material in soil, and (3) stabilisation of the hydrophobic organic material. This final process is necessary to ensure persistence of induced water repellency symptoms. Petroleum residues as water-repellent substances in weathered nonwettable oil-contaminated soils were also discussed and a hypothesis about soil water repellency was presented which deals with flexible conformation in organic matter coatings. Processes leading to the development of soil water repellency following crude oil contamination were also described. It was determined that soil water repellency is a function of the packing density and the chain conformation of amphiphilic organic molecules in the outermost layer of soil organic matter coatings. This research suggests that the fractional coverage of alkyl chains on soil particle surfaces determines the degree of water repellency that is displayed by soil. It was shown that prompt remediation of some oil-contaminated plots can effectively prevent the development of soil water repellency. 4 refs., 32 tabs., 22 figs., 5 appendices

  8. Protection of Grain Products from Sitophilus oryzae (L.) Contamination by Anti-Insect Pest Repellent Sachet Containing Allyl Mercaptan Microcapsule.

    Science.gov (United States)

    Chang, Yoonjee; Lee, Soo-Hyun; Na, Ja Hyun; Chang, Pahn-Shick; Han, Jaejoon

    2017-11-01

    The purpose of this study was to develop an anti-insect pest repellent sachet to prevent Sitophilus oryzae (L.) (Coleoptera: Curculionidae) contamination in grain packaging. The anti-insect pest activities of essential oils (EOs) from garlic (Allium Sativum), ginger (Zingiber Officinalis), black pepper (Piper nigrum), onion (Allium cepa), and fennel (Foeniculum vulgare) as well as major compounds (allyl disulfide, AD; allyl mercaptan, AM) isolated from of garlic and onion (AD and AM) were measured against S. oryzae. The results revealed that garlic EO, onion EO, AD, and AM showed strong fumigant insecticidal activities. Among these, AM showed the highest acetylcholinesterase (AChE) inhibition rate, indicating that the fumigation insecticidal efficacy of AM is related with its AChE inhibition ability. Subsequently, the microcapsules were produced with a high efficiency (80.02%) by using AM as a core material and rice flour as a wall material. Finally, sachet composed of rice flour microcapsule containing 2% AM (RAM) was produced. Repellent assay was performed to measure anti-insect pest ability of the RAM sachet, showed remarkable repelling effect within 48 h both in the presence or absence of attractant. In a release profile of RAM sachet, it was expected to last over 20 mo during the distribution period of brown rice. Moreover, RAM sachet showed no undesirable changes to the sensory properties of the rice both before and after cooking. Taken together, these results suggest that the newly developed RAM sachet could be used as a packaging material to protect grain products from S. oryzae contamination. The rice weevil, Sitophilus oryzae (L.) (Coleoptera: Curculionidae), causes damages to stored products and its contamination in grain products has become a major problem in cereal market. To preserve brown rice, an anti-insect pest repellent sachet containing 2% allyl mercaptan was newly developed and it showed remarkable repellent abilities against S. oryzae. It

  9. ORAL INSECT REPELLENTS - INSECT TASTE RECEPTORS AND THEIR ACTION,

    Science.gov (United States)

    CULICIDAE, * CHEMORECEPTORS ), INSECT REPELLENTS, ELECTROPHYSIOLOGY, STIMULATION(PHYSIOLOGY), ELECTROLYTES(PHYSIOLOGY), BLOOD, INGESTION(PHYSIOLOGY), REPRODUCTION(PHYSIOLOGY), NUTRITION, ENTOMOLOGY, AEDES, MOUTH

  10. A short history of insecticides

    Directory of Open Access Journals (Sweden)

    Oberemok Volodymyr Volodymyrovych

    2015-07-01

    Full Text Available This review contains a brief history of the use of insecticides. The peculiarities, main advantages, and disadvantages of some modern insecticides are described. The names of the discoverers of some of the most popular insecticide preparations on the world market, are listed. The tendencies to find new insecticides to control the quantity of phytophagous insects are discussed. Special attention is paid to the perspective of creating preparations based on nucleic acids, in particular DNA insecticides. The use of insect-specific, short single-stranded DNA fragments as DNA insecticides, is paving the way in the field of “intellectual” insecticides that “think” before they act. It is worth noting, though, that in the near future, the quantity of produced insecticides will increase due to the challenges associated with food production for a rapidly growing population. It is concluded, that an agreeable interaction of scientists and manufacturers of insecticides should lead to the selection of the most optimal solutions for insect pest control, which would be safe, affordable, and effective at the same time.

  11. Deltamethrin-resistant German Cockroaches Are Less Sensitive to the Insect Repellents DEET and IR3535 than Non-resistant Individuals.

    Science.gov (United States)

    Mengoni, Sofía L; Alzogaray, Raúl A

    2018-04-02

    The German cockroach, Blattella germanica (L.) (Blattodea: Blattellidae), is a serious worldwide pest with a considerable economical and sanitary impact. It is mainly controlled by the application of synthetic insecticides, but repeated use of these substances has promoted the appearance of resistance in cockroach populations throughout the world. The aim of this study was to compare the behavior of deltamethrin-susceptible (CIPEIN colony) and deltamethrin-resistant (JUBA and VGBA colonies) first instar nymphs exposed to the repellents N,N-diethyl-3-methylbenzamide (DEET) and ethyl 3-[acetyl(butyl)amino]propanoate (IR3535). Firstly, the behavior of the nymphs was assessed in an experimental arena in the absence of repellents. The parameters Distance Traveled, Velocity, Mobility Time, and Time Spent (in each half of the arena) were quantified using an image analyser, and showed that the behavior elicited by the three colonies was similar. After this, the behavior of the nymphs was quantified in an arena, half of which had been treated with repellent. The repellency of DEET increased as a linear function of log concentration for the three colonies. DEET elicited repellency as from a concentration of 97.49 µg/cm2 for the CIPEIN and JUBA colonies and 194.98 µg/cm2 for the VGBA colony. The repellency of IR3535 was weaker and started at a concentration of 389.96 µg/cm2 for the CIPEIN colony, 779.92 μg/cm2 for JUBA, and 1559.84 μg/cm2 for VGBA . Finally, nymphs were exposed to 3:1, 1:1, and 1:3 DEET:IR3535 mixtures, and a synergistic effect was observed only in the CIPEIN colony.

  12. Chemical Composition, Antifungal and Insecticidal Activities of Hedychium Essential Oils

    Directory of Open Access Journals (Sweden)

    Kanniah Rajasekaran

    2013-04-01

    Full Text Available The antimicrobial properties of essential oils have been documented, and their use as “biocides” is gaining popularity. The aims of this study were to analyze the chemical composition and assess the biological activities of Hedychium essential oils. Oils from 19 Hedychium species and cultivars were analyzed by gas chromatography (GC and gas chromatography-mass spectrometry (GC-MS techniques. The antifungal and insecticidal activities of these oils were tested against Colletotrichum acutatum, C. fragariae, and C. gloeosporioides, and three insects, the azalea lace bug (Stephanitis pyrioides, the yellow fever mosquito (Aedes aegypti, and the red imported fire ant (Solenopsis invicta. Hedychium oils were rich in monoterpenes and sesquiterpenes, especially 1,8-cineole (0.1%–42%, linalool (<0.1%–56%, a-pinene (3%–17%, b-pinene (4%–31%, and (E-nerolidol (0.1%–20%. Hedychium oils had no antifungal effect on C. gloeosporioides, C. fragariae, and C. acutatum, but most Hedychium oils effectively killed azalea lace bugs. The oils also show promise as an adult mosquito repellent, but they would make rather poor larvicides or adulticides for mosquito control. Hedychium oils acted either as a fire ant repellent or attractant, depending on plant genotype and oil concentration.

  13. Evaluating the efficacy of biological and conventional insecticides with the new 'MCD bottle' bioassay.

    Science.gov (United States)

    Sternberg, Eleanore D; Waite, Jessica L; Thomas, Matthew B

    2014-12-16

    Control of mosquitoes requires the ability to evaluate new insecticides and to monitor resistance to existing insecticides. Monitoring tools should be flexible and low cost so that they can be deployed in remote, resource poor areas. Ideally, a bioassay should be able to simulate transient contact between mosquitoes and insecticides, and it should allow for excito-repellency and avoidance behaviour in mosquitoes. Presented here is a new bioassay, which has been designed to meet these criteria. This bioassay was developed as part of the Mosquito Contamination Device (MCD) project and, therefore, is referred to as the MCD bottle bioassay. Presented here are two experiments that serve as a proof-of-concept for the MCD bottle bioassay. The experiments used four insecticide products, ranging from fast-acting, permethrin-treated, long-lasting insecticide nets (LLINs) that are already widely used for malaria vector control, to the slower acting entomopathogenic fungus, Beauveria bassiana, that is currently being evaluated as a prospective biological insecticide. The first experiment used the MCD bottle to test the effect of four different insecticides on Anopheles stephensi with a range of exposure times (1 minute, 3 minutes, 1 hour). The second experiment is a direct comparison of the MCD bottle and World Health Organization (WHO) cone bioassay that tests a subset of the insecticides (a piece of LLIN and a piece of netting coated with B. bassiana spores) and a further reduced exposure time (5 seconds) against both An. stephensi and Anopheles gambiae. Immediate knockdown and mortality after 24 hours were assessed using logistic regression and daily survival was assessed using Cox proportional hazards models. Across both experiments, fungus performed much more consistently than the chemical insecticides but measuring the effect of fungus required monitoring of mosquito mortality over several days to a week. Qualitatively, the MCD bottle and WHO cone performed comparably

  14. Review of insecticide resistance and behavioral avoidance of vectors of human diseases in Thailand

    Science.gov (United States)

    2013-01-01

    Physiological resistance and behavioral responses of mosquito vectors to insecticides are critical aspects of the chemical-based disease control equation. The complex interaction between lethal, sub-lethal and excitation/repellent ('excito-repellent’) properties of chemicals is typically overlooked in vector management and control programs. The development of “physiological” resistance, metabolic and/or target site modifications, to insecticides has been well documented in many insect groups and disease vectors around the world. In Thailand, resistance in many mosquito populations has developed to all three classes of insecticidal active ingredients currently used for vector control with a majority being synthetic-derived pyrethroids. Evidence of low-grade insecticide resistance requires immediate countermeasures to mitigate further intensification and spread of the genetic mechanisms responsible for resistance. This can take the form of rotation of a different class of chemical, addition of a synergist, mixtures of chemicals or concurrent mosaic application of different classes of chemicals. From the gathered evidence, the distribution and degree of physiological resistance has been restricted in specific areas of Thailand in spite of long-term use of chemicals to control insect pests and disease vectors throughout the country. Most surprisingly, there have been no reported cases of pyrethroid resistance in anopheline populations in the country from 2000 to 2011. The precise reasons for this are unclear but we assume that behavioral avoidance to insecticides may play a significant role in reducing the selection pressure and thus occurrence and spread of insecticide resistance. The review herein provides information regarding the status of physiological resistance and behavioral avoidance of the primary mosquito vectors of human diseases to insecticides in Thailand from 2000 to 2011. PMID:24294938

  15. The Effectiveness of Lemongrass, Garlic, and Tree Marigold as Botanical Insecticides in Controlling of Cocoa Mirid,Helopeltis antonii

    Directory of Open Access Journals (Sweden)

    Endang Sulistyowati

    2014-05-01

    ,3%. Based on no significantly different on the effect of time investation of H. antoniion their feeding activity and mortality, it can be concluded that the three botanical insecticides tested have a mode of action both as a repellent and contact poison. Key words: cocoa, Helopeltis antonii, botanical insecticide, lemongrass, garlic, marigold, teta-cypermethrin

  16. Insecticidal and repellent effect of extracts of Pluchea sericea (Nutt. on adults of Bemisia tabaci (Genn.

    Directory of Open Access Journals (Sweden)

    Carlos Enrique Ail-Catzim

    2015-01-01

    Full Text Available Para el control de Bemisia tabaci (Genn. en los cultivos agrícolas se usan repetidas aplicaciones de insecticidas, lo que ha provocado problemas de resistencia y contaminación ambiental. Los insumos provenientes de especies vegetales son una alternativa para reducir esta problemática. Las plantas son una fuente de químicos bioactivos, que pueden tener efecto insecticida, repelente, atrayente, antialimenticio o regulador de crecimiento. El objetivo fue determinar la actividad insecticida y repelente de extractos etanólicos, acetónicos y acuosos, tanto de hojas como de tallos de Pluchea sericea (Nutt. sobre Bemisia tabaci (Genn.. Se estimó la CL50 de cada uno de los extractos, mediante bioensayos con la técnica de película residual, sobre adultos de mosquita blanca. Además, se evaluó el efecto repelente a partir de la CL50 de cada extracto, se estimó el índice de repelencia (IR, si IR = 1 el efecto es neutro, IR 1, el efecto es atrayente. Los extractos de hoja-etanol, hoja-agua y hoja-acetona presentaron valores menores de CL50 700, 1,190 y 1,250 ppm respectivamente, lo que indica alta eficiencia sobre B. tabaci, seguidos del extracto tallo-agua, por último los extractos tallo-etanol y tallo-acetona presentaron menor efectividad. Todos los extractos tuvieron acción repelente, independientemente del disolvente y órgano de la planta a 24 y 48 h. Sin embargo, los extractos a base de agua podrían tener mayor potencial para el control de la mosquita blanca en sistemas de manejo integrado de plagas, debido a que presentaron efecto insecticida y repelente, además el disolvente es inocuo y de bajo costo.

  17. Investigating the repellency of trifluoromethylphenyl amides analogues against Aedes aegypti

    Science.gov (United States)

    The purpose of this study is to develop new repellents and evaluate their efficacy for personal protection against mosquitoes. The minimum effective dosage (MED) was determined to estimate the lowest passing concentration of a repellent that prevents >99% of mosquito bites through a treated cloth. D...

  18. Toxicity and repellency to rats of actidione

    Science.gov (United States)

    Traub, R.; DeWitt, J.B.; Welch, J.F.; Newman, D.

    1950-01-01

    The antibiotic actidione was found to be highly repellent to laboratory rats and to significantly reduce gnawing attacks upon treated paperboards. Rats refused to accept food or water containing this material even under conditions of acute starvation and died of starvation and thirst,rather than accept water containing l.0 mg. of actidione per liter. The compound is highly toxic to .rats with the minimum .lethal dose by oral administration being approximately l.0 mg./Kg body weight. Paperboard treated with the compound resisted gnawing attacks by specially trained and motivated rats for periods of two hundred hours, although similar .untreated boards were pierced within thirty-to sixty minutes.

  19. Pest repellent properties of ant pheromones

    DEFF Research Database (Denmark)

    Offenberg, Joachim

    2012-01-01

    of ant pheromones may be sufficient to repel pest insects from ant territories. The study of ant semiochemicals is in its infancy, yet, evidence for their potential use in pest management is starting to build up. Pheromones from four of five tested ant species have been shown to deter herbivorous insect...... prey and competing ant species are also deterred by ant deposits, whereas ant symbionts may be attracted to them. Based on these promising initial findings, it seems advisable to further elucidate the signaling properties of ant pheromones and to test and develop their use in future pest management....

  20. Biologically inspired hairy surfaces for liquid repellency

    Science.gov (United States)

    Hsu, Shu-Hau

    Owing to remarkable features, such as self-cleaning, anti-biofouling and drag reduction, interest on rendering surfaces water-repellent has significantly grown within this decade. Attempts on making surfaces "superhydrophobic", where high water contact angle (θc >150°) accompanied with only few degrees of roll-off angle, have been extensively demonstrated through the mimicking of the surface chemistry and morphology of lotus leaves. This appealing phenomenon also exists on another structure from nature: surfaces comprising soft hairs. Although the role of this piliferous integument has long been recognized for providing life, arthropods in particular, waterrepellency, the synthetic superhydrophobic surfaces based on this structure are still very limited. In this study, the goal was to develop a novel liquid-repellent surface by mimicking the hairy exterior of species. The artificial hairy surfaces were prepared by means of pressurized membrane casting, in which thermoplastic sheets were forced to flow into porous membranes at elevated temperature. The G-shaped pillars on the membrane cast polypropylene substrate are particularly similar to the conformation of natural hairs. The principle of this fabrication technique is relatively accessible and is expected to be compatible with large-area fabrication of superhydrophobic interfaces. The artificial hairy surface features perfectly hydrophobic response where no contact angle hysteresis was observed from video assessment. Thus the artificial hairy surface of the current work appears to be the first report to have such extreme hydrophobicity with only structural modification from the original substrate. This ultralow adhesion to water droplet is believed to be attributed to the hydrophobic methyl groups and the mechanical response of the artificial hairs. Liquid repellency of the hairy surfaces was further enhanced by coating with fluorocarbon (CF) layers via deep reactive ion etching (DRIE). The contact angle of

  1. Manufacturing and characterisation of water repellent surfaces

    DEFF Research Database (Denmark)

    De Grave, Arnaud; Botija, Pablo; Hansen, Hans Nørgaard

    2006-01-01

    design criteria for such surfaces. The problem of adapting this behaviour to artificially roughened surfaces is addressed by providing design criteria for superhydrophobic, water-repellent and self-cleaning surfaces according to the concrete performance desired for them. Different kind of manufacturing...... techniques are investigated and the production of patterned micro structured surfaces following two different manufacturing techniques is reported. The first is a combination of laser manufacturing and hot embossing on polystyrene. To compare geometry and functionality a non-silicon based lithography...

  2. Lethal and sub-lethal effects of select macrocyclic lactones insecticides on forager worker honey bees under laboratory experimental conditions.

    Science.gov (United States)

    Abdu-Allah, Gamal A M; Pittendrigh, Barry R

    2018-01-01

    Selective insecticide application is one important strategy for more precisely targeting harmful insects while avoiding or mitigating collateral damage to beneficial insects like honey bees. Recently, macrocyclic lactone-class insecticides have been introduced into the market place as selective bio-insecticides for controlling many arthropod pests, but how to target this selectivity only to harmful insects has yet to be achieved. In this study, the authors investigated the acute toxicity of fourmacrocyclic lactone insecticides (commercialized as abamectin, emamectin benzoate, spinetoram, and spinosad) both topically and through feeding studies with adult forager honey bees. Results indicated emamectin benzoate as topically 133.3, 750.0, and 38.3-fold and orally 3.3, 7.6, and 31.7-fold more toxic, respectively than abamectin, spinetoram and spinosad. Using Hazard Quotients for estimates of field toxicity, abamectin was measured as the safest insecticide both topically and orally for honey bees. Moreover, a significant reduction of sugar solution consumption by treatment group honey bees for orally applied emamectin benzoate and spinetoram suggests that these insecticides may have repellent properties.

  3. Water repellent soils: the case for unsaturated soil mechanics

    Directory of Open Access Journals (Sweden)

    Beckett Christopher

    2016-01-01

    Full Text Available Water repellent (or “hydrophobic” or “non-wetting” soils have been studied by soil scientists for well over a century. These soils are typified by poor water infiltration, which leads to increased soil erosion and poor crop growth. However, the importance of water repellence on determining soil properties is now becoming recognised by geotechnical engineers. Water repellent soils may, for example, offer novel solutions for the design of cover systems overlying municipal or mine waste storage facilities. However, investigations into factors affecting their mechanical properties have only recently been initiated. This purpose of this paper is to introduce geotechnical engineers to the concept of water repellent soils and to discuss how their properties can be evaluated under an unsaturated soils framework. Scenarios in which water repellent properties might be relevant in geotechnical applications are presented and methods to quantify these properties in the laboratory and in the field examined.

  4. Repellents inhibit P450 enzymes in Stegomyia (Aedes aegypti.

    Directory of Open Access Journals (Sweden)

    Gloria Isabel Jaramillo Ramirez

    Full Text Available The primary defence against mosquitoes and other disease vectors is often the application of a repellent. Despite their common use, the mechanism(s underlying the activity of repellents is not fully understood, with even the mode of action of DEET having been reported to be via different mechanisms; e.g. interference with olfactory receptor neurones or actively detected by olfactory receptor neurones on the antennae or maxillary palps. In this study, we discuss a novel mechanism for repellence, one of P450 inhibition. Thirteen essential oil extracts from Colombian plants were assayed for potency as P450 inhibitors, using a kinetic fluorometric assay, and for repellency using a modified World Health Organisation Pesticide Evaluations Scheme (WHOPES arm-in cage assay with Stegomyia (Aedes aegypti mosquitoes. Bootstrap analysis on the inhibition analysis revealed a significant correlation between P450-inhibition and repellent activity of the oils.

  5. Soil water repellency in north-eastern Greece with adverse effects of drying on the persistence

    NARCIS (Netherlands)

    Ziogas, A.K.; Dekker, L.W.; Oostindie, K.; Ritsema, C.J.

    2005-01-01

    Many soils may be water repellent to some degree, challenging the common perception that soil water repellency is only an interesting aberration. When dry, water repellent soils resist or retard water infiltration into the soil matrix. Soil water repellency often leads to the development of unstable

  6. EPA-Registered Repellents for Mosquitoes Transmitting Emerging Viral Disease.

    Science.gov (United States)

    Patel, Radha V; Shaeer, Kristy M; Patel, Pooja; Garmaza, Aleksey; Wiangkham, Kornwalee; Franks, Rachel B; Pane, Olivia; Carris, Nicholas W

    2016-12-01

    In many parts of the United States, mosquitoes were previously nuisance pests. However, they now represent a potential threat in the spread of viral diseases. The Aedes aegypti, Aedes albopictus, and Culex species mosquitoes are endemic to the United States and together may transmit a variety of viral diseases of growing concern, including West Nile virus, chikungunya, dengue fever, and Zika virus. The Centers for Disease Control and Prevention and the Environmental Protection Agency (EPA) recommend N,N-diethyl-meta-toluamide (DEET) as a first-line mosquito repellent, but for patients refusing to use DEET or other conventional repellents, guidance is limited to any EPA-registered product. Therefore, we conducted a systematic review of the literature to identify which EPA-registered personal mosquito repellent provides the best protection from A. aegypti, A. albopictus, and Culex spp. mosquitoes. We abstracted data from 62 published reports of EPA-registered mosquito repellents. The conventional repellent picaridin has the strongest data to support its use as a second-line agent, while IR3535 and oil of lemon eucalyptus are reasonably effective natural products. Citronella, catnip, and 2-undecanone offer limited protection or have limited data. These results can be used by pharmacists and other health care professionals to advise patients on the selection of an EPA-registered mosquito repellent. Regardless of the repellent chosen, it is vital for patients to follow all instructions/precautions in the product labeling to ensure safe and effective use. © 2016 Pharmacotherapy Publications, Inc.

  7. Laboratory investigations of insecticide impregnated materials for the control of New World screwworm flies

    International Nuclear Information System (INIS)

    Harris, E.G.; Brown, M.; Smith, S.

    1992-01-01

    In laboratory tests, New World screwworm flies were found to be at least three orders of magnitude less susceptible to the insecticides deltamethrin, alphacypermethrin and cyfluthrin than are tsetse flies. Deltamethrin was the most toxic of the three insecticides to screwworm flies. For topical application, the LD50s for deltamethrin 20% suspension concentrate were 33 ng and 25 ng for male and female screwworm flies respectively, compared with 0.04 ng for tsetse, G.m. morsitans. In various tests simulating contact of screwworm flies with cloth or netting targets impregnated with insecticide, 100% kill was only achieved with 3.2% deltamethrin and contact times of at least 10 sec, although 100% knockdown for up to 24 hours was obtained with lower concentrations. No repellent effect was observed at the higher concentrations. Cloth targets impregnated with a high dose of insecticide and baited with an attractant could be effective against NWS flies, especially if after ''knockdown'' flies are removed by predators. 1 fig., 9 tabs

  8. Water retention of repellent and subcritical repellent soils: New insights from model and experimental investigations

    Science.gov (United States)

    Czachor, H.; Doerr, S. H.; Lichner, L.

    2010-01-01

    SummarySoil organic matter can modify the surface properties of the soil mineral phase by changing the surface tension of the mineral surfaces. This modifies the soil's solid-water contact angle, which in turn would be expected to affect its water retention curve (SWRC). Here we model the impact of differences in the soil pore-water contact angle on capillarity in non-cylindrical pores by accounting for their complex pore geometry. Key outcomes from the model include that (i) available methods for measuring the Young's wetting angle on soil samples are insufficient in representing the wetting angle in the soil pore space, (ii) the wetting branch of water retention curves is strongly affected by the soil pore-water contact angle, as manifest in the wetting behavior of water repellent soils, (iii) effects for the drying branch are minimal, indicating that both wettable and water repellent soils should behave similarly, and (vi) water retention is a feature not of only wettable soils, but also soils that are in a water repellent state. These results are tested experimentally by determining drying and wetting branches for (a) 'model soil' (quartz sands with four hydrophobization levels) and (b) five field soil samples with contrasting wettability, which were used with and without the removal of the soil organic matter. The experimental results support the theoretical predictions and indicate that small changes in wetting angle can cause switches between wettable and water repellent soil behavior. This may explain the common observation that relatively small changes in soil water content can cause substantial changes in soil wettability.

  9. Neurotoxicology of insecticides and pheromones

    National Research Council Canada - National Science Library

    Narahashi, Toshio

    1979-01-01

    The purpose of this symposium was to provide a forum where a variety of scientists who were interested in the interactions of insecticides and pheromones with the nervous system got together to exchange their views...

  10. A renaissance for botanical insecticides?

    Science.gov (United States)

    Isman, Murray B

    2015-12-01

    Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product. © 2015 Society of Chemical Industry.

  11. Dimension of non-conformal repellers: a survey

    International Nuclear Information System (INIS)

    Chen, Jianyu; Pesin, Yakov

    2010-01-01

    This paper is a survey of recent results on the dimension of repellers for expanding maps and limit sets for iterated function systems. While the case of conformal repellers is well understood, the study of non-conformal repellers is in its early stages though a number of interesting phenomena have been discovered, some remarkable results obtained and several interesting examples constructed. We will describe contemporary state of the art in the area with emphasis on some new emerging ideas and open problems. (invited article)

  12. Nectar Theft and Floral Ant-Repellence: A Link between Nectar Volume and Ant-Repellent Traits?

    Science.gov (United States)

    Ballantyne, Gavin; Willmer, Pat

    2012-01-01

    As flower visitors, ants rarely benefit a plant. They are poor pollinators, and can also disrupt pollination by deterring other flower visitors, or by stealing nectar. Some plant species therefore possess floral ant-repelling traits. But why do particular species have such traits when others do not? In a dry forest in Costa Rica, of 49 plant species around a third were ant-repellent at very close proximity to a common generalist ant species, usually via repellent pollen. Repellence was positively correlated with the presence of large nectar volumes. Repellent traits affected ant species differently, some influencing the behaviour of just a few species and others producing more generalised ant-repellence. Our results suggest that ant-repellent floral traits may often not be pleiotropic, but instead could have been selected for as a defence against ant thieves in plant species that invest in large volumes of nectar. This conclusion highlights to the importance of research into the cost of nectar production in future studies into ant-flower interactions. PMID:22952793

  13. Repellency property of long chain aliphatic methyl ketones against ...

    African Journals Online (AJOL)

    -tridecanone and 2-pentadecanone) were more effective than compounds with even carbon atoms (2-decanone and 2- dodecanone). Comparable repellency activity of 2-tridecanone to DEET show that, it may save as Anopheles gambiae s.s. ...

  14. Fumigant and repellent activities of essential oil extracted from Artemisia dubia and its main compounds against two stored product pests.

    Science.gov (United States)

    Liang, Jun-Yu; Guo, Shan-Shan; Zhang, Wen-Juan; Geng, Zhu-Feng; Deng, Zhi-Wei; Du, Shu-Shan; Zhang, Ji

    2018-05-01

    The major chemical constituents of the essential oil extracted from Artemisia dubia wall. ex Bess. (Family: Asteraceae) were found as terpinolene (19.02%), limonene (17.40%), 2,5-etheno[4.2.2]propella-3,7,9-triene (11.29%), isoelemicin (11.05%) and p-cymene-8-ol (5.93%). Terpinolene and limonene were separated as main components from the essential oil. The essential oil showed fumigant toxicity against Tribolium castaneum and Liposcelis bostrychophila with LC 50 values of 49.54 and 0.74 mg/L, respectively. The essential oil and isolated compounds of A. dubia showed repellency activities against both insects. Terpinolene and limonene showed the fumigant toxicity against T. castaneum. Terpinolene showed obvious fumigant toxicity against L. bostrychophila. The results indicated that the essential oil of A. dubia had potential to be developed into natural insecticides for controlling stored product pests.

  15. Toxicity of a plant based mosquito repellent/killer

    Science.gov (United States)

    Singh, Prakash Raj; Mohanty, Manoj Kumar

    2012-01-01

    The mission to make humans less attractive to mosquitoes has fuelled decades of scientific research on mosquito behaviour and control. The search for the perfect topical insect repellent/killer continues. This analysis was conducted to review and explore the scientific information on toxicity produced by the ingredients/contents of a herbal product. In this process of systemic review the following methodology was applied. By doing a MEDLINE search with key words of selected plants, plant based insect repellents/killers pertinent articles published in journals and authentic books were reviewed. The World Wide Web and the Extension Toxicity Network database (IPCS-ITOX) were also searched for toxicology data and other pertinent information. Repellents do not all share a single mode of action and surprisingly little is known about how repellents act on their target insects. Moreover, different mosquito species may react differently to the same repellent. After analysis of available data and information on the ingredient, of the product in relation to medicinal uses, acute and chronic toxicity of the selected medicinal plants, it can be concluded that the ingredients included in the herbal product can be used as active agents against mosquitoes. If the product which contains the powder of the above said plants is applied with care and safety, it is suitable fo use as a mosquito repellent/killer. PMID:23554562

  16. Development of Natural Insect-Repellent Loaded Halloysite Nanotubes and their Application to Food Packaging to Prevent Plodia interpunctella Infestation.

    Science.gov (United States)

    Kim, Jungheon; Park, No-Hyung; Na, Ja Hyun; Han, Jaejoon

    2016-08-01

    The aims of this study were to develop insect-proof halloysite nanotubes (HNTs) and apply the HNTs to a low-density polyethylene (LDPE) film that will prevent Plodia interpunctella (Hübner) (Lepidoptera: Pyralidae), commonly known as Indian mealmoth, from infesting the food. Clove bud oil (CO), an insect repellent, was encapsulated into HNTs with polyethylenimine (PEI) to bring about controlled release of CO. Chemical composition and insecticidal effect of CO were examined. The Fourier transform infrared (FTIR) spectrum of encapsulated CO was confirmed. The surface charges of uncoated HNTs (HNTs/CO) and coated HNTs with PEI by the layer-by-layer (LBL) method (HNTs/CO/LBL) were determined to be -37.23 and 36.33 mV, respectively. HNTs/CO/LBL showed slow, controlled release of CO compared to HNTs/CO. After 30 d, the residual amounts of CO in HNTs/CO and HNTs/CO/LBL were estimated to be 13.43 and 28.66 mg/g, respectively. HNTs/CO/LBL showed the most sustainable repellent effect. HNTs applied to gravure printing ink solution did not affect mechanical, optical, or thermal properties of the developed film. Gravure-printed LDPE film containing HNTs/CO/LBL displayed the greatest preventive effect on insect penetration, indicating its potential for use as insect-resistant food packaging materials. © 2016 Institute of Food Technologists®

  17. Repellent activities of dichloromethane extract of Allium sativum (garlic) (Liliaceae) against Hyalomma rufipes (Acari).

    Science.gov (United States)

    Nchu, Felix; Magano, Solomon R; Eloff, Jacobus N

    2016-12-02

    Dichloromethane (DCM) extract of garlic (Allium sativum Linn.) bulbs was assessed for its repellent effect against the hard tick, Hyalomma rufipes (Acari: Ixodidae) using two tick behavioural bioassays; Type A and Type B repellency bioassays, under laboratory conditions. These bioassays exploit the questing behaviour of H. rufipes, a tick that in nature displays ambush strategy, seeking its host by climbing up on vegetation and attaching to a passing host. One hundred microlitres (100 µL) of the test solution containing DCM extract of garlic bulbs and DCM at concentrations of 0.35%, 0.7% or 1.4% w/v were evaluated. DCM only was used for control. Tick repellency increased significantly (R2 = 0.98) with increasing concentration (40.03% - 86.96%) yielding an EC50 of 0.45% w/v in Type B repellency bioassay. At concentration of 1.4% w/v, the DCM extract of garlic bulbs produced high repellency index of 87% (male ticks) and 87.5% (female ticks) in the Type A repellency bioassay. Only 4% avoidance of male ticks or female ticks was recorded in the Type B repellency bioassay. In the corresponding controls, the mean numbers of non-repelled male or female ticks were 80% and 41 males or 38 females of 50 ticks in the Type A and Type B repellency bioassays, respectively. The variations in the results could be attributed to the difference in tick repellent behaviours that were assessed by the two repellency bioassays; the Type A repellency bioassay assessed repellent effect of garlic extracts without discriminating between deterrence and avoidance whereas the Type B repellency bioassay only assessed avoidance response. Generally, DCM extract of garlic was repellent against H. rufipes, albeit weak tick repellency was obtained in the Type B repellency bioassay. Furthermore, this study established that the tick repellent activity of garlic extracts is predominantly by deterrence.

  18. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.

  19. Contact and Repellant Activities of Zerumbone and Its Analogues from the Essential Oil of Zingiber zerumbet (L.) Smith against Lasioderma serricorne.

    Science.gov (United States)

    Wu, Yan; Guo, Shan-Shan; Huang, Dong-Ye; Wang, Cheng-Fang; Wei, Jian-Yu; Li, Zhi-Hua; Sun, Jian-Sheng; Bai, Jia-Feng; Tian, Zhao-Fu; Wang, Ping-Juan; Du, Shu-Shan

    2017-04-03

    The contact toxicity and repellent activities of the essential oil extracted from the rhizomes of Zingiber zerumbet (L.) Smith (Zingiberaceae) was evaluated against cigarette beetles (Lasioderma serricorne). The essential oil obtained by hydrodistillation was investigated by GC-FID and GC-MS. The main constituents of the essential oil were zerumbone (40.2%), α-caryophyllene (8.6%), humulene epoxide II (7.3%), camphene (5.9%) and fenchene (4.7%). Zerumbone and its analogues totally are accounting for 60.3% of the essential oil. It was found that the essential oil possessed contact toxicity against L. serricorne adults with a LD 50 value of 48.3 µg/adult. α-Caryophyllene (LD 50 = 13.1 µg/adult) exhibited stronger contact toxicity against L. serricorne than humulene oxide (LD 50 = 31.2 µg/adult), β-caryophyllene (LD 50 = 35.5 µg/adult) and zerumbone (LD 50 = 42.4 µg/adult). Moreover, α-caryophyllene possessed strong repellent activity (Class IV and V, respectively) against the beetles at 78.63 nL/cm 2 , after 2 and 4 h treatment. The results indicate that zerumbone and its analogues might be developed into natural insecticides or repellents for control of cigarette beetles, but their bioactivities are affected by their structures.

  20. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors

    OpenAIRE

    Reid, Molly C.; McKenzie, F. Ellis

    2016-01-01

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malari...

  1. Creams formulated with Ocimum gratissimum L. and Lantana camara L. crude extracts and fractions as mosquito repellents against Aedes aegypti L. (Diptera: Culicidae).

    Science.gov (United States)

    Keziah, Ezeike Amarachi; Nukenine, Elias Nchiwan; Danga, Simon Pierre Yinyang; Younoussa, Lame; Esimone, Charles Okechukwu

    2015-01-01

    Mosquitoes are the most deadly vectors of parasites that cause diseases such as malaria, yellow fever, and filariasis. In view of the recent increased interest in developing plant origin insecticides as an alternative to chemical insecticides, the objective of this study was to determine the repellent activity of creams formulated with methanol crude extract (MCE), hexane fraction (HF), and ethyl acetate fractions (EAFs) of Ocimum gratissimum and Lantana camara leaves in single and combined actions against female Aedes aegypti. Evaluation was carried out in the net cages (30 by 30 by 30 cm) containing 60 blood-starved female mosquitoes each and were assayed in the laboratory condition following World Health Organization 2009 protocol. All formulations (single and mixture) were applied at 2, 4, 6, and 8 mg/cm(2) in the exposed area of human hands. Only acetone + white soft paraffin served as negative control and odomos (12% DEET) as positive control. All the formulations presented good protection against mosquito bites without any allergic reaction by the human volunteers. The repellent activity was dependent on the strength of the extracts and fractions. Among the tested formulations, the maximum protection time was observed in MCE (120 min) and EAF (150 min) of O. gratissimum; MCE:MCE (150 min) and HF:HF (120 min) mixtures of both plants. In addition, MCE:MCE and HF:HF mixtures from both plants showed possible synergistic effect. From the results, the combination of O. gratissimum and L. camara to formulate natural mosquito repellent using small amount of extracts can be encouraging to be an alternative to conventional DEET. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  2. Evaluation of the efficacy of insecticidal coatings based on teflutrin and chlorpyrifos against Rhynchophorus ferrugineus.

    Science.gov (United States)

    Pugliese, Massimo; Rettori, Andrea Alberto; Martinis, Roberto; Al-Rohily, Khalid; Velate, Suresh; Moideen, Mohamed Ashraf; Al-Maashi, Ali

    2017-08-01

    The date palm (Phoenix dactylifera L.), an important economic resource for many nations worldwide, has recently been threatened by the presence of different insect pests, like the red palm weevil (RPW) Rhynchophorus ferrugineus. Two products, a glue (polyvinyl acetate) and an oil (raw linseed oil) were used as coatings and applied together with a repellent and two insecticides (teflutrin and chlorpyrifos) at different dosages on two species of palm (P. dactylifera and P. canariensis). Phytotoxic effects of the treatments were evaluated in a greenhouse on 260 potted palms (130 P. dactylifera and 130 P. canariensis) and no negative effects were observed. Afterwards, a trial lasting 400 days was carried out in a nursery located in Sicily (south Italy), treating 572 potted palm trees (286 P. dactylifera and 286 P. canariensis) with an average diameter at the base of 18-20 cm. After 400 days, 48% of the untreated palms were infested, while only 3% of date palms and 7% of Canary palms treated with insecticide at lower dosages were infested. The application of an insecticide-based coating is a good strategy to control and prevent the red palm weevil infestation, in particular on date palms. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  3. Pyrethrum flowers and pyrethroid insecticides.

    OpenAIRE

    Casida, J E

    1980-01-01

    The natural pyrethrins from the daisy-like flower, Tanacetum or Chrysanthemum cinerariifolium, are nonpersistent insecticides of low toxicity to mammals. Synthetic analogs or pyrethroids, evolved from the natural compounds by successive isosteric modifications, are more potent and stable and are the newest important class of crop protection chemicals. They retain many of the favorable properties of the pyrethrins.

  4. Limonene--A Natural Insecticide.

    Science.gov (United States)

    Beatty, Joseph H.

    1986-01-01

    Describes a high school chemistry student's research project in which limonene was isolated from the oil of lemons and oranges. Outlines the students' tests on the use of this chemical as an insecticide. Discusses possible extensions of the exercises based on questions generated by the students. (TW)

  5. Radioligand Recognition of Insecticide Targets.

    Science.gov (United States)

    Casida, John E

    2018-04-04

    Insecticide radioligands allow the direct recognition and analysis of the targets and mechanisms of toxic action critical to effective and safe pest control. These radioligands are either the insecticides themselves or analogs that bind at the same or coupled sites. Preferred radioligands and their targets, often in both insects and mammals, are trioxabicyclooctanes for the γ-aminobutyric acid (GABA) receptor, avermectin for the glutamate receptor, imidacloprid for the nicotinic receptor, ryanodine and chlorantraniliprole for the ryanodine receptor, and rotenone or pyridaben for NADH + ubiquinone oxidoreductase. Pyrethroids and other Na + channel modulator insecticides are generally poor radioligands due to lipophilicity and high nonspecific binding. For target site validation, the structure-activity relationships competing with the radioligand in the binding assays should be the same as that for insecticidal activity or toxicity except for rapidly detoxified or proinsecticide analogs. Once the radioligand assay is validated for relevance, it will often help define target site modifications on selection of resistant pest strains, selectivity between insects and mammals, and interaction with antidotes and other chemicals at modulator sites. Binding assays also serve for receptor isolation and photoaffinity labeling to characterize the interactions involved.

  6. Metalized polyethylene mulch to repel Asian citrus psyllid, slow spread of huanglongbing and improve growth of new citrus plantings.

    Science.gov (United States)

    Croxton, Scott D; Stansly, Philip A

    2014-02-01

    Greening or huanglongbing (HLB) is a debilitating disease of citrus caused by Candidatus Liberibactor asiaticus and transmitted by the Asian citrus psyllid (ACP), Diaphorina citri. HLB now occurs worldwide in all major citrus growing regions except the Mediterranean and Australia. Management relies principally on insecticidal control of the ACP vector, but is insufficient, even for young trees which are most susceptible to the disease. We tested the ability of metalized polyethylene mulch to repel adult ACP as well as effects on incidence of HLB and early tree growth. Metalized mulch significantly reduced ACP populations and HLB incidence compared to whiteface mulch or bare ground. In addition, metalized mulch, together with the associated drip irrigation and fertigation system, increased soil moisture, reduced weed pressure, and increased tree growth rate. Metalized mulch slows spread of ACP and therefore HLB pressure on young citrus trees. Metalized mulch can thereby augment current control measures for young trees based primarily on systemic insecticides. Additional costs could be compensated for by increased tree growth rate which would shorten time to crop profitability. These advantages make a compelling case for large-scale trials using metalized mulch in young citrus plantings threatened by HLB. © 2013 Society of Chemical Industry.

  7. Rhanterium epapposum Oliv. essential oil: Chemical composition and antimicrobial,insect-repellent and anticholinesterase activities

    Science.gov (United States)

    Essential oils from Rhanterium epapposum Oliv. (Asteraceae) was investigated for its repellent, antimicrobial and acetyl- and butyrylcholine esterase inhibitory activities. The oil showed good repellent activity while oils demonstrated weak in antimicrobial and cholinesterase inhibitions. Terpenoids...

  8. Repellent Activity of TRIG (N-N Diethyl Benzamide) against Man-Biting Mosquitoes

    OpenAIRE

    Msangi, Shandala; Kweka, Eliningaya; Mahande, Aneth

    2018-01-01

    A study was conducted to assess efficacy of a new repellent brand TRIG (15% N-N Diethyl Benzamide) when compared to DEET (20% N-N Methyl Toluamide). The repellents were tested in laboratory and field. In the laboratory, the repellence was tested on human volunteers, by exposing their repellent-treated arms on starved mosquitoes in cages for 3 minutes at hourly intervals, while counting the landing and probing attempts. Anopheles gambiae and Aedes aegypti mosquitoes were used. Field evaluation...

  9. Toxicity, repellency and flushing out in Triatoma infestans (Hemiptera: Reduviidae exposed to the repellents DEET and IR3535

    Directory of Open Access Journals (Sweden)

    Mercedes M.N. Reynoso

    2017-05-01

    Full Text Available DEET and IR3535 are insect repellents present worldwide in commercial products; their efficacy has been mainly evaluated in mosquitoes. This study compares the toxicological effects and the behavioral responses induced by both repellents on the blood-sucking bug Triatoma infestans Klug (Hemiptera: Reduviidae, one of the main vectors of Chagas disease. When applied topically, the Median Lethal Dose (72 h for DEET was 220.8 µg/insect. Using IR3535, topical application of 500 µg/insect killed no nymphs. The minimum concentration that produced repellency was the same for both compounds: 1,15 µg/cm2. The effect of a mixture DEET:IR3535 1:1 was similar to that of their pure components. Flushing out was assessed in a chamber with a shelter containing groups of ten nymphs. The repellents were aerosolized on the shelter and the number of insects leaving it was recorded for 60 min. During that time, 0.006 g/m3 of the positive control tetramethrin flushed out 76.7% of the nymphs, while 1.76 g/m3 of DEET or IR3535 flushed out 30 and 0%, respectively. The concentrations required for both compounds to produce toxicity or flushing out are too high to have any practical applications. However, they showed a promising repellency. Additional research should be done to evaluate their possible use for personal protection against T. infestans bites.

  10. Evaluation of a Noncontact, Alternative Mosquito Repellent Assay System.

    Science.gov (United States)

    Tisgratog, Rungarun; Kongmee, Monthathip; Sanguanpong, Unchalee; Prabaripai, Atchariya; Bangs, Michael J; Chareonviriyaphap, Theeraphap

    2016-09-01

    A novel noncontact repellency assay system (NCRAS) was designed and evaluated as a possible alternative method for testing compounds that repel or inhibit mosquitoes from blood feeding. Deet and Aedes aegypti were used in a controlled laboratory setting. Using 2 study designs, a highly significant difference were seen between deet-treated and untreated skin placed behind the protective screens, indicating that deet was detected and was acting as a deterrence to mosquito landing and probing behavior. However, a 2nd study showed significant differences between protected (behind a metal screen barrier) and unprotected (exposed) deet-treated forearms, indicating the screen mesh might restrict the detection of deet and thus influences landing/biting response. These findings indicate the prototype NCRAS shows good promise but requires further evaluation and possible modification in design and testing protocol to achieve more desirable operational attributes in comparison with direct skin-contact repellency mosquito assays.

  11. Preferential flow in water-repellent sandy soils : model development and lysimeter experiments

    NARCIS (Netherlands)

    Rooij, de G.H.

    1996-01-01


    When water enters a water-repellent topsoil, preferential flow paths develop and the flow bypasses a large part of the unsaturated zone. Therefore, preferential flow caused by water- repellency is expected to accelerate solute leaching to the groundwater. In soils with water-repellent

  12. Natural and fire-induced soil water repellency in a Portugese Shrubland

    NARCIS (Netherlands)

    Stoof, C.R.; Moore, D.; Ritsema, C.J.; Dekker, L.W.

    2011-01-01

    Post-fire land degradation is often attributed to fire-induced soil water repellency, despite the fact that soil water repellency is a natural phenomenon in many soils and is therefore not necessarily caused by fire. To improve our understanding of the role of soil water repellency in causing

  13. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors.

    Science.gov (United States)

    Reid, Molly C; McKenzie, F Ellis

    2016-02-19

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malaria vectors were identified. In 23 of the 25 relevant recent publications from across Africa, higher resistance in mosquito populations was associated with agricultural insecticide use. This association appears to be affected by crop type, farm pest management strategy and urban development.

  14. Repellency Effect of Essential Oils of Some Native Plants and Synthetic Repellents against Human Flea, Pulex irritans (Siphonaptera: Pulicidae

    Directory of Open Access Journals (Sweden)

    Mohammad Bagher Ghavami

    2017-04-01

    Full Text Available Background: Fleas are important vectors of human and animal disease, and control measures for protection against their bites and flea-borne diseases are necessary.Methods: The essential oils (EOs of four native medicinal plants, Ziziphora tenuiore, Myrtus communis, Achillea wilhelmsii and Mentha piperita were isolated by hydrodistillation technique and analyzed by GC-MC. The repellent activity of EOs and synthetic compounds, DEET and permethrin, were assayed on human subjects against field col­lected fleas. The effective doses of 50% and 90% of EOs and synthetic compounds were estimated by probit analysis of dose and response regression line.Results: Analysis of EOs revealed about 19 major components. All oils were found to be more repellent (ED50 range= 208–955µg cm-2 than DEET and permethrin (ED50 range= 27–182 x 103 µg cm-2. Thyme and myrtle oils showed high repellent activities and among the total detected terpenes, thymol (36.26% and α- pinene (32.5% were the major components of those oils respectively.Conclusion: Low repellent potency of DEET and permethrin against fleas might be related to flea olfactory system and further molecular and electrophysiological studies are required to conceive new ideas for the discovery and de­velopment of the next generation of repellents. Based on high repellent activity of thyme and myrtle essential oils against Pulex irritans further studies should be staged to develop their appropriate effective formulations. Likewise, field trials should be carried out to evaluate the operational feasibility and dermal toxicity over a long period.

  15. Plant Essential Oils from Apiaceae Family as Alternatives to Conventional Insecticides

    Directory of Open Access Journals (Sweden)

    Asgar Ebadollahi

    2013-06-01

    Full Text Available Main method to control insect pest is using synthetic insecticides, but the development of insect resistance to this products, the high operational cost, environmental pollution, toxicity to humans and harmful effect on non-target organisms have created the need for developing alternative approaches to control insect pest. Furthermore, the demand for organic crops, especially vegetables for the fresh market, has greatly increased worldwide. The ideal insecticide should control target pests adequately and should be target-specific, rapidly degradable, and low in toxicity to humans and other mammals. Plant essential oils could be an alternative source for insect pest control because they constitute a rich source of bioactive chemicals and are commonly used as flavoring agents in foods. These materials may be applied to food crops shortly before harvest without leaving excessive residues. Moreover, medically safe of these plant derivatives has emphasized also. For these reasons, much effort has been focused on plant essential oils or their constituents as potential sources of insect control agents. In this context, Apiaceae (Umbelliferae family would rank among the most important families of plants. In the last few years more and more studies on the insecticidal properties of essential oils from Apiaceae family have been published and it seemed worthwhile to compile them. The focus of this review lies on the lethal (ovicidal, larvicidal, pupicidal and adulticidal and sublethal (antifeedant, repellent, oviposition deterrent, Growth inhibitory and progeny production activities of plant essential oils and theirmain components from Apiaceae family. These features indicate that pesticides based on Apiaceae essential oils could be used in a variety of ways to control a large number of pests. It can be concluded that essential oils and phytochemicals isolated from Apiaceae family may be efficacious and safe replacements for conventional synthetic

  16. How to repel hot water from a superhydrophobic surface?

    KAUST Repository

    Yu, Zhejun; Yang, Jieyi; Wan, Fang; Ge, Quan; Yang, Longlai; Ding, Zunliang; Yang, Dequan; Sacher, Edward R.; Isimjan, Tayirjan T.

    2014-01-01

    Superhydrophobic surfaces, with water contact angles greater than 150° and slide angles less than 10°, have attracted a great deal of attention due to their self-cleaning ability and excellent water-repellency. It is commonly accepted that a

  17. The role of repellents and hydrophobins in Ustilago maydis

    NARCIS (Netherlands)

    Teertstra, W.R.

    2009-01-01

    Ustilago maydis is an important model organism to study fungal pathogenicity. U. maydis can grow yeast-like and filamentous. In the latter form this fungus infects maize. In my Thesis the expression and function of hydrophobins and repellents of U. maydis were studied. Hydrophobins are produced by

  18. Exponential increase of publications related to soil water repellency

    NARCIS (Netherlands)

    Dekker, L.W.; Oostindie, K.; Ritsema, C.J.

    2005-01-01

    Soil water repellency is much more wide-spread than formerly thought. During the last decades, it has been a topic of study for soil scientists and hydrologists in at least 21 States of the USA, in Canada, Australia, New Zealand, Mexico, Colombia, Chile, Congo, Nepal, India, Hong Kong, Taiwan,

  19. Water repellency of two forest soils after biochar addition

    Science.gov (United States)

    D. S. Page-Dumroese; P. R. Robichaud; R. E. Brown; J. M. Tirocke

    2015-01-01

    Practical application of black carbon (biochar) to improve forest soil may be limited because biochar is hydrophobic. In a laboratory, we tested the water repellency of biochar application (mixed or surface applied) to two forest soils of varying texture (a granitic coarse-textured Inceptisol and an ash cap fine-textured Andisol) at four different application rates (0...

  20. Engineering Characteristics of Chemically Treated Water-Repellent Kaolin

    Directory of Open Access Journals (Sweden)

    Youngmin Choi

    2016-12-01

    Full Text Available Water-repellent soils have a potential as alternative construction materials that will improve conventional geotechnical structures. In this study, the potential of chemically treated water-repellent kaolin clay as a landfill cover material is explored by examining its characteristics including hydraulic and mechanical properties. In order to provide water repellency to the kaolin clay, the surface of clay particle is modified with organosilanes in concentrations (CO ranging from 0.5% to 10% by weight. As the CO increases, the specific gravity of treated clay tends to decrease, whereas the total organic carbon content of the treated clay tends to increase. The soil-water contact angle increases with an increase in CO until CO = 2.5%, and then maintains an almost constant value (≈134.0°. Resistance to water infiltration is improved by organosilane treatment under low hydrostatic pressure. However, water infiltration resistance under high hydrostatic pressure is reduced or exacerbated to the level of untreated clay. The maximum compacted dry weight density decreases with increasing CO. As the CO increases, the small strain shear modulus increases, whereas the effect of organosilane treatment on the constrained modulus is minimal. The results indicate that water-repellent kaolin clay possesses excellent engineering characteristics for a landfill cover material.

  1. Engineering Characteristics of Chemically Treated Water-Repellent Kaolin

    Science.gov (United States)

    Choi, Youngmin; Choo, Hyunwook; Yun, Tae Sup; Lee, Changho; Lee, Woojin

    2016-01-01

    Water-repellent soils have a potential as alternative construction materials that will improve conventional geotechnical structures. In this study, the potential of chemically treated water-repellent kaolin clay as a landfill cover material is explored by examining its characteristics including hydraulic and mechanical properties. In order to provide water repellency to the kaolin clay, the surface of clay particle is modified with organosilanes in concentrations (CO) ranging from 0.5% to 10% by weight. As the CO increases, the specific gravity of treated clay tends to decrease, whereas the total organic carbon content of the treated clay tends to increase. The soil-water contact angle increases with an increase in CO until CO = 2.5%, and then maintains an almost constant value (≈134.0°). Resistance to water infiltration is improved by organosilane treatment under low hydrostatic pressure. However, water infiltration resistance under high hydrostatic pressure is reduced or exacerbated to the level of untreated clay. The maximum compacted dry weight density decreases with increasing CO. As the CO increases, the small strain shear modulus increases, whereas the effect of organosilane treatment on the constrained modulus is minimal. The results indicate that water-repellent kaolin clay possesses excellent engineering characteristics for a landfill cover material. PMID:28774098

  2. A new approach to the problem of chaotic repellers

    International Nuclear Information System (INIS)

    Szepfalusy, P.; Tel, T.

    1986-05-01

    It is shown that a smooth stationary distribution can be derived for 'coarse grained' repellers by compensating the local escape. This provides a convenient framework to investigate statistical properties of long chaotic transients. Furthermore, the procedure yields a powerful tool for calculating fractal dimensions. (author)

  3. Repellency of Dettol, a Commercial Cleaning Product, Against Adult ...

    African Journals Online (AJOL)

    acer

    ABSTRACT: Dettol, a commercial cleaning product was tested for its repellent action against adults of Periplaneta americana (L.). Experimental cage was constructed with pieces of polypropylene plastic material to have a finished form measuring 30×30×60cm. Two cardboard shelters (for each trial) were assembled each ...

  4. Prevention of vector transmitted diseases with clove oil insect repellent.

    Science.gov (United States)

    Shapiro, Rochel

    2012-08-01

    Vector repellent is one element in the prevention of vector-borne diseases. Families that neglect protecting their children against vectors risk their children contracting illnesses such as West Nile virus, eastern equine encephalitis, Lyme disease, malaria, dengue hemorrhagic fever, yellow fever, babesiosis, Crimean-Congo hemorrhagic fever, Rocky Mountain spotted fever, Southern tick-associated rash illness, ehrlichiosis, tick-borne relapsing fever, tularemia, and other insect and arthropod related diseases (CDC, 2011). Identification of families at risk includes screening of the underlying basis for reluctance to apply insect repellent. Nurses and physicians can participate in a positive role by assisting families to determine the proper prophylaxis by recommending insect repellent choices that are economical, safe, and easy to use. A holistic alternative might include the suggestion of clove oil in cases where families might have trepidations regarding the use of DEET on children. This article will explore the safety and effectiveness of clove oil and its use as an insect repellent. Copyright © 2012 Elsevier Inc. All rights reserved.

  5. Antioxidant capacity, insecticidal ability and heat-oxidation stability of Tagetes lemmonii leaf extract.

    Science.gov (United States)

    Ma, Chih-Ming; Cheng, Chih-Lun; Lee, Shang-Chieh; Hong, Gui-Bing

    2018-04-30

    The aim of this study was to examine the effect of process factors such as ethanol concentration, extraction time and temperature on the extraction yield and the bioactive contents of Tagetes lemmonii leaf extracts using response surface methodology (RSM). ANOVA results showed that the response variables were affected by the ethanol concentration to a very significant degree and by extraction temperature to a lesser degree. GC/MS characterization showed that the extract is rich in bioactive compounds and those present exhibited important biological activities such as antioxidant, insect repellence and insecticidal activities. The results from the toxicity assay demonstrate that the extract obtained from the leaves of Tagetes lemmonii was an effective insect toxin against Tribolium castaneum. The radical scavenging activity and p-anisidine test results of olive oil spiked with different concentrations of leaf extract showed that the phenolic compounds can retard lipid oxidation. Copyright © 2018 Elsevier Inc. All rights reserved.

  6. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  7. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  8. 2 Assessmen of the Efficiency of Insecticide

    African Journals Online (AJOL)

    Administrator

    malaria vectors and nuisance in West Africa – a-part. 2. Field evaluation. Malar J. 9: 341. Mosqueira B., Duchon S., Chandre F., Hougard, J. M., Carnevale P. and Mas-Coma S. (2010). Efficacy of an insecticide paint against insecticide- susceptible and resistant mosquitoes – b- Part 1: Laboratory evaluation. Malar J. 9: 340.

  9. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    2007-01-24

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.  Created: 1/24/2007 by Emerging Infectious Diseases.   Date Released: 3/13/2007.

  10. Octanoic acid confers to royal jelly varroa-repellent properties

    Science.gov (United States)

    Nazzi, Francesco; Bortolomeazzi, Renzo; Della Vedova, Giorgio; Del Piccolo, Fabio; Annoscia, Desiderato; Milani, Norberto

    2009-02-01

    The mite Varroa destructor Anderson & Trueman is a parasite of the honeybee Apis mellifera L. and represents a major threat for apiculture in the Western world. Reproduction takes place only inside bee brood cells that are invaded just before sealing; drone cells are preferred over worker cells, whereas queen cells are not normally invaded. Lower incidence of mites in queen cells is at least partly due to the deterrent activity of royal jelly. In this study, the repellent properties of royal jelly were investigated using a lab bioassay. Chemical analysis showed that octanoic acid is a major volatile component of royal jelly; by contrast, the concentration is much lower in drone and worker larval food. Bioassays, carried out under lab conditions, demonstrated that octanoic acid is repellent to the mite. Field studies in bee colonies confirmed that the compound may interfere with the process of cell invasion by the mite.

  11. of Several Organophosphorus Insecticide Metabolites

    Directory of Open Access Journals (Sweden)

    Russell L. Carr

    2015-01-01

    Full Text Available Paraoxonase (PON1 is a calcium dependent enzyme that is capable of hydrolyzing organophosphate anticholinesterases. PON1 activity is present in most mammals and previous research established that PON1 activity differs depending on the species. These studies mainly used the organophosphate substrate paraoxon, the active metabolite of the insecticide parathion. Using serum PON1 from different mammalian species, we compared the hydrolysis of paraoxon with the hydrolysis of the active metabolites (oxons of two additional organophosphorus insecticides, methyl parathion and chlorpyrifos. Paraoxon hydrolysis was greater than that of methyl paraoxon, but the level of activity between species displayed a similar pattern. Regardless of the species tested, the hydrolysis of chlorpyrifos-oxon was significantly greater than that of paraoxon or methyl paraoxon. These data indicate that chlorpyrifos-oxon is a better substrate for PON1 regardless of the species. The pattern of species differences in PON1 activity varied with the change in substrate to chlorpyrifos-oxon from paraoxon or methyl paraoxon. For example, the sex difference observed here and reported elsewhere in the literature for rat PON1 hydrolysis of paraoxon was not present when chlorpyrifos-oxon was the substrate.

  12. Insecticide resistance and intracellular proteases.

    Science.gov (United States)

    Wilkins, Richard M

    2017-12-01

    Pesticide resistance is an example of evolution in action with mechanisms of resistance arising from mutations or increased expression of intrinsic genes. Intracellular proteases have a key role in maintaining healthy cells and in responding to stressors such as pesticides. Insecticide-resistant insects have constitutively elevated intracellular protease activity compared to corresponding susceptible strains. This increase was shown for some cases originally through biochemical enzyme studies and subsequently putatively by transcriptomics and proteomics methods. Upregulation and expression of proteases have been characterised in resistant strains of some insect species, including mosquitoes. This increase in proteolysis results in more degradation products (amino acids) of intracellular proteins. These may be utilised in the resistant strain to better protect the cell from stress. There are changes in insect intracellular proteases shortly after insecticide exposure, suggesting a role in stress response. The use of protease and proteasome inhibitors or peptide mimetics as synergists with improved application techniques and through protease gene knockdown using RNA interference (possibly expressed in crop plants) may be potential pest management strategies, in situations where elevated intracellular proteases are relevant. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  13. Insect Repellents: Modulators of Mosquito Odorant Receptor Activity

    Science.gov (United States)

    2010-08-01

    Laboratory, Henry A. Wallace Beltsville Agricultural Research Center, Plant Sciences Institute, Agricultural Research Service, United States Department...origin. 2-U is a naturally occurring compound produced by the glandular trichomes of wild tomato plants as part of a plant defense mechanism against...antennal OSNs responding to carboxylic acids and monoterpenes [23]. In our study, we investigate the action of 4 insect repellents on the activities of

  14. Durability of two water repelents applied to granite

    Directory of Open Access Journals (Sweden)

    Rivas, T.

    1998-06-01

    Full Text Available The durability of two water-repellents for granitic stonework was determined. Weathered and sound samples of granites widely used in building construction and restoration in Galicia (NW Spain were treated with water repellents of known efficacy, and then subjected to two artificial weathering tests: prolonged exposure to UV light, and sodium sulphate crystallization cycles. In both tests, but especially in the salt crystallization cycles, both treatments rapidly lost their water-repellency. Furthermore, the hydrophobic layer of water repellent impeded salt mobility, favouring fissuration parallel to the treated surface, which was eventually shed in the form of a plaque.

    Se presentan los resultados de la durabilidad de dos tratamientos de hidrofugación aplicados a rocas graníticas ampliamente utilizados en la construcción de edificios en Galicia (Noroeste de España. Tras la evaluación de la eficacia de dichos tratamientos, cuyos resultados se presentaron en un trabajo anterior, se someten las muestras tratadas a dos ensayos diferentes de envejecimiento acelerado: ciclos de exposición a la luz ultravioleta y ciclos de cristalización de sulfato de sodio. Los productos hidrofugantes muestran una escasa resistencia a ambos ensayos, sobre todo a los ciclos de cristalización de sulfato de sodio; esta débil durabilidad se manifiesta en una rápida pérdida de sus propiedades hidrofugantes. Así mismo, se observa que la presencia de la capa hidrófoba en la piedra funciona como una barrera frente a la movilidad de sales, lo que ocasiona el total desprendimiento de aquella y un fuerte deterioro del material rocoso.

  15. Soil water repellency and its hydro-geomorphological consequences

    Czech Academy of Sciences Publication Activity Database

    Lichner, Ľ.; Babejová, N.; Šír, Miloslav; Tesař, Miroslav

    2003-01-01

    Roč. 2, č. 2 (2003), s. 1-7 ISSN 1336-1120 R&D Projects: GA AV ČR IAA3060001 Grant - others:Slovac Scientific Grant Agency(SK) 2/3032/23; Science and Technology Assistance Agency(SK) APVT-51-006502 Institutional research plan: CEZ:AV0Z2060917 Keywords : hydrophobicity * water repellency * soil Subject RIV: DA - Hydrology ; Limnology

  16. Repellency of Lantana camara (Verbenaceae) flowers against Aedes mosquitoes.

    Science.gov (United States)

    Dua, V K; Gupta, N C; Pandey, A C; Sharma, V P

    1996-09-01

    The repellent effect of Lantana camara flowers was evaluated against Aedes mosquitoes. Lantana flower extract in coconut oil provided 94.5% protection from Aedes albopictus and Ae. aegypti. The mean protection time was 1.9 h. One application of Lantana flower can provide more than 50% protection up to 4 h against the possible bites of Aedes mosquitoes. No adverse effects of the human volunteers were observed through 3 months after the application.

  17. Evaluation of Contact Toxicity and Repellency of the Essential Oil of Pogostemon cablin Leaves and Its Constituents Against Blattella germanica (Blattodae: Blattelidae).

    Science.gov (United States)

    Liu, Xin Chao; Liu, Qiyong; Chen, Han; Liu, Qi Zhi; Jiang, Shi Yao; Liu, Zhi Long

    2015-01-01

    The aim of this research was to evaluate contact toxicity and repellency of the essential oil of Pogostemon cablin (Blanco) Bentham leaves against German cockroaches (Blattella germanica) (L.) and to isolate any active constituents. Essential oil of P. cablin leaves was obtained by hydrodistillation and analyzed by gas chromatography (GC) and gas chromatography-mass spectrometry (GC-MS). Twenty-three components were identified in the essential oil, and the main constituents were patchoulol (41.31%), pogostone (18.06%), α-bulnesene (6.56%), caryophyllene (5.96%), and seychellene (4.32%). Bioactivity-directed chromatographic separation of the essential oil led to the isolation of pogostone, patchoulol, and caryophyllene as active compounds. The essential oil of P. cablin leaves exhibited acute toxicity against male B. germanica adults with an LC50 value of 23.45 μg per adult. The constituent compound, pogostone (LC50 = 8.51 μg per adult) showed stronger acute toxicity than patchoulol (LC50 = 207.62 μg per adult) and caryophyllene (LC50 = 339.90 μg per adult) against the male German cockroaches. The essential oil of P. cablin leaves and the three isolated constituents exhibited strong repellent activity against German cockroaches at a concentration of 5 ppm. The results indicated that the essential oil of P. cablin leaves and its major constituents have good potential as a source for natural insecticides and repellents. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America. For Permissions, please e-mail: journals.permissions@oup.com.

  18. Mosquito repellent activity of essential oils of aromatic plants growing in Argentina.

    Science.gov (United States)

    Gillij, Y G; Gleiser, R M; Zygadlo, J A

    2008-05-01

    Mosquitoes are important vectors of diseases and nuisance pests. Repellents minimize contact with mosquitoes. Repellents based on essential oils (EO) are being developed as an alternative to DEET (N,N-diethyl-m-methylbenzamide), an effective compound that has disadvantages including toxic reactions, and damage to plastic and synthetic fabric. This work evaluated the repellency against Aedes aegypti of EO from aromatic plants that grow in Argentina: Acantholippia seriphioides, Achyrocline satureioides, Aloysia citriodora, Anemia tomentosa, Baccharis spartioides, Chenopodium ambrosioides, Eucalyptus saligna, Hyptis mutabilis, Minthostachys mollis, Rosmarinus officinalis, Tagetes minuta and Tagetes pusilla. Most EO were effective. Variations depending on geographic origin of the plant were detected. At a 90% EO concentration, A. satureoides and T. pusilla were the least repellent. At concentrations of 12.5% B. spartioides, R. officinalis and A. citriodora showed the longest repellency times. Comparisons of the principal components of each EO suggest that limonene and camphor were the main components responsible for the repellent effects.

  19. Structure-activity of valencenoid derivatives and their repellence to the Formosan subterranean termite.

    Science.gov (United States)

    Zhu, Betty C R; Henderson, Gregg; Sauer, Anne M; Yu, Ying; Crowe, William; Laine, Roger A

    2003-12-01

    Eight valencenoid derivatives were evaluated for their repelling activity against Formosan subterranean termites, Coptotermes formosanus Shiraki. Among them, 1,10-dihydronootkatone was the strongest repellent, and valencene was the weakest. Results of the structure-repellency relationships indicated (1) reduction of the ketone group to the alcohol on position 2 of nootkatone curtailed the activity; (2) because of the low activity of valencene relative to nootkatone that the ketone group was essential for repellent activity; (3) reduction of the 1,10 double bond (1,10-dihydronootkatone and tetrahydronootkatone) produced compounds more repellent than nootkatone; (4) the isopropenyl group probably does not participate in binding as evidenced by no significant difference in the repellent activity among nootkatone (double bond between position 11 and 12), isonootkatone (double bond between position 7 and 11), and 11,12-dihydronootkatone.

  20. Efficacy of topical permethrin as repellent against Aedes aegypti's bites.

    Science.gov (United States)

    Miot, Hélio Amante; Ferreira, Daniela Pinho; Mendes, Fabiana Guandalini; Carrenho, Flávia Roberta Hernandes; de Oliveira Amui, Isabela; Carneiro, Carlos Augusto Sá; Madeira, Newton Goulart

    2008-07-15

    Mosquitoes are the most important vectors of infectious diseases and their bites are related to several adverse skin reactions. Permethrin impregnated clothes are an efficient strategy against arthropods' bites; however, its topical efficacy as a repellent has not been well established. We studied the response to permethrin lotion 5 percent and N,N-Diethyl-meta-toluamide (DEET) spray 50 percent applied to the unprotected forearms of 10 volunteers. Each arm was exposed to 20 female mosquitoes of Aedes aegypti. We performed 71 bilateral comparative measurements evaluating the timing for the first bites. The average times for the arm without the product, with permethrin 5 percent, and with DEET 50 percent were: 7.9 seconds, 336.2 seconds and 7512.1 seconds. The results showed a significant difference between repellency times between either product and unprotected controls. In addition, there was a significant difference in time to first bite between permethrin and DEET treated arms (pAedes aegypti bites in this experimental setting. However, permethrin's profile of repellency was significantly inferior to that of DEET.

  1. Critical homoclinic orbits lead to snap-back repellers

    International Nuclear Information System (INIS)

    Gardini, Laura; Sushko, Iryna; Avrutin, Viktor; Schanz, Michael

    2011-01-01

    Highlights: → We consider critical homoclinic orbits in continuous and discontinuous maps. → Unbounded homoclinic orbits in maps on unbounded domains are considered as well. → We show that a snapback-repeller (SBR) with a non-critical homoclinic orbit implies chaos. → We show also that a SBR with a critical homoclinic orbit may or may not imply chaos. - Abstract: When nondegenerate homoclinic orbits to an expanding fixed point of a map f:X→X,X subset or equal R n , exist, the point is called a snap-back repeller. It is known that the relevance of a snap-back repeller (in its original definition) is due to the fact that it implies the existence of an invariant set on which the map is chaotic. However, when does the first homoclinic orbit appear? When can other homoclinic explosions, i.e., appearance of infinitely many new homoclinic orbits, occur? As noticed by many authors, these problems are still open. In this work we characterize these bifurcations, for any kind of map, smooth or piecewise smooth, continuous or discontinuous, defined in a bounded or unbounded closed set. We define a noncritical homoclinic orbit and a homoclinic orbit of an expanding fixed point is structurally stable iff it is noncritical. That is, only critical homoclinic orbits are responsible for the homoclinic explosions. The possible kinds of critical homoclinic orbits will be also investigated, as well as their dynamic role.

  2. Insecticide control of vector-borne diseases: when is insecticide resistance a problem?

    Directory of Open Access Journals (Sweden)

    Ana Rivero

    Full Text Available Many of the most dangerous human diseases are transmitted by insect vectors. After decades of repeated insecticide use, all of these vector species have demonstrated the capacity to evolve resistance to insecticides. Insecticide resistance is generally considered to undermine control of vector-transmitted diseases because it increases the number of vectors that survive the insecticide treatment. Disease control failure, however, need not follow from vector control failure. Here, we review evidence that insecticide resistance may have an impact on the quality of vectors and, specifically, on three key determinants of parasite transmission: vector longevity, competence, and behaviour. We argue that, in some instances, insecticide resistance is likely to result in a decrease in vector longevity, a decrease in infectiousness, or in a change in behaviour, all of which will reduce the vectorial capacity of the insect. If this effect is sufficiently large, the impact of insecticide resistance on disease management may not be as detrimental as previously thought. In other instances, however, insecticide resistance may have the opposite effect, increasing the insect's vectorial capacity, which may lead to a dramatic increase in the transmission of the disease and even to a higher prevalence than in the absence of insecticides. Either way-and there may be no simple generality-the consequence of the evolution of insecticide resistance for disease ecology deserves additional attention.

  3. Turmeric powder and its derivatives from Curcuma longa rhizomes: Insecticidal effects on cabbage looper and the role of synergists.

    Science.gov (United States)

    de Souza Tavares, Wagner; Akhtar, Yasmin; Gonçalves, Gabriel Luiz Padoan; Zanuncio, José Cola; Isman, Murray B

    2016-11-02

    Curcuma longa has well-known insecticidal and repellent effects on insect pests, but its impact on Trichoplusia ni is unknown. In this study, the compound ar-turmerone, extracted and purified from C. longa rhizomes, was identified, and its insecticidal effects, along with turmeric powder, curcuminoid pigments and crude essential oil were evaluated against this important agricultural pest. The role of natural (sesamol and piperonal) and synthetic [piperonyl butoxide (PBO)] synergists under laboratory and greenhouse conditions were also evaluated. The concentration of ar-turmerone in C. longa rhizomes harvested was 0.32% (dwt). Turmeric powder and its derivatives caused 10-20% mortality in third instar T. ni at a very low dose (10 μg/larva). Addition of PBO increased toxicity of turmeric powder and its derivatives (90-97% mortality) in most binary combinations (5 μg of turmeric powder or its derivatives +5 μg of PBO), but neither piperonal nor sesamol were active as synergists. The compound ar-turmerone alone and the combination with PBO reduced larval weight on treated Brassica oleracea in the laboratory and in greenhouse experiments, compared with the negative control. The compound ar-turmerone could be used as a low cost botanical insecticide for integrated management of cabbage looper in vegetable production.

  4. Turmeric powder and its derivatives from Curcuma longa rhizomes: Insecticidal effects on cabbage looper and the role of synergists

    Science.gov (United States)

    de Souza Tavares, Wagner; Akhtar, Yasmin; Gonçalves, Gabriel Luiz Padoan; Zanuncio, José Cola; Isman, Murray B.

    2016-01-01

    Curcuma longa has well-known insecticidal and repellent effects on insect pests, but its impact on Trichoplusia ni is unknown. In this study, the compound ar-turmerone, extracted and purified from C. longa rhizomes, was identified, and its insecticidal effects, along with turmeric powder, curcuminoid pigments and crude essential oil were evaluated against this important agricultural pest. The role of natural (sesamol and piperonal) and synthetic [piperonyl butoxide (PBO)] synergists under laboratory and greenhouse conditions were also evaluated. The concentration of ar-turmerone in C. longa rhizomes harvested was 0.32% (dwt). Turmeric powder and its derivatives caused 10–20% mortality in third instar T. ni at a very low dose (10 μg/larva). Addition of PBO increased toxicity of turmeric powder and its derivatives (90–97% mortality) in most binary combinations (5 μg of turmeric powder or its derivatives +5 μg of PBO), but neither piperonal nor sesamol were active as synergists. The compound ar-turmerone alone and the combination with PBO reduced larval weight on treated Brassica oleracea in the laboratory and in greenhouse experiments, compared with the negative control. The compound ar-turmerone could be used as a low cost botanical insecticide for integrated management of cabbage looper in vegetable production. PMID:27804972

  5. The efficacy of repellents against Aedes, Anopheles, Culex and Ixodes spp. - a literature review.

    Science.gov (United States)

    Lupi, Eleonora; Hatz, Christoph; Schlagenhauf, Patricia

    2013-01-01

    Travellers are confronted with a variety of vector-borne threats. Is one type of repellent effective against all biting vectors? The aim of this review is to examine the literature, up to December 31st, 2012, regarding repellent efficacy. We searched PubMed for relevant papers. Repellents of interest were DEET, Icaridin as well as other piperidine-derived products (SS220), Insect Repellent (IR) 3535 (ethyl-butylacetyl-amino-propionat, EBAAP) and plant-derived products, including Citriodora (para-menthane-3,8-diol). As vectors, we considered the mosquito species Anopheles, Aedes and Culex as well as the tick species Ixodes. We selected only studies evaluating the protective efficacy of repellents on human skin. We reviewed a total of 102 publications. Repellents were evaluated regarding complete protection time or as percentage efficacy [%] in a time interval. We found no standardized study for tick bite prevention. Regarding Aedes, DEET at concentration of 20% or more, showed the best efficacy providing up to 10 h protection. Citriodora repellency against this mosquito genus was lower compared to the other products. Also between subspecies a difference could be observed: Ae. aegypti proved more difficult to repel than Ae. Albopictus. Fewer studies have been conducted on mosquito species Anopheles and Culex. The repellency profile against Anopheles species was similar for the four principal repellents of interest, providing on average 4-10 h of protection. Culex mosquitoes are easier to repel and all four repellents provided good protection. Few studies have been conducted on the tick species Ixodes. According to our results, the longest protection against Ixodes scapularis was provided by repellents containing IR3535, while DEET and commercial products containing Icaridin or PMD showed a better response than IR3535 against Ixodes ricinus. Many plant-based repellents provide only short duration protection. Adding vanillin 5% to plant-based repellents and to DEET

  6. Repellency of Plant Extracts against the Legume Flower Thrips Megalurothrips sjostedti (Thysanoptera: Thripidae

    Directory of Open Access Journals (Sweden)

    Andnet Abtew

    2015-06-01

    Full Text Available Megalurothrips sjostedti Trybom is an important pest of cowpea (Vigna unguiculata L. in Africa. To propose an alternative to chemical control, the repellency of 24 plant extracts was evaluated against adult female thrips of M. sjostedti in the laboratory. Plant extracts in ethanol were separately applied on a filter paper disk in a still air visual cue olfactometer. The results showed highly significant differences in repellency among extract type, concentration and their interactions. We classified the level of repellency into four categories as strong, good, moderate and weak or non- repellent based on hierarchical ascendant classification. We identified Piper nigrum, Cinnamomum zeylanicum, Cinnamomum cassia as strong repellents. Five extracts were classified as good, eight as moderate and the remaining eight extracts were weak or non-repellent. Repellency of the extracts increased with the concentration suggesting that the behavioral response of M. sjostedti was dose-dependent. Mono- and sesquiterpene hydrocarbon compounds from seven highly repellent extracts were identified by gas chromatography-mass spectrometry (GC/MS. The use of repellent extracts could be useful in developing integrated pest management strategies for thrips on legume crops. In this regard, the specific modes of action of the identified compounds need to be investigated to incorporate them into the existing crop protection strategies.

  7. Weevil x Insecticide: Does 'Personality' Matter?

    Science.gov (United States)

    Morales, Juliana A; Cardoso, Danúbia G; Della Lucia, Terezinha Maria C; Guedes, Raul Narciso C

    2013-01-01

    An insect's behavior is the expression of its integrated physiology in response to external and internal stimuli, turning insect behavior into a potential determinant of insecticide exposure. Behavioral traits may therefore influence insecticide efficacy against insects, compromising the validity of standard bioassays of insecticide activity, which are fundamentally based on lethality alone. By extension, insect 'personality' (i.e., an individual's integrated set of behavioral tendencies that is inferred from multiple empirical measures) may also be an important determinant of insecticide exposure and activity. This has yet to be considered because the behavioral studies involving insects and insecticides focus on populations rather than on individuals. Even among studies of animal 'personality', the relative contributions of individual and population variation are usually neglected. Here, we assessed behavioral traits (within the categories: activity, boldness/shyness, and exploration/avoidance) of individuals from 15 populations of the maize weevil (Sitophilus zeamais), an important stored-grain pest with serious problems of insecticide resistance, and correlated the behavioral responses with the activity of the insecticide deltamethrin. This analysis was performed at both the population and individual levels. There was significant variation in weevil 'personality' among individuals and populations, but variation among individuals within populations accounted for most of the observed variation (92.57%). This result emphasizes the importance of individual variation in behavioral and 'personality' studies. When the behavioral traits assessed were correlated with median lethal time (LT50) at the population level and with the survival time under insecticide exposure, activity traits, particularly the distance walked, significantly increased survival time. Therefore, behavioral traits are important components of insecticide efficacy, and individual variation should be

  8. Effects of Insecticides and Fungicides Commonly Used in Tomato Production on Phytoseiulus persimilis (Acari: Phtyoseiidae).

    Science.gov (United States)

    Ditillo, J L; Kennedy, G G; Walgenbach, J F

    2016-12-01

    The twospotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae), is an important pest of tomatoes in North Carolina. Resident populations of the predatory mite Phytoseiulus persimilis have recently been detected on field-grown tomatoes in central North Carolina, and potentially can be a useful biological control agent against T. urticae Laboratory bioassays were used to assess lethal and reproductive effects of 10 insecticides and five fungicides commonly used in commercial tomato production (chlorantraniliprole, spinetoram, permethrin, imidacloprid, dimethoate, dinotefuran, thiamethoxam, bifenthrin, fenpropathrin, lambda-cyhalothrin, azoxystrobin, chlorothalonil, boscalid, cyazofamid, and mancozeb) on P. persimilis adult females and eggs. Insecticides were tested using concentrations equivalent to 1×, 0.5×, and 0.1× of the recommended field rates. Fungicides were tested at the 1× rate only. Dimethoate strongly impacted P. persimilis with high adult mortality, reduced fecundity, and reduced hatch of eggs laid by treated adults, particularly at high concentrations. The pyrethroids lambda-cyhalothrin, bifenthrin, and fenpropathrin were associated with repellency and reproductive effects at high concentrations. Bifenthrin additionally caused increased mortality at high concentrations. Chlorantraniliprole, dinotefuran, and permethrin did not significantly affect mortality or reproduction. Imidacloprid significantly reduced fecundity and egg viability, but was not lethal to adult P. persimilis Thiamethoxam negatively impacted fecundity at the 1× rate. There were no negative effects associated with fungicide exposure with the exception of mancozeb, which impacted fecundity. Field trials were conducted to explore the in vivo impacts of screened insecticides on P. persimilis populations in the field. Field trials supported the incompatibility of dimethoate with P. persimilis populations. © The Authors 2016. Published by Oxford University Press on behalf

  9. Fungal degradation of organophosphorous insecticides

    Energy Technology Data Exchange (ETDEWEB)

    Bumpus, J.A. [Notre Dame Univ., IN (United States); Kakar, S.N.; Coleman, R.D. [Argonne National Lab., IL (United States)

    1992-07-01

    Organophosphorous insecticides are used extensively to treat a variety of pests and insects. Although as a group they are easily degraded by bacteria in the environment, a number of them have half-lives of several months. Little is known about their biodegradation by fungi. We have shown that Phanerochaete chrysosporium can substantially degrade chlorpyrifos, fonofos, and terbufos (27.5%, 12.2%, and 26.6%, respectively) during 18-day incubation in nitrogen-limited stationary cultures. The results demonstrate that the clorinated pyridinyl ring of chlorpyrifos and the phenyl ring of fonofos undergo ring cleavage during biodegradation by the fungus. The usefulness of the fungus system for bioremediation is discussed. 16 refs., 7 figs., 2 tabs.

  10. Fungal degradation of organophosphorous insecticides

    Energy Technology Data Exchange (ETDEWEB)

    Bumpus, J.A. (Notre Dame Univ., IN (United States)); Kakar, S.N.; Coleman, R.D. (Argonne National Lab., IL (United States))

    1992-01-01

    Organophosphorous insecticides are used extensively to treat a variety of pests and insects. Although as a group they are easily degraded by bacteria in the environment, a number of them have half-lives of several months. Little is known about their biodegradation by fungi. We have shown that Phanerochaete chrysosporium can substantially degrade chlorpyrifos, fonofos, and terbufos (27.5%, 12.2%, and 26.6%, respectively) during 18-day incubation in nitrogen-limited stationary cultures. The results demonstrate that the clorinated pyridinyl ring of chlorpyrifos and the phenyl ring of fonofos undergo ring cleavage during biodegradation by the fungus. The usefulness of the fungus system for bioremediation is discussed. 16 refs., 7 figs., 2 tabs.

  11. Decrease of insecticide resistance over generations without exposure to insecticides in Nilaparvata lugens (Hemipteran: Delphacidae).

    Science.gov (United States)

    Yang, Yajun; Dong, Biqin; Xu, Hongxing; Zheng, Xusong; Tian, Junce; Heong, Kongleun; Lu, Zhongxian

    2014-08-01

    The brown planthopper, Nilaparvata lugens (Stål), is one of the most important insect pests on paddy rice in tropical and temperate Asia. Overuse and misuse of insecticides have resulted in the development of high resistance to many different insecticides in this pest. Studies were conducted to evaluate the change of resistance level to four insecticides over 15 generations without any exposure to insecticides in brown planthopper. After 15 generations' rearing without exposure to insecticide, brown planthopper could reverse the resistance to imidacloprid, chlorpyrifos, fipronil, and fenobucarb. The range and style of resistance reversal of brown planthopper differed when treated with four different insecticides. To monitor potential changes in insect physiological responses, we measured the activity of each of the three selected enzymes, including acetylcholinesterases (AChE), general esterases (EST), and glutathione S-transferases. After multiple generations' rearing without exposure to insecticide, AChE and EST activities of brown planthopper declined with the increased generations, suggesting that the brown planthopper population adjusted activities of EST and AChE to adapt to the non-insecticide environment. These findings suggest that the reducing, temporary stop, or rotation of insecticide application could be incorporated into the brown planthopper management.

  12. Substitution of PFAS chemistry in outdoor apparel and the impact on repellency performance.

    Science.gov (United States)

    Hill, Philippa J; Taylor, Mark; Goswami, Parikshit; Blackburn, Richard S

    2017-08-01

    Intensifying legislation and increased research on the toxicological and persistent nature of per- and polyfluoroalkyl substances (PFASs) have recently influenced the direction of liquid repellent chemistry use; environmental, social, and sustainability responsibilities are at the crux. Without PFAS chemistry, it is challenging to meet current textile industry liquid repellency requirements, which is a highly desirable property, particularly in outdoor apparel where the technology helps to provide the wearer with essential protection from adverse environmental conditions. Herein, complexities between required functionality, legislation and sustainability within outdoor apparel are discussed, and fundamental technical performance of commercially available long-chain (C8) PFASs, shorter-chain (C6) PFASs, and non-fluorinated repellent chemistries finishes are evaluated comparatively. Non-fluorinated finishes provided no oil repellency, and were clearly inferior in this property to PFAS-finished fabrics that demonstrated good oil-resistance. However, water repellency ratings were similar across the range of all finished fabrics tested, all demonstrating a high level of resistance to wetting, and several non-fluorinated repellent fabrics provide similar water repellency to long-chain (C8) PFAS or shorter-chain (C6) PFAS finished fabrics. The primary repellency function required in outdoor apparel is water repellency, and we would propose that the use of PFAS chemistry for such garments is over-engineering, providing oil repellency that is in excess of user requirements. Accordingly, significant environmental and toxicological benefits could be achieved by switching outdoor apparel to non-fluorinated finishes without a significant reduction in garment water-repellency performance. These conclusions are being supported by further research into the effect of laundering, abrasion and ageing of these fabrics. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Transformation of the insecticide teflubenzuron by microorganisms

    NARCIS (Netherlands)

    Finkelstein, Z.I.; Baskunov, B.P.; Rietjens, I.M.C.M.; Boersma, M.G.; Vervoort, J.; Golovleva, L.A.

    2001-01-01

    Transformation of teflubenzuron, the active component in the insecticide commercialized as Nomolt, by soil microorganisms was studied. It was shown that microorganisms, belonging to Bacillus, Alcaligenes, Pseudomonas and Acinetobacter genera are capable to perform the hydrolytic cleavage of the

  14. Repelência e deterrência na oviposição de Bemisia tabaci biótipo B pelo uso de extratos vegetais em Cucurbita pepo L Repellence and deterrence on oviposition of Bemisia tabaci biotype B by the use of vegetal extracts in Cucurbita pepo L

    Directory of Open Access Journals (Sweden)

    J.P.G.F. Silva

    2012-01-01

    Full Text Available Bemisia tabaci biótipo B é um dos principais insetos-praga na cultura da abobrinha (Cucurbita pepo L.. O manejo dessa mosca-branca tornou-se grande desafio aos agricultores, uma vez que esta apresenta rápida capacidade de desenvolver resistência a diferentes classes de inseticidas. Como alternativa vem sendo investigado o uso de extratos vegetais com atividades inseticida e/ou insetistática, os quais têm revelado resultados promissores no combate a inseto. O presente trabalho teve por objetivo avaliar os possíveis efeitos de sete extratos provenientes de cinco espécies vegetais, Ruta graveolens L. (folhas, Azadirachta indica A. Juss. (folhas + ramos, Trichilia pallida Swartz (ramos, T. pallida (folhas, A. indica (amêndoas, Chenopodium ambrosioides L. (inflorescências + ramos+ folhas e Mentha pulegium L. (folhas, sobre Bemisia tabaci biótipo B em abobrinha, por meio de testes de repelência e deterrência para oviposição. Em teste com chance de escolha, avaliou-se a atratividade e determinou-se o índice de repelência após 6, 24 e 48 horas da aplicação dos extratos. A oviposição foi verificada após a terceira contagem do número de adultos. O extrato à base de folhas de M. pulegium mostrou repelência e deterrência à oviposição de B. tabaci biótipo B, podendo ser recomendado como alternativa para o manejo do inseto.Bemisia tabaci biotype B is one of the main pests in squash (Cucurbita pepo L.. The management of this whitefly has become a major challenge to growers, since they have the ability to quickly develop resistance to different classes of insecticides. Alternatively, the use of plant extracts with insecticide and/or insectistatic activities has been investigated, showing promising results for the whitefly control. The present study evaluated the possible effects of seven extracts from five plant species, Ruta graveolens L. (leaves, Azadirachta indica A. Juss. (leaves + branches, Trichilia pallida Swartz (branches

  15. Evaluation of DEET and eight essential oils for repellency against nymphs of the lone star tick, Amblyomma americanum (Acari: Ixodidae)

    Science.gov (United States)

    Eight commercially available essential oils (oregano, clove, thyme, vetiver, sandalwood, cinnamon, cedarwood, and peppermint) were evaluated for repellency against host-seeking nymphs of the lone star tick, Amblyomma americanum. Concentration- repellency response was established using the vertical ...

  16. Application of minidisk infiltrometer to estimate soil water repellency

    Science.gov (United States)

    Alagna, Vincenzo; Iovino, Massimo; Bagarello, Vincenzo; Mataix-Solera, Jorge; Lichner, Ľubomír

    2016-04-01

    Soil water repellency (SWR) reduces affinity of soils to water resulting in detrimental implication for plants growth as well as for hydrological processes. During the last decades, it has become clear that SWR is much more widespread than formerly thought, having been reported for a wide variety of soils, land uses and climatic conditions. The repellency index (RI), based on soil-water to soil-ethanol sorptivity ratio, was proposed to characterize subcritical SWR that is the situation where a low degree of repellency impedes infiltration but does not prevent it. The minidisk infiltrometer allows adequate field assessment of RI inherently scaled to account for soil physical properties other than hydrophobicity (e.g., the volume, connectivity and the geometry of pores) that directly influence the hydrological processes. There are however some issues that still need consideration. For example, use of a fixed time for both water and ethanol sorptivity estimation may lead to inaccurate RI values given that water infiltration could be negligible whereas ethanol sorptivity could be overestimated due to influence of gravity and lateral diffusion that rapidly come into play when the infiltration process is very fast. Moreover, water and ethanol sorptivity values need to be determined at different infiltration sites thus implying that a large number of replicated runs should be carried out to obtain a reliable estimate of RI for a given area. Minidisk infiltrometer tests, conducted under different initial soil moisture and management conditions in the experimental sites of Ciavolo, Trapani (Italy) and Javea, Alicante (East Spain), were used to investigate the best applicative procedure to estimate RI. In particular, different techniques to estimate the water, Sw, and ethanol, Se, sorptivities were compared including i) a fixed 1-min time interval, ii) the slope of early-time 1D infiltration equation and iii) the two-term transient 3D infiltration equation that explicitly

  17. Improvement of Water Movement in an Undulating Sandy Soil Prone to Water Repellency

    NARCIS (Netherlands)

    Oostindie, K.; Dekker, L.W.; Wesseling, J.G.; Ritsema, C.J.

    2011-01-01

    The temporal dynamics of water repellency in soils strongly influence water flow. We investigated the variability of soil water content in a slight slope on a sandy fairway exhibiting water-repellent behavior. A time domain reflectometry (TDR) array of 60 probes measured water contents at 3-h

  18. Repellent activity of monoterpenoid esters with neurotransmitter amino acids against yellow fever mosquito, Aedes aegypti

    Directory of Open Access Journals (Sweden)

    Nesterkina Mariia

    2018-03-01

    Full Text Available Repellent activity of monoterpenoid esters (1-6 with neurotransmitter amino acids (GABA and glycine was investigated against Aedes aegypti by using a “cloth-patch” assay and compared to reference standard N,N-diethyl-3-methylbenzamide (DEET. Monoterpenoid esters showed repellent activity with minimum effective dosages (MED in the range of 0.031-0.469 mg/cm2. The carvacrol ester of GABA (2, MED of 0.031 ± 0.008 mg/cm2 exhibited the highest repellency of six monoterpenoid esters tested in comparison to the standard repellent DEET (MED of 0.009 ± 0.002 mg/cm2; however, the repellent activity of carvacrol-glycine ester (5 decreased 4-fold compared to the carvacrol-GABA derivative (2. The repellent activities of menthol GABA (1, MED= 0.375 ± 0.000 mg/cm2 and glycine ester (4, MED=0.312 ± 0.063 mg/cm2 were similar The guaiacol-glycine ester (6 was 3.75-fold more efficacious than the guaiacol ester of GABA (3. In the present study, we report repellent efficacy of prolonged exposure to GABA and glycine esters of menthol, carvacrol, guaiacol (1-6 as compared to the repellent activities of their monoterpene moieties alone.

  19. Effect of water repellent preservatives and other wood treatments on restoration and durability of millwork

    Science.gov (United States)

    R. Sam Williams

    2001-01-01

    This report describes the long-term performance of painted window units that were placed outdoors near Madison, Wisconsin, in 1956. Covered in this report are the effects of the initial water repellent preservative (WRP) treatment during the first 6 years of exposure, a comparison of the water repellent effectiveness (WRE) ofthe WRP with the condition of the windows...

  20. New procedure for sampling infiltration to assess post-fire soil water repellency

    Science.gov (United States)

    P. R. Robichaud; S. A. Lewis; L. E. Ashmun

    2008-01-01

    The Mini-disk Infiltrometer has been adapted for use as a field test of post-fire infiltration and soil water repellency. Although the Water Drop Penetration Time (WDPT) test is the common field test for soil water repellency, the Mini-disk Infiltrometer (MDI) test takes less time, is less subjective, and provides a relative infiltration rate. For each test, the porous...

  1. Essential oils and their compositions as spatial repellents for pestiferous social wasps.

    Science.gov (United States)

    Zhang, Qing-He; Schneidmiller, Rodney G; Hoover, Doreen R

    2013-04-01

    The study objectives were: (1) to field test potential repellency of common essential oils against several pestiferous social wasps (Hymenoptera: Vespidae), using attractant-baited traps; (2) to identify vespid antennally active compounds from the repellent essential oils; (3) to determine potential repellency of these electroantennographic detection (EAD) active compounds in the field. Of the 21 essential oils tested, 17 showed significant repellency on yellowjackets [mainly Vespula pensylvanica (Saussure)] and paper wasps [mainly Polistes dominulus (Christ)]: clove, pennyroyal, lemongrass, ylang ylang, spearmint, wintergreen, sage, rosemary, lavender, geranium, patchouli, citronella, Roman chamomile, thyme, fennel seed, anise and peppermint. Two essential oil mixtures - 3EO-mix (clove, geranium and lemongrass) and 4EO-mix (clove, geranium, lemongrass and rosemary) - totally blocked the attraction of vespid workers. Twenty-nine vespid antennally active compounds were identified from solid-phase microextraction (SPME) samples of 11 strongly repellent essential oils by GC-EAD/MS techniques. Among the synthetic EAD-active compounds field tested, eugenol, P/I-menthone, pulegone, α/β-thujone, l-carvone, E/Z-citral, citronellal, methyl benzoate, benzyl acetate, methyl salicylate and 3-octanol showed a significant repellency on vespid workers. These compounds are likely responsible for the repellency of their corresponding essential oils. These repellent essential oils and their active compositions have great potential for efficient, environmentally sound semiochemical-based IPM of pestiferous vespid wasps. © 2012 Society of Chemical Industry.

  2. Spatial repellency screening in a high-throughput apparatus with Aedes aegypti and Anopheles gambiae

    Science.gov (United States)

    Spatial repellents are essential for personal protection against mosquitoes, such as Aedes aegypti and Anopheles gambiae, to reduce annoyance biting and transmission of mosquito-borne diseases. The number of safe and effective repellents, including DEET, picaridin, and IR3535, is limited and contin...

  3. Temporal fluctuations in soil water repellency following wildfire in chaparral steeplands, southern California

    Science.gov (United States)

    K.R. Hubbert; V. Oriol

    2005-01-01

    Soil water repellency is partularly common in unburned chaparral, and its degree and duration can be influenced by seasonal weather conditions. Water repellency tends to increase in dry soils, whil eit decreases or vanishes following precipitation or extended periods of soil moisture. The 15426 ha Williams Fire provided an opportunity to investigate post-fire...

  4. [Studies on reduction of repellent force of rare earth magnets--concerning tooth intrusion].

    Science.gov (United States)

    Kitsugi, A

    1992-12-01

    The purpose of this investigation was to evaluate the sealing effect of the repelling force of the magnets with ferromagnetic stainless steel and also to examine the reduction pattern along with the change of the relative position of the magnets. The Nd-Fe-B magnet as rare earth magnet, and SUSXM 27, YEP-3, SUS 416 as ferromagnetic stainless steel were used in this experiment. The findings were as follows: 1. There was a little decrease of the repelling force of the magnets sealed with ferromagnetic stainless steel. On the other hand, no significant differences in the repelling force sealed with any kind of ferromagnetic stainless steel were found. 2. Direct contact of the repelling force of the phi 4.0 x 1.5 mm magnets sealed with SUSXM 27 of 0.2 mm in thickness was 242 gf. According to relative horizontal 1.2 mm movement keeping direct contact, the vertical and horizontal components of the repelling force were of the same value. 3. The repelling force of the phi 10.0 x 1.8 mm magnets sealed with SUSXM 27 of 0.2 mm in thickness was 815 gf. It showed more than 300 gf of vertical component of the repelling force when the magnets shifted to 3.0 mm horizontally when in contact. 4. It is suggested that the repelling force of the Nd-Fe-B magnets will be clinically useful for the intrusion of molar teeth.

  5. Spatial repellents on strips of camouflage netting reduce mosquito collections in a field environment

    Science.gov (United States)

    Barrier treatments can be effective in reducing host seeking mosquito vectors and provide an additional layer of passive defense, reducing disease risk. Devices designed to release spatial repellents or direct application of spatial repellents to artificial surfaces can serve as efficient barriers r...

  6. Oleoresin Capsicum has Potential as a Rodent Repellent in Direct Sedding Longleaf Pine

    Science.gov (United States)

    James P. Barnett

    1998-01-01

    Direct seeding of southern pines has been a versatile and inexpensive alternative to planting on many reforestation sites across the South. Successful direct seeding has required that seeds be coated with thiram to repel birds, and with endrin to repel rodents. Endrin, which is extremely toxic, is no longer produced in the United States. Therefore, a substitute is...

  7. Measuring and understanding soil water repellency through novel interdisciplinary approaches

    Science.gov (United States)

    Balshaw, Helen; Douglas, Peter; Doerr, Stefan; Davies, Matthew

    2017-04-01

    Food security and production is one of the key global issues faced by society. It has become evermore essential to work the land efficiently, through better soil management and agronomy whilst protecting the environment from air and water pollution. The failure of soil to absorb water - soil water repellency - can lead to major environmental problems such as increased overland flow and soil erosion, poor uptake of agricultural chemicals and increased risk of groundwater pollution due to the rapid transfer of contaminants and nutrient leaching through uneven wetting and preferential flow pathways. Understanding the causes of soil hydrophobicity is essential for the development of effective methods for its amelioration, supporting environmental stability and food security. Organic compounds deposited on soil mineral or aggregate surfaces have long been recognised as a major factor in causing soil water repellency. It is widely accepted that the main groups of compounds responsible are long-chain acids, alkanes and other organic compounds with hydrophobic properties. However, when reapplied to sands and soils, the degree of water repellency induced by these compounds and mixtures varied widely with compound type, amount and mixture, in a seemingly unpredictable way. Our research to date involves two new approaches for studying soil wetting. 1) We challenge the theoretical basis of current ideas on the measured water/soil contact angle measurements. Much past and current discussion involves Wenzel and Cassie-Baxter models to explain anomalously high contact angles for organics on soils, however here we propose that these anomalously high measured contact angles are a consequence of the measurement of a water drop on an irregular non-planar surface rather than the thermodynamic factors of the Cassie-Baxter and Wenzel models. In our analysis we have successfully used a much simpler geometric approach for non-flat surfaces such as soil. 2) Fluorescent and phosphorescent

  8. Modeling global distribution of agricultural insecticides in surface waters.

    Science.gov (United States)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J; Schäfer, Ralf B; Fornaroli, Riccardo; Liess, Matthias

    2015-03-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. Use of repellents formulated in Specialized Pheromone and Lure Application Technology (SPLAT®) for effective insect pest management

    Science.gov (United States)

    Agenor Mafra-Neto; Christopher J. Fettig; A. Steven Munson; Lukasz L. Stelinski

    2014-01-01

    Despite the many impediments to commercialization of insect repellents in agriculture and forestry, there are some situations where the use of repellents is desirable and warranted. ISCA Technologies (Riverside, California), together with collaborators from academic, government, and private sectors, is actively developing repellent formulations against several...

  10. Laboratory and semi-field evaluations of two (Transfluthrin) spatial repellent devices against Aedes aegypti (L.) (Diptera: Culicidae)

    Science.gov (United States)

    Two transfluthrin-based spatial repellent products (Raid Dual Action Insect Repellent and Home Freshener and Raid Shield (currently not commercially available), SC Johnson, Racine WI) were evaluated for spatial repellent effects against female Aedes aegypti (L.) mosquitoes underlaboratory (wind tunn...

  11. Preliminary Study of Water Repellent Properties of Red Pepper Seed Oil

    Science.gov (United States)

    Kurniawan, F.; Madurani, K. A.; Wahyulis, N. C.

    2017-03-01

    The water-repellent properties of red pepper seed oil (capsicol) have been studied. The oil was coated on the glass surface by spray technique. Water repellent properties were performed by measuring the contact angle of water droplets. The measurement was conducted by varying the drying time of the oil coating at room temperature. The optimum contact angle of the droplets on the glass with capsicol coating is 46.77°, which can be achieved in 30 min of drying time. It also obtained the smallest diameter of the droplets (0.47 cm). The longer drying time decrease the contact angles and increases the diameter. The results were compared with the bare glass and commercial water repellent. The contact angle of the droplets on the glass surface with capsicol coating is higher than bare glass, but lower than glass with commercial water repellent coating. It means that capsicol has the water-repellent properties.

  12. Evaluation of Repellency Effect of Essential Oils of Satureja khuzestanica (Carvacrol, Myrtus communis (Myrtle, Lavendula officinalis and Salvia sclarea using Standard WHO Repellency Tests.

    Directory of Open Access Journals (Sweden)

    Mohammad Hassan Kayedi

    2014-06-01

    Full Text Available Using special lotions and repellent sprays on skin is one of the effective methods to prevent Arthropods biting which was verified in this study.Essential oils of four plants (Satureja khuzestanica, Salvia sclarea, Lavendula officinalis and Myrtus communis were separately extracted by Clevenger used hydro distillation method. Then separated solutions with 10%, 20% and 40% concentrations of essential oils of plants in 99.6 % ethanol were prepared. WHO guidelines for efficacy testing of mosquito repellents for human skin were used on different concentrations of essential oils of plants, traditional repellents (DEET, 50% and 33% as positive control, and ethanol 99.6% and naked hands as negative controls.In negative control groups, the number of bits were comparable (P= 0.42 and had decreasing time trends (naked hands P= 0.011, ethanol P< 0.001. In all time points, minimum bites were observed in traditional repellents and it was significantly less than the other groups (P< 0.001. The time trend in the number of bites in the other groups was positive and showed minimum number of bites in time zero in all groups. We also found that the concentration of repellents had association with the number of bites. The maximum and minimum numbers of bites were observed with 10% and 40% concentrations respectively in all groups.Essential oils of Salvia sclarea, Lavendula officinalis and Myrtus communis have repellency effect, even with 10% concentration of essential oils.

  13. Malaria Vector Control Still Matters despite Insecticide Resistance.

    Science.gov (United States)

    Alout, Haoues; Labbé, Pierrick; Chandre, Fabrice; Cohuet, Anna

    2017-08-01

    Mosquito vectors' resistance to insecticides is usually considered a major threat to the recent progresses in malaria control. However, studies measuring the impact of interventions and insecticide resistance reveal inconsistencies when using entomological versus epidemiological indices. First, evaluation tests that do not reflect the susceptibility of mosquitoes when they are infectious may underestimate insecticide efficacy. Moreover, interactions between insecticide resistance and vectorial capacity reveal nonintuitive outcomes of interventions. Therefore, considering ecological interactions between vector, parasite, and environment highlights that the impact of insecticide resistance on the malaria burden is not straightforward and we suggest that vector control still matters despite insecticide resistance. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Efeito repelente de azadiractina e óleos essenciais sobre Aphis gossypii Glover (Hemiptera: Aphididae em algodoeiro Repellent effect of azadirachtin and essential oils on Aphis gossypii Glover (Hemiptera: Aphididae in cotton plants

    Directory of Open Access Journals (Sweden)

    Lígia Helena de Andrade

    2013-09-01

    Full Text Available A repelência de inseticidas botânicos tem se destacado como uma tática promissora no controle alternativo de pragas agrícolas e urbanas, podendo ser um dos componentes do manejo integrado de pragas. Objetivou-se com este trabalho identificar a repelência de inseticidas botânicos sobre fêmeas ápteras de Aphis gossypii Glover. Testes com chance de escolha foram realizados com discos de folha de algodoeiro, imersos nas caldas dos inseticidas e testemunha (água destilada com DMSO a 2%. Utilizou-se azadirachtina (0,075% e os óleos essenciais de Piper hispidinervum CDC, P. aduncum L., Cymbopogon winterianus (L., C. citratus (D.C. Stapf, Foeniculum vulgare Mill, Syzygium aromaticum (L. Merrill e Perry, Cinnamomum zeylanicum Blume, Schinus terebinthifolius Raddi e Chenopodium ambrosioides L. na concentração de 0,05%. C. citratus, C. winterianus, P. aduncum, S. terebinthifolius, azadirachtina e C. zeylanicum apresentaram os maiores percentuais de repelência, 100; 84; 66,67; 64; 60,87 e 48% respectivamente e reduziram a produção de ninfas em 100; 92; 42,9; 87,5; 80,65 e 89,74%, apresentando resultados significativos pelo teste do χ2 ao nível de 10% de probabilidade. Nos testes com F. vulgare (χ2 = 3,66, P = 0,05 as fêmeas de A. gossypii foram atraídas significativamente para os discos tratados e ocorreu um aumento na produção de ninfas nos resultados obtidos para F. vulgare (χ2 = 5,87, P = 0,02 e C. ambrosioides (χ2 = 14,31, P = 0,001.The repellence of botanical insecticides has emerged as a promising technique in the alternative control of urban and agricultural pests, being seen as one component of integrated pest management. The aim of this work was to identify the repellence of botanical insecticides on apterous females of Aphis gossypii Glover. Random-choice tests were carried out with discs from the leaves of cotton plants immersed in insecticide solution and in a control (distilled water with 2% DMSO. Azadirachtin was used

  15. Water repellency of clay, sand and organic soils in Finland

    Directory of Open Access Journals (Sweden)

    K. RASA

    2008-12-01

    Full Text Available Water repellency (WR delays soil wetting process, increases preferential flow and may give rise to surface runoff and consequent erosion. WR is commonly recognized in the soils of warm and temperate climates. To explore the occurrence of WR in soils in Finland, soil R index was studied on 12 sites of different soil types. The effects of soil management practice, vegetation age, soil moisture and drying temperature on WR were studied by a mini-infiltrometer with samples from depths of 0-5 and 5-10 cm. All studied sites exhibited WR (R index >1.95 at the time of sampling. WR increased as follows: sand (R = 1.8-5.0 < clay (R = 2.4-10.3 < organic (R = 7.9-undefined. At clay and sand, WR was generally higher at the soil surface and at the older sites (14 yr., where organic matter is accumulated. Below 41 vol. % water content these mineral soils were water repellent whereas organic soil exhibited WR even at saturation. These results show that soil WR also reduces water infiltration at the prevalent field moisture regime in the soils of boreal climate. The ageing of vegetation increases WR and on the other hand, cultivation reduces or hinders the development of WR.;

  16. Sustainable manufacture of insect repellents derived from Nepeta cataria.

    Science.gov (United States)

    Patience, Gregory S; Karirekinyana, Ginette; Galli, Federico; Patience, Nicolas A; Kubwabo, Cariton; Collin, Guy; Bizimana, Jean Claude; Boffito, Daria C

    2018-02-02

    Malaria devastates sub-Saharan Africa; the World Health Organization (WHO) estimates that 212 million people contract malaria annually and that the plasmodium virus will kill 419 000 in 2017. The disease affects rural populations who have the least economic means to fight it. Impregnated mosquito nets have reduced the mortality rate but the Anopheles mosquitoes are changing their feeding patterns and have become more active at dusk and early morning rather than after 22h00 as an adaptation to the nets. Everyone is susceptible to the Anopheles at these times but infants and pregnant women are the most vulnerable to the disease. Plant-based mosquito repellents are as effective as synthetic repellents that protect people from bites. They are sustainable preventative measures against malaria not only because of their efficacy but because the local population can produce and distribute them, which represents a source of economic growth for rural areas. Here, we extract and test the essential oil nepetalactone from Nepeta cataria via steam distillation. Families in endemic areas of Burundi found them effective against bites but commented that the odor was pungent. An epidemiological study is required to establish its clinical efficacy.

  17. Ionic-Liquid-Infused Nanostructures as Repellent Surfaces.

    Science.gov (United States)

    Galvan, Yaraset; Phillips, Katherine R; Haumann, Marco; Wasserscheid, Peter; Zarraga, Ramon; Vogel, Nicolas

    2018-02-02

    In order to prepare lubricant-infused repellent coatings on silica nanostructures using low vapor pressure ionic liquids as lubricants, we study the wetting behavior of a set of imidazolium-based ionic liquids with different alkyl side chains as a function of the applied surface functionalities. We take advantage of the structural color of inverse opals prepared from a colloidal coassembly technique to study the infiltration of ionic liquids into these nanoporous structures. We find that the more hydrophobic ionic liquids with butyl and hexyl side chains can completely infiltrate inverse opals functionalized with mixed self-assembled monolayers composed of imidazole groups and aliphatic hydrocarbon chains, which we introduce via silane chemistry. These molecular species reflect the chemical nature of the ionic liquid, thereby increasing the affinity between the liquid and solid surface. The mixed surface chemistry provides sufficiently small contact angles with the ionic liquid to infiltrate the nanopores while maximizing the contact angle with water. As a result, the mixed monolayers enable the design of a stable ionic liquid/solid interface that is able to repel water as a test liquid. Our results underline the importance of matching chemical affinities to predict and control the wetting behavior in complex, multiphase systems.

  18. Laser removal of water repellent treatments on limestone

    Energy Technology Data Exchange (ETDEWEB)

    Gomez-Heras, Miguel; Alvarez de Buergo, Monica; Rebollar, Esther; Oujja, Mohamed; Castillejo, Marta; Fort, Rafael

    2003-12-15

    Protective and water repellent treatments are applied on stone materials used on buildings or sculptures of artistic value to reduce water intrusion without limiting the natural permeability to water vapour of the material. The effect of the wavelength associated with the laser removal of two water repellent treatments applied on limestone, Paraloid B-72, a copolymer of methyl acrylate and ethyl methacrylate, and Tegosivin HL-100, a modified polysiloxane resin, was investigated by using the four harmonics of a Q-switched Nd:YAG laser (1064, 532, 355 and 266 nm). The modifications induced on the surface of limestone samples by laser irradiation were studied using colorimetry, roughness measurements and scanning electron microscopy (SEM). The removal of the treatments was found to be dependent on the laser irradiation conditions and on the characteristics of the coatings. The fundamental laser radiation was effective in removing both treatments, but thermal alteration processes were induced on the constituent calcite crystals. The best results were obtained by irradiation in the near UV at 355 nm.

  19. Insecticidal activity of garlic essential oil and their constituents against the mealworm beetle, Tenebrio molitor Linnaeus (Coleoptera: Tenebrionidae)

    Science.gov (United States)

    Plata-Rueda, Angelica; Martínez, Luis Carlos; Santos, Marcelo Henrique Dos; Fernandes, Flávio Lemes; Wilcken, Carlos Frederico; Soares, Marcus Alvarenga; Serrão, José Eduardo; Zanuncio, José Cola

    2017-01-01

    This study evaluated the insecticidal activity of garlic, Allium sativum Linnaeus (Amaryllidaceae) essential oil and their principal constituents on Tenebrio molitor. Garlic essential oil, diallyl disulfide, and diallyl sulfide oil were used to compare the lethal and repellent effects on larvae, pupae and adults of T. molitor. Six concentrations of garlic essential oil and their principal constituents were topically applied onto larvae, pupae and adults of this insect. Repellent effect and respiration rate of each constituent was evaluated. The chemical composition of garlic essential oil was also determined and primary compounds were dimethyl trisulfide (19.86%), diallyl disulfide (18.62%), diallyl sulfide (12.67%), diallyl tetrasulfide (11.34%), and 3-vinyl-[4H]-1,2-dithiin (10.11%). Garlic essential oil was toxic to T. molitor larva, followed by pupa and adult. In toxic compounds, diallyl disulfide was the most toxic than diallyl sulfide for pupa > larva > adult respectively and showing lethal effects at different time points. Garlic essential oil, diallyl disulfide and diallyl sulfide induced symptoms of intoxication and necrosis in larva, pupa, and adult of T. molitor between 20–40 h after exposure. Garlic essential oil and their compounds caused lethal and sublethal effects on T. molitor and, therefore, have the potential for pest control. PMID:28425475

  20. Insecticidal activity of garlic essential oil and their constituents against the mealworm beetle, Tenebrio molitor Linnaeus (Coleoptera: Tenebrionidae).

    Science.gov (United States)

    Plata-Rueda, Angelica; Martínez, Luis Carlos; Santos, Marcelo Henrique Dos; Fernandes, Flávio Lemes; Wilcken, Carlos Frederico; Soares, Marcus Alvarenga; Serrão, José Eduardo; Zanuncio, José Cola

    2017-04-20

    This study evaluated the insecticidal activity of garlic, Allium sativum Linnaeus (Amaryllidaceae) essential oil and their principal constituents on Tenebrio molitor. Garlic essential oil, diallyl disulfide, and diallyl sulfide oil were used to compare the lethal and repellent effects on larvae, pupae and adults of T. molitor. Six concentrations of garlic essential oil and their principal constituents were topically applied onto larvae, pupae and adults of this insect. Repellent effect and respiration rate of each constituent was evaluated. The chemical composition of garlic essential oil was also determined and primary compounds were dimethyl trisulfide (19.86%), diallyl disulfide (18.62%), diallyl sulfide (12.67%), diallyl tetrasulfide (11.34%), and 3-vinyl-[4H]-1,2-dithiin (10.11%). Garlic essential oil was toxic to T. molitor larva, followed by pupa and adult. In toxic compounds, diallyl disulfide was the most toxic than diallyl sulfide for pupa > larva > adult respectively and showing lethal effects at different time points. Garlic essential oil, diallyl disulfide and diallyl sulfide induced symptoms of intoxication and necrosis in larva, pupa, and adult of T. molitor between 20-40 h after exposure. Garlic essential oil and their compounds caused lethal and sublethal effects on T. molitor and, therefore, have the potential for pest control.

  1. Modeling global distribution of agricultural insecticides in surface waters

    International Nuclear Information System (INIS)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J.; Schäfer, Ralf B.; Fornaroli, Riccardo; Liess, Matthias

    2015-01-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. - Highlights: • First global map on insecticide runoff through modelling. • Model predicts upper limit of insecticide exposure when compared to field data. • Water bodies in 40% of global land surface may be at risk of adverse effects. • Insecticide application rate, terrain slope and rainfall main drivers of exposure. - We provide the first global map on insecticide runoff to surface water predicting that water bodies in 40% of global land surface may be at risk of adverse effects

  2. Neurobehavioral toxicology of pyrethroid insecticides

    International Nuclear Information System (INIS)

    Crofton, K.M.

    1986-01-01

    Pyrethroid insecticides are classified as either Type I or Type II based upon in vivo toxic signs, and neurophysiological and biochemical data. Both axonal sodium channels and the γ-aminobutyric acid (GABA) receptor complex have been proposed as the major site of action of the Type II pyrethroids. This investigation characterized the behavior and biochemical effects of low dosages of pyrethroids in rats. Type I and II pyrethroids were tested for effects on figure-eight maze activity and the acoustic startle response (ASR). All compounds decreased figure-eight maze activity. Interactions of Type I and II pyrethroids with the three major binding sites on the GABA complex were determined in vivo. Radioligand binding experiments assessed in vitro interactions of pyrethroids with the three major GABA-complex binding sites. None of the pyrethroids competed for [ 3 H]-muscimol or [ 3 H]-flunitrazepam binding. Only Type II pyrethroids inhibited binding of [ 35 S]-t-butylbicyclophosphorothionate (TBPS) in cortical synaptosome preparations with K/sub i/ values of 5 to 10 μM. The [ 35 S]-TBPS data implicate the TBPS/picrotoxinin binding site in the mechanism of Type II pyrethroid toxicity. The results of these experiments support the classification of pyrethroids into two classes, and demonstrate the utility of the figure-eight maze and the ASR in studies to elucidate neurotoxic mechanisms. The interaction of the Type II pyrethroids is probably restricted to the TBPS/picrotoxinin binding domain on the GABA complex as shown by both the in vivo and in vitro studies

  3. A low-cost repellent for malaria vectors in the Americas: results of two field trials in Guatemala and Peru.

    Science.gov (United States)

    Moore, Sarah J; Darling, Samuel T; Sihuincha, Moisés; Padilla, Norma; Devine, Gregor J

    2007-08-01

    The cost of mosquito repellents in Latin America has discouraged their wider use among the poor. To address this problem, a low-cost repellent was developed that reduces the level of expensive repellent actives by combining them with inexpensive fixatives that appear to slow repellent evaporation. The chosen actives were a mixture of para-menthane-diol (PMD) and lemongrass oil (LG). To test the efficacy of the repellent, field trials were staged in Guatemala and Peru. Repellent efficacy was determined by human-landing catches on volunteers who wore the experimental repellents, control, or 15% DEET. The studies were conducted using a balanced Latin Square design with volunteers, treatments, and locations rotated each night. In Guatemala, collections were performed for two hours, commencing three hours after repellent application. The repellent provided >98% protection for five hours after application, with a biting pressure of >100 landings per person/hour. The 15% DEET control provided lower protection at 92% (p 46 landings per person/hour. The 20% DEET control provided significantly lower protection at 64% (p < 0.0001). In both locations, the PMD/LG repellent provided excellent protection up to six hours after application against a wide range of disease vectors including Anopheles darlingi. The addition of fixatives to the repellent extended its longevity while enhancing efficacy and significantly reducing its cost to malaria-endemic communities.

  4. A low-cost repellent for malaria vectors in the Americas: results of two field trials in Guatemala and Peru

    Directory of Open Access Journals (Sweden)

    Sihuincha Moisés

    2007-08-01

    Full Text Available Abstract Background The cost of mosquito repellents in Latin America has discouraged their wider use among the poor. To address this problem, a low-cost repellent was developed that reduces the level of expensive repellent actives by combining them with inexpensive fixatives that appear to slow repellent evaporation. The chosen actives were a mixture of para-menthane-diol (PMD and lemongrass oil (LG. Methods To test the efficacy of the repellent, field trials were staged in Guatemala and Peru. Repellent efficacy was determined by human-landing catches on volunteers who wore the experimental repellents, control, or 15% DEET. The studies were conducted using a balanced Latin Square design with volunteers, treatments, and locations rotated each night. Results In Guatemala, collections were performed for two hours, commencing three hours after repellent application. The repellent provided >98% protection for five hours after application, with a biting pressure of >100 landings per person/hour. The 15% DEET control provided lower protection at 92% (p 46 landings per person/hour. The 20% DEET control provided significantly lower protection at 64% (p Conclusion In both locations, the PMD/LG repellent provided excellent protection up to six hours after application against a wide range of disease vectors including Anopheles darlingi. The addition of fixatives to the repellent extended its longevity while enhancing efficacy and significantly reducing its cost to malaria-endemic communities.

  5. Effect of insecticide-treated bed nets on house-entry by malaria mosquitoes: The flight response recorded in a semi-field study in Kenya.

    Science.gov (United States)

    Spitzen, Jeroen; Koelewijn, Teun; Mukabana, W Richard; Takken, Willem

    2017-08-01

    Insecticide-treated nets are currently a major tool to reduce malaria transmission. Their level of repellency affects contact of the mosquito with the net, but may also influence the mosquito's entry into the house. The response of host-seeking malaria mosquitoes approaching the eave of an experimental house was recorded within a large screen house. We compared entry- and exit rates in relation to the presence in the house of different insecticide-treated bed nets (ITNs) with an untreated net. Mosquitoes were lured towards the house by dispensing a synthetic host-odour blend from within the net in the house. Complementary WHO bioassays revealed that the treated nets caused high knock-down- and mortality responses to the Anopheles gambiae sensu stricto strain tested. The proportion of mosquitoes that came into view of the cameras and subsequently entered the house did not differ between treated nets and the untreated net. Treated nets did not affect proportions of mosquitoes that exited the house and departed from view around the eave. However, the percentage of house-leaving and re-entering mosquitoes when an insecticide- treated net was present, was lower than in the presence of an untreated net. Our results indicated that there was no spatial repellent effect from pyrethroid-treated nets that influences house-entry at eave level. It is argued that the toxic effect of treated bed nets resulted in a reduced number of mosquitoes re-entering the house, which could thereby affect malaria transmission in neighbouring, unprotected houses. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  6. Application of Super-Hydrophobic Coating for Enhanced Water Repellency of Ballistic Fabric

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Barton [ORNL; Rajic, Slobodan [ORNL; Hunter, Scott Robert [ORNL

    2014-10-01

    The objective of this work was to demonstrate that a superhydrophobic coating technology developed at Oak Ridge National Laboratory (ORNL) increases the water repellency of ballistic fabric beyond that provided by existing water repellency treatments. This increased water repellency has the potential to provide durable ballistic fabric for body armor without adding significant weight to the armor or significant manufacturing cost. Specimens of greige and scoured ballistic fabric were treated with a superhydrophobic coating and their weights and degree of water repellency were compared to specimens of untreated fabric. Treatment of both greige and scoured ballistic fabrics yielded highly water repellent fabrics. Our measurements of the water droplet contact angles gave values of approximately 150 , near the lower limit of 160 for superhydrophobic surfaces. The coatings increased the fabric weights by approximately 6%, an amount that is many times less than the estimated weight increase in a conventional treatment of ballistic fabric. The treated fabrics retained a significant amount of water repellency following a basic abrasion test, with water droplet contact angles decreasing by 14 to 23 . Microscopic analysis of the coating applied to woven fabrics indicated that the coating adhered equally well to fibers of greige and scoured yarns. Future evaluation of the superhydrophobic water repellent treatment will involve the manufacture of shoot packs of treated fabric for ballistic testing and provide an analysis of manufacturing scale-up and cost-to-benefit considerations.

  7. Zein Nanoparticles as Eco-Friendly Carrier Systems for Botanical Repellents Aiming Sustainable Agriculture.

    Science.gov (United States)

    Oliveira, Jhones L de; Campos, Estefânia V R; Pereira, Anderson E S; Pasquoto, Tatiane; Lima, Renata; Grillo, Renato; Andrade, Daniel Junior de; Santos, Fabiano Aparecido Dos; Fraceto, Leonardo Fernandes

    2018-02-14

    Botanical repellents represent one of the main ways of reducing the use of synthetic pesticides and the contamination of soil and hydric resources. However, the poor stability and rapid degradation of these compounds in the environment hinder their effective application in the field. Zein nanoparticles can be used as eco-friendly carrier systems to protect these substances against premature degradation, provide desirable release characteristics, and reduce toxicity in the environment and to humans. In this study, we describe the preparation and characterization of zein nanoparticles loaded with the main constituents of the essential oil of citronella (geraniol and R-citronellal). The phytotoxicity, cytotoxicity, and insect activity of the nanoparticles toward target and nontarget organisms were also evaluated. The botanical formulations showed high encapsulation efficiency (>90%) in the nanoparticles, good physicochemical stability, and effective protection of the repellents against UV degradation. Cytotoxicity and phytotoxicity assays showed that encapsulation of the botanical repellents decreased their toxicity. Repellent activity tests showed that nanoparticles containing the botanical repellents were highly repellent against the Tetranychus urticae Koch mite. This nanotechnological formulation offers a new option for the effective use of botanical repellents in agriculture, reducing toxicity, protecting against premature degradation, and providing effective pest control.

  8. Are commercially available essential oils from Australian native plants repellent to mosquitoes?

    Science.gov (United States)

    Maguranyi, Suzann K; Webb, Cameron E; Mansfield, Sarah; Russell, Richard C

    2009-09-01

    While the use of topical insect repellents, particularly those containing synthetic active ingredients such as deet (N,N-diethyl-3-methylbenzamide), are a mainstay in personal protection strategies emphasized in public health messages, there is a growing demand in the community for alternative repellents, particularly those of botanical origin and thus deemed to be "natural." This study evaluated the repellency of essential oils from 11 Australian native plants in 5% v/v formulations against Aedes aegypti, Culex quinquefasciatus, and Culex annulirostris under laboratory conditions. A blend of the top 3 performing oils was then compared with deet and a commercially available botanical insect repellent. All essential oils provided at least some protection against the 3 mosquito species, with the longest protection time (110 min) afforded by Prostanthera melissifolia against Cx. quinquefasciatus. Mean protection times against Ae. aegypti were substantially lower than those for the Culex spp. tested. Deet provided significantly longer protection against Ae. aegypti than both the 5% v/v blend of Leptospermum petersonii, Prostanthera melissifolia, and Melaleuca alternifolia (the 3 most effective oils) and the commercial botanical repellent. The results of this study indicate that these essential oils from Australian native plants offer limited protection against biting mosquitoes and that a blend of essential oils holds may offer commercial potential as a short-period repellent or under conditions of low mosquito abundance. However, it is important that public health messages continue to emphasize the greater effectiveness of deet-based repellents in areas with risks of mosquito-borne disease.

  9. Celery-based topical repellents as a potential natural alternative for personal protection against mosquitoes.

    Science.gov (United States)

    Tuetun, B; Choochote, W; Pongpaibul, Y; Junkum, A; Kanjanapothi, D; Chaithong, U; Jitpakdi, A; Riyong, D; Pitasawat, B

    2008-12-01

    Celery-based products were investigated for chemical composition, skin irritation, and mosquito repellency in comparison to commercial repellents and the standard chemical, N,N-diethyl-3-methylbenzamide (DEET), with a goal to develop a natural alternative to synthetic repellents for protection against mosquitoes. Chemical identification by gas chromatography coupled with mass spectrometry discovered that the major constituents of Apium graveolens hexane extract (AHE) were 3-n-butyl-tetrahydrophthalide (92.48%), followed by 5.10% beta-selinene and 0.68% gamma-selinene. Evaluation of skin irritation in 27 human volunteers revealed no irritant potential from 25% ethanolic AHE solution. Laboratory investigated repellent against female Aedes aegypti mosquitoes demonstrated that G10 formula, the best AHE-developed product, provided remarkable repellency with a median protection time of 4.5 h (4.5-5 h), which was greater than that of ethanolic DEET solution (25% DEET, 3.5 h) and comparable to that of the best commercial repellent, Insect Block 28 (28.5% DEET, 4.5 h). According to significantly promising results, including highly effective repellency and no potential skin irritation or other side effects, the G10 formula is a worthwhile product that has the promise of being developed for commercialized registration. This developed AHE product could be an acceptable and affordable alternative to conventional synthetic chemicals in preventing mosquito bites, and in turn, helping to interrupt mosquito-borne disease transmission.

  10. Repellent Activity of Apiaceae Plant Essential Oils and their Constituents Against Adult German Cockroaches.

    Science.gov (United States)

    Lee, Hyo-Rim; Kim, Gil-Hah; Choi, Won-Sil; Park, Il-Kwon

    2017-04-01

    We evaluated the repellent activity of 12 Apiaceae plant essential oils and their components against male and female adult German cockroaches, Blattella germanica L., to find new natural repellents. Of all the plant essential oils tested, ajowan (Trachyspermum ammi Sprague) and dill (Anethum graveolens L.) essential oils showed the most potent repellent activity against male and female adult German cockroaches. Repellent activities of chemicals already identified in active oils were also investigated. Of the compounds identified, carvacrol, thymol, and R-(-)-carvone showed >80% repellent activity against male and female adult German cockroaches at 2.5 µg/cm2. S-(+)-Carvone, (+)-dihydrocarvone, and terpinen-4-ol showed >70% repellent activity against male and female adult German cockroaches at 10 µg/cm2. Our results indicated that Apiaceae plant essential oils and their constituents have good potential as natural repellents against adult German cockroaches. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  11. Polymer-based Drug Delivery Systems Applied to Insects Repellents Devices: A Review.

    Science.gov (United States)

    Barradas, Thaís Nogueira; Senna, Juliana Perdiz; Ricci, Eduardo; Mansur, Claudia Regina Elias

    2016-01-01

    Insects-borne diseases constitute a public health concern. Since there is no vaccine or curative treatment for many of these diseases, individual protection is the main approach to prevent them. Nowadays, the search for replacing synthetic molecules for insect repellents from natural sources, such as essential oils, is increasing. However, most of them present low efficiency compared to synthetic repellents. Therefore, decreasing skin permeation of synthetic repellents or yet, increasing effectiveness of natural repellents are challenges that must be overcome during the development of novel insect repellent formulations. In this context, polymer-based formulations allow entrapping active ingredients and provide release control. Encapsulation into polymeric micro/nanocapsules, cyclodextrins, polymeric micelles or hydrogels constitutes an approach to modify physicochemical properties of encapsulated molecules. Such techniques, applied in topical formulations, fabrics modification for personal protection, or food packaging have proved to be more effective in increasing repellency time and also in reducing drug dermal absorption, improving safety profiles of these products. In this work, the main synthetic and natural insect repellents are described as well as their polymeric carrier systems and their potential applications.

  12. From Chemistry to Behavior. Molecular Structure and Bioactivity of Repellents against Ixodes ricinus Ticks.

    Directory of Open Access Journals (Sweden)

    Simone Del Fabbro

    Full Text Available Tick-borne zoonoses are considered as emerging diseases. Tick repellents represent an effective tool for reducing the risk of tick bite and pathogens transmission. Previous work demonstrated the repellent activity of the phenylpropanoid eugenol against Ixodes ricinus; here we investigate the relationship between molecular structure and repellency in a group of substances related to that compound. We report the biological activity of 18 compounds varying for the presence/number of several moieties, including hydroxyl and methoxy groups and carbon side-chain. Each compound was tested at different doses with a bioassay designed to measure repellency against individual tick nymphs. Both vapor pressure and chemical features of the tested compounds appeared to be related to repellency. In particular, the hydroxyl and methoxy groups as well as the side-chain on the benzene ring seem to play a role. These results are discussed in light of available data on chemical perception in ticks. In the course of the study new repellent compounds were identified; the biological activity of some of them (at least as effective as the "gold standard" repellent DEET appears to be very promising from a practical point of view.

  13. [Repellent activity of plant essential oils against bites of Lutzomyia migonei (Diptera: Psychodidae)].

    Science.gov (United States)

    Nieves, Elsa; Fernández Méndez, Janett; Lias, José; Rondón, Maritza; Briceño, Benito

    2010-12-01

    Natural repellents from plant extracts have demonstrated good efficacy against bites of some insect species. The present study evaluated the repellent effect of essential oils extracted from 8 plants species against bites of Lutzomyia migonei, the Leishmania vector. The essential oils were extracted by steam destillation in Clevenger chamber, from the following plants: Hyptis suaveolens, Pimenta racemosa, Piper marginatum, Monticalia imbricatifolia, Pseudognaphalium caeruleocanum, Espeletia shultzii, Plecthranthus amboinicus and Cinnamomun zeylanicum. Repellency tests were performed under laboratory conditions by the human hand method in cage assays, using female colonies of L. migonei. The more effective oils were tested at variable concentrations on different volunteers. The protection percentage and time were calculated. The results showed what oils of P. caeruleocanum and C. zeylanicum were the most effective. Although P. amboinicus oil also had repellent effect showed an irritant effect. The oils P. marginatum, H. suaveolens and P. racemosa showed no repellent effect, while the rest of oil extracts showed significant repellency in variable degrees. P. caeruleocanum and C. zeylanicum oils provided the 95% protection against bites of L. migonei for 3 h. The P. caeruleocanum oil showed the greatest protection time, with a mean over 4h and 3h at concentrations of 50% and 10% respectively. The results suggest that the P. caeruleocanum oil could represent a potential natural repellent against Leishmania vectors.

  14. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Background: There has been a rapid emergence in insecticide resistance among mosquito population to commonly used public health insecticides. This situation presents a challenge to chemicals that are currently used to control mosquitoes in sub-Saharan African. Furthermore, there is limited information on insecticide ...

  15. Microbes as interesting source of novel insecticides: A review ...

    African Journals Online (AJOL)

    ... strains with good insecticidal properties can be identified, evaluated and utilized for pest control. This paper reviews the insecticidal properties of microbes and their potential utility in pest management. Keywords: Microbes, insecticides, metabolites, pest management. African Journal of Biotechnology, Vol 13(26) 2582- ...

  16. Metabolic control of the insecticides safety use

    Directory of Open Access Journals (Sweden)

    L.I. Solomenko

    2016-06-01

    Full Text Available The results of the conducted research affirm that the phosphororganic insecticides utilization can lead to the break in the nitrogen metabolism, breaking the protein formation, reducing the protein molecules renewal, causing the amino acid and amides accumulation in the active state. It has been revealed that the translocation and transformation of the insecticides under consideration are more closely connected with the changes of insoluble protein fraction. The stagnation point of the Phosphamide and Kaunter impact on the plant has been determined. And only the use of the preparation in optimal norms can influence stimulatingly the course of the process under consideration.

  17. Room temperature synthesis of water-repellent polystyrene nanocomposite coating

    International Nuclear Information System (INIS)

    Guo Yonggang; Jiang Dong; Zhang Xia; Zhang Zhijun; Wang Qihua

    2010-01-01

    A stable superhydrophobic polystyrene nanocomposite coating was fabricated by means of a very simple and easy method. The coating was characterized by scanning electron microscopy and X-ray photoelectron spectrum. The wettability of the products was also investigated. By adding the surface-modified SiO 2 nanoparticles, the wettability of the coating changed to water-repellent superhydrophobic, not only for pure water, but also for a wide pH range of corrosive liquids. The influence of the drying temperature and SiO 2 content on the wettability of the nanocomposite coating was also investigated. It was found that both factors had little or no significant effect on the wetting behavior of the coating surface.

  18. Self-Trapping Self-Repelling Random Walks

    Science.gov (United States)

    Grassberger, Peter

    2017-10-01

    Although the title seems self-contradictory, it does not contain a misprint. The model we study is a seemingly minor modification of the "true self-avoiding walk" model of Amit, Parisi, and Peliti in two dimensions. The walks in it are self-repelling up to a characteristic time T* (which depends on various parameters), but spontaneously (i.e., without changing any control parameter) become self-trapping after that. For free walks, T* is astronomically large, but on finite lattices the transition is easily observable. In the self-trapped regime, walks are subdiffusive and intermittent, spending longer and longer times in small areas until they escape and move rapidly to a new area. In spite of this, these walks are extremely efficient in covering finite lattices, as measured by average cover times.

  19. Thermal repellent properties of surface coating using silica

    Science.gov (United States)

    Lee, Y. Y.; Halim, M. S.; Aminudin, E.; Guntor, N. A.

    2017-11-01

    Extensive land development in urban areas is completely altering the surface profile of human living environment. As cities growing rapidly, impervious building and paved surfaces are replacing the natural landscape. In the developing countries with tropical climate, large masses of building elements, such as brick wall and concrete members, absorb and store large amount of heat, which in turn radiate back to the surrounding air during the night time. This bubble of heat is known as urban heat island (UHI). The use of high albedo urban surfaces is an inexpensive measure that can reduce surrounded temperature. Thus, the main focus of this study is to investigate the ability of silica, SiO2, with high albedo value, to be used as a thermal-repelled surface coating for brick wall. Three different silica coatings were used, namely silicone resin, silicone wax and rain repellent and one exterior commercial paint (jota shield paint) that commercially available in the market were applied on small-scale brick wall models. An uncoated sample also had been fabricated as a control sample for comparison. These models were placed at the outdoor space for solar exposure. Outdoor environment measurement was carried out where the ambient temperature, surface temperature, relative humidity and UV reflectance were recorded. The effect of different type of surface coating on temperature variation of the surface brick wall and the thermal performance of coatings as potential of heat reduction for brick wall have been studied. Based on the results, model with silicone resin achieved the lowest surface temperature which indicated that SiO2 can be potentially used to reduce heat absorption on the brick wall and further retains indoor passive thermal comfortability.

  20. Lack of insecticidal effect of mosquito coils containing either metofluthrin or esbiothrin on Anopheles gambiae sensu lato mosquitoes.

    Science.gov (United States)

    Lukwa, Nzira; Chiwade, Tonderai

    2008-12-01

    Use of mosquito coils for personal protection against malaria and mosquito nuisance is advocated under mosquito and malaria control programmes. We performed field studies of mosquito coils containing either metofluthrin or esbiothrin in experimental huts situated in Kamhororo village, Gokwe district, Zimbabwe. All tests were performed on 3-5 day old reared female Anopheles gambiae sensu lato mosquitoes. The burning times were 9hr 20min for mosquito coils containing metofluthrin and 8 hr for those containing esbiothrin and the results were significantly different (p = metofluthrin was 90% and that for esbiothrin was 73.3% and the results were significantly different (p = 0.00). Mosquito coils containing metofluthrin had a mean repellence of 92.7% as compared to 85.4% for esbiothrin and the results were not significantly different (p=0.27). The protection time as required by EPA (1999) was 6 hr for mosquito coils containing metofluthrin and 5 hr for those containing esbiothrin. The mean insecticidal effect of mosquito coils containing metofluthrin was 84% as compared to 83% for those containing esbiothrin and the results were not significantly different (p = 0.56). Both mosquito formulations could not be classified as having insecticidal effect since none of them met the 95% mortality rate criteria.

  1. Determination of Insecticidal Effect (LC50 and LC90) of Organic Fatty Acids Mixture (C8910+Silicone) Against Aedes aegypti and Aedes albopictus (Diptera: Culicidae).

    Science.gov (United States)

    Dunford, James C; Falconer, Aneika; Leite, Laura N; Wirtz, Robert A; Brogdon, William G

    2016-05-01

    Emerging and re-emerging vector-borne diseases such as chikungunya and dengue and associated Aedes vectors are expanding their historical ranges; thus, there is a need for the development of novel insecticides for use in vector control programs. The mosquito toxicity of a novel insecticide and repellent consisting of medium-chain carbon fatty acids (C8910) was examined. Determination of LC 50 and LC 90 was made against colony-reared Aedes aegypti (L.) and Aedes albopictus (Skuse) using probit analysis on mortality data generated by Centers for Disease Control and Prevention bottle bioassays. Six different concentrations of C8910 + silicone oil yielded an LC 50 of 160.3 µg a.i/bottle (147.6-182.7) and LC 90 of 282.8 (233.2-394.2) in Ae. aegypti; five concentrations yielded an LC 50 of 125.4 (116.1-137.6) and LC 90 of 192.5 (165.0-278.9) in Ae. albopictus. Further development of C8910 and similar compounds could provide vector control specialists novel insecticides for controlling insect disease vectors. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  2. Effect of selected insecticides on SF9 insect cell line

    International Nuclear Information System (INIS)

    Saleh, M.; Rahmo, A.; Hajjar, J.

    2013-01-01

    The toxic effect of three insecticides: dimethoate (organophosphate insecticide), acetamiprid (neonicotinoid insecticide) and deltamethrin (pyrethroid insecticide) were evaluated in vitro on cultured Sf9 cell line. Cell growth inhibition was measured by the 3- (4,5- dimethylthiazol - 2-yl) - 2,5 - diphenyl tetrazolium bromide (MTT) assay. Regression Analysis was used to estimate the 20% inhibition of cells growth (IC 20). The IC 20 values obtained for deltamethrin, acetamipridand dimethoate were: 46.8, 61.6 and 68.9 μM, respectively. The proportion of phagocytic cells was positively correlated with the applied concentrations of the insecticides. (author)

  3. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:MŠk(CZ) 2B08049 Institutional support: RVO:67985858 Keywords : botanical insecticides * plant extracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  4. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:GA MŠMT(CZ) 2B08049 Institutional research plan: CEZ:AV0Z40720504 Keywords : botanical insecticides * plant exctracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  5. Insecticidal and fungicidal compounds from Isatis tinctoria.

    Science.gov (United States)

    Seifert, K; Unger, W

    1994-01-01

    Tryptanthrin (1), indole-3-acetonitrile (2) and p-coumaric acid methylester (3) were isolated from the aerial parts of Isatis tinctoria L. The compounds show insecticidal and anti-feedant activity against termites (Reticulitermis santonensis), insect preventive and control activity against larvae of the house longhorn beetle (Hylotrupes bajulus) and fungicidal activity against the brown-rot fungus (Coniophora puteana).

  6. Potential of Eucalyptus Oil as Repellent against House Rat, Rattus rattus

    Science.gov (United States)

    Thind, Ramandeep Kaur; Mahal, Amrit Kaur

    2014-01-01

    Rodent repellents are chemicals which by taste or odour or possibly by both will prevent animal from feeding or gnawing. Such substances may be used in protecting an area from rodent infestation or in protecting packaged food, packing materials, electric cables, and other important vulnerable materials. Mature and healthy house rat, Rattus rattus of both sexes, was exposed to 5, 10, and 20% eucalyptus oil applied as spray in laboratory pens in bichoice tests. Each concentration was applied through three different modes of application, that is, daily, once, and alternatively in a week. Repellent effect of the oil was assessed based on food consumption from treated and untreated sides for four days. In overall, food consumption was significantly (P eucalyptus oil. Present studies reveal the potential of eucalyptus oil in repelling away R. rattus; however, further studies may be conducted to enhance the persistence of repellent effect for longer period of time. PMID:24523633

  7. Repellent Action of Carapa guianensis and Caesalpinia ferrea for flies species of Calliphoridae family

    Directory of Open Access Journals (Sweden)

    Ciciane Pereira Marten Fernandes

    2016-05-01

    Full Text Available ABSTRACT: Myiases occur by the infestation of fly larvae in tissues of live vertebrate animals, resulting in economic loss. Phytotherapy is considered an important alternative in the control of insects, which may reduce the economic impacts . Carapa guianensis is a plant that has been studied as a repellent against mosquitoes and Caesalpinia ferrea is reported in tropical climates, and there are few studies about its repellent action. The present study was designed to evaluate the repellent action of s C. guianensis and C. ferrea plants on flies species of the Calliphoridae family. W.O.T. traps containing deteriorated bovine liver and herbs cream of at concentrations of 20 and 50% were used to catch the flies. It was reported that the creams containing C. ferrea at concentrations of 20 and 50% and C. guianensis at the concentration of 50% have repellent effect against species of Calliphoridae family.

  8. Repellent activity of fractioned compounds from Chamaecyparis nootkatensis essential oil against nymphal Ixodes scapularis (Acari: Ixodidae).

    Science.gov (United States)

    Dietrich, Gabrielle; Dolan, Marc C; Peralta-Cruz, Javier; Schmidt, Jason; Piesman, Joseph; Eisen, Rebecca J; Karchesy, Joseph J

    2006-09-01

    Preliminary repellent activity of 14 natural products isolated from essential oil components extracted from the heartwood of Alaska yellow cedar, Chamaecyparis nootkatensis (D. Don) Spach., were evaluated against nymphal Ixodes scapularis Say in a laboratory bioassay and compared with technical grade N,N-diethyl-3-methylbenzamide (deet). Four hours after treatment, nootkatone and valencene-13-ol had repellent concentration (RC)50 values of 0.0458 and 0.0712% (wt:vol), respectively; two additional Alaska yellow cedar compounds, nootkatone 1 --> 10 epoxide and carvacrol had reported RC50 values of 0.0858 and 0.112%, respectively. The observed RC50 value for deet was 0.0728% (wt:vol). Although not statistically significantly more active than deet, the ability of these natural products to repel ticks at relatively low concentrations may represent a potential alternative to synthetic commercial repellents.

  9. Variation in the repellency effects of the leaves of Mentha piperita ...

    African Journals Online (AJOL)

    Administrator

    2011-09-21

    Sep 21, 2011 ... The repellency effects of Mentha piperita leaves, collected from two different locations in ... of trace metals were reported from the soil and plant collected from Malelane (p < 0.05). ... an increased concentration of chromium.

  10. Is Apis mellifera more sensitive to insecticides than other insects?

    Science.gov (United States)

    Hardstone, Melissa C; Scott, Jeffrey G

    2010-11-01

    Honey bees (Apis mellifera L.) are among the most important pollinators in natural and agricultural settings. They commonly encounter insecticides, and the effects of insecticides on honey bees have been frequently noted. It has been suggested that honey bees may be (as a species) uniquely sensitive to insecticides, although no comparative toxicology study has been undertaken to examine this claim. An extensive literature review was conducted, using data in which adult insects were topically treated with insecticides. The goal of this review was to summarize insecticide toxicity data between A. mellifera and other insects to determine the relative sensitivity of honey bees to insecticides. It was found that, in general, honey bees were no more sensitive than other insect species across the 62 insecticides examined. In addition, honey bees were not more sensitive to any of the six classes of insecticides (carbamates, nicotinoids, organochlorines, organophosphates, pyrethroids and miscellaneous) examined. While honey bees can be sensitive to individual insecticides, they are not a highly sensitive species to insecticides overall, or even to specific classes of insecticides. However, all pesticides should be used in a way that minimizes honey bee exposure, so as to minimize possible declines in the number of bees and/or honey contamination. Copyright © 2010 Society of Chemical Industry.

  11. Insect Repellents and Associated Personal Protection for a Reduction in Human Disease

    Science.gov (United States)

    2012-01-01

    of topical repellents and scrub typhus was reduced through the use of treated clothing. Successful reduction of leishmaniasis was achieved through the...epidemic typhus , scrub typhus , plague and malaria. The result was the development of many of the modern strategies for vector control that we take for...prevent bites and disease. They gave examples that represented well-documented disease reduction achieved with repellent clothing ( scrub typhus ; McCulloch

  12. Field Evaluations of Topical Arthropod Repellents in North, Central, and South America

    Science.gov (United States)

    2014-09-01

    De La Rocque et al. 2011) and their spread into higher elevations of Africa, Latin America , and Asia (Epstein 2001). Dengue fever and...denguehemorrhagic fever have resurgeddramatically in Latin America (Zell 2004). In North America ,West Nile virus has impacted signiÞcantly the health and welfare of...VECTOR CONTROL, PEST MANAGEMENT, RESISTANCE, REPELLENTS Field Evaluations of Topical Arthropod Repellents in North, Central , and South America KENDRA

  13. Do insect repellents induce drift behaviour in aquatic non-target organisms?

    Science.gov (United States)

    Fink, Patrick; Moelzner, Jana; Berghahn, Ruediger; von Elert, Eric

    2017-01-01

    Synthetic insect repellents are compounds applied to surfaces to discourage insects, mainly mosquitoes, from landing on those surfaces. As some of these repellents have repeatedly been detected in surface waters at significant concentrations, they may also exert repellent effects on aquatic non-target organisms. In running water systems, aquatic invertebrates actively enter downstream drift in order to avoid unfavourable environmental conditions. We thus tested the hypothesis that the widely used insect repellents DEET (N,N-Diethyl-m-toluamide), EBAAP (3-[N-butyl-N-acetyl]-aminopropionic acid ethyl ester) and Icaridin (1-piperidinecarboxylic acid 2-(2-hydroxyethyl)-1-methylpropyl ester) induce downstream drift behaviour in the aquatic invertebrates Gammarus pulex (Crustacea, Amphipoda) and Cloeon dipterum (Insecta, Ephemeroptera), using a laboratory-scale drift assay. We found no clear increase in the drift behaviour of both invertebrate species across a concentration gradient of eight orders of magnitude and even beyond maximum environmental concentrations for any of the three repellents. We found no evidence for a direct drift-inducing activity of insect repellents on aquatic non-target organisms. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. Water repellency, plants, agriculture abandonment and fire in citrus plantations. The Canyoles river watershed study site

    Science.gov (United States)

    Cerdà, Artemi; Jordán, Antonio; Doerr, Stefan Helmut

    2017-04-01

    Soil water repellency (SWR) is a key soil property that determine the soil and water losses, soil fertility and plant development. Although until the 90's the soil water repellency was seeing as an uncommon soil characteristic, now is considered a key soil property to understand the soil hydrology (Alanís et al., 2016; Hewelke et al., 2016; Keesstra et al., 2016; Jiménez-Morillo et al., 2016). The inspiring research of Leonard DeBano and Stefan H Doerr changed the fate of the science (DeBano, 2000; Doerr et al. 2000). Soil water repellency was associated to forest fire affected land due to the pioneer contribution of professor DeBano in the 70's and Professor Doerr in the 90's. The research during the last two decades demonstrate that fire affects the reallocation of the hydrophobic substances and can reduce or increase the severity of the soil water repellence at different soil depths and horizons. The SWR is usually measured by sampling to show the influence of key soil properties (texture, structure, plant cover, litter, season…) on the degree of soil water repellency. The sampling is applied usually with a few drops when the Water Drop Penetration Time method is applied, and this inform of the time of penetration, but few researches focussed in the spatial distribution of the water repellency, which is a key factor of the runoff generation, the water infiltration and the water redistribution such as demonstrate the wetting fronts. Our approach research the spatial distribution of the water repellency by means of an intense sampling of soil surface water repellency. One thousand drops were distributed in a square meter (100 lines separated 1 cm and 100 drops per each line of 100 cm, with a total od 1000 drops in 1m2) on 10 sampling points on 4 land managements: ploughing and herbicide agriculture fields treatment), abandoned 10 years, and burnt. The research was carried out in citrus plantations of the Canyoles river watershed. The results show that the

  15. Defensive Metabolites from Antarctic Invertebrates: Does Energetic Content Interfere with Feeding Repellence?

    Science.gov (United States)

    Núñez-Pons, Laura; Avila, Conxita

    2014-01-01

    Many bioactive products from benthic invertebrates mediating ecological interactions have proved to reduce predation, but their mechanisms of action, and their molecular identities, are usually unknown. It was suggested, yet scarcely investigated, that nutritional quality interferes with defensive metabolites. This means that antifeedants would be less effective when combined with energetically rich prey, and that higher amounts of defensive compounds would be needed for predator avoidance. We evaluated the effects of five types of repellents obtained from Antarctic invertebrates, in combination with diets of different energetic values. The compounds came from soft corals, ascidians and hexactinellid sponges; they included wax esters, alkaloids, a meroterpenoid, a steroid, and the recently described organic acid, glassponsine. Feeding repellency was tested through preference assays by preparing diets (alginate pearls) combining different energetic content and inorganic material. Experimental diets contained various concentrations of each repellent product, and were offered along with control compound-free pearls, to the Antarctic omnivore amphipod Cheirimedon femoratus. Meridianin alkaloids were the most active repellents, and wax esters were the least active when combined with foods of distinct energetic content. Our data show that levels of repellency vary for each compound, and that they perform differently when mixed with distinct assay foods. The natural products that interacted the most with energetic content were those occurring in nature at higher concentrations. The bioactivity of the remaining metabolites tested was found to depend on a threshold concentration, enough to elicit feeding repellence, independently from nutritional quality. PMID:24962273

  16. Defensive Metabolites from Antarctic Invertebrates: Does Energetic Content Interfere with Feeding Repellence?

    Directory of Open Access Journals (Sweden)

    Laura Núñez-Pons

    2014-06-01

    Full Text Available Many bioactive products from benthic invertebrates mediating ecological interactions have proved to reduce predation, but their mechanisms of action, and their molecular identities, are usually unknown. It was suggested, yet scarcely investigated, that nutritional quality interferes with defensive metabolites. This means that antifeedants would be less effective when combined with energetically rich prey, and that higher amounts of defensive compounds would be needed for predator avoidance. We evaluated the effects of five types of repellents obtained from Antarctic invertebrates, in combination with diets of different energetic values. The compounds came from soft corals, ascidians and hexactinellid sponges; they included wax esters, alkaloids, a meroterpenoid, a steroid, and the recently described organic acid, glassponsine. Feeding repellency was tested through preference assays by preparing diets (alginate pearls combining different energetic content and inorganic material. Experimental diets contained various concentrations of each repellent product, and were offered along with control compound-free pearls, to the Antarctic omnivore amphipod Cheirimedon femoratus. Meridianin alkaloids were the most active repellents, and wax esters were the least active when combined with foods of distinct energetic content. Our data show that levels of repellency vary for each compound, and that they perform differently when mixed with distinct assay foods. The natural products that interacted the most with energetic content were those occurring in nature at higher concentrations. The bioactivity of the remaining metabolites tested was found to depend on a threshold concentration, enough to elicit feeding repellence, independently from nutritional quality.

  17. Identification of repellent odorants to the body louse, Pediculus humanus corporis, in clove essential oil.

    Science.gov (United States)

    Iwamatsu, Takuma; Miyamoto, Daisuke; Mitsuno, Hidefumi; Yoshioka, Yoshiaki; Fujii, Takeshi; Sakurai, Takeshi; Ishikawa, Yukio; Kanzaki, Ryohei

    2016-04-01

    The control of body lice is an important issue for human health and welfare because lice act as vectors of disease such as typhus, relapsing fever, and trench fever. Body lice exhibit avoidance behavior to some essential oils, including clove essential oil. Therefore, odorants containing clove essential oil components may potentially be useful in the development of repellents to body lice. However, such odorants that induce avoidance behavior in body lice have not yet been identified from clove essential oil. Here, we established an analysis method to evaluate the avoidance behavior of body lice to specific odorants. The behavioral analysis of the body lice in response to clove essential oil and its constituents revealed that eugenol, a major component of clove essential oil, has strong repellent effect on body lice, whereas the other components failed to induce obvious avoidance behavior. A comparison of the repellent effects of eugenol with those of other structurally related odorants revealed possible moieties that are important for the avoidance effects to body lice. The repellent effect of eugenol to body lice was enhanced by combining it with the other major component of clove essential oil, β-caryophyllene. We conclude that a synthetic blend of eugenol and β-caryophyllene is the most effective repellent to body lice. This finding will be valuable as the potential use of eugenol as body lice repellent.

  18. Status and Prospect of Test Methods of Quality Silicone Water Repellent for Protecting Reinforced Concrete

    Energy Technology Data Exchange (ETDEWEB)

    Sun, H. Y.; Yuan, Z. Y.; Yang, Z.; Shan, G. L. [Nanjing Hydraulic Research Institute, Nanjing (China); Shen, M. X. [Hehai University, Nanjing (China)

    2017-06-15

    Impregnating with quality silicone water repellent on the concrete surface is an effective method of protecting concrete. Quality silicone water repellent has been widely used in the engineering profession because of its desirable properties such as hydrophobicity, keeping concrete breathable and preserving the original appearance of the concrete. The companies in China that produce silicone water repellent are listed. Test methods in the specifications or standards about silicone water repellent in China are summed. The test methods relative to durability of concrete impregnated with silicone water repellent (such as resistant to chloride ion penetration, resistant to alkali, resistance to freezing and thawing and weather ability etc.) and the constructive quality (such as water absorption rate, impregnating depth and the dry velocity coefficient etc.) are compared and analyzed. The results indicate that there are differences among test methods relative to different specifications with the same index and therefore, confusion has ensued when selecting test methods. All test methods with the exception of the method of water absorption rate by using a Karsten flask are not non-destructive methods or conducted in a laboratory. Finally, further research on silicone water repellent during application is proposed.

  19. [Evaluation of effectiveness of several repellents against mosquito bites available at the Polish market].

    Science.gov (United States)

    Mikulak, Ewa; Gliniewicz, Aleksandra; Królasik, Agnieszka; Sawicka, Bozena; Rabczenko, Daniel

    2012-01-01

    BACKGROUND. Mosquitoes are blood-sucking insects, nuisance to humans and animals. Their bites cause itching and allergic reactions. These insects are also vectors of several viruses, bacteria and parasites. Protection against mosquitoes is therefore justified and desirable. This can give repellents and products for protection small outdoor areas such as terraces, home gardens. OBJECTIVE. The aim of this study was to evaluate the effectiveness of eight selected products with different formulations used against mosquitoes including: 5 preparations for use on the body or clothing (repellents A, B, C, D, E and 3 products for use in small outdoor spaces (I, J, K). [corrected] Repellents were tested in laboratory trials, when volunteers were exposed to Aedes aegypti females breeding in the laboratory. Products I, J, K were tested in field trials; volunteers were exposed to female mosquitoes at various ages from the environment (Aedes sp, Culex sp). The results showed that all tested repellents were efficient during 4 hrs. After this time their effectiveness decreased--fast in the case of repellent B (10% DEET), not very fast, but significant--in the case of repellent C (15% DEET). Three products for small area protection gave (each of them) 3-hour protection against mosquito bites. Product K (21,97% allethrin) was 100% effective (no bites at all). Both kinds of product can give effective protection against mosquito bites. Their use is most effective, cheaper and more safe for the environment method of protection against mosquitoes than chemical spraying of large areas.

  20. Insect repellents and sunscreen: implications for personal protection strategies against mosquito-borne disease.

    Science.gov (United States)

    Webb, Cameron E; Russell, Richard C

    2009-10-01

    To determine the protection times provided by insect repellent and sunscreen in combined formulations against biting mosquitoes. To determine if concurrent use of repellent and sunscreen influenced protection times. Insect repellent containing comparable concentrations of N, N-diethyl-3-methylbenzamide (DEET) with and without sunscreen were tested on human skin to determine the mean protection time (MPT) against Aedes aegypti (L.) in the laboratory. Further trials were undertaken to determine the effect on MPT of sunscreen reapplication over repellent every two hours. There was no significant difference in the MPT provided by 80% DEET with (MPT+/-SE=770+/-54.8 minutes) and without (MPT+/-SE=830+/-20.2 minutes) sunscreen or 7.14% DEET with (MPT+/-SE =240+/-15.5 minutes) and 6.98% DEET without (MPT+/-SE =230+/-18.4 minutes) sunscreen. Reapplication of sunscreen resulted in a significantly lower MPT of a 17.0% DEET formulation when sunscreen was reapplied concurrently (MPT+/-SE=330+/-25.2 minutes), compared with DEET alone (MPT+/-SE =400+/-12.7 minutes). When combined in a single formulation with sunscreen, the MPT provided by both high and low concentrations of DEET is not reduced. However, if sunscreen is reapplied over insect repellent, protection times can be reduced significantly. In areas of endemic mosquito-borne disease, the reapplication of a low concentration repellent and sunscreen formulation may provide the most effective protection from biting mosquitoes while minimising the risk of overexposure to DEET.

  1. Repellent Activity of TRIG (N-N Diethyl Benzamide against Man-Biting Mosquitoes

    Directory of Open Access Journals (Sweden)

    Shandala Msangi

    2018-01-01

    Full Text Available A study was conducted to assess efficacy of a new repellent brand TRIG (15% N-N Diethyl Benzamide when compared to DEET (20% N-N Methyl Toluamide. The repellents were tested in laboratory and field. In the laboratory, the repellence was tested on human volunteers, by exposing their repellent-treated arms on starved mosquitoes in cages for 3 minutes at hourly intervals, while counting the landing and probing attempts. Anopheles gambiae and Aedes aegypti mosquitoes were used. Field evaluation was conducted by Human Landing Catch technique. During the night, the repellents were applied on arms and legs and mosquitoes landing on these areas were collected. In laboratory tests, TRIG provided complete protection (100% against Anopheles gambiae when applied at 1.25 g, while DEET provided this at 0.75 g. When tested on Aedes aegypti, TRIG provided complete protection when applied at 1 g, compared to 0.5 g for DEET. In the field, when applied at a recommended dose, both TRIG and DEET achieved above 90% protection against both An. arabiensis and Culex quinquefasciatus and a Complete Protection Time of about 6 hrs against both species of mosquitoes. The performances of the two products were found to be comparable and TRIG was recommended for use as repellent against mosquito bites.

  2. Repellent Activity of TRIG (N-N Diethyl Benzamide) against Man-Biting Mosquitoes.

    Science.gov (United States)

    Msangi, Shandala; Kweka, Eliningaya; Mahande, Aneth

    2018-01-01

    A study was conducted to assess efficacy of a new repellent brand TRIG (15% N-N Diethyl Benzamide) when compared to DEET (20% N-N Methyl Toluamide). The repellents were tested in laboratory and field. In the laboratory, the repellence was tested on human volunteers, by exposing their repellent-treated arms on starved mosquitoes in cages for 3 minutes at hourly intervals, while counting the landing and probing attempts. Anopheles gambiae and Aedes aegypti mosquitoes were used. Field evaluation was conducted by Human Landing Catch technique. During the night, the repellents were applied on arms and legs and mosquitoes landing on these areas were collected. In laboratory tests, TRIG provided complete protection (100%) against Anopheles gambiae when applied at 1.25 g, while DEET provided this at 0.75 g. When tested on Aedes aegypti, TRIG provided complete protection when applied at 1 g, compared to 0.5 g for DEET. In the field, when applied at a recommended dose, both TRIG and DEET achieved above 90% protection against both An. arabiensis and Culex quinquefasciatus and a Complete Protection Time of about 6 hrs against both species of mosquitoes. The performances of the two products were found to be comparable and TRIG was recommended for use as repellent against mosquito bites.

  3. Status and Prospect of Test Methods of Quality Silicone Water Repellent for Protecting Reinforced Concrete

    International Nuclear Information System (INIS)

    Sun, H. Y.; Yuan, Z. Y.; Yang, Z.; Shan, G. L.; Shen, M. X.

    2017-01-01

    Impregnating with quality silicone water repellent on the concrete surface is an effective method of protecting concrete. Quality silicone water repellent has been widely used in the engineering profession because of its desirable properties such as hydrophobicity, keeping concrete breathable and preserving the original appearance of the concrete. The companies in China that produce silicone water repellent are listed. Test methods in the specifications or standards about silicone water repellent in China are summed. The test methods relative to durability of concrete impregnated with silicone water repellent (such as resistant to chloride ion penetration, resistant to alkali, resistance to freezing and thawing and weather ability etc.) and the constructive quality (such as water absorption rate, impregnating depth and the dry velocity coefficient etc.) are compared and analyzed. The results indicate that there are differences among test methods relative to different specifications with the same index and therefore, confusion has ensued when selecting test methods. All test methods with the exception of the method of water absorption rate by using a Karsten flask are not non-destructive methods or conducted in a laboratory. Finally, further research on silicone water repellent during application is proposed.

  4. Repellent Activity of Eight Essential Oils of Chinese Medicinal Herbs t oBlattella germanica L.

    Directory of Open Access Journals (Sweden)

    Zhi Long Liu

    2011-01-01

    Full Text Available Eight e ssential oil s of Chinese medicinal herbs ( Angelica sinensis , Curuma aeruginosa , Cyperus rotundus , Eucalyptus robusta , Illicium verum , Lindera aggregate , Ocimum basilicum , and Zanthoxylum bungeanum w ere obtained by hydrodistillation and the essential oil of Eucalyptus robusta leaves was analyzed by gas chromatography-mass spectrometry (GC-MS. A total of 22 components of the essential oil of E. robusta were identified. The principal compounds in E . robusta essential oil were α- p inene (28.74% and 1,8- c ineole (27.18%, spathulenol (6.63%, globulol (6.53% and ρ - m enth-1-en-8-ol (5.20%. The 8 essential oil s and two main components, α -pinene and 1, 8-cineole of the essential oil of E. robusta were evaluated repellency against nymphs of the German cockroaches . Strong repellency (Class V was obtained for Cyperus rotundus and Eucalyptus robusta essential oils and α- p inene and 1, 8- c ineole . However, Illicium verum essential oil possessed weak (Class I repellency. At a concentration of 5 ppm, all the 8 essential oils and the two compounds showed repellent activity after one hour exposure. At 1 ppm concentration, essential oil of Cyperus rotundus showed strong repellency and Class IV repellency was obtained for essential oil of E. robusta and the two compounds after one hour exposure. However, essential oils of I . verum and Lindera aggregata showed strong attractiveness to the German cockroaches at a concentration of 1 ppm .

  5. Survival and behavioural responses of the predatory ladybird beetle, Eriopis connexa populations susceptible and resistant to a pyrethroid insecticide.

    Science.gov (United States)

    Spíndola, A F; Silva-Torres, C S A; Rodrigues, A R S; Torres, J B

    2013-08-01

    The ladybird beetle, Eriopis connexa (Germar) (Coleoptera: Coccinellidae), is one of the commonest predators of aphids (Hemiptera: Aphididae) in the cotton agroecosystem and in many other row and fruit crops in Brazil, and has been introduced into other countries such as the USA for purposes of aphid control. In addition, the boll weevil, Anthonomus grandis Boheman (Coleoptera: Curculionidae) is the most serious cotton pest where it occurs, including Brazil. Controlling boll weevils and other pests such as cotton defoliators still tends to involve the intense application of insecticides to secure cotton production. The pyrethroid insecticide lambda-cyhalothrin (LCT) is commonly used, but this compound is not effective against aphids; hence, a desirable strategy would be to maintain E. connexa populations in cotton fields where LCT is applied. Using populations of E. connexa resistant (Res) and susceptible (Sus) to LCT, we compared behavioural responses on treated cotton plants and under confinement on partially and fully treated surfaces, and assessed the insects' survival on treated plants compared with that of the boll weevil. The E. connexa resistant population caged on treated plants with 15 and 75 g a.i. ha-1 exhibited ≫82% survival for both insecticide concentrations compared with ≪3% and ≪17% survival for susceptible E. connexa populations and boll weevils, respectively. The response of E. connexa Res and Sus populations when released, either on the soil or on the plant canopy, indicated avoidance towards treated plants, as measured by elapsed time to assess the plant. When compared with susceptible individuals, resistant ones took longer time to suffer insecticide knockdown, had a higher recovery rate after suffering knockdown, and spent more time in the plant canopy. Based on behavioural parameters evaluated in treated arenas, no ladybird beetles exhibited repellency. However, irritability was evident, with the susceptible population exhibiting

  6. Larvicidal, Repellent and Irritant Potential of the Seed-derived Essential oil of Apium graveolens against Dengue Vector, Aedes aegypti L. (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Sarita eKumar

    2014-09-01

    Full Text Available Aedes aegypti L., the primary carrier for viruses causing dengue, chikungunya and yellow fever is widespread over large areas of the tropics and subtropics. Keeping in view the adverse effects of chemical insecticides-based intervention measures; the eco-friendly, bio-degradable essential oil extracted from the seeds of celery, Apium graveolens; was investigated for anti-mosquito potential against Ae. aegypti. Evaluation of larvicidal potential of celery seed oil against early fourth instars of Ae. aegypti resulted in LC50 and LC90 values of 16.10 ppm and 29.08 ppm, respectively, after an exposure to 24 h; the toxic effect of the oil increasing by 1.2 fold with an LC50 value of 13.22 ppm after an exposure to 48h. Interestingly, the seed oil did not cause rapid mortality, suggesting a delayed type of larval killing effect. The remarkable finding of the present study was effective repellency of the essential oil leading to 100% protection till 165 min as compared to control that did not show any repellency against mosquitoes. Only 1 bite was recorded in the 165th minute after which only 2 bites were scored until 180 min of exposure of the oil to the adult mosquitoes. An exciting observation was the knocked-down of mosquitoes caused by the exposure to 10% oil-impregnated papers. The exposure to 1% oil resulted in first flight only after 4 sec and a total of 63.66 average flights during 15 min exposure revealing the relative irritability of 26.97.The qualitative phytochemical study of the oil showed the presence of terpenoids, lactones and flavonoids as the major constituents suggesting their possible role in the toxicity. Present investigations proved celery seed essential oil to be an efficient larvicide and repellent against dengue vector. Further studies are needed to identify the active principles involved, their mode of action, formulated preparations for enhancing potency and stability, toxicity and effects on non-target organisms and the

  7. Carvacrol importance in veterinary and human medicine as ecologic insecticide and acaricide

    Directory of Open Access Journals (Sweden)

    Vučinić Marijana

    2011-01-01

    Full Text Available Carvacrol is an active ingredient of essential oils from different plants, mainly from oregano and thyme species. It poseses biocidal activity agains many artropodes of the importance for veterinary and human medicine. Carvacrol acts as repelent, larvicide, insecticide and acaricide. It acts against pest artropodes such as those that serve as mechanical or biological vectors for many causal agents of viral, bacterial and parasitic diseases for animals and humans. Therefore, it may be used not only in pest arthropodes control but in vector borne diseases control, too. In the paper carvacrol bioactivity against mosquitoes, house flies, cockroaches, ticks and mites are described. Potencial modes of carvacrol action on artropodes are given, too. Carvacrol reachs its biotoxicity against arthropodes alone or in combination with other active ingredients from the same plant of its origin, such as tymol, cymen or others. The paper explains reasons for frequently investigations on essential oils and other natural products of plant origin to their biotoxicity against food stored pest or pest of medicinal importance, as well as, needs for their use in agriculture, veterinary and human medicine.

  8. Insecticidal Properties of Essential Oils and Some of Their Constituents on the Turkestan Cockroach (Blattodea: Blattidae).

    Science.gov (United States)

    Gaire, Sudip; O'Connell, Mary; Holguin, Francisco O; Amatya, Anup; Bundy, Scott; Romero, Alvaro

    2017-04-01

    The Turkestan cockroach, Blatta lateralis (Walker), has become the most important peridomestic species in urban areas of the Southwestern United States. The aim of this study was to evaluate the use of botanical compounds to control this urban pest. We tested the acute toxicity and repellency of six botanical constituents and three essential oils on Turkestan cockroach nymphs. Chemical composition of the essential oils was also determined. Topical and fumigant assays with nymphs showed that thymol was the most toxic essential oil constituent, with a LD50 of 0.34 mg/nymph and a LC50 of 27.6 mg/liter air, respectively. Contact toxicity was also observed in assays with trans-Cinnamaldehyde, eugenol, geraniol, methyl eugenol, and p-Cymene. Methyl eugenol and geraniol had limited fumigant toxicity. The essential oils from red thyme, clove bud, and Java citronella exhibited toxicity against nymphs. Cockroaches avoided fresh dry residues of thymol and essential oils. Chemical analysis of the essential oils confirmed high contents of effective essential oil constituents. Our results demonstrated that essential oils and some of their constituents have potential as eco-friendly insecticides for the management of Turkestan cockroaches. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. Structural requirements for repellency: norsesquiterpenes and sesquiterpenoid derivatives of nootkatone against the Formosan subterranean termite (Isoptera: Rhinotermitidae).

    Science.gov (United States)

    Zhu, Betty C R; Henderson, Gregg; Sauer, Anne M; Crowe, William; Laine, Roger A

    2010-08-01

    Research has shown that the family of grapefruit flavors called nootkatones have significant repellant and toxic effects to Formosan subterranean termites (Coptotermes formosanus Shiraki). Nineteen synthetic nootkatone derivatives, along with three commercially available nootkatone derivatives, were tested for repellent activity against C. formosanus by a choice assay in a petri dish with a two-step triage procedure. Based on the repellency threshold value, the relationships between structure and activity are discussed. Four derivatives of nootkatone have very high repellency and toxicity to C. formosanus, 9 times the potency of the primary compound nootkatone. Four other compounds have between 2 and 3 times the repellency of nootkatones, and three compounds are equal in their repellency to nootkatone. Copyright (c) 2010 Society of Chemical Industry.

  10. Spatial repellency of metofluthrin-impregnated multilayer paper strip against Aedes albopictus under outdoor conditions, Nagasaki, Japan

    OpenAIRE

    Argueta, Tamara Belzabel Obispo; Kawada, Hitoshi; Takagi, Masahiro

    2004-01-01

    Spatial repellency of a new device in which metofluthrin, a newly synthesized pyrethroid, is impregnated into a multilayer paper strip, against Aedes albopictus was evaluated under outdoor conditions. High spatial repellency (>80%) with the metofluthrin-impregnated (200 mg) device lasted for more than 6 weeks, while the repellency with the same device impregnated with the same amount of transfluthrin declined within 5 weeks after treatment.

  11. Laboratory and field evaluation of spatial repellency with metofluthrin-impregnated paper strip against mosquitoes in Lombok Island, Indonesia.

    Science.gov (United States)

    Kawada, Hitoshi; Maekawa, Yoshihide; Tsuda, Yoshio; Takagi, Masahiro

    2004-09-01

    Spatial repellency of a new multilayer paper strip impregnated with metofluthrin, a newly synthesized pyrethroid, was evaluated in the laboratory and in the field at Kerandangan, Lombok Island, Indonesia, with the use of cow- and human-baited double nets. Spatial repellency was observed in both cow- and human-baited collections. Metofluthrin treatment reduced mosquito collection by >80% during the 1st 4 weeks. However, repellency seemed to reduce with the loss of metofluthrin by evaporation within 6 wk after treatment.

  12. Laboratory and field evaluation of spatial repellency with metofluthrin impregnated paper strip against mosquitoes in Lombok Island, Indonesia.

    OpenAIRE

    Kawada, Hitoshi; Maekawa, Yoshihide; Tsuda, yoshio; Takagi, Masahiro

    2004-01-01

    Spatial repellency of a new multilayer paper strip impregnated with metofluthrin, a newly synthesized pyrethroid, was evaluated in the laboratory and in the field at Kerandangan, Lombok Island, Indonesia,with the use of cow- and human-baited double nets. Spatial repellency was observed in both cow- and human-baited collections. Metofluthrin treatment reduced mosquito collection by >8O% during the lst 4 weeks.However, repellency seemed to reduce with the loss of metofluthrin by evaporation wit...

  13. Radiopacity of household deodorizers, air fresheners, and moth repellents.

    Science.gov (United States)

    Woolf, A D; Saperstein, A; Zawin, J; Cappock, R; Sue, Y J

    1993-01-01

    Household deodorizers and moth repellents are common agents implicated in many childhood poisonings. Their ingredients usually include either paradichlorobenzene or naphthalene compressed into a solid ball or another shape, sometimes with added essential oils and fragrances. Because medically naphthalene is a more important toxin than paradichlorobenzene, with hematologic and nervous system effects, clinicians often seek to discern which product has been ingested. We discovered fortuitously that a mothball swallowed by a retarded adult was radiopaque, and so designed an in vitro experiment to study the radiopacity of a variety of household deodorizers and products. Of 10 products screened for radiopacity by two radiologists, those containing paradichlorobenzene were consistently strongly radiopaque; those containing naphthalene were radiolucent. A third alternative ingredient which is used in some toilet bowl deodorizers, cetrimonium bromide, was also radiopaque. Radiopacity of paradichlorobenzene or cetrimonium bromide-containing products did not dissipate with time. We speculate that the halogen within the chemical structure of these compounds accounts for their radiopacity. We conclude that paradichlorobenzene-containing commercial products can be distinguished clinically from those containing naphthalene by the performance of an abdominal radiograph.

  14. Repellence and attraction of Apis mellifera foragers by nectar alkaloids

    Directory of Open Access Journals (Sweden)

    Hroncová Z.

    2016-03-01

    Full Text Available Plant secondary metabolites present naturally in nectar, such as alkaloids, may change the behavioural responses of floral visitors and affect pollination. Some studies have shown that nectar containing low concentrations of these secondary metabolites is preferred by honey bee foragers over pure nectar. However, it remains unclear whether this is caused by dependence or addictive behaviour, a simple taste preference, or by other conditions such as self-medication. In our choice experiment, free-flying bees were presented with artificial flowers holding 20% sucrose containing 0.5−50 μg ml−1 of one of the naturally occurring nectar alkaloids - caffeine, nicotine, senecionine, and gelsemine. Nectar uptake was determined by weighing each flower and comparing the weight to that of the control flower. Our experimental design minimized memorizing and marking; despite this, caffeine was significantly preferred at concentrations 0.5−2 μg ml−1 over control nectar; this preference was not observed for other alkaloids. All of the compounds tested were repellent at concentrations above 5 μg ml−1. We confirmed previous reports that bees exhibit a preference for caffeine, and hypothesize that this is not due only to addictive behaviour but is at least partially mediated by taste preference. We observed no significant preference for nicotine or any other alkaloid.

  15. How to repel hot water from a superhydrophobic surface?

    KAUST Repository

    Yu, Zhejun

    2014-01-01

    Superhydrophobic surfaces, with water contact angles greater than 150° and slide angles less than 10°, have attracted a great deal of attention due to their self-cleaning ability and excellent water-repellency. It is commonly accepted that a superhydrophobic surface loses its superhydrophobicity in contact with water hotter than 50 °C. Such a phenomenon was recently demonstrated by Liu et al. [J. Mater. Chem., 2009, 19, 5602], using both natural lotus leaf and artificial leaf-like surfaces. However, our work has shown that superhydrophobic surfaces maintained their superhydrophobicity, even in water at 80 °C, provided that the leaf temperature is greater than that of the water droplet. In this paper, we report on the wettability of water droplets on superhydrophobic thin films, as a function of both their temperatures. The results have shown that both the water contact and slide angles on the surfaces will remain unchanged when the temperature of the water droplet is greater than that of the surface. The water contact angle, or the slide angle, will decrease or increase, however, with droplet temperatures increasingly greater than that of the surfaces. We propose that, in such cases, the loss of superhydrophobicity of the surfaces is caused by evaporation of the hot water molecules and their condensation on the cooler surface. © 2014 the Partner Organisations.

  16. Exploration of Novel Botanical Insecticide Leads: Synthesis and Insecticidal Activity of β-Dihydroagarofuran Derivatives.

    Science.gov (United States)

    Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen

    2016-02-24

    The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.

  17. Ion channels: molecular targets of neuroactive insecticides.

    Science.gov (United States)

    Raymond-Delpech, Valérie; Matsuda, Kazuhiko; Sattelle, Benedict M; Rauh, James J; Sattelle, David B

    2005-11-01

    Many of the insecticides in current use act on molecular targets in the insect nervous system. Recently, our understanding of these targets has improved as a result of the complete sequencing of an insect genome, i.e., Drosophila melanogaster. Here we examine the recent work, drawing on genetics, genomics and physiology, which has provided evidence that specific receptors and ion channels are targeted by distinct chemical classes of insect control agents. The examples discussed include, sodium channels (pyrethroids, p,p'-dichlorodiphenyl-trichloroethane (DDT), dihydropyrazoles and oxadiazines); nicotinic acetylcholine receptors (cartap, spinosad, imidacloprid and related nitromethylenes/nitroguanidines); gamma-aminobutyric acid (GABA) receptors (cyclodienes, gamma-BHC and fipronil) and L-glutamate receptors (avermectins). Finally, we have examined the molecular basis of resistance to these molecules, which in some cases involves mutations in the molecular target, and we also consider the future impact of molecular genetic technologies in our understanding of the actions of neuroactive insecticides.

  18. Experimental Investigation of Evaporation and Drainage in Wettable and Water-Repellent Sands

    Directory of Open Access Journals (Sweden)

    Dae Hyun Kim

    2015-05-01

    Full Text Available This study presents experimental results on evaporation and drainage in both wettable and water-repellent sands whose surface wettability was artificially modified by silanization. The 2D optical and 3D X-ray computed tomographic imaging was performed during evaporation and the water retention during cyclic drainage and infiltration was measured to assess effects of wettability and initial wetting conditions. The evaporation gradually induces its front at the early stage advance regardless of the wettability and sand types, while its rate becomes higher in water-repellent Ottawa sand than the wettable one. Jumunjin sand which has a smaller particle size and irregular particle shape than Ottawa sand exhibits a similar evaporation rate independent of wettability. Water-repellent sand can facilitate the evaporation when both wettable and water-repellent sands are naturally in contact with each other. The 3D X-ray imaging reveals that the hydraulically connected water films in wettable sands facilitate the propagation of the evaporation front into the soil such that the drying front deeply advances into the soil. For cyclic drainage-infiltration testing, the evolution of water retention is similar in both wettable and water-repellent sands when both are initially wet. However, when conditions are initially dry, water-repellent sands exhibit low residual saturation values. The experimental observations made from this study propose that the surface wettability may not be a sole factor while the degree of water-repellency, type of sands, and initial wetting condition are predominant when assessing evaporation and drainage behaviors.

  19. Protection against mosquito vectors Aedes aegypti, Anopheles stephensi and Culex quinquefasciatus using a novel insect repellent, ethyl anthranilate.

    Science.gov (United States)

    Islam, Johirul; Zaman, Kamaruz; Tyagi, Varun; Duarah, Sanjukta; Dhiman, Sunil; Chattopadhyay, Pronobesh

    2017-10-01

    Growing concern on the application of synthetic mosquito repellents in the recent years has instigated the identification and development of better alternatives to control different mosquito-borne diseases. In view of above, present investigation evaluates the repellent activity of ethyl anthranilate (EA), a non-toxic, FDA approved volatile food additive against three known mosquito vectors namely, Aedes aegypti, Anopheles stephensi and Culex quinquefasciatus under laboratory conditions following standard protocols. Three concentration levels (2%, 5% and 10% w/v) of EA were tested against all the three selected mosquito species employing K & D module and arm-in-cage method to determine the effective dose (ED 50 ) and complete protection time (CPT), respectively. The repellent activity of EA was further investigated by modified arm-in-cage method to determine the protection over extended spatial ranges against all mosquito species. All behavioural situations were compared with the well-documented repellent N,N-diethylphenyl acetamide (DEPA) as a positive control. The findings demonstrated that EA exhibited significant repellent activity against all the three mosquitoes species. The ED 50 values of EA, against Aedes aegypti, Anopheles stephensi and Culex quinquefasciatus were found to be 0.96%, 5.4% and 3.6% w/v, respectively. At the concentration of 10% w/v, it provided CPTs of 60, 60 and 30min, respectively, against Aedes aegypti, Anopheles stephensi and Culex quinquefasciatus mosquitoes. Again in spatial repellency evaluation, EA was found to be extremely effective in repelling all the three tested species of mosquitoes. Ethyl anthranilate provided comparable results to standard repellent DEPA during the study. Results have concluded that the currently evaluated chemical, EA has potential repellent activity against some well established mosquito vectors. The study emphasizes that repellent activity of EA could be exploited for developing effective, eco

  20. Acaricidal and repellent activities of essential oil of Eucalyptus globulus against Dermanyssus gallinae (Acari: Mesostigmata

    Directory of Open Access Journals (Sweden)

    Dehghani-Samani Amir

    2015-07-01

    Full Text Available Introduction: By considering an increase in drug resistance against red mites, finding the nonchemical herbal acaricide against Dermanyssus gallinae (De Geer (Acari: Mesostigmata is necessary to kill them and to reduce the chemical resistance against chemical acaricides in this specie. Dermanyssus gallinae is a potential vector of the causal agent of several viral diseases such as Equine encephalitis and St. Louis encephalitis. It can be a vector of bacteria such as Salmonella spp., Mycobacterium spp. and Erysipelothrix rhusiopathiae. It is also known to cause itching dermatosis in humans. In this study acaricidal and repellent activities of essential oil of Eucalyptus globulus against Dermanyssus gallinae were studied. Methods: After extracting the essential oil, different concentrations of the plant extract were prepared. Then, acaricidal effect of different concentrations was tested on poultry red mite, Dermanyssus gallinae, by dropping 3-4 drops of essential oil on mites. Repellent activity of essential oil was tested by Y-tube olfactometer bioassay. After the test, total number of killed and repellent mites reported. Results: Concentration of 1:2 or 50% had more acaricidal effect on mites. Also essential oil of Eucalyptus globulus had repellent activity against red mites. Conclusion: This study showed that essential oil of Eucalyptus globulus had acaricidal and repellent activities against red mites. Hence it might be used as a herbal acaricide against it to kill and to reduce the chemical resistance in this specie.

  1. Determining Exposure Factors of Anti-Fogging, Dye, Disinfectant, Repellent, and Preservative Products in Korea.

    Science.gov (United States)

    Lee, Daeyeop; Kim, Joo-Hyon; Kim, Taksoo; Yoon, Hyojung; Jo, Areum; Lee, Byeongwoo; Lim, Hyunwoo; Kim, Pilje; Seo, Jungkwan

    2018-01-30

    Reliable exposure factors are essential to determine health risks posed by chemicals in consumer products. We analyzed five risk-concerned product categories (anti-fogging, dye, disinfectant, repellent, and preservative products) for 13 products (three car anti-fogging products, a lens anti-fogging product, two car dye products, two drain disinfectants, an air conditioner disinfectant, a chlorine-based disinfectant, a fabric repellent, an insect repellent for food, and a wood preservative) considered to be of high risk in order to determine exposure factors via web surveys and estimation of amount of product. Among the 3000 participants (1482 (49%) men) aged ≥19 years, drain disinfectants were used most frequently (38.2%); the rate of usage of the other products ranged between 1.1-24.0%. The usage rates for the consumer products differed by sex, age, income, and education. Some consumer products such as car and lens anti-fogging products, chlorine-based disinfectants, fabric repellents, and drain disinfectants were regularly used more than once a month, while car dye products, air conditioner disinfectants, insect repellents for food, and wood preservatives were not regularly used owing to the specific product purposes and seasonal needs. Our results could be used for managing or controlling chemical substances in consumer products and conducting accurate exposure assessments.

  2. Peatland water repellency: Importance of soil water content, moss species, and burn severity

    Science.gov (United States)

    Moore, P. A.; Lukenbach, M. C.; Kettridge, N.; Petrone, R. M.; Devito, K. J.; Waddington, J. M.

    2017-11-01

    Wildfire is the largest disturbance affecting peatlands, with northern peat reserves expected to become more vulnerable to wildfire as climate change enhances the length and severity of the fire season. Recent research suggests that high water table positions after wildfire are critical to limit atmospheric carbon losses and enable the re-establishment of keystone peatland mosses (i.e. Sphagnum). Post-fire recovery of the moss surface in Sphagnum-feathermoss peatlands, however, has been shown to be limited where moss type and burn severity interact to result in a water repellent surface. While in situ measurements of moss water repellency in peatlands have been shown to be greater for feathermoss in both a burned and unburned state in comparison to Sphagnum moss, it is difficult to separate the effect of water content from species. Consequently, we carried out a laboratory based drying experiment where we compared the water repellency of two dominant peatland moss species, Sphagnum and feathermoss, for several burn severity classes including unburned samples. The results suggest that water repellency in moss is primarily controlled by water content, where a sharp threshold exists at gravimetric water contents (GWC) lower than ∼1.4 g g-1. While GWC is shown to be a strong predictor of water repellency, the effect is enhanced by burning. Based on soil water retention curves, we suggest that it is highly unlikely that Sphagnum will exhibit strong hydrophobic conditions under field conditions.

  3. Studies on repellent activity of seed oils alone and in combination on mosquito, Aedes aegypti.

    Science.gov (United States)

    Mukesh, Y; Savitri, P; Kaushik, R; Singh, N P

    2014-09-01

    The study was undertaken to investigate the relative repellency of Pongamia pinnata and Azadirachta indica seed oils on vector mosquito, Aedes aegypti under laboratory conditions. The repellents were formulated into 3 groups: seed oils, their mixture and combination of seed oils with three carrier oils viz. olive, mustard and coconut oil. Different formulations of each oil were tested at the concentrations of 1% and 5% on human baits. Efficiency was assessed, based on the total protection time; biting rate and percent protection provided by each formulation. Results showed that 5% formulation of the Pongamia pinnata and Azadirachta indica seed oils, mixed in 1:1 ratio exhibited highest percentage repellency of 85%, protection time of 300 min and bite rate of 6%. 5% concentration of A. indica and P. pinnata seed oil in mustard oil base offered 86.36% and 85% protection respectively with total protection time of 230 and 240 min respectively. The study confirms that Azadirachta indica and Pongamia pinnata have mosquito-repellent potential. When mixed in different ratios or with some carrier oil their efficacy increases 2-fold in some cases. These formulations are very promising for topical use (> 5 hrs complete protection) and are comparable to the protection provided by advanced Odomos mosquito repellent cream available commercially and thus are recommended for field trial.

  4. Synergistic mosquito-repellent activity of Curcuma longa, Pogostemon heyneanus and Zanthoxylum limonella essential oils.

    Science.gov (United States)

    Das, N G; Dhiman, Sunil; Talukdar, P K; Rabha, Bipul; Goswami, Diganta; Veer, Vijay

    2015-01-01

    Mosquito repellents play an important role in preventing man-mosquito contact. In the present study, we evaluated the synergistic mosquito-repellent activity of Curcuma longa, Pogostemon heyneanus and Zanthoxylum limonella essential oils. The mosquito repellent efficacies of three essential oils were evaluated separately and in combination under laboratory and field conditions. N,N-Diethylphenylacetamide (DEPA) and dimethylphthalate (DMP) were used for comparison of the protection time of the mixture of essential oils. At an optimum concentration of 20%, the essential oils of C. longa, Z. limonella and P. heyneanus provided complete protection times (CPTs) of 96.2, 91.4 and 123.4 min, respectively, against Aedes albopictus mosquitoes in the laboratory. The 1:1:2 mixture of the essential oils provided 329.4 and 391.0 min of CPT in the laboratory and field trials, respectively. The percent increases in CPTs for the essential oil mixture were 30 for DMP and 55 for N,N-diethylphenylacetamide (DEPA). The synergistic repellent activity of the essential oils used in the present study might be useful for developing safer alternatives to synthetic repellents for personal protection against mosquitoes. Copyright © 2015 King Saud Bin Abdulaziz University for Health Sciences. Published by Elsevier Ltd. All rights reserved.

  5. CO2 efflux from soils with seasonal water repellency

    Science.gov (United States)

    Urbanek, Emilia; Doerr, Stefan H.

    2017-10-01

    Soil carbon dioxide (CO2) emissions are strongly dependent on pore water distribution, which in turn can be modified by reduced wettability. Many soils around the world are affected by soil water repellency (SWR), which reduces infiltration and results in diverse moisture distribution. SWR is temporally variable and soils can change from wettable to water-repellent and vice versa throughout the year. Effects of SWR on soil carbon (C) dynamics, and specifically on CO2 efflux, have only been studied in a few laboratory experiments and hence remain poorly understood. Existing studies suggest soil respiration is reduced with increasing severity of SWR, but the responses of soil CO2 efflux to varying water distribution created by SWR are not yet known.Here we report on the first field-based study that tests whether SWR indeed reduces soil CO2 efflux, based on in situ measurements carried out over three consecutive years at a grassland and pine forest sites under the humid temperate climate of the UK.Soil CO2 efflux was indeed very low on occasions when soil exhibited consistently high SWR and low soil moisture following long dry spells. Low CO2 efflux was also observed when SWR was absent, in spring and late autumn when soil temperatures were low, but also in summer when SWR was reduced by frequent rainfall events. The highest CO2 efflux occurred not when soil was wettable, but when SWR, and thus soil moisture, was spatially patchy, a pattern observed for the majority of the measurement period. Patchiness of SWR is likely to have created zones with two different characteristics related to CO2 production and transport. Zones with wettable soil or low persistence of SWR with higher proportion of water-filled pores are expected to provide water with high nutrient concentration resulting in higher microbial activity and CO2 production. Soil zones with high SWR persistence, on the other hand, are dominated by air-filled pores with low microbial activity, but facilitating O2

  6. Evaluation of the laboratory mouse model for screening topical mosquito repellents.

    Science.gov (United States)

    Rutledge, L C; Gupta, R K; Wirtz, R A; Buescher, M D

    1994-12-01

    Eight commercial repellents were tested against Aedes aegypti 0 and 4 h after application in serial dilution to volunteers and laboratory mice. Results were analyzed by multiple regression of percentage of biting (probit scale) on dose (logarithmic scale) and time. Empirical correction terms for conversion of values obtained in tests on mice to values expected in tests on human volunteers were calculated from data obtained on 4 repellents and evaluated with data obtained on 4 others. Corrected values from tests on mice did not differ significantly from values obtained in tests on volunteers. Test materials used in the study were dimethyl phthalate, butopyronoxyl, butoxy polypropylene glycol, MGK Repellent 11, deet, ethyl hexanediol, Citronyl, and dibutyl phthalate.

  7. Bio-inspired water repellent surfaces produced by ultrafast laser structuring of silicon

    International Nuclear Information System (INIS)

    Barberoglou, M.; Zorba, V.; Stratakis, E.; Spanakis, E.; Tzanetakis, P.; Anastasiadis, S.H.; Fotakis, C.

    2009-01-01

    We report here an efficient method for preparing stable superhydrophobic and highly water repellent surfaces by irradiating silicon wafers with femtosecond laser pulses and subsequently coating them with chloroalkylsilane monolayers. By varying the laser pulse fluence on the surface one can successfully control its wetting properties via a systematic and reproducible variation of roughness at micro- and nano-scale, which mimics the topology of natural superhydrophobic surfaces. The self-cleaning and water repellent properties of these artificial surfaces are investigated. It is found that the processed surfaces are among the most water repellent surfaces ever reported. These results may pave the way for the implementation of laser surface microstructuring techniques for the fabrication of superhydrophobic and self-cleaning surfaces in different kinds of materials as well

  8. Bioassay-guided investigation of two monarda essential oils as repellents of yellow fever mosquito Aedes aegypti

    Science.gov (United States)

    As part of an ongoing research program to identify active mosquito repellents, Monarda bradburiana Beck and M. fistulosa L. essential oils showed potent repellents with minimum effective dosages (MED) of 0.055 ± 0.036 and 0.078 ± 0.027 mg/cm2, respectively, compared to reference standard N,N-diethyl...

  9. Arthropod repellency, especially tick (Ixodes ricinus), exerted by extract from Artemisia abrotanum and essential oil from flowers of Dianthus caryophyllum.

    Science.gov (United States)

    Tunón, H; Thorsell, W; Mikiver, A; Malander, I

    2006-06-01

    A toluene extract of southernwood (Artemisia abrotanum) and the essential oil from flowers of carnation (Dianthus caryophyllum ) exerted pronounced a repellent effect both against ticks (nymphs of Ixodes ricinus) and yellow fever mosquitoes (Aedes aegypti). The most potent repellents found were coumarin and thujyl alcohol from A. abrotanum and phenylethanol from D. caryophyllum where coumarin and thujyl alcohol were also detected.

  10. Post-Fire soil water repellency, hydrologic response, and sediment yield compared between grass-converted and chaparral watersheds

    Science.gov (United States)

    Ken R. Hubbert; Pete M. Wohlgemuth; Jan L. Beyers; Marcia G. Narog; Ross Gerrard

    2012-01-01

    In 2002, the Williams Fire burned >90 % of the San Dimas Experimental Forest, providing an opportunity to investigate differences in soil water repellency, peak discharge, and sediment yield between grass-converted and chaparral watersheds. Post-fire water repellency and moisture content were measured in the winter and summer for four years. Peak discharge was...

  11. Water repellent soils following prescribed burning treatments and a wildfire in the oak savannas of the Malpai Borderlands Region

    Science.gov (United States)

    Cody L. Stropki; Peter F. Ffolliott; Gerald J. Gottfried

    2009-01-01

    Water repellent (hydrophobic) soils impact the infiltration process of a water budget by restricting the movement of water into and through a soil body. The infiltration of water into a water repellent soil can be inhibited or completely impeded in which case much of the incoming precipitation reaching the soil surface becomes overland flow. One mechanism causing the...

  12. Insecticides suppress natural enemies and increase pest damage in cabbage.

    Science.gov (United States)

    Bommarco, Riccardo; Miranda, Freddy; Bylund, Helena; Björkman, Christer

    2011-06-01

    Intensive use of pesticides is common and increasing despite a growing and historically well documented awareness of the costs and hazards. The benefits from pesticides of increased yields from sufficient pest control may be outweighed by developed resistance in pests and killing of beneficial natural enemies. Other negative effects are human health problems and lower prices because of consumers' desire to buy organic products. Few studies have examined these trade-offs in the field. Here, we demonstrate that Nicaraguan cabbage (Brassica spp.) farmers may suffer economically by using insecticides as they get more damage by the main pest diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae), at the same time as they spend economic resources on insecticides. Replicated similarly sized cabbage fields cultivated in a standardized manner were either treated with insecticides according common practice or not treated with insecticides over two seasons. Fields treated with insecticides suffered, compared with nontreated fields, equal or, at least in some periods of the seasons, higher diamondback moth pest attacks. These fields also had increased leaf damage on the harvested cabbage heads. Weight and size of the heads were not affected. The farmers received the same price on the local market irrespective of insecticide use. Rates of parasitized diamondback moth were consistently lower in the treated fields. Negative effects of using insecticides against diamondback moth were found for the density of parasitoids and generalist predatory wasps, and tended to affect spiders negatively. The observed increased leaf damages in insecticide-treated fields may be a combined consequence of insecticide resistance in the pest, and of lower predation and parasitization rates from naturally occurring predators that are suppressed by the insecticide applications. The results indicate biological control as a viable and economic alternative pest management strategy

  13. CO2 response to rewetting of hydrophobic soils - Can soil water repellency inhibit the 'Birch effect'?

    Science.gov (United States)

    Sanchez-Garcia, Carmen; Urbanek, Emilia; Doerr, Stefan

    2017-04-01

    Rewetting of dry soils is known to cause a short-term CO2 pulse commonly known as the 'Birch effect'. The displacement of CO2 with water during the process of wetting has been recognised as one of the sources of this pulse. The 'Birch effect' has been extensively observed in many soils, but some studies report a lack of such phenomenon, suggesting soil water repellency (SWR) as a potential cause. Water infiltration in water repellent soils can be severely restricted, causing overland flow or increased preferential flow, resulting in only a small proportion of soil pores being filled with water and therefore small gas-water replacement during wetting. Despite the suggestions of a different response of CO2 fluxes to wetting under hydrophobic conditions, this theory has never been tested. The aim of this study is to test the hypothesis that CO2 pulse does not occur during rewetting of water repellent soils. Dry homogeneous soils at water-repellent and wettable status have been rewetted with different amounts of water. CO2 flux as a response to wetting has been continuously measured with the CO2 flux analyser. Delays in infiltration and non-uniform heterogeneous water flow were observed in water repellent soils, causing an altered response in the CO2 pulse in comparison to typically observed 'Birch effect' in wettable systems. The main conclusion from the study is that water repellency not only affects water relations in soil, but has also an impact on greenhouse gas production and transport and therefore should be included as an important parameter during the sites monitoring and modelling of gas fluxes.

  14. Robust Manipulations of Pest Insect Behavior Using Repellents and Practical Application for Integrated Pest Management.

    Science.gov (United States)

    Wallingford, Anna K; Cha, Dong H; Linn, Charles E; Wolfin, Michael S; Loeb, Gregory M

    2017-10-01

    In agricultural settings, examples of effective control strategies using repellent chemicals in integrated pest management (IPM) are relatively scarce compared to those using attractants. This may be partly due to a poor understanding of how repellents affect insect behavior once they are deployed. Here we attempt to identify potential hallmarks of repellent stimuli that are robust enough for practical use in the field. We explore the literature for success stories using repellents in IPM and we investigate the mechanisms of repellency for two chemical oviposition deterrents for controlling Drosophila suzukii Matsumura, a serious pest of small fruit crops. Drosophila suzukii causes injury by laying her eggs in ripening fruit and resulting larvae make fruit unmarketable. In caged choice tests, reduced oviposition was observed in red raspberry fruit treated with volatile 1-octen-3-ol and geosmin at two initial concentrations (10% and 1%) compared to untreated controls. We used video monitoring to observe fly behavior in these caged choice tests and investigate the mode of action for deterrence through the entire behavioral repertoire leading to oviposition. We observed fewer visitors and more time elapsed before flies first landed on 1-octen-3-ol-treated fruits than control fruits and concluded that this odor primarily inhibits behaviors that occur before D. suzukii comes in contact with a potential oviposition substrate (precontact). We observed some qualitative differences in precontact behavior of flies around geosmin-treated fruits; however, we concluded that this odor primarily inhibits behaviors that occur after D. suzukii comes in contact with treated fruits (postcontact). Field trials found reduced oviposition in red raspberry treated with 1-octen-3-ol and a combination of 1-octen-3-ol and geosmin, but no effect of geosmin alone. Recommendations for further study of repellents for practical use in the field are discussed. © The Authors 2017. Published by

  15. Diagnostic Doses of Insecticides for Adult Aedes aegypti to Assess Insecticide Resistance in Cuba.

    Science.gov (United States)

    Rodríguez, María Magdalena; Crespo, Ariel; Hurtado, Daymi; Fuentes, Ilario; Rey, Jorge; Bisset, Juan Andrés

    2017-06-01

    The objective of this study was to determine diagnostic doses (DDs) of 5 insecticides for the Rockefeller susceptible strain of Aedes aegypti , using the Centers for Disease Control and Prevention (CDC) bottle bioassay as a tool for monitoring insecticide resistance in the Cuban vector control program. The 30-min DD values determined in this study were 13.5 μg/ml, 6.5 μg/ml, 6 μg/ml, 90.0 μg/ml, and 15.0 μg/ml for cypermethrin, deltamethrin, lambda-cyhalothrin, chlorpyrifos, and propoxur, respectively. To compare the reliability of CDC bottle bioassay with the World Health Organization susceptible test, 3 insecticide-resistant strains were evaluated for deltamethrin and lambda-cyhalothrin. Results showed that the bottles can be used effectively from 21 to 25 days after treatment and reused up to 4 times, depending on the storage time. The CDC bottle bioassay is an effective tool to assess insecticide resistance in field populations of Ae. aegypti in Cuba and can be incorporated into vector management programs using the diagnostic doses determined in this study.

  16. Responses of lone star tick (acari: ixodidae) nymphs to the repellent deet applied in acetone and ethanol solutions in vitro bioassays

    Science.gov (United States)

    Behavioral bioassays remain a standard tool in the discovery, development, and registration of repellents. Although tick repellent bioassays tend to be rather uncomplicated, several factors can influence their outcomes. Typically repellent bioassays use a solvent, such as acetone or ethanol, to disp...

  17. Emamectin benzoate: new insecticide against Helicoverpa armigera.

    Science.gov (United States)

    Fanigliulo, A; Sacchetti, M

    2008-01-01

    Emamectin benzoate is a new insecticide of Syngenta Crop Protection, with a new mechanism of action and a strong activity against Lepidoptera as well as with and a high selectivity on useful organisms. This molecule acts if swallowed and has some contact action. It penetrates leaf tissues (translaminar activity) and forms a reservoir within the leaf. The mechanism of action is unique in the panorama of insecticides. In facts, it inhibits muscle contraction, causing a continuous flow of chlorine ions in the GABA and H-Glutamate receptor sites. During 2006 and 2007, experimentation was performed by the Bioagritest test facility, according to EPPO guidelines and Principles of Good Experimental Practice (GEP), aiming at establishing the biological efficacy and the selectivity of Emamectin benzoate on industry tomato against Helicoverpa armigera (Lepidoptera: Noctuidoe). The study was performed in Tursi-Policoro (Matera), southern Italy. Experimental design consisted in random blocks, in 4 repetitions. A dosage of 1.5 Kg/ha of the formulate was compared with two commercial formulates: Spinosad 0.2 kg/ha (Laser, Dow Agrosciences Italia) and Indoxacarb 0.125 kg/ha (Steward EC insecticide, Dupont). Three foliage applications were applied every 8 days. The severity of damage induced by H. armigera was evaluated on fruits. Eventual phytotoxic effects were also evaluated. Climatic conditions were optimal for Lepidoptera development, so that the percentage of fruits attacked in 2007 at the first scouting was 68.28%. Emamectin benzoate has shown, in two years of testing, a high control of H. armigera if compared with the standards Indoxacarb and Spinosad. No effect of phytotoxicity was noticed on fruits.

  18. BACILLUS THURINGIENSIS ELASTASES WITH INSECTICIDE ACTIVITY

    Directory of Open Access Journals (Sweden)

    E. V. Matseliukh

    2015-10-01

    Full Text Available The purpose of the research was a screening of proteases with elastase activity among Bacillus thuringiensis strains, their isolation, partially purification, study of physicochemical properties and insecticide activity in relation to the larvae of the Colorado beetle. The objects of the investigation were 18 strains of B. thuringiensis, isolated from different sources: sea water, dry biological product "Bitoksibatsillin" and also from natural populations of Colorado beetles of the Crimea, Kherson, Odesa, Mykolaiv and Zaporizhiia regions of Ukraine. Purification of enzymes with elastase activity isolated from above mentioned strains was performed by gel-chromatography and insecticide activity was studied on the 3–4 larvae instar of Colorado beetle. The ability of a number of B. thuringiensis strains to synthesize the proteases with elastase activity has been established. The most active were enzymes obtained from strains IMV B-7465, IMV B-7324 isolated from sea water, and strains 9, 902, Bt-H and 0-239 isolated from Colorado beetles. The study of the physicochemical properties of the partially purified proteases of these strains showed that they belonged to enzymes of the serine type. Peptidases of a number of B. thuringiensis strains (IMV B-7324, IMV B-7465, 902, 0-239, 9 are metal-dependent enzymes. Optimal conditions of action of all tested enzymes are the neutral and alkaline рН values and the temperatures of 30–40 °С. The studies of influence of the complex enzyme preparations and partially purified ones of B. thuringiensis strains on the larvae instar of Colorado beetles indicated that enzymes with elastase activity could be responsible for insecticide action of the tested strains.

  19. Oil-Repellent Antifogging Films with Water-Enabled Functional and Structural Healing Ability.

    Science.gov (United States)

    Xu, Fuchang; Li, Xiang; Li, Yang; Sun, Junqi

    2017-08-23

    Healable oil-repellent antifogging films are fabricated by layer-by-layer assembly of hyaluronic acid (HA) and branched poly(ethylenimine) (bPEI), followed by immersion in the aqueous solutions of perfluorooctanesulfonic acid potassium salt (PFOS). The loading of PFOS endows the HA/bPEI films with oil repellency while maintaining its original hydrophilicity. The resulting films have an excellent antifogging ability, and various organic liquids can easily slide down the slightly tilted films (touch screens, antigraffiti coatings for signs and shop windows, and antifogging coatings for lenses, mirrors, and windshields.

  20. Thermal properties and water repellency of cotton fabric prepared through sol-gel method

    Directory of Open Access Journals (Sweden)

    Gu Jia-Li

    2016-01-01

    Full Text Available Cotton fabrics were treated by one-step sol-gel method. The pure silica hydrosol and phosphorus-doped hydrosol were prepared with the addition of a hydrophobic hexadecyltrimethoxysilane to decrease the surface energy of cotton fabric. The thermal properties and water repellency of treated cotton fabric were characterized by thermo-gravimetric analysis, micro combustion, limiting oxygen index, and contact angle measurement. The results showed that cotton fabric treated by phosphorus-doped silica hydrosol had excellent flame retardance, and the water repellence was apparently improved with the addition of hexadecyltrimethoxysilane.

  1. Effects of wildfire on soil water repellency in pine and eucalypt forest in central Portugal

    Science.gov (United States)

    Faria, Sílvia; Eufemia Varela, María.; Keizer, Jan Jacob

    2010-05-01

    Soil water repellency is a naturally occurring phenomenon that can be intensified by soil heating during fires. Fire-induced or -enhanced water repellency, together with the loss of plant cover, is widely regarded as a key factor in increased surface runoff and accelerated erosion in recently burnt areas. The present study is part of the EROSFIRE-II project, whose main aim is to assess and predict post-wildfire hydrological and erosion processes at multiple spatial scales, ranging from micro-plot (Pinus pinaster and Eucaliptus globulus). In addition, two similar but long unburned slopes were selected in the immediate surroundings. For a period of 10 months, starting November 2008, water repellency and moisture content of the 0-5 cm topsoil layer were measured in the field at monthly intervals. Repellency was measured using the ‘Molarity of an Ethanol Droplet' (MED) test, soil moisture content using a DECAGON EC5 sensor. The results revealed a very strong repellency (ethanol classes 6-7) at all four sites during the first sampling period in November 2008, suggesting that the immediate wildfire effects were minor for both forest types. In the subsequent 5 to 6 months, however, there was a definite tendency for higher ethanol classes at the recently burnt than the adjacent unburned sites. Especially in the case of the pine stands, this tendency was inverted during the remaining months. The above-mentioned differences between the neighboring sites reflected more pronounced temporal patters in the case of the unburned sites, where median repellency levels corresponded none to slight severity ratings from December to March (pine) or April (eucalypt). Such seasonal drops in repellency were considerably shorter at the two burnt sites (1-2 months) and also less pronounced, without median ethanol classes becoming zero as occurred at the burnt sites. The seasonal repellency patterns at the unburned sites could be explained rather well by changes in soil moisture content

  2. Spatial repellents: from discovery and development to evidence-based validation

    Directory of Open Access Journals (Sweden)

    Achee Nicole L

    2012-05-01

    Full Text Available Abstract International public health workers are challenged by a burden of arthropod-borne disease that remains elevated despite best efforts in control programmes. With this challenge comes the opportunity to develop novel vector control paradigms to guide product development and programme implementation. The role of vector behaviour modification in disease control was first highlighted several decades ago but has received limited attention within the public health community. This paper presents current evidence highlighting the value of sub-lethal agents, specifically spatial repellents, and their use in global health, and identifies the primary challenges towards establishing a clearly defined and recommended role for spatial repellent products in disease control.

  3. Ethnobotanical study of some of mosquito repellent plants in north-eastern Tanzania

    Directory of Open Access Journals (Sweden)

    Tenu Filemoni

    2008-08-01

    Full Text Available Abstract Background The use of plant repellents against nuisance biting insects is common and its potential for malaria vector control requires evaluation in areas with different level of malaria endemicity. The essential oils of Ocimum suave and Ocimum kilimandscharicum were evaluated against malaria vectors in north-eastern Tanzania. Methodology An ethnobotanical study was conducted at Moshi in Kilimanjaro region north-eastern Tanzania, through interviews, to investigate the range of species of plants used as insect repellents. Also, bioassays were used to evaluate the protective potential of selected plants extracts against mosquitoes. Results The plant species mostly used as repellent at night are: fresh or smoke of the leaves of O. suave and O. kilimandscharicum (Lamiaceae, Azadirachta indica (Meliaceae, Eucalyptus globules (Myrtaceae and Lantana camara (Verbenaceae. The most popular repellents were O. kilimandscharicum (OK and O. suave (OS used by 67% out of 120 households interviewed. Bioassay of essential oils of the two Ocimum plants was compared with citronella and DEET to study the repellence and feeding inhibition of untreated and treated arms of volunteers. Using filter papers impregnated with Ocimum extracts, knockdown effects and mortality was investigated on malaria mosquito Anopheles arabiensis and Anopheles gambiae, including a nuisance mosquito, Culex quinquefasciatus. High biting protection (83% to 91% and feeding inhibition (71.2% to 92.5% was observed against three species of mosquitoes. Likewise the extracts of Ocimum plants induced KD90 of longer time in mosquitoes than citronella, a standard botanical repellent. Mortality induced by standard dosage of 30 mg/m2 on filter papers, scored after 24 hours was 47.3% for OK and 57% for OS, compared with 67.7% for citronella. Conclusion The use of whole plants and their products as insect repellents is common among village communities of north-eastern Tanzania and the results

  4. Initial water repellency affected organic matter depletion rates of manure amended soils in Sri Lanka

    Directory of Open Access Journals (Sweden)

    Leelamanie D.A.L.

    2014-12-01

    Full Text Available The wetting rate of soil is a measure of water repellency, which is a property of soils that prevents water from wetting or penetrating into dry soil. The objective of the present research was to examine the initial water repellency of organic manure amended soil, and its relation to the soil organic matter (SOM depletion rates in the laboratory. Soil collected from the Wilpita natural forest, Sri Lanka, was mixed with organic manure to prepare soil samples with 0, 5, 10, 25, and 50% organic manure contents. Locally available cattle manure (CM, goat manure (GM, and Casuarina equisetifolia leaves (CE were used as the organic manure amendments. Organic matter content of soils was measured in 1, 3, 7, 14, and 30 days intervals under the laboratory conditions with 74±5% relative humidity at 28±1°C. Initial water repellency of soil samples was measured as the wetting rates using the water drop penetration time (WDPT test. Initial water repellency increased with increasing SOM content showing higher increasing rate for hydrophobic CE amended samples compared with those amended with CM and GM. The relation between water repellency and SOM content was considered to be governed by the original hydrophobicities of added manures. The SOM contents of all the soil samples decreased with the time to reach almost steady level at about 30 d. The initial SOM depletion rates were negatively related with the initial water repellency. However, all the CE amended samples initially showed prominent low SOM depletion rates, which were not significantly differed with the amended manure content or the difference in initial water repellency. It is explicable that the original hydrophobicity of the manure as well has a potentially important effect on initiation of SOM decomposition. In contrast, the overall SOM depletion rate can be attributed to the initial water repellency of the manure amended sample, however, not to the original hydrophobicity of the amended manure

  5. Predicting the impact of insecticide-treated bed nets on malaria transmission: the devil is in the detail.

    Science.gov (United States)

    Gu, Weidong; Novak, Robert J

    2009-11-16

    Insecticide-treated bed nets (ITNs), including long-lasting insecticidal nets (LLINs), play a primary role in global campaigns to roll back malaria in tropical Africa. Effectiveness of treated nets depends on direct impacts on individual mosquitoes including killing and excite-repellency, which vary considerably among vector species due to variations in host-seeking behaviours. While monitoring and evaluation programmes of ITNs have focuses on morbidity and all-cause mortality in humans, local entomological context receives little attention. Without knowing the dynamics of local vector species and their responses to treated nets, it is difficult to predict clinical outcomes when ITN applications are scaled up across African continent. Sound model frameworks incorporating intricate interactions between mosquitoes and treated nets are needed to develop the predictive capacity for scale-up applications of ITNs. An established agent-based model was extended to incorporate the direct outcomes, e.g. killing and avoidance, of individual mosquitoes exposing to ITNs in a hypothetical village setting with 50 houses and 90 aquatic habitats. Individual mosquitoes were tracked throughout the life cycle across the landscape. Four levels of coverage, i.e. 40, 60, 80 and 100%, were applied at the household level with treated houses having only one bed net. By using Latin hypercube sampling scheme, parameters governing killing, diverting and personal protection of net users were evaluated for their relative roles in containing mosquito populations, entomological inoculation rates (EIRs) and malaria incidence. There were substantial gaps in coverage between households and individual persons, and 100% household coverage resulted in circa 50% coverage of the population. The results show that applications of ITNs could give rise to varying impacts on population-level metrics depending on values of parameters governing interactions of mosquitoes and treated nets at the individual level

  6. Predicting the impact of insecticide-treated bed nets on malaria transmission: the devil is in the detail

    Directory of Open Access Journals (Sweden)

    Novak Robert J

    2009-11-01

    Full Text Available Abstract Background Insecticide-treated bed nets (ITNs, including long-lasting insecticidal nets (LLINs, play a primary role in global campaigns to roll back malaria in tropical Africa. Effectiveness of treated nets depends on direct impacts on individual mosquitoes including killing and excite-repellency, which vary considerably among vector species due to variations in host-seeking behaviours. While monitoring and evaluation programmes of ITNs have focuses on morbidity and all-cause mortality in humans, local entomological context receives little attention. Without knowing the dynamics of local vector species and their responses to treated nets, it is difficult to predict clinical outcomes when ITN applications are scaled up across African continent. Sound model frameworks incorporating intricate interactions between mosquitoes and treated nets are needed to develop the predictive capacity for scale-up applications of ITNs. Methods An established agent-based model was extended to incorporate the direct outcomes, e.g. killing and avoidance, of individual mosquitoes exposing to ITNs in a hypothetical village setting with 50 houses and 90 aquatic habitats. Individual mosquitoes were tracked throughout the life cycle across the landscape. Four levels of coverage, i.e. 40, 60, 80 and 100%, were applied at the household level with treated houses having only one bed net. By using Latin hypercube sampling scheme, parameters governing killing, diverting and personal protection of net users were evaluated for their relative roles in containing mosquito populations, entomological inoculation rates (EIRs and malaria incidence. Results There were substantial gaps in coverage between households and individual persons, and 100% household coverage resulted in circa 50% coverage of the population. The results show that applications of ITNs could give rise to varying impacts on population-level metrics depending on values of parameters governing interactions of

  7. Effectiveness and profitability of insecticide formulations used for ...

    African Journals Online (AJOL)

    To identify optimal pest control with lower economic risks to farmers, we investigated the effectiveness and profitability of different insecticides and insecticide formulations against bean fly (Ophiomyia spp.) and bean flower thrips (Megalurothrips sjostedtii). Two separate experiments were conducted during 2009 to 2012.

  8. Effects of insecticide spray application on insect pest infestation and ...

    African Journals Online (AJOL)

    USER

    2010-03-15

    Mar 15, 2010 ... This study provides information on the incidence of major insect pests of cowpea as well as the minimum insecticide control intervention necessary for effectively reducing cowpea yield losses on the field. Two insecticide spray regimes (once at flowering and podding) significantly reduced insect population ...

  9. Effects of insecticide spray application on insect pest infestation and ...

    African Journals Online (AJOL)

    Field studies were conducted during the 2008 - 2009 cropping season to determine the minimal insecticide application which can reduce cowpea yield losses on the field due to insect pest infestations in the Transkei region of South Africa. Treatments consisted of five cowpea varieties and four regimes of insecticide spray ...

  10. Design, Synthesis and Insecticidal Activities of Novel Phenyl Substituted Isoxazolecarboxamides

    Institute of Scientific and Technical Information of China (English)

    LIU Peng-fei; ZHANG Ji-feng; YAN Tao; XIONG Li-xia; LI Zheng-ming

    2012-01-01

    Thirteen novel phenyl substituted isoxazolecarboxamides were synthesized,and their structures were characterized by 1H NMR,elementary analysis and high-resolution mass spectrometry(HRMS) techniques.Their evaluated insecticidal activities against oriental armyworm(Mythimna separata) indicate that the phcnyl substituted isoxazolecarboxamides exhibited moderate insecticidal activities,among which compounds 9c and 9k showed comparatively higher activities.

  11. Mechanistic modeling of insecticide risks to breeding birds in ...

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of the insecticide and the risk the insecticide poses to the environment and non-target wildlife. At the present time, current USEPA risk assessments do not include population-level endpoints. In this paper, we present a new mechanistic model, which allows risk assessors to estimate the effects of insecticide exposure on the survival and seasonal productivity of birds known to use agricultural fields during their breeding season. The new model was created from two existing USEPA avian risk assessment models, the Terrestrial Investigation Model (TIM v.3.0) and the Markov Chain Nest Productivity model (MCnest). The integrated TIM/MCnest model has been applied to assess the relative risk of 12 insecticides used to control corn pests on a suite of 31 avian species known to use cornfields in midwestern agroecosystems. The 12 insecticides that were assessed in this study are all used to treat major pests of corn (corn root worm borer, cutworm, and armyworm). After running the integrated TIM/MCnest model, we found extensive differences in risk to birds among insecticides, with chlorpyrifos and malathion (organophosphates) generally posing the greatest risk, and bifenthrin and ë-cyhalothrin (

  12. Expression of melanin and insecticidal protein from Rhodotorula ...

    African Journals Online (AJOL)

    Both the salmon/red melanin and the insecticidal producing genes of Rhodotorula glutinis was successfully expressed in Escherichia coli using plasmid pZErO-1. This work suggests that in Rhodotorula species melanin and insecticidal toxin are co-expressed and therefore possibly co-evolved. Keywords: Rhodotorula ...

  13. Guide to testing insecticides on coniferous forest defoliators

    Science.gov (United States)

    Carroll B Jr. Williams; David A. Sharpnack; Liz Maxwell; Patrick J. Shea; Mark D. McGregor

    1985-01-01

    This report provides a guide to techniques for designing field tests of candidate insecticides, and for carrying out pilot tests and control projects. It describes experimental designs for testing hypotheses, and for sampling trees to estimate insect population densities and percent reduction after treatments. Directions for applying insecticides by aircraft and for...

  14. Biological efficacy of the ecotoxically favourable insecticides and ...

    African Journals Online (AJOL)

    Administrator

    2011-05-30

    May 30, 2011 ... different, studies done in natural conditions should be favored. Key words: Insecticides ... insecticide was applied on synthetic or natural food of the target insect ..... Pozsgay M, Fast P, Kaplan H, Carey PR (1987). The effect of ...

  15. Ecdysone Agonist: New Insecticides with Novel Mode of Action

    Directory of Open Access Journals (Sweden)

    Y. Andi Trisyono

    2002-12-01

    Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists

  16. Identification and cloning of two insecticidal protein genes from ...

    African Journals Online (AJOL)

    Bacillus thuringiensis (Bt) is the most widely applied type of microbial pesticide due to its high specificity and environmental safety. The activity of Bt is largely attributed to the insecticidal crystal protein encoded by the cry genes. Different insecticidal crystal proteins of Bt have different bioactivity against distinct agricultural ...

  17. Interactions of transgenic Bacillus thuringiensis insecticidal crops with spiders (Araneae)

    Science.gov (United States)

    Genetically modified crops expressing insecticidal proteins from Bacillus thuringiensis (Bt) have dramatically increased in acreage since their introduction in the mid-1990’s. Although the insecticidal mechanisms of Bt target specific pests, concerns persist regarding direct and indirect effects on...

  18. Conifer flavonoid compounds inhibit detoxification enzymes and synergize insecticides.

    Science.gov (United States)

    Wang, Zhiling; Zhao, Zhong; Cheng, Xiaofei; Liu, Suqi; Wei, Qin; Scott, Ian M

    2016-02-01

    Detoxification by glutathione S-transferases (GSTs) and esterases are important mechanisms associated with insecticide resistance. Discovery of novel GST and esterase inhibitors from phytochemicals could provide potential new insecticide synergists. Conifer tree species contain flavonoids, such as taxifolin, that inhibit in vitro GST activity. The objectives were to test the relative effectiveness of taxifolin as an enzyme inhibitor and as an insecticide synergist in combination with the organophosphorous insecticide, Guthion (50% azinphos-methyl), and the botanical insecticide, pyrethrum, using an insecticide-resistant Colorado potato beetle (CPB) Leptinotarsa decemlineata (Say) strain. Both taxifolin and its isomer, quercetin, increased the mortality of 1(st) instar CPB larvae after 48h when combined with Guthion, but not pyrethrum. Taxifolin had greater in vitro esterase inhibition compared with the commonly used esterase inhibitor, S, S, S-tributyl phosphorotrithioate (DEF). An in vivo esterase and GST inhibition effect after ingestion of taxifolin was measured, however DEF caused a greater suppression of esterase activity. This study demonstrated that flavonoid compounds have both in vitro and in vivo esterase inhibition, which is likely responsible for the insecticide synergism observed in insecticide-resistant CPB. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

  19. Botanical insecticides inspired by plant-herbivore chemical interactions.

    Science.gov (United States)

    Miresmailli, Saber; Isman, Murray B

    2014-01-01

    Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides. Copyright © 2013 Elsevier Ltd. All rights reserved.

  20. Ecotoxicological study of insecticide effects on arthropods in common bean.

    Science.gov (United States)

    de Barros, Emerson Cristi; Ventura, Hudson Vaner; Gontijo, Pablo Costa; Pereira, Renata Ramos; Picanço, Marcelo Coutinho

    2015-01-01

    Arthropods are an important group of macroorganisms that work to maintain ecosystem health. Despite the agricultural benefits of chemical control against arthropod pests, insecticides can cause environmental damage. We examined the effects of one and two applications of the insecticides chlorfenapyr (0.18 liters a.i. ha-1) and methamidophos (0.45 liters a.i. ha-1), both independently and in combination, on arthropods in plots of common bean. The experiment was repeated for two growing seasons. Principal response curve, richness estimator, and Shannon-Wiener diversity index analyses were performed. The insecticides generally affected the frequency, richness, diversity, and relative abundance of the arthropods. In addition, the arthropods did not experience recovery after the insecticide applications. The results suggest that the insecticide impacts were sufficiently drastic to eliminate many taxa from the studied common bean plots. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  1. An Operational Framework for Insecticide Resistance Management Planning.

    Science.gov (United States)

    Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael

    2016-05-01

    Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.

  2. Wetting properties of fungi mycelium alter soil infiltration and soil water repellency in a γ-sterilized wettable and repellent soil.

    Science.gov (United States)

    Chau, Henry Wai; Goh, Yit Kheng; Vujanovic, Vladimir; Si, Bing Cheng

    2012-12-01

    Soil water repellency (SWR) has a drastic impact on soil quality resulting in reduced infiltration, increased runoff, increased leaching, reduced plant growth, and increased soil erosion. One of the causes of SWR is hydrophobic fungal structures and exudates that change the soil-water relationship. The objective of this study was to determine whether SWR and infiltration could be manipulated through inoculation with fungi. The effect of fungi on SWR was investigated through inoculation of three fungal strains (hydrophilic -Fusarium proliferatum, chrono-amphiphilic -Trichoderma harzianum, and hydrophobic -Alternaria sp.) on a water repellent soil (WR-soil) and a wettable soil (W-soil). The change in SWR and infiltration was assessed by the water repellency index and cumulative infiltration respectively. F. proliferatum decreased the SWR on WR-soil and slightly increased SWR in W-soil, while Alternaria sp. increased SWR in both the W-soil and the WR-soil. Conversely T. harzianum increased the SWR in the W-soil and decreased the SWR in the WR-soil. All strains showed a decrease in infiltration in W-soil, while only the F. proliferatum and T. harzianum strain showed improvement in infiltration in the WR-soil. The ability of fungi to alter the SWR and enmesh soil particles results in changes to the infiltration dynamics in soil. Copyright © 2012 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  3. Rice Production without Insecticide in Smallholder Farmer's Field

    Directory of Open Access Journals (Sweden)

    M. P. Ali

    2017-05-01

    Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even

  4. Effect of kaolinite and Ca-montmorillonite on the alleviation of soil water repellency

    Czech Academy of Sciences Publication Activity Database

    Dlapa, P.; Doerr, S. H.; Lichner, Ľ.; Šír, Miloslav; Tesař, Miroslav

    2004-01-01

    Roč. 50, č. 8 (2004), s. 358-363 ISSN 0370-663X R&D Projects: GA AV ČR IAA3042301; GA AV ČR IBS2060104 Keywords : water repellency * kaolinite * Ca-montmorillonite Subject RIV: DA - Hydrology ; Limnology Impact factor: 0.379, year: 2004

  5. Impacts of grass removal on wetting and actual water repellency in a sandy soil

    NARCIS (Netherlands)

    Oostindie, K.; Dekker, L.W.; Wesseling, J.G.; Geissen, V.; Ritsema, C.J.

    2016-01-01

    Soil water content and actual water repellency were assessed for soil profiles at two sites in a bare and grasscovered plot of a sand pasture, to investigate the impact of the grass removal on both properties. The soil of the plots was sampled six times in vertical transects to a depth of 33 cm

  6. Transport of water and solutes in wettable and water repellent sandy soils

    NARCIS (Netherlands)

    Ritsema, C.J.; Dekker, L.W.

    1996-01-01

    The research yielded the following conclusions and results: preferential flow can be expected in recently deposited, loosely packed, wettable dune sands; preferential flow is common in most water-repellent sandy soils; distribution flow in topsoils isa process of major importance, resulting in a

  7. Distribution flow: a general process in the top layer of water repellent soils

    NARCIS (Netherlands)

    Ritsema, C.J.; Dekker, L.W.

    1995-01-01

    Distribution flow is the process of water and solute flowing in a lateral direction over and through the very first millimetre or centimetre of the soil profile. A potassium bromide tracer was applied in two water-repellent sandy soils to follow the actual flow paths of water and solutes in the

  8. Screening of botanical extracts for repellence against western corn rootworm larvae

    Science.gov (United States)

    The ability of Western corn rootworm (WCR) to develop resistance to various management practices enforces the development of new control options. Repellent substances can act as efficacy enhancing agents in WCR control with biological control agents. The present study investigated the potential repe...

  9. The Effect of Water Repellent Surface Impregnation on Durability of Cement-Based Materials

    Directory of Open Access Journals (Sweden)

    Peng Zhang

    2017-01-01

    Full Text Available In many cases, service life of reinforced concrete structures is severely limited by chloride penetration until the steel reinforcement or by carbonation of the covercrete. Water repellent treatment on the surfaces of cement-based materials has often been considered to protect concrete from these deteriorations. In this paper, three types of water repellent agents have been applied on the surface of concrete specimens. Penetration profiles of silicon resin in treated concrete have been determined by FT-IR spectroscopy. Water capillary suction, chloride penetration, carbonation, and reinforcement corrosion in both surface impregnated and untreated specimens have been measured. Results indicate that surface impregnation reduced the coefficient of capillary suction of concrete substantially. An efficient chloride barrier can be established by deep impregnation. Water repellent surface impregnation by silanes also can make the process of carbonation action slow. In addition, it also has been concluded that surface impregnation can provide effective corrosion protection to reinforcing steel in concrete with migrating chloride. The improvement of durability and extension of service life for reinforced concrete structures, therefore, can be expected through the applications of appropriate water repellent surface impregnation.

  10. Phoenix dactylifera L. spathe essential oil: Chemical composition and repellent activity against the yellow fever mosquito

    Science.gov (United States)

    Date palm, Phoenix dactylifera L. (Arecaceae), grows commonly in the Arabian Peninsula and is traditionally used to treat various diseases. The aim of the present study was to identify chemical composition of the essential oil and to investigate the repellent activity. The essential oil of P. dacty...

  11. Soil water repellency and infiltration in coarse-textured soils of burned and unburned sagebrush ecosystems

    Science.gov (United States)

    F. B. Pierson; P. R. Robichaud; C. A. Moffet; K. E. Spaeth; C. J. Williams; S. P. Hardegree; P. E. Clark

    2008-01-01

    Millions of dollars are spent each year in the United States to mitigate the effects of wildfires and reduce the risk of flash floods and debris flows. Research from forested, chaparral, and rangeland communities indicate that severe wildfires can cause significant increases in soil water repellency resulting in increased runoff and erosion. Few data are available to...

  12. Quantifying the Effect of Soil Water Repellency on Infiltration Parameters Using a Dry Sand

    Science.gov (United States)

    Shillito, R.; Berli, M.; Ghezzehei, T. A.; Kaminski, E.

    2017-12-01

    Water infiltration into less than perfectly wettable soils has usually been considered an exceptional case—in fact, it may be the rule. Infiltration into soils exhibiting some degree of water repellency has important implications in agricultural irrigation, post-fire runoff, golf course and landscape management, and spill and contaminant mitigation. Beginning from fundamental principles, we developed a physically-based model to quantify the effect of water repellency on infiltration parameters. Experimentally, we used a dry silica sand and treated it to achieve various known degrees of water repellency. The model was verified using data gathered from multiple upward infiltration (wicking) experiments using the treated sand. The model also allowed us to explore the effect of initial soil moisture conditions on infiltration into water-repellent soils, and the physical interpretation of the simple water drop penetration time test. These results provide a fundamental step in the physically-based understanding of how water infiltrates into a less than perfectly wettable porous media.

  13. Repellence and toxicity of plant essential oils to the potato aphid, Macrosiphum euphorbiae

    NARCIS (Netherlands)

    Munneke, M.E.; Bruin, de A.; Moskal, J.R.; Tol, van R.W.H.M.

    2004-01-01

    Several plant essential oils were tested for their effect on behaviour and mortality of M. euphorbiae. Olfactory and contact experiments were performed to study these effects. We found that host plant and formulation of the different oils have a strong influence on repellence and mortality of the

  14. REPELLENCY OF ESSENTIAL OIL OF PIPER ADUNCUM AGAINST AEDES ALBOPICTUS IN THE LABORATORY

    NARCIS (Netherlands)

    Misni, Norashiqin; Sulaiman, Sallehudin; Othman, Hidayatulfathi; Omar, Baharudin

    2009-01-01

    The repellent activity of Piper aduncum essential oil against Aedes albopictus was investigated under laboratory conditions with human volunteers. The lowest median effective dose (ED(50)) value was 1.5 mu g/cm(2) at 60 sec of exposure when compared to 90 see (2.1 mu g/cm(2)) and 120 see (1.8 mu

  15. Mediation of deet repellency in mosquitoes (Diptera: Culicidae) by species, age, and parity.

    Science.gov (United States)

    Barnard, D R

    1998-05-01

    Laboratory bioassays assessed differences in the protection time provided by the repellent deet (N,N-diethyl-3-methylbenzamide) against 5-d-old nulliparous and 10-, 15-, and 20-d-old nulliparous and parous female Aedes aegypti (L.), Anopheles albimanus (Weidemann), and Anopheles quadrimaculatus Say sensu lato. Mean protection time was shortest against An. albimanus (1.6 h) and An. quadrimaculatus (1.5 h) and longest against Ae. aegypti (6.5 h), but was not significantly influenced by mosquito age or parity. Mean percentage of biting at repellent failure time was highest in An. albimanus (14.2%), followed by An. quadrimaculatus (7.0%) and Ae. aegypti (2.9%), was higher in parous females (10.8%) than in nulliparous females (5.9%), and was highest overall (35%) in 20-d-old parous An. albimanus. Interaction between mosquito species and parity and between parity and age factors, respectively, resulted from a significant decrease in percentage of biting by parous An. quadrimaculatus compared with other females, and a significant increase in biting by 20-d-old parous females compared with other females. The main finding of this study is that repellent protection time is unaffected by parity; this is important because parous mosquitoes are the primary target of personal-protection measures in disease-endemic areas. When repellent failure did occur, there was a higher risk of bite by old, parous An. albimanus than for any other species, age, or parity grouping of females.

  16. A dual function for 4-methoxybenzaldehyde in Petasites fragrans? Pollinator-attractant and ant-repellent

    Czech Academy of Sciences Publication Activity Database

    Pattrick, J. G.; Shepherd, T.; Hoppitt, W.; Plowman, Nichola S.; Willmer, P.

    2017-01-01

    Roč. 11, č. 5 (2017), s. 623-627 ISSN 1872-8855 Institutional support: RVO:60077344 Keywords : Petasites fragrans * ant-repellent floral volatiles * 4-methoxybenzaldehyde Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 1.441, year: 2016 https://link.springer.com/article/10.1007/s11829-017-9519-3

  17. Lantana montevidensis Essential Oil: Chemical Composition and Mosquito Repellent Activity against Aedes aegypti

    Science.gov (United States)

    The essential oil (EO) of Lantana montevidensis (Spreng.) Briq. (L. sellowiana Link & Otto) was investigated for its chemical composition and mosquito repellent activity. The essential oil obtained by hydrodistillation of aerial plant parts was analyzed by GC-FID and GC-MS. The major constituents we...

  18. Field measurement of soil water repellency and its impact on water flow under different vegetation

    Czech Academy of Sciences Publication Activity Database

    Lichner, Ľ.; Hallett, P. D.; Feeney, D. S.; Ďugová, O.; Šír, Miloslav; Tesař, Miroslav

    2007-01-01

    Roč. 62, č. 5 (2007), s. 537-541 ISSN 0006-3088 R&D Projects: GA ČR GA205/05/2312 Institutional research plan: CEZ:AV0Z20600510 Keywords : vegetation * sandy soil * water repellency * hydraulic conductivity Subject RIV: DA - Hydrology ; Limnology Impact factor: 0.207, year: 2007

  19. Repellency and toxicity of three Impatients species (Balsaminaceae) extracts on Myzus persicae Sulzer (Homoptera: Aphididae)

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Vrchotová, Naděžda; Šerá, Božena

    2009-01-01

    Roč. 2009, - (2009), s. 48-51 ISSN 0974-391X R&D Projects: GA MZe(CZ) QH72117 Institutional research plan: CEZ:AV0Z60870520 Keywords : Impatiens * repellency * toxicity Subject RIV: EH - Ecology, Behaviour

  20. Higher glandular trichome density in tomato leaflets and repellence to spider mites

    International Nuclear Information System (INIS)

    Maluf, Wilson Roberto; Inoue, Irene Fumi; Ferreira, Raphael de Paula Duarte; Gomes, Luiz Antonio Augusto; Castro, Evaristo Mauro de; Cardoso, Maria das Gracas

    2007-01-01

    The objective of this work was to evaluate the feasibility of selection for higher glandular trichome densities, as an indirect criterion of selection for increasing repellence to spider mites Tetranychus urticae, in tomato populations derived from an interspecific cross between Lycopersicon esculentum x L. hirsutum var. glabratum PI 134417. Trichome densities were evaluated in 19 genotypes, including 12 from advanced backcross populations, derived from the original cross L. esculentum x L. hirsutum var. glabratum PI 134417. Counts were made both on the adaxial and abaxial leaf surfaces, and trichomes were classified into glandular types IV and VI, other glandular types (types I+VII), and nonglandular types. Mite repellence was measured by distances walked by mites onto the tomato leaf surface after 20, 40 and 60 min. Spider mite repellence biotests indicated that higher densities of glandular trichomes (especially type VI) decreased the distances walked by the mites onto the tomato leaf surface. Selection of plants with higher densities of glandular trichomes can be an efficient criterion to obtain tomato genotypes with higher resistance (repellence) to spider mites. (author)

  1. Essential oils of aromatic Egyptian plants repel nymphs of the tick Ixodes ricinus (Acari: Ixodidae).

    Science.gov (United States)

    El-Seedi, Hesham R; Azeem, Muhammad; Khalil, Nasr S; Sakr, Hanem H; Khalifa, Shaden A M; Awang, Khalijah; Saeed, Aamer; Farag, Mohamed A; AlAjmi, Mohamed F; Pålsson, Katinka; Borg-Karlson, Anna-Karin

    2017-09-01

    Due to the role of Ixodes ricinus (L.) (Acari: Ixodidae) in the transmission of many serious pathogens, personal protection against bites of this tick is essential. In the present study the essential oils from 11 aromatic Egyptian plants were isolated and their repellent activity against I. ricinus nymphs was evaluated Three oils (i.e. Conyza dioscoridis L., Artemisia herba-alba Asso and Calendula officinalis L.) elicited high repellent activity in vitro of 94, 84.2 and 82%, respectively. The most active essential oil (C. dioscoridis) was applied in the field at a concentration of 6.5 µg/cm 2 and elicited a significant repellent activity against I. ricinus nymphs by 61.1%. The most repellent plants C. dioscoridis, C. officinalis and A. herba-alba yielded essential oils by 0.17, 0.11 and 0.14%, respectively. These oils were further investigated using gas chromatography-mass spectrometry analysis. α-Cadinol (10.7%) and hexadecanoic acid (10.5%) were the major components of C. dioscoridis whereas in C. officinalis, α-cadinol (21.2%) and carvone (18.2%) were major components. Artemisia herba-alba contained piperitone (26.5%), ethyl cinnamate (9.5%), camphor (7.7%) and hexadecanoic acid (6.9%). Essential oils of these three plants have a potential to be used for personal protection against tick bites.

  2. Assessment of the repellent effect of Lippia alba essential oil and major monoterpenes on the cattle tick Rhipicephalus microplus.

    Science.gov (United States)

    Lima, A da Silva; Carvalho, J F de; Peixoto, M G; Blank, A F; Borges, L M F; Costa Junior, L M

    2016-03-01

    The control of Rhipicephalus microplus (Ixodida: Ixodidae) is achieved using synthetic acaricides. However, resistant tick populations are widespread around the world. Plant essential oils can act as repellents, keeping ticks away from hosts and decreasing the selection pressure on synthetic acaricides. The aim of this study was to evaluate the in vitro repellent effect of Lippia alba essential oil on R. microplus larvae. Leaves from two L. alba genotypes maintained under the same agronomic and environmental conditions were collected. Essential oil was extracted by hydrodistillation and analysed by gas chromatography-mass spectrometry (GC-MS). The major monoterpenes detected in the chemical analysis were commercially acquired and tested. For the repellency test, a glass rod was vertically fixed to measure active climbing of approximately 30 R. microplus larvae aged 14-21 days in response to essential oils and monoterpenes. Repellency was evaluated at 1 h, 3 h and 5 h after treatment. Variation in repellent action was detected between the genotypes. The major monoterpenes identified in the essential oils (limonene and carvone) showed low repellent effects in comparison with intact essential oils. Thus, the present results showed that L. alba essential oil contains bioactive compounds with great repellent activity against ticks that varies according to the plant genotype. © 2015 The Royal Entomological Society.

  3. Repellency of essential oils extracted from Thai native plants against Aedes aegypti (Linn.) and Culex quinquefasciatus (Say).

    Science.gov (United States)

    Phukerd, Ubol; Soonwera, Mayura

    2014-09-01

    Repellent activity of essential oils derived from 10 Thai native plants, belonging to three families were evaluated against female Aedes aegypti and Culex quinquefasciatus and to compare them with a commercial chemical repellents (DEET; N,N-diethyl-3-methylbenzamide 20% w/w; Sketolene Shield). Each test repellent was applied at 1, 5, and 10% concentrations for testing by arm in cage method. The results showed significant differences in repellency among the repellents by mosquito species. The protection time of the essential oils against Ae. aegypti ranged from 3 to 30 min. According to the Culex mosquito, it showed the protection time ranged from 3 to 260 min. 10 % Boesenbergia rotunda essential oil provided the best efficiency, in which protection time was 4.3 h as equal as DEET. The essential oils which exhibited protection time more than 2 h were those of 10% Zingiber zerumbet, Litsea petiolata, Curcuma zedoaria, and Zingiber cassumunar essential oils (3.1, 2.8, 2.6, and 2.3 h, respectively). The biting percentage ranged from 0.9 to 18.0% and 0.8 to 3.6% against Ae. aegypti and Cx. quinquefasciatus, respectively. The results revealed that the potential of essential oil extracted from B. rotunda, Z. zerumbet, L. petiolata, C. zedoaria, and Z. cassumunar had attributes of good repellent and deterred biting. We recommend the five essential oils for further study to develop as commercial repellents.

  4. Efficacy of plant-derived and synthetic compounds on clothing as repellents against Ixodes scapularis and Amblyomma americanum (Acari: Ixodidae).

    Science.gov (United States)

    Jordan, Robert A; Schulze, Terry L; Dolan, Marc C

    2012-01-01

    We conducted field trials to compare the relative repellent activity of two natural product compounds (nootkatone and carvacrol) with commercially available plant-derived (EcoSMART organic insect repellent) and permethrin-based (Repel Permanone) repellents against adult Ixodes scapularis Say and Amblyomma americanum (L.) (Acari: Ixodidae) by using treated coveralls. One day after treatment, nootkatone and carvacrol provided 100% repellency of I. scapularis adults, with nootkatone maintaining complete protection through 3 d, whereas carvacrol showed steadily declining repellency against I. scapularis during the 7-d course of the trials. Nootkatone was at least as effective against host-seeking A. americanum as against I. scapularis through 3 d. Carvacrol provided little protection against A. americanum adults. Both natural compounds performed well initially in comparison with the commercial products. After 7 d, nootkatone was the most effective against both species followed in order of activity by Permanone, EcoSMART, and carvacrol. Nootkatone seems to have offer considerable potential as a clothing repellent against both I. scapularis and A. americanum.

  5. The influence of compost addition on the water repellency of brownfield soils

    Science.gov (United States)

    Whelan, Amii; Kechavarzi, Cedric; Sakrabani, Ruben; Coulon, Frederic; Simmons, Robert; Wu, Guozhong

    2010-05-01

    Compost application to brownfield sites, which can facilitate the stabilisation and remediation of contaminants whilst providing adequate conditions for plant growth, is seen as an opportunity to divert biodegradable wastes from landfill and put degraded land back into productive use. However, although compost application is thought to improve soil hydraulic functioning, there is a lack of information on the impact of large amounts of compost on soil water repellency. Water repellency in soils is attributed to the accumulation of hydrophobic organic compounds released as root exudates, fungal and microbial by-products and decomposition of organic matter. It has also been shown that brownfield soils contaminated with petroleum-derived organic contaminants can exhibit strong water repellency, preventing the rapid infiltration of water and leading potentially to surface run off and erosion of contaminated soil. However, hydrophobic organic contaminants are known to become sequestrated by partitioning into organic matter or diffusing into nano- and micropores, making them less available over time (ageing). The effect of large amounts of organic matter addition through compost application on the water repellency of soils contaminated with petroleum-derived organic contaminants requires further investigation. We characterised the influence of compost addition on water repellency in the laboratory by measuring the Water Drop Penetration Time (WDPT), sorptivity and water repellency index through infiltration experiments on soil samples amended with two composts made with contrasting feedstocks (green waste and predominantly meat waste). The treatments consisted of a sandy loam, a clay loam and a sandy loam contaminated with diesel fuel and aged for 3 years, which were amended with the two composts at a rate equivalent to 750t/ha. In addition core samples collected from a brownfield site, amended with compost at three different rates (250, 500 and 750t/ha) in 2007, were

  6. USE OF BOTANICAL INSECTICIDES AS AN ALTERNATIVE FOR THE MANAGEMENT OF THE MEXICAN BEAN WEEVIL

    Directory of Open Access Journals (Sweden)

    KAREN FERREIRA DA SILVA

    2016-01-01

    Full Text Available This study aimed to evaluate the insecticidal activity of eight botanical species in the behavior and biological development of Zabrotes subfasciatus (Coleoptera: Chrysomelidae: Bruchinae under laboratory conditions. The botanical species were applied on bean grains (Phaseolus vulgaris Linnaeus directly as powder or indirectly within TNT bags. Three laboratory assays were performed. First, a repellent activity test was performed by exposing twenty couples of Z. subfasciatus adults in a choice-test arena. Second, a mortality test was performed for seven days after infestation. Finally, the oviposition and emergency rates of adults (% and the development from egg to adult (in days were evaluated in seven couples (males and females for seven days inside of a vial containing 0.3g of the powder from each botanical species and 10 g of bean grains (3% w.w-1. The study was conducted in a completely randomized design, and the treatments were arranged as a factorial design (2 x 9 with two factors (factor 1= powder and TNT bag application forms and factor 2= eight botanical species and control with eight replications. The powder application form was more efficient in controlling Z. subfasciatus. Azadirachta indica (powder application, Ruta graveolens (powder application, and Piper aduncum (TNT bag reduced the infestation of adults. The species A. inidica, Piper tuberculatum, Trichilia catigua, Pfaffia glomerata, R. graveolens, and Mentha pulegium inhibited the oviposition of the insects regardless of the formulation applied. R. graveolens (powder application caused 100% of mortality. The powder application of R. graveolens and M. pulegium reduced egg viability and insect emergence; therefore, they are very promising alternatives to control Z. subfasciatus in stored grains.

  7. Vegetation type and the presence of ash as factors in the evolution of soil water repellency after a forest fire

    Directory of Open Access Journals (Sweden)

    P. Jiménez-Pinilla

    2013-05-01

    Full Text Available After wildfires, burning may induce the occurrence of soil water repellency. Soil water repellency may vary in space and time in function of vegetation, the presence of ash and soil moisture. This study analyzes the evolution of fire-induced soil water repellency in function of these factors, and proposes measures to promote the restoration of fire-affected soils. Burnt and unburnt (control soil plots under pine and shrub from a recently burned area (Gorga, Alicante, SE Spain were established. Three treatments were applied: in some of the plots, the original ash layer was kept on the ground; in a second group, the ash layer was removed for simulating the effects of erosion; finally, in a third group, percolating irrigation was conducted to simulate a possible good input of water into the soil profile after burning, that could occur if the first rains were with high quantity but low intensity. During the dry season, soil moisture content was significantly lower in burned plots due to fire-induced water repellency and reduced vegetation cover. During the wet season, soil moisture decreased in the control unburnt plots due to direct evaporation of water intercepted by vegetation and consumption by roots. Fire increased soil water repellency only in plots under pine. Water repellency decreased during the wet season, disappearing in January and reappearing after declining rainfalls. This baseline recovery of soil water repellency was lower where ash removal was simulated. In unburned plots, seasonal fluctuations were less important. In general, ash removal promotes a rapid reduction of water repellency, since it can induce washing of hydrophobic compounds. Irrigation performed immediately after the fire also contributed to decreased water repellency.

  8. A fly in the ointment: evaluation of traditional use of plants to repel and kill blowfly larvae in fermented fish.

    Directory of Open Access Journals (Sweden)

    Hugo J de Boer

    Full Text Available INTRODUCTION: In rural areas in Laos, fly larvae infestations are common in fermenting fish. Blowflies (Chrysomya megacephala, Diptera: Calliphoridae are attracted to oviposit (and/or larviposit onto fermenting fish which results in infestations with fly larvae. Knowledge of traditional use of plants to repel larvae during the production of fermented fish is common and widespread in Lao PDR. RESEARCH QUESTIONS: How effective are the most salient species in repelling, and killing fly larvae in fermenting fish? MATERIAL AND METHODS: The three plant species most frequently reported to repel fly larvae during an ethnobotanical survey throughout Lao PDR were tested for repellence and larvicidal activity of fly larvae infesting fermented fish. The lethality and repellence of Tadehagi triquetrum (L. H. Ohashi (Fabaceae, Uraria crinita (L. Desv. ex DC. (Fabaceae and Bambusa multiplex (Lour. Raeusch. ex Schult. & Schult. f. (Poaceae were tested in an experimental design using fermenting fish in Vientiane, Lao PDR. RESULTS: The repellent effect of fresh material of T. triquetrum and U. crinita, and the larvicidal effect of fresh B. multiplex, is significantly more effective than that of dried material of the same species, and the total effect (repellence and larvicidal effect combined for each of the three species was significantly more effective for fresh than for dry material. Fresh material of T. triquetrum, U. crinita, or B. multiplex added on top of the fermenting fish repelled 50%, 54%, 37%, and killed 22%, 28%, and 40% of fly larvae. The total effect was not significantly different per species at 72%, 82%, and 77%, respectively. DISCUSSION AND CONCLUSIONS: The three most salient species are effective in repelling and killing fly larvae in the production of fermented fish, and may be essential to augment food safety during traditional fermentation in open jars.

  9. Insecticide-induced hormesis and arthropod pest management.

    Science.gov (United States)

    Guedes, Raul Narciso C; Cutler, G Christopher

    2014-05-01

    Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas. © 2013 Society of Chemical Industry.

  10. Application of minidisk infiltrometer to estimate water repellency in Mediterranean pine forest soils

    Directory of Open Access Journals (Sweden)

    Alagna Vincenzo

    2017-09-01

    Full Text Available Assessment of soil water repellency (SWR was conducted in the decomposed organic floor layer (duff and in the mineral soil layer of two Mediterranean pine forests, one in Italy and the other in Spain, by the widely-used water drop penetration time (WDPT test and alternative indices derived from infiltration experiments carried out by the minidisk infiltrometer (MDI. In particular, the repellency index (RI was calculated as the adjusted ratio between ethanol and water soil sorptivities whereas the water repellency cessation time (WRCT and the specifically proposed modified repellency index (RIm were derived from the hydrophobic and wettable stages of a single water infiltration experiment. Time evolution of SWR and vegetation cover influence was also investigated at the Italian site. All indices unanimously detected severe SWR conditions in the duff of the pine forests. The mineral subsoils in the two forests showed different wettability and the clay-loam subsoil at Ciavolo forest was hydrophobic even if characterized by organic matter (OM content similar to the wettable soil of an adjacent glade. It was therefore assumed that the composition rather than the total amount of OM influenced SWR. The hydraulic conductivity of the duff differed by a factor of 3.8–5.8 between the two forested sites thus influencing the vertical extent of SWR. Indeed, the mineral subsoil of Javea showed wettable or weak hydrophobic conditions probably because leaching of hydrophobic compounds was slowed or prevented at all. Estimations of SWR according to the different indices were in general agreement even if some discrepancies were observed. In particular, at low hydrophobicity levels the SWR indices gathered from the MDI tests were able to signal sub-critical SWR conditions that were not detected by the traditional WDPT index. The WRCT and modified repellency index RIm yielded SWR estimates in reasonable agreement with those obtained with the more cumbersome RI

  11. Plant insecticidal toxins in ecological networks.

    Science.gov (United States)

    Ibanez, Sébastien; Gallet, Christiane; Després, Laurence

    2012-04-01

    Plant secondary metabolites play a key role in plant-insect interactions, whether constitutive or induced, C- or N-based. Anti-herbivore defences against insects can act as repellents, deterrents, growth inhibitors or cause direct mortality. In turn, insects have evolved a variety of strategies to act against plant toxins, e.g., avoidance, excretion, sequestration and degradation of the toxin, eventually leading to a co-evolutionary arms race between insects and plants and to co-diversification. Anti-herbivore defences also negatively impact mutualistic partners, possibly leading to an ecological cost of toxin production. However, in other cases toxins can also be used by plants involved in mutualistic interactions to exclude inadequate partners and to modify the cost/benefit ratio of mutualism to their advantage. When considering the whole community, toxins have an effect at many trophic levels. Aposematic insects sequester toxins to defend themselves against predators. Depending on the ecological context, toxins can either increase insects' vulnerability to parasitoids and entomopathogens or protect them, eventually leading to self-medication. We conclude that studying the community-level impacts of plant toxins can provide new insights into the synthesis between community and evolutionary ecology.

  12. Plant Insecticidal Toxins in Ecological Networks

    Directory of Open Access Journals (Sweden)

    Sébastien Ibanez

    2012-04-01

    Full Text Available Plant secondary metabolites play a key role in plant-insect interactions, whether constitutive or induced, C- or N-based. Anti-herbivore defences against insects can act as repellents, deterrents, growth inhibitors or cause direct mortality. In turn, insects have evolved a variety of strategies to act against plant toxins, e.g., avoidance, excretion, sequestration and degradation of the toxin, eventually leading to a co-evolutionary arms race between insects and plants and to co-diversification. Anti-herbivore defences also negatively impact mutualistic partners, possibly leading to an ecological cost of toxin production. However, in other cases toxins can also be used by plants involved in mutualistic interactions to exclude inadequate partners and to modify the cost/benefit ratio of mutualism to their advantage. When considering the whole community, toxins have an effect at many trophic levels. Aposematic insects sequester toxins to defend themselves against predators. Depending on the ecological context, toxins can either increase insects’ vulnerability to parasitoids and entomopathogens or protect them, eventually leading to self-medication. We conclude that studying the community-level impacts of plant toxins can provide new insights into the synthesis between community and evolutionary ecology.

  13. Gustatory receptor neuron responds to DEET and other insect repellents in the yellow-fever mosquito, Aedes aegypti

    Science.gov (United States)

    Sanford, Jillian L.; Shields, Vonnie D. C.; Dickens, Joseph C.

    2013-03-01

    Three gustatory receptor neurons were characterized for contact chemoreceptive sensilla on the labella of female yellow-fever mosquitoes, Aedes aegypti. The neuron with the smallest amplitude spike responded to the feeding deterrent, quinine, as well as N, N-diethyl-3-methylbenzamide and other insect repellents. Two other neurons with differing spikes responded to salt (NaCl) and sucrose. This is the first report of a gustatory receptor neuron specific for insect repellents in mosquitoes and may provide a tool for screening chemicals to discover novel or improved feeding deterrents and repellents for use in the management of arthropod disease vectors.

  14. Angelica sinensis (Umbelliferae) with proven repellent properties against Aedes aegypti, the primary dengue fever vector in Thailand.

    Science.gov (United States)

    Champakaew, D; Junkum, A; Chaithong, U; Jitpakdi, A; Riyong, D; Sanghong, R; Intirach, J; Muangmoon, R; Chansang, A; Tuetun, B; Pitasawat, B

    2015-06-01

    Botanical resources with great diversity in medicinal and aromatic plants are a rich and reliable source for finding insect repellents of plant origin, which are widely popular among today's consumers. Although some herbal-based repellents have been proven comparable to or even better than synthetics, commercially available natural repellents generally tend to be expensive, with short-lived effectiveness. This critical flaw leads to ongoing research for new and effective repellents, which provide longer protection against vector and nuisance-biting insects, while remaining safe, user friendly, and reasonably priced. This study aimed to evaluate the repellent activity of plant-derived products against the primary dengue vector, Aedes aegypti, by following the human bait technique of World Health Organization guidelines. Preliminary laboratory screening tests for repellency of 33 plant species clearly demonstrated Angelica sinensis as the most effective repellent from each kind of extracted product, with its essential oil and ethanolic extract having median complete protection times of 7.0 h (6.0-7.5) and 2.5 h (2.0-2.5), respectively. Due to its low yield (0.02 %), pungent smell, and little cause of irritation, A. sinensis essential oil did not qualify as a candidate for further repellent assessment. However, subsequent extractions of A. sinensis with different organic solvents of increasing polarity provided four extractants with varying degrees of repellency against A. aegypti. The hexane extract of A. sinensis provided excellent repellency, with a median complete protection time of 7.5 h (6.5-8.5), which was longer than that of ethanol (2.5, 2.0-2.5 h), acetone (1.75, 0.5-2.5 h), and methanol extracts (0.5, 0-1.0 h). By being the most effective product, A. sinensis hexane extract gave significant protection comparable to that of its essential oil and the standard synthetic repellent, N,N-diethyl-3-methylbenzamide (DEET: 6.25, 5.0-6.5 h). Qualitative gas

  15. Induced tolerance from a sublethal insecticide leads to cross-tolerance to other insecticides.

    Science.gov (United States)

    Hua, Jessica; Jones, Devin K; Relyea, Rick A

    2014-04-01

    As global pesticide use increases, the ability to rapidly respond to pesticides by increasing tolerance has important implications for the persistence of nontarget organisms. A recent study of larval amphibians discovered that increased tolerance can be induced by an early exposure to low concentrations of a pesticide. Since natural systems are often exposed to a variety of pesticides that vary in mode of action, we need to know whether the induction of increased tolerance to one pesticide confers increased tolerance to other pesticides. Using larval wood frogs (Lithobates sylvaticus), we investigated whether induction of increased tolerance to the insecticide carbaryl (AChE-inhibitor) can induce increased tolerance to other insecticides that have the same mode of action (chlorpyrifos, malathion) or a different mode of action (Na(+)channel-interfering insecticides; permethrin, cypermethrin). We found that embryonic exposure to sublethal concentrations of carbaryl induced higher tolerance to carbaryl and increased cross-tolerance to malathion and cypermethrin but not to chlorpyrifos or permethrin. In one case, the embryonic exposure to carbaryl induced tolerance in a nonlinear pattern (hormesis). These results demonstrate that that the newly discovered phenomenon of induced tolerance also provides induced cross-tolerance that is not restricted to pesticides with the same mode of action.

  16. Quantitative structure-activity relationship (QSAR) for insecticides: development of predictive in vivo insecticide activity models.

    Science.gov (United States)

    Naik, P K; Singh, T; Singh, H

    2009-07-01

    Quantitative structure-activity relationship (QSAR) analyses were performed independently on data sets belonging to two groups of insecticides, namely the organophosphates and carbamates. Several types of descriptors including topological, spatial, thermodynamic, information content, lead likeness and E-state indices were used to derive quantitative relationships between insecticide activities and structural properties of chemicals. A systematic search approach based on missing value, zero value, simple correlation and multi-collinearity tests as well as the use of a genetic algorithm allowed the optimal selection of the descriptors used to generate the models. The QSAR models developed for both organophosphate and carbamate groups revealed good predictability with r(2) values of 0.949 and 0.838 as well as [image omitted] values of 0.890 and 0.765, respectively. In addition, a linear correlation was observed between the predicted and experimental LD(50) values for the test set data with r(2) of 0.871 and 0.788 for both the organophosphate and carbamate groups, indicating that the prediction accuracy of the QSAR models was acceptable. The models were also tested successfully from external validation criteria. QSAR models developed in this study should help further design of novel potent insecticides.

  17. Insecticidal defenses of Piperaceae from the neotropics.

    Science.gov (United States)

    Bernard, C B; Krishanmurty, H G; Chauret, D; Durst, T; Philogène, B J; Sánchez-Vindas, P; Hasbun, C; Poveda, L; San Román, L; Arnason, J T

    1995-06-01

    Insecticidal and growth-reducing properties of extracts of 14 species of American neotropical Piperaceae were investigated by inclusion in diets of a polyphagous lepidopteran, the European corn borer,Ostrinia nubilalis. Nutritional indices suggested most extracts acted by postdigestive toxicity.Piper aduncum, P. tuberculatum, andP. decurrens were among the most active species and were subjected to bioassay-guided isolation of the active components. Dillapiol was isolated from the active fraction ofP. aduncum, piperlonguminine was isolated fromP. tuberculatum, and a novel neolignan fromP. decurrens. The results support other studies on Asian and AfricanPiper species, which suggest that lignans and isobutyl amides are the active defence compounds in this family.

  18. Insecticidal Constituents from Buddlej aalbiflora Hemsl.

    Science.gov (United States)

    Zhang, Xiu-Yun; Shen, Jing; Zhou, Yu; Wei, Zhi-Ping; Gao, Jin-Ming

    2017-06-01

    Eleven known compounds, deoxymikanolide (1), 1,3-dihydroxyxanthone (2), kumatakenin (3), apigenin (4), chrysin (5), kaempferol (6), Iso-kaempferol (7), luteolin (8), luteolin-3',4'-dimethylether-7-O-β-glucoside (9), luteolin-7-O-β-glucoside (10) and quercetin (11) were identified in MeOH extract of Buddleja albiflora Hemsl (Oleaceae). These compounds (each, 1, 0.5 and 0.25 mg mL -1 ) were tested for insecticidal activity against 3rd and 4th-instar larvae of Plutella xylostella, 3rd-instar larvae of Mythimna separata and 3rd-instar larvae of Macrosiphoniella sanborni. The lowest 50% anti-feedant concentration (AFC 50 ) against P. xylostella and 50% lethal concentration (LC 50 ) against P. xylostella and M. sanborni were observed as 0.0058, 0.0046 and 3.4048 mg L -1 , respectively.

  19. Insecticidal Activity of Cyanohydrin and Monoterpenoid Compounds

    Directory of Open Access Journals (Sweden)

    Joel R. Coats

    2000-04-01

    Full Text Available The insecticidal activities of several cyanohydrins, cyanohydrin esters and monoterpenoid esters (including three monoterpenoid esters of a cyanohydrin were evaluated. Topical toxicity to Musca domestica L. adults was examined, and testing of many compounds at 100 mg/fly resulted in 100% mortality. Topical LD50 values of four compounds for M. domestica were calculated. Testing of many of the reported compounds to brine shrimp (Artemia franciscana Kellog resulted in 100% mortality at 10 ppm, and two compounds caused 100% mortality at 1 ppm. Aquatic LC50 values were calculated for five compounds for larvae of the yellow fever mosquito (Aedes aegypti (L.. Monoterpenoid esters were among the most toxic compounds tested in topical and aquatic bioassays.

  20. Insecticidal Activity of Essential Oil of Cinnamomum cassia and its ...

    African Journals Online (AJOL)

    1Department of Entomology, China Agricultural University, 2 Yuanmingyuan West Road, Haidian District, Beijing 100193, 2Key. Laboratory of Urban Agriculture (North), Ministry of Agriculture, Beijing University of ... and house dust mites [9-13]. Moreover, the essential oil of C. cassia also exhibits strong repellency and ...

  1. Teenage organophosphate insecticide poisoning: An ugly trend in ...

    African Journals Online (AJOL)

    UNIBEN

    is worsened by uncontrolled sale of organophosphorus insecticides on the streets and in open markets. We report ..... Nicotinic activity results in autonomic nervous system .... optimize outcome.23 Oximes are cholinesterase re-activators used ...

  2. Gas Chromaotography-Mass Spectrometry Analysis of Insecticidal ...

    African Journals Online (AJOL)

    Insecticidal Essential Oil Derived from Chinese Ainsliaea fragrans Champ ex Benth ... Methods: The essential oil of A. fragrans aerial parts was obtained by hydrodistillation and analyzed by ..... toxicity than the crude oil. Caryophyllene showed.

  3. Scepticism towards insecticide treated mosquito nets for malaria ...

    African Journals Online (AJOL)

    Scepticism towards insecticide treated mosquito nets for malaria control in rural ... especially among under-five year children and pregnant women in poor rural ... through social marketing strategy for malaria control prior to the introduction of ...

  4. Design, Synthesis and Insecticidal Activity of Novel Phenylurea Derivatives

    Directory of Open Access Journals (Sweden)

    Jialong Sun

    2015-03-01

    Full Text Available A series of novel phenylurea derivatives were designed and synthesized according to the method of active groups linkage and the principle of aromatic groups bioisosterism in this study. The structures of the novel phenylurea derivatives were confirmed based on ESI-MS, IR and 1H-NMR spectral data. All of the compounds were evaluated for the insecticidal activity against the third instars larvae of Spodoptera exigua Hiibner, Plutella xyllostella Linnaeus, Helicoverpa armigera Hubner and Pieris rapae Linne respectively, at the concentration of 10 mg/L. The results showed that all of the derivatives displayed strong insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, chlorbenzuron and metaflumizone. Among the synthesized compounds, 3b, 3d, 3f, 4b and 4g displayed broad spectrum insecticidal activity.

  5. Neurotoxicological effects and the mode of action of pyrethroid insecticides

    NARCIS (Netherlands)

    Vijverberg, H.P.M.; Bercken, Joep van den

    1990-01-01

    Neuroexcitatory symptoms of acute poisoning of vertebrates by pyrethroids are related to the ability of these insecticides to modify electrical activity in various parts of the nervous system. Repetitive nerve activity, particularly in the sensory nervous system, membrane depolarization, and

  6. Effect of natural and chemical insecticides on Hyalopterus pruni and ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-06-17

    Jun 17, 2008 ... Anthmis pseudocotula and their mixtures with chemical insecticide (Malathion) on growth of ... ed the use of natural extracts of Fagonia arabica, Salix ..... Studies on the efficacy of neem products against the aphid Aphis.

  7. Process optimization and insecticidal activity of alkaloids from the ...

    African Journals Online (AJOL)

    Process optimization and insecticidal activity of alkaloids from the root bark of Catalpa ovata G. Don by response surface methodology. ... Tropical Journal of Pharmaceutical Research. Journal Home · ABOUT THIS JOURNAL · Advanced ...

  8. Insect P450 inhibitors and insecticides: challenges and opportunities.

    Science.gov (United States)

    Feyereisen, René

    2015-06-01

    P450 enzymes are encoded by a large number of genes in insects, often over a hundred. They play important roles in insecticide metabolism and resistance, and growing numbers of P450 enzymes are now known to catalyse important physiological reactions, such as hormone metabolism or cuticular hydrocarbon synthesis. Ways to inhibit P450 enzymes specifically or less specifically are well understood, as P450 inhibitors are found as drugs, as fungicides, as plant growth regulators and as insecticide synergists. Yet there are no P450 inhibitors as insecticides on the market. As new modes of action are constantly needed to support insecticide resistance management, P450 inhibitors should be considered because of their high potential for insect selectivity, their well-known mechanisms of action and the increasing ease of rational design and testing. © 2014 Society of Chemical Industry.

  9. Gas Chromatography-Mass Spectrometric Analysis and Insecticidal ...

    African Journals Online (AJOL)

    HP

    Original Research Article. Gas Chromatography-Mass Spectrometric Analysis and ... into a natural fumigant/insecticide for the control of stored product insects. Keywords: Mallotus ..... stability as well as reduce cost. ACKNOWLEDGEMENT.

  10. Gas Chromatography-Mass Spectrometric Analysis and Insecticidal ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research ... apelta aerial parts was analyzed by gas chromatography/mass spectrometric (GC/MS) to determine its composition. ... into a natural fumigant/insecticide for the control of stored product insects.

  11. Federal Insecticide, Fungicide, and Rodenticide Act Section 18 Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — Section 18 of Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) authorizes EPA to allow an unregistered use of a pesticide for a limited time if EPA...

  12. PRN 73-4: Residual Insecticides in Food Handling Establishments

    Science.gov (United States)

    This notice provides a copy of a Federal Register notice published July 6, 1973, regarding certain insecticides used in food-handling establishments. It establishes certain definitions and requirements related to approval for crack and crevice treatment.

  13. Identifying the effective concentration for spatial repellency of the dengue vector Aedes aegypti.

    Science.gov (United States)

    Achee, Nicole; Masuoka, Penny; Smith, Philip; Martin, Nicholas; Chareonviryiphap, Theeraphap; Polsomboon, Suppaluck; Hendarto, Joko; Grieco, John

    2012-12-28

    Current efforts are underway to quantify the chemical concentration in a treated air space that elicits a spatial repellent (deterrent) response in a vector population. Such information will facilitate identifying the optimum active ingredient (AI) dosage and intervention coverage important for the development of spatial repellent tools--one of several novel strategies being evaluated for vector-borne disease control. This study reports initial findings from air sampling experiments conducted under field conditions to describe the relationship between air concentrations of repellent AIs and deterrent behavior in the dengue vector, Aedes aegypti. Air samples were taken inside and outdoors of experimental huts located in Pu Tuey Village, Kanchanaburi Province, Thailand in conjunction with mosquito behavioral evaluations. A mark-release-recapture study design using interception traps was used to measure deterrency of Ae. aegypti against 0.00625% metofluthrin coils and DDT-treated fabric (2g/m2) within separate experimental trials. Sentinel mosquito cohorts were positioned adjacent to air sampling locations to monitor knock down responses to AI within the treated air space. Air samples were analyzed using two techniques: the U.S. Environmental Protection Agency (USEPA) Compendium Method TO-10A and thermal desorption (TD). Both the USEPA TO-10A and TD air sampling methods were able to detect and quantify volatized AIs under field conditions. Air samples indicated concentrations of both repellent chemicals below thresholds required for toxic responses (mortality) in mosquitoes. These concentrations elicited up to a 58% and 70% reduction in Ae. aegypti entry (i.e., deterrency) into treated experimental huts using metofluthrin coils and DDT-treated fabric, respectively. Minimal knock down was observed in sentinel mosquito cohorts positioned adjacent to air sampling locations during both chemical evaluations. This study is the first to describe two air sampling

  14. Identifying the effective concentration for spatial repellency of the dengue vector Aedes aegypti

    Directory of Open Access Journals (Sweden)

    Achee Nicole

    2012-12-01

    Full Text Available Abstract Background Current efforts are underway to quantify the chemical concentration in a treated air space that elicits a spatial repellent (deterrent response in a vector population. Such information will facilitate identifying the optimum active ingredient (AI dosage and intervention coverage important for the development of spatial repellent tools – one of several novel strategies being evaluated for vector-borne disease control. This study reports initial findings from air sampling experiments conducted under field conditions to describe the relationship between air concentrations of repellent AIs and deterrent behavior in the dengue vector, Aedes aegypti. Methods Air samples were taken inside and outdoors of experimental huts located in Pu Tuey Village, Kanchanaburi Province, Thailand in conjunction with mosquito behavioral evaluations. A mark-release-recapture study design using interception traps was used to measure deterrency of Ae. aegypti against 0.00625% metofluthrin coils and DDT-treated fabric (2g/m2 within separate experimental trials. Sentinel mosquito cohorts were positioned adjacent to air sampling locations to monitor knock down responses to AI within the treated air space. Air samples were analyzed using two techniques: the U.S. Environmental Protection Agency (USEPA Compendium Method TO-10A and thermal desorption (TD. Results Both the USEPA TO-10A and TD air sampling methods were able to detect and quantify volatized AIs under field conditions. Air samples indicated concentrations of both repellent chemicals below thresholds required for toxic responses (mortality in mosquitoes. These concentrations elicited up to a 58% and 70% reduction in Ae. aegypti entry (i.e., deterrency into treated experimental huts using metofluthrin coils and DDT-treated fabric, respectively. Minimal knock down was observed in sentinel mosquito cohorts positioned adjacent to air sampling locations during both chemical evaluations. Conclusions

  15. REPELLENT AND OVIPOSITION DETERRENT ACTIVITIES OFTHE ESSENTIAL OIL FROM MIKANIA MICRANTHA AND ITS COMPOUNDS ON PLUTELLA XYLOSTELLA

    Institute of Scientific and Technical Information of China (English)

    Mao-xinZhang; BingLing; Shao-yingChen; Guang-wenLiang; Xiong-feiPang

    2004-01-01

    Repellent and oviposition deterrent activities of the essential oil from Mikania micrantha and five volatile compounds including limonene, a-terpinene, linalool, B-caryophylene and verbenone on the diamondback moth (DBM), Plutella xylostella, was investigated in door and in net-house. The results showed that the essential oil of the M. micrantha had significant repellant effect (at flow 100-180 mL/min) and oviposition deterrent activity at dose 1020 uL/seedling for the DBM. In five volatile compounds, a-terpinene, limonene and linalool had significant effect on repellent and oviposition deterrent of the DBM moths, but verbenone and B-caryophylene, no significantly effect was observed in repellent and oviposition deterrent.

  16. Experimental Investigation of 2D thermal signature and 3D X-Ray Computed Tomography in contrasting Wettable and Water-Repellent Beads

    Science.gov (United States)

    Alsih, Abdulkareem; Flavel, Richard; McGrath, Gavan

    2017-04-01

    This study presents experimental results investigating spatial patterns of infiltration and evaporation in heterogeneous water repellent media. Infrared camera measurements and 3D X-ray computed tomography imaging was performed across wet-dry cycles on glass beads with engineered patches of water repellence. The imaging revealed spatial variability in infiltration and the redistribution of water in the media resulting in differences in relative evaporation rates during drying. It appears that the spatial organization of the heterogeneity play a role in the breakdown of water repellence at the interface of the two media. This suggests a potential mechanism for self-organization of repellency spatial patterns in field soils. At the interface between wettable and water repellent beads a lateral drying front propagates towards the wettable beads from the repellent beads. During this drying the relative surface temperatures change from a relatively cooler repellent media surface to a relatively cooler wettable media surface indicating the changes in evaporative water loss between the beads of varying water repellence. The lateral drying front was confirmed using thermography in a small-scale model of glass beads with chemically induced repellence and then subjected to 3D X-ray imaging. Pore-scale imaging identified the hydrology at the interface of the two media and at the drying front giving insights into the physics of water flow in water repellent soil.

  17. Log bioassay of residual effectiveness of insecticides against bark beetles

    Science.gov (United States)

    Richard H. Smith

    1982-01-01

    Residual effectiveness of nine insecticides applied to bark was tested against western, mountain, and Jeffrey pine beetles. Ponderosa and Jeffrey pine trees were treated and logs cut from them 2 to 13 months later, and bioassayed with the three beetles. The insecticides were sprayed at the rate of 1 gal (3.8 l) per 40- or 80-ft² (3.6 or 7.2 m²) bark surface at varying...

  18. The use of insecticides to control insect pests

    OpenAIRE

    M Wojciechowska; P Stepnowski; M Gołębiowski

    2016-01-01

    Pesticides are used as plants protection products. Among those, insecticides serve as agents to control insects. When incorrectly applied, however these substances may negatively affect people's health and natural environment. Administration routes of insecticides depend on many factors and vary from spraying to fertilizers. These different methods influence how insects prey and how pests develop. Additionally, too frequent use of the same chemicals can lead to development of resi...

  19. Insecticidal activity of Trichilia claussenii (Meliaceae) fruits against Spodoptera frugiperda

    International Nuclear Information System (INIS)

    Nebo, Liliane; Matos, Andrea Pereira; Vieira, Paulo Cezar; Fernandes, Joao Batista; Silva, Maria Fatima das Gracas Fernandes da; Rodrigues, Ricardo Ribeiro

    2010-01-01

    An evaluation of the insecticidal activity of the fruits extracts of Trichilia claussenii was carried out and the methanol extract revealed to have strong insecticidal activity. The fractionation of methanol extract of T. claussenii seeds bioassay-guided against Spodoptera frugiperda has led to the identification of the ω-phenylalkyl and alkenyl fatty acids as active compounds in this extract. The structures of the compounds were proposed by spectroscopic analysis and comparison with literature data. (author)

  20. Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei

    Directory of Open Access Journals (Sweden)

    D.C. Pathak

    2011-07-01

    Full Text Available Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei in Chakrashila Wildlife Sanctuary (CWS in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pulmonary congestion and neuronal degeneration were recorded in all three animals.

  1. Plant compounds insecticide activity against Coleoptera pests of stored products

    OpenAIRE

    MOREIRA, M.D.; PICANÇO, M.C.; BARBOSA, L.C. de A.; GUEDES, R.N.C.; CAMPOS, M.R. de; SILVA, G.A.; MARTINS, J.C.

    2008-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed...

  2. Efficacy of Plant-Derived and Synthetic Compounds on Clothing as Repellents Against Ixodes scapularis and Amblyomma americanum (Acari: Ixodidae)

    Science.gov (United States)

    2012-01-01

    efÞcacy of the repellent deet against Aedes aegypti . J. Am. Mosq. Control Assoc. 14: 178Ð182. Robbins, P. J., and M. G. Cherniack. 1986. Review of...number of reported Lyme disease cases reached an all- time high of35,000 in 2008 (CDC 2010). The blacklegged tick, Ixodes scapularis Say, the principal...Paddock 2003, Mixson et al. 2006, Apperson et al. 2008). Repellents remain the primary method of personal protection against tick bites (Piesman and

  3. The formulation of the essential oil of Piper aduncum Linnaeus (Piperales: Piperaceae) increases its efficacy as an insect repellent.

    Science.gov (United States)

    Mamood, S N H; Hidayatulfathi, O; Budin, S B; Ahmad Rohi, G; Zulfakar, M H

    2017-02-01

    The essential oil (EO) of Piper aduncum Linnaeus, known as 'sireh lada' to locals Malaysian, has the potential to be used as an alternative to synthetic insect repellents such as N,N-diethyl-meta-toluamide. However, the EO's efficacy as a repellent decreases after application due to the high volatility of its active ingredients. A number of studies have showed that optimizing the formulation of plant-based EOs can improve their efficacy as repellents. The present study sought to evaluate the effectiveness of 10% P. aduncum EO in ethanol and in three different semisolid formulations: ointment, cream and gel. These formulations were tested on Aedes aegypti under laboratory conditions. Each formulation was applied to the subject's hands, which were then inserted into a cage containing 25 nulliparous A. aegypti. The number of mosquitoes landing on or biting each subject's hand was recorded, and the repellency percentage, landing/biting percentage and protection time for each of the formulations were compared. There were no statistically significant differences between the semisolid EO formulations with regards to the repellency percentage and the landing/biting percentage at 4 h post-application. All three semisolid EO formulations were able to repel >65% of the A. aegypti at 4 h post-application. The EO ointment formulation provided a protection time (182.5 ± 16.01 min) that was statistically significantly longer than that associated with the EO gel formulation (97.5 ± 14.93 min). Meanwhile, the EO cream formulation provided a protection time of 162.5 ± 6.29 min. As the EO cream and ointment formulations displayed better repellent properties than the EO gel formulation, they appear to be the most promising P. aduncum EO formulations to be developed and commercialized as alternatives to synthetic repellents.

  4. Impact of some selected insecticides application on soil microbial respiration.

    Science.gov (United States)

    Latif, M A; Razzaque, M A; Rahman, M M

    2008-08-15

    The aim of present study was to investigate the impact of selected insecticides used for controlling brinjal shoot and fruit borer on soil microorganisms and to find out the insecticides or nontoxic to soil microorganism the impact of nine selected insecticides on soil microbial respiration was studied in the laboratory. After injection of different insecticides solutions, the soil was incubated in the laboratory at room temperature for 32 days. The amount of CO2 evolved due to soil microbial respiration was determined at 2, 4, 8, 16, 24 and 32 days of incubation. Flubendiamide, nimbicidine, lambda-cyhalothrin, abamectin and thiodicarb had stimulatory effect on microbial respiration during the initial period of incubation. Chlorpyriphos, cartap and carbosulfan had inhibitory effect on microbial respiration and cypermethrin had no remarkable effect during the early stage of incubation. The negative effect of chlorpyriphos, cartap and carbosulfan was temporary, which was disappeared after 4 days of insecticides application. No effect of the selected insecticides on soil microorganisms was observed after 24 or 32 days of incubation.

  5. The Role of the United States Military in the Development of Vector Control Products, Including Insect Repellents, Insecticides, and Bed Nets

    Science.gov (United States)

    2009-06-01

    Kondig, R. Fernandez, and F. Carbajal. 2004. Field detection of eastern equine encephalitis virus in the Amazon Basin region of Peru using reverse...Yes (fleas) 26. Q fever Yes (argasid ticks) 27. Plague Yes ( rodent fleas) 28. Venezuelan equine encephalitis Yes (Culex and Psorophora mosquitoes) 29

  6. Evaluation of four commercial natural products for repellency and toxicity against the lone star tick, Amblyomma americanum (Acari: Ixodidae).

    Science.gov (United States)

    Machtinger, Erika T; Li, Andrew Y

    2017-12-01

    Lone star ticks are aggressive ectoparasites of domestic and wild animals, as well as humans. These ticks can transmit many pathogens that cause disease including Erhlichia and tularemia. Common compounds used for personal protection and area sprays are N-diethyl-3-methyl benzamide (DEET) and permethrin, but public concern over personal and environmental safety require the development of new, safer products. In the current study, four commercially available products (Wondercide, Essentria IC 3 , Vet's Best, and Mosquito Barrier) were tested for both repellent and toxic effects against lone star tick nymphs and adults. Overall, all four products were more effective against nymphs than against adults. Wondercide and Essentria IC 3 were as toxic to nymphs as permethrin at concentrations of 3.13% and higher, and as repellent as DEET at all concentrations. Nymphs were also repelled by Mosquito Barrier and Vet's Best, but these products had about half or less of the repellent effects of Wondercide and Essentria IC 3 at most of the concentrations. Adult ticks were repelled similarly by all products at all tested concentrations, but at lower levels than nymphs. Toxicity of the four tested products on adults was similar at concentrations of 12.5% and below, less than half of what was observed with permethrin with declining effectiveness as concentrations decreased. Overall, these four products may offer a natural way to repel lone star ticks, but further field testing is needed to determine rates of application and residual activity.

  7. Bioassay-guided investigation of two Monarda essential oils as repellents of yellow fever mosquito Aedes aegypti.

    Science.gov (United States)

    Tabanca, Nurhayat; Bernier, Ulrich R; Ali, Abbas; Wang, Mei; Demirci, Betul; Blythe, Eugene K; Khan, Shabana I; Baser, K Husnu Can; Khan, Ikhlas A

    2013-09-11

    As part of an ongoing research program to identify active mosquito repellents, Monarda bradburiana Beck and Monarda fistulosa L. essential oils showed good repellent activity with minimum effective dosages (MED) of 0.055 ± 0.036 and 0.078 ± 0.027 mg/cm(2), respectively, compared to reference standard N,N-diethyl-3-methylbenzamide (DEET) (0.039 ± 0.014 mg/cm(2)). Systematic bioassay-guided fractionation of essential oils of both Monarda species was performed to identify the active repellent compounds, and isolated pure compounds were individually tested for repellency. Of the isolated compounds, carvacrol, thymol, eugenol, and carvacrol methyl ether were found to be the repellent compounds with MEDs in the range of 0.013-0.063 mg/cm(2). Active repellent compounds were also tested for larvicidal activity against 1-day-old Aedes aegypti larvae. Thymol was the best larvicide among the tested individual compounds (LD50 of 13.9 ppm). None of the individual compounds showed cytotoxicity against mammalian cells; however, the essential oils were toxic to all cell lines.

  8. Repellent activity of herbal essential oils against Aedes aegypti (Linn. and Culex quinquefasciatus (Say.

    Directory of Open Access Journals (Sweden)

    Duangkamon Sritabutra

    2013-08-01

    Full Text Available Objective: To determine the mosquito repellent activity of herbal essential oils against female Aedes aegypti and Culex quinquefasciatus. Methods: On a volunteer’s forearm, 0.1 mL of each essential oil was applied to 3 cm伊10 cm of exposed skin. The protection time was recorded for 3 min after every 30 min. Results: Essential oil from clove oil in olive oil and in coconut oil gave the longest lasting period of 76.50 min and 96.00 min respectively against Aedes aegypti. The citronella grass oil in olive oil, citronella grass oil in coconut oil and lemongrass oil in coconut oil exhibited protection against Culex quinquefasciatus at 165.00, 105.00, and 112.50 min respectively. Conclusions: The results clearly indicated that clove, citronella and lemongrass oil were the most promising for repellency against mosquito species. These oils could be used to develop a new formulation to control mosquitoes.

  9. Hydrophobic duck feathers and their simulation on textile substrates for water repellent treatment

    International Nuclear Information System (INIS)

    Liu Yuyang; Chen Xianqiong; Xin, J H

    2008-01-01

    Inspired by the non-wetting phenomena of duck feathers, the water repellent property of duck feathers was studied at the nanoscale. The microstructures of the duck feather were investigated by a scanning electron microscope (SEM) imaging method through a step-by-step magnifying procedure. The SEM results show that duck feathers have a multi-scale structure and that this multi-scale structure as well as the preening oil are responsible for their super hydrophobic behavior. The microstructures of the duck feather were simulated on textile substrates using the biopolymer chitosan as building blocks through a novel surface solution precipitation (SSP) method, and then the textile substrates were further modified with a silicone compound to achieve low surface energy. The resultant textiles exhibit super water repellent properties, thus providing a simple bionic way to create super hydrophobic surfaces on soft substrates using flexible material as building blocks

  10. Preventing Superinfection in Malaria Spreads with Repellent and Medical Treatment Policy

    Science.gov (United States)

    Fitri, Fanny; Aldila, Dipo

    2018-03-01

    Malaria is a kind of a vector-borne disease. That means this disease needs a vector (in this case, the anopheles mosquito) to spread. In this article, a mathematical model for malaria disease spread will be discussed. The model is constructed as a seven-dimensional of a non-linear ordinary differential equation. The interventions of treatment for infected humans and use of repellent are included in the model to see how these interventions could be considered as alternative ways to control the spread of malaria. Analysis will be made of the disease-free equilibrium point along with its local stability criteria, construction of the next generation matrix which followed with the sensitivity analysis of basic reproduction number. We found that both medical treatment and repellent intervention succeeded in reducing the basic reproduction number as the endemic indicator of the model. Finally, some numerical simulations are given to give a better interpretation of the analytical results.

  11. Fumigant and Repellent Activity of Limonene Enantiomers Against Tribolium confusum du Val.

    Science.gov (United States)

    Malacrinò, A; Campolo, O; Laudani, F; Palmeri, V

    2016-10-01

    The use of pesticides, as carried out in the last 50 years, caused several negative environmental and human health consequences, leading to the development of alternative techniques to control pests, such as the use of compounds of plant origin. In this study, we assessed the fumigant and repellent activity of both the enantiomers of limonene, a monoterpene usually found in many plant species, against Tribolium confusum du Val. We tested both molecules at different doses, air temperatures, and in absence and presence of flour. R-(+)-limonene resulted more effective than S-(-)-limonene; indeed, it was able to reach 100% of efficacy at a concentration of 85 mg/L air when tested at different temperatures without flour. Data showed a positive relationship between efficacy and temperature, and a negative effect of the presence of debris on the bioactivity of limonene. Furthermore, repellency trials reported a higher activity of R-(+)-limonene compared to the other enantiomer.

  12. Soil-Water Repellency Characteristic Curves for Soil Profiles with Organic Carbon Gradients

    DEFF Research Database (Denmark)

    Wijewardana, Nadeeka Senani; Muller, Karin; Moldrup, Per

    2016-01-01

    Soil water repellency (SWR) of soils is a property with significant consequences for agricultural water management, water infiltration, contaminant transport, and for soil erosion. It is caused by the presence of hydrophobic agents on mineral grain surfaces. Soils were samples in different depths......, and the sessile drop method (SDM). The aim to (i) compare the methods, (ii) characterize the soil-water repellency characteristic curves (SWRCC) being SWR as a function of the volumetric soil-water content (θ) or matric potential (ψ), and (iii) find relationships between SWRCC parameters and SOC content. The WDPT...... at three forest sites in Japan and three pasture sites in New Zealand, covering soil organic carbon (SOC) contents between 1 and 26%. The SWR was measured over a range of water contents by three common methods; the water drop penetration time (WDPT) test, the molarity of an ethanol droplet (MED) method...

  13. Polymer Surface Textured with Nanowire Bundles to Repel High-Speed Water Drops.

    Science.gov (United States)

    Li, Y P; Li, X Y; Zhu, X P; Lei, M K; Lakhtakia, A

    2018-05-11

    Water drops impacting windshields of high-speed trains and aircraft as well as blades in steam turbine power generators obliquely and at high speeds are difficult to repel. Impacting drops penetrate the void regions of nanotextured and microtextured superhydrophobic coatings, with this pinning resulting in the loss of drop mobility. In order to repel high-speed water drops, we nanotextured polymer surfaces with nanowire bundles separated from their neighbors by microscale void regions, with the nanowires in a bundle separated from their neighbors by nanoscale void regions. Water drops with speeds below a critical speed rebound completely. Water drops with speeds exceeding a critical speed rebound partially, but residual droplets that begin to be pinned undergo a spontaneous dewetting process and slide off. The natural oscillations of residual droplets drive this dewetting process in the interbundle void regions, resulting in a transition from the sticky Wenzel state to the slippery Cassie state without external stimuli.

  14. Insecticide mixtures could enhance the toxicity of insecticides in a resistant dairy population of Musca domestica L [corrected].

    Directory of Open Access Journals (Sweden)

    Hafiz Azhar Ali Khan

    Full Text Available House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-"A" and LC50: LC50-"B" significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies.

  15. Insecticide Mixtures Could Enhance the Toxicity of Insecticides in a Resistant Dairy Population of Musca domestica L

    Science.gov (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin

    2013-01-01

    House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758

  16. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation

    Science.gov (United States)

    de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso

    2017-01-01

    The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907

  17. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation.

    Directory of Open Access Journals (Sweden)

    Luis Gustavo de Almeida

    Full Text Available The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects.

  18. Influence of water-repellent treatment on the properties lime and lime pozzolan mortars

    Directory of Open Access Journals (Sweden)

    Fortes Revilla, C.

    2001-06-01

    Full Text Available The influence that water-repellent products can have on physical and micro-structural properties of lime mortars, and lime plus pozzolan mortars has been studied. Three water repellent products have been used. Mixes of the previously mentioned three water repellents plus a biocide product were also applied. Treatments make the total porosity and saturation coefficient of both mortars to decrease, while colorimetric coordinates bear little alteration. All treatments with water repellent products provided mortars with a hydrophobic property index close to 100%. Durability of such mortars has been also studied: salt crystallization test, frost-thaw and dry-wet cycles, as well as ultraviolet radiation test were carried out. Relationship between mortars behavior and their porosity and saturation coefficient were found.

    En el presente trabajo se ha estudiado la influencia de la aplicación de productos hidrofugantes a morteros de cal y morteros de cal y puzolana sobre sus propiedades físicas y microestructurales. Se han estudiado tres productos hidrofugantes. También han sido estudiados dichos productos junto con un biocida. La porosidad total y el coeficiente de saturación de ambos tipos de morteros se ve reducido por el efecto de los tratamientos mientras que las coordenadas colorimétricas se ven poco alteradas. Todos los tratamientos confieren un índice de hidrofobicidad a los morteros próximo al 100%. Asimismo, también se ha estudiado la durabilidad de dichos morteros frente a la cristalización de sales, hielo-deshielo, los ciclos de humedad-sequedad y radiaciones ultravioleta. Se relaciona el comportamiento de los morteros con su porosidad y el coeficiente de saturación.

  19. Dry-season soil water repellency affects Tahoe Basin infiltration rates

    OpenAIRE

    Rice, Erin C; Grismer, Mark E

    2010-01-01

    Lake Tahoe’s declining clarity makes the identification of runoff and erosion sources and evaluation of control measures vitally important. We treated relatively undisturbed, native, forested sites of 10% to 15% slope with surfactant and used a rain-fall simulator to investigate the effects of repellency. We compared infiltration measurements made by the simulator and a mini-disk infiltrometer (MDI). Runoff was produced by all plots with untreated water, but only two of 12 plots with surfacta...

  20. Effective delivery of a nematode-repellent peptide using a root-cap-specific promoter.

    Science.gov (United States)

    Lilley, Catherine J; Wang, Dong; Atkinson, Howard J; Urwin, Peter E

    2011-02-01

    The potential of the MDK4-20 promoter of Arabidopsis thaliana to direct effective transgenic expression of a secreted nematode-repellent peptide was investigated. Its expression pattern was studied in both transgenic Arabidopsis and Solanum tuberosum (potato) plants. It directed root-specific β-glucuronidase expression in both species that was chiefly localized to cells of the root cap. Use of the fluorescent timer protein dsRED-E5 established that the MDK4-20 promoter remains active for longer than the commonly used constitutive promoter CaMV35S in separated potato root border cells. Transgenic Arabidopsis lines that expressed the nematode-repellent peptide under the control of either AtMDK4-20 or CaMV35S reduced the establishment of the beet cyst nematode Heterodera schachtii. The best line using the AtMDK4-20 promoter displayed a level of resistance >80%, comparable to that of lines using the CaMV35S promoter. In transgenic potato plants, 94.9 ± 0.8% resistance to the potato cyst nematode Globodera pallida was achieved using the AtMDK4-20 promoter, compared with 34.4 ± 8.4% resistance displayed by a line expressing the repellent peptide from the CaMV35S promoter. These results establish the potential of the AtMDK4-20 promoter to limit expression of a repellent peptide whilst maintaining or even improving the efficacy of the cyst-nematode defence. © 2010 The Authors. Plant Biotechnology Journal © 2010 Society for Experimental Biology, Association of Applied Biologists and Blackwell Publishing Ltd.

  1. Mortality and repellent effects of microbial pathogens on Coptotermes formosanus (Isoptera: Rhinotermitidae

    Directory of Open Access Journals (Sweden)

    Wright Maureen S

    2012-12-01

    Full Text Available Abstract Background Two entomopathogenic fungi, Isaria fumosorosea and Metarhizium anisopliae, and one bacterium, Bacillus thuringiensis, were tested for their ability to cause mortality of Formosan subterranean termites (FST, Coptotermes formosanus (Shiraki, after liquid exposure, and for their lack of propensity to repel FST. Results The fungus Isaria fumosorosea at 108 spores/ml caused 72.5% mortality on day 7, significantly higher than the control and 106 spores/ml treatment. On day 14, the 106 and 108 concentrations caused 38.8% and 92.5% mortality, respectively, significantly higher than the control. On day 21, 82.5% and 100% of the termites were killed by the 106 and 108 treatments, respectively. I. fumosorosea did not repel termites at 106 nor 108 spores/g in sand, soil or sawdust. The fungus Metarhizium anisopliae at 108 spores/ml caused 57.5% mortality on day 7, 77.5% mortality on day 14 and 100% mortality on day 21. Conclusions On all three days the rate of mortality was significantly higher than that of the control and 106 spores/ml treatment with I. fumosorosea. Neither I. fumosorosea nor M. anisopliae caused repellency of FST in sand, soil or sawdust. The bacterium Bacillus thuringiensis did not cause significant mortality on days 7, 14 or 21. When termites were exposed to cells of B. thuringiensis in sawdust and when termites were exposed to a mixture of spores and cells in sand, a significantly higher number remained in the control tubes. Repellency was not seen with B. thuringiensis spores alone, nor with the above treatments in the other substrates.

  2. Water-repellent preservative treatment of brick molding prior to factory priming improves paint service life

    Science.gov (United States)

    R. Sam Williams; Alan S. Ross; Peter Sotos; Chuck Cheeks

    2001-01-01

    One end of each piece of brick molding (about 35 mm long) was dipped in a water-repellent preservative (WRP). Following the WRP treatment, the sections were divided into two groups and painted with one of two different primers formulated to be typical of factory-applied primers. Each of the primed groups was further divided into four groups to determine the effect of...

  3. LD50 and repellent effects of essential oils from Argentinian wild plant species on Varroa destructor.

    Science.gov (United States)

    Ruffinengo, Sergio; Eguaras, Martin; Floris, Ignazio; Faverin, Claudia; Bailac, Pedro; Ponzi, Marta

    2005-06-01

    The repellent and acaricidal effects of some essential oils from the most typical wild plant species of northern Patagonia, Argentina, on Varroa destructor Anderson & Trueman were evaluated using a complete exposure test. Honey bees, Apis mellifera L., and mites (five specimens of each per dish) were introduced in petri dishes having different oil concentrations (from 0.1 to 25 micro per cage). Survival of bees and mites was registered after 24, 48, and 72 h. An attraction/repellence test was performed using a wax tube impregnated with essential oil and another tube containing wax only. The lowest LD50 values for mites were registered for Acantholippia seriphioides (A. Gray) Mold. (1.27 microl per cage) and Schinus molle L. (2.65 microl per cage) after 24 h, and for Wedelia glauca (Ortega) O. Hoffm. ex Hicken (0.59 microl per cage) and A. seriphioides (1.09 microl per cage) after 72 h of treatment. The oil with the highest selectivity ratio (A. mellifera LD50/V. destructor LD50) was the one extracted from S. molle (>16). Oils of Lippia junelliana (Mold.) Troncoso, Minthostachys mollis (HBK) Grieseb., and Lippia turbinata Grieseb. mixed with wax had repellent properties. None of the oils tested had attractive effects on Varroa mites.

  4. Moment analysis description of wetting and redistribution plumes in wettable and water-repellent soils

    Science.gov (United States)

    Xiong, Yunwu; Furman, Alex; Wallach, Rony

    2012-02-01

    SummaryWater repellency has a significant impact on water flow patterns in the soil profile. Transient 2D flow in wettable and natural water-repellent soils was monitored in a transparent flow chamber. The substantial differences in plume shape and spatial water content distribution during the wetting and subsequent redistribution stages were related to the variation of contact angle while in contact with water. The observed plumes shape, internal water content distribution in general and the saturation overshoot behind the wetting front in particular in the repellent soils were associated with unstable flow. Moment analysis was applied to characterize the measured plumes during the wetting and subsequent redistribution. The center of mass and spatial variances determined for the measured evolving plumes were fitted by a model that accounts for capillary and gravitational driving forces in a medium of temporally varying wettability. Ellipses defined around the stable and unstable plumes' centers of mass and whose semi-axes represented a particular number of spatial variances were used to characterize plume shape and internal moisture distribution. A single probability curve was able to characterize the corresponding fractions of the total added water in the different ellipses for all measured plumes, which testify the competence and advantage of the moment analysis method.

  5. Acaricidal activity and repellency of essential oil from Piper aduncum and its components against Tetranychus urticae.

    Science.gov (United States)

    Araújo, Mário J C; Câmara, Cláudio A G; Born, Flávia S; Moraes, Marcílio M; Badji, César A

    2012-06-01

    The chemical composition of essential oil of leaves of Piper aduncum L., growing wild in a fragment of the Atlantic Rainforest biome in northeastern Brazil, was determined through gas chromatography-mass spectrometry. The acaricidal activity and repellency of the essential oil and its components [dillapiole (0.28 g/ml), α-humulene (0.016 g/ml), (E)-nerolidol (0.0007 g/ml) and β-caryophyllene (0.0021 g/ml)] were evaluated in the laboratory against adults of Tetranychus urticae Koch. The mites were more susceptible to the oil in fumigation tests (LC(50) = 0.01 μl/l of air) than in contact test with closed Petri dish (LC(50) = 7.17 μl/ml); mortality was reduced by approximately 50 % in the latter test. The repellent action of the oil and toxicity by fumigation and contact did not differ significantly from the positive control (eugenol). The repellent activity was attributed to the components (E)-nerolidol, α-humulene and β-caryophyllene, whereas toxicity by fumigation and contact was attributed to β-caryophyllene. The effect of Piper oil and the role of its components regarding host plant preference with a two-choice leaf disk test are also discussed.

  6. Use of chemosensory cues as repellents for sea lamprey: Potential directions for population management

    Science.gov (United States)

    Imre, I.; Brown, G.E.; Bergstedt, R.A.; McDonald, R.

    2010-01-01

    Sea lamprey invaded the Great Lakes in the early 20th century and caused an abrupt decline in the population densities of several native fish species. The integrated management of this invasive species is composed of chemical (lampricide) applications, low-head barrier dams, adult trapping and sterile male release. Recently, there has been an increased emphasis on the development of control methods alternative to lampricide applications. We propose as an alternative-control method the use of chemosensory cues as repellents for sea lamprey population management. Based on the available evidence at this time, we suggest that injury-released chemical alarm cues show promise as repellents for sea lamprey and further research should be directed at determining whether sea lamprey show an avoidance response to these types of chemosensory cues. From a management perspective, these chemosensory cues could be used to restrict sea lamprey access to spawning grounds. Repellents could also be used together with attractants like sex pheromones to manipulate sea lamprey behavior, similar to the "push-pull" strategies utilized with insect pests. ?? 2010 Elsevier B.V.

  7. Inverse estimation of soil hydraulic properties and water repellency following artificially induced drought stress

    Directory of Open Access Journals (Sweden)

    Filipović Vilim

    2018-06-01

    Full Text Available Global climate change is projected to continue and result in prolonged and more intense droughts, which can increase soil water repellency (SWR. To be able to estimate the consequences of SWR on vadose zone hydrology, it is important to determine soil hydraulic properties (SHP. Sequential modeling using HYDRUS (2D/3D was performed on an experimental field site with artificially imposed drought scenarios (moderately M and severely S stressed and a control plot. First, inverse modeling was performed for SHP estimation based on water and ethanol infiltration experimental data, followed by model validation on one selected irrigation event. Finally, hillslope modeling was performed to assess water balance for 2014. Results suggest that prolonged dry periods can increase soil water repellency. Inverse modeling was successfully performed for infiltrating liquids, water and ethanol, with R2 and model efficiency (E values both > 0.9. SHP derived from the ethanol measurements showed large differences in van Genuchten-Mualem (VGM parameters for the M and S plots compared to water infiltration experiments. SWR resulted in large saturated hydraulic conductivity (Ks decrease on the M and S scenarios. After validation of SHP on water content measurements during a selected irrigation event, one year simulations (2014 showed that water repellency increases surface runoff in non-structured soils at hillslopes.

  8. Comparative efficacy of IR3535 and deet as repellents against adult Aedes aegypti and Culex quinquefasciatus.

    Science.gov (United States)

    Cilek, J E; Petersen, J L; Hallmon, C E

    2004-09-01

    Arm-in-cage laboratory evaluations of 2 proprietary formulations of the mosquito repellents IR3535 and N,N-diethyl-3-methylbenzamide (deet; aqueous cream, hydroalcoholic spray) were made with 10 and 20% concentrations of each repellent. Also, 4 commercially available products containing IR3535 (Expedition insect repellent 20.07% active ingredient [AI], Bug Guard Plus with SPF30 sunscreen 7.5% AI, Bug Guard Plus with SPF15 sunscreen 7.5% AI, and Bug Guard Plus 7.5% AI) were tested. All comparisons were made on an equal formulation or concentration basis. Eight volunteers tested all formulations or products 3 times against laboratory-reared, Aedes aegypti and Culex quinquefasciatus mosquitoes (6-10 days old). Products were applied to a forearm at the rate of 0.002 g/cm2. The other forearm was not treated and served as a control. Elapsed time to 1st and 2nd consecutive bite was recorded. Mean protection time (i.e., time to 1st bite) with proprietary formulations of IR3535 were comparable to those of deet, with 20% concentrations providing greater protection against Ae. aegypti (3 h) and Cx. quinquefasciatus (6 h). Mean protection time for commercial products containing IR3535 ranged from nearly 90 to 170 min for Ae. aegypti and 3.5 to 6.5 h for Cx. quinquefasciatus. Mean time to the 2nd bite was similar to time to 1st bite for each mosquito species, product, and formulation.

  9. Deposition of chemically reactive and repellent sites on biosensor chips for reduced non-specific binding.

    Science.gov (United States)

    Gandhiraman, R P; Gubala, V; Le, N C H; Nam, Le Cao Hoai; Volcke, C; Doyle, C; James, B; Daniels, S; Williams, D E

    2010-08-01

    The performances of new polymeric materials with excellent optical properties and good machinability have led the biomedical diagnostics industry to develop cheap disposable biosensor platforms appropriate for point of care applications. Zeonor, a type of cycloolefin polymer (COP), is one such polymer that presents an excellent platform for biosensor chips. These polymer substrates have to be modified to have suitable physico-chemical properties for immobilizing proteins. In this work, we have demonstrated the amine functionalization of COP substrates, by plasma enhanced chemical vapour deposition (PECVD), through codeposition of ethylene diamine and 3-aminopropyltriethoxysilane precursors, for building chemistries on the plastic chip. The elemental composition, adhesion, ageing and reactivity of the plasma polymerized film were examined. The Si-O functionality present in amino silane contributed for a good interfacial adhesion of the coating to COP substrates and also acted as a network building layer for plasma polymerization. Wet chemical modification was then carried out on the amine functionalized chips to create chemically reactive isothiocyanate sites and protein repellent fluorinated sites on the same chip. The density of the reactive and repellent sites was altered by choosing appropriate mixtures of homofunctional phenyldiisothiocyanate (PDITC), pentafluoroisothiocyanate (5FITC) and phenylisothiocyanate (PITC) compounds. By tailoring the density of reactive binding sites and protein repellent sites, the non-specific binding of ssDNA has been decreased to a significant extent. Copyright 2010 Elsevier B.V. All rights reserved.

  10. The repellency of lemongrass oil against stable flies, tested using video tracking

    Science.gov (United States)

    Baldacchino, Frédéric; Tramut, Coline; Salem, Ali; Liénard, Emmanuel; Delétré, Emilie; Franc, Michel; Martin, Thibaud; Duvallet, Gérard; Jay-Robert, Pierre

    2013-01-01

    Lemongrass oil (Cymbopogon citratus) is an effective repellent against mosquitoes (Diptera: Culicidae) and house flies (Diptera: Muscidae). In this study, its effectiveness was assessed on stable flies (Diptera: Muscidae) in laboratory conditions. First, we demonstrated that lemongrass oil is an active substance for antennal olfactory receptor cells of Stomoxys calcitrans as indicated by a significant increase in the electroantennogram responses to increasing doses of lemongrass oil. Feeding-choice tests in a flight cage with stable flies having access to two blood-soaked sanitary pads, one of which was treated with lemongrass oil, showed that stable flies (n = 24) spent significantly more time in the untreated zone (median value = 218.4 s) than in the treated zone (median value = 63.7 s). No stable flies fed on the treated pad, whereas nine fed on the untreated pad. These results suggest that lemongrass oil could be used as an effective repellent against stable flies. Additional studies to confirm its spatial repellent and feeding deterrent effects are warranted. PMID:23759542

  11. Chemical Composition and Repellent Activity of Achillea vermiculata and Satureja hortensis against Anopheles stephensi

    Directory of Open Access Journals (Sweden)

    Masoumeh Pirmohammadi

    2016-01-01

    Full Text Available Background: One of the best ways to control the malaria disease and to be protected human against Anopheles mos­quito biting is the use of repellents. Throughout repellents, herbal ones may be an appropriate and safe source for protection.Methods: Chemical constituents of Achillea vermiculata and Satoreja hortensis were determined by using gas chromatography-mass spectrometry. Efficacy and the protection time of these plants were assessed on Anopheles stephensi under the laboratory condition.Results: The mean assessed protection time and efficacy for A. vermiculata was 2.16 and 3.16 hours respectively and the obtained ED50 and ED90 for this plant was 5.67 and 63 µl/cm2 respectively. The figured for S. hortensis was 4.16 and 5 hours respectively.  ED50 and ED90 for this plant were 5.63 and 45.75µl/cm2 respectively.Conclusion: Results of investigation showed that S. hortensis plant has an acceptable protection time, therefore, this plant could be considered as a good herbal repellent against anopheles mosquitoes.

  12. Extreme Wetting-Resistant Multiscale Nano-/Microstructured Surfaces for Viscoelastic Liquid Repellence

    Directory of Open Access Journals (Sweden)

    Aoythip Chunglok

    2016-01-01

    Full Text Available We demonstrate exceptional wetting-resistant surfaces capable of repelling low surface tension, non-Newtonian, and highly viscoelastic liquids. Theoretical analysis and experimental result confirm that a higher level of multiscale roughness topography composed of at least three structural length scales, ranging from nanometer to supermicron sizes, is crucial for the reduction of liquid-solid adhesion hysteresis. With Cassie-Baxter nonwetting state satisfied at all roughness length scales, the surface has been proven to effectively repel even highly adhesive liquid. Practically, this high-level hierarchical structure can be achieved through fractal-like structures of silica aggregates induced by siloxane oligomer interparticle bridges. The induced aggregation and surface functionalization of the silica particles can be performed simultaneously within a single reaction step, by utilizing trifunctional fluoroalkylsilane precursors that largely form a disordered fluoroalkylsiloxane grafting layer under the presence of sufficient native moisture preadsorbed at the silica surface. Spray-coating deposition of a particle surface layer on a precoated primer layer ensures facile processability and scalability of the fabrication method. The resulting low-surface-energy multiscale roughness exhibits outstanding liquid repellent properties, generating equivalent lotus effect for highly viscous and adhesive natural latex concentrate, with apparent contact angles greater than 160°, and very small roll-off angles of less than 3°.

  13. Organic compounds in hot-water-soluble fractions from water repellent soils

    Science.gov (United States)

    Atanassova, Irena; Doerr, Stefan

    2014-05-01

    Water repellency (WR) is a soil property providing hydrophobic protection and preventing rapid microbial decomposition of organic matter entering the soil with litter or plant residues. Global warming can cause changes in WR, thus influencing water storage and plant productivity. Here we assess two different approaches for analysis of organic compounds composition in hot water extracts from accelerated solvent extraction (ASE) of water repellent soils. Extracts were lyophilized, fractionated on SiO2 (sand) and SPE cartridge, and measured by GC/MS. Dominant compounds were aromatic acids, short chain dicarboxylic acids (C4-C9), sugars, short chain fatty acids (C8-C18), and esters of stearic and palmitic acids. Polar compounds (mainly sugars) were adsorbed on applying SPE clean-up procedure, while esters were highly abundant. In addition to the removal of polar compounds, hydrophobic esters and hydrocarbons (alkanes and alkenes particle wettability and C dynamics in soils. Key words: soil water repellency, hot water soluble carbon (HWSC), GC/MS, hydrophobic compounds

  14. Plant essential oils and potassium metabisulfite as repellents for Drosophila suzukii (Diptera: Drosophilidae)

    Science.gov (United States)

    Renkema, Justin M.; Wright, Derek; Buitenhuis, Rose; Hallett, Rebecca H.

    2016-01-01

    Spotted wing drosophila, Drosophila suzukii, is a globally invasive pest of soft-skinned fruit. Females oviposit into ripening fruit and larvae cause direct destruction of tissues. As many plant essential oils are permitted food additives, they may provide a safe means of protecting fruit from D. suzukii infestation in both conventional and organic production systems. Twelve oils and potassium metabisulfite (KMS) were screened in the laboratory as repellents for D. suzukii flies. Most essential oils deterred D. suzukii flies from cotton wicks containing attractive raspberry juice. Peppermint oil was particularly effective, preventing almost all flies from contacting treated wicks and remaining 100% repellent for 6 d post-application. Thyme oil was unique because it caused high male mortality and reduced the number of responding flies compared to other oils. KMS was not found to be repellent to D. suzukii, but may have fumigant properties, particularly at high concentrations. Peppermint oil appears to be the best candidate for field testing to determine the effectiveness and feasibility of using essential oils as part of a push-pull management strategy against D. suzukii. This is the first time that essential oils have been evaluated and proven effective in preventing fruit-infesting flies from contacting attractive stimuli. PMID:26893197

  15. Enzymes and Inhibitors in Neonicotinoid Insecticide Metabolism

    Science.gov (United States)

    Shi, Xueyan; Dick, Ryan A.; Ford, Kevin A.; Casida, John E.

    2009-01-01

    Neonicotinoid insecticide metabolism involves considerable substrate specificity and regioselectivity of the relevant CYP450, aldehyde oxidase, and phase II enzymes. Human CYP450 recombinant enzymes carry out the following conversions: CYP3A4, 2C19 and 2B6 for thiamethoxam (TMX) to clothianidin (CLO); 3A4, 2C19 and 2A6 for CLO to desmethyl-CLO; 2C19 for TMX to desmethyl-TMX. Human liver aldehyde oxidase reduces the nitro substituent of CLO to nitroso much more rapidly than that of TMX. Imidacloprid (IMI), CLO and several of their metabolites do not give detectable N-glucuronides but 5-hydroxy-IMI, 4,5-diol-IMI and 4-hydroxy-thiacloprid are converted to O-glucuronides in vitro with mouse liver microsomes and UDP-glucuronic acid or in vivo in mice. Mouse liver cytosol with S-adenosylmethionine converts desmethyl-CLO to CLO but not desmethyl-TMX to TMX. Two organophosphorus CYP450 inhibitors partially block IMI, thiacloprid and CLO metabolism in vivo in mice, elevating the brain and liver levels of the parent compounds while reducing amounts of the hydroxylated metabolites. PMID:19391582

  16. Azobenzene Modified Imidacloprid Derivatives as Photoswitchable Insecticides: Steering Molecular Activity in a Controllable Manner

    Science.gov (United States)

    Xu, Zhiping; Shi, Lina; Jiang, Danping; Cheng, Jiagao; Shao, Xusheng; Li, Zhong

    2015-10-01

    Incorporating the photoisomerizable azobenzene into imidacloprid produced a photoswitchable insecticidal molecule as the first neonicotinoid example of remote control insecticide performance with spatiotemporal resolution. The designed photoswitchable insecticides showed distinguishable activity against Musca both in vivo and in vitro upon irradiation. Molecular docking study further suggested the binding difference of the two photoisomers. The generation of these photomediated insecticides provides novel insight into the insecticidal activity facilitating further investigation on the functions of insect nicotinic acetylcholine receptors and opens a novel way to control and study insect behavior on insecticide poisoning using light.

  17. Climate change, agricultural insecticide exposure, and risk for freshwater communities.

    Science.gov (United States)

    Kattwinkel, Mira; Kühne, Jan-Valentin; Foit, Kaarina; Liess, Matthias

    2011-09-01

    Climate change exerts direct effects on ecosystems but has additional indirect effects due to changes in agricultural practice. These include the increased use of pesticides, changes in the areas that are cultivated, and changes in the crops cultivated. It is well known that pesticides, and in particular insecticides, affect aquatic ecosystems adversely. To implement effective mitigation measures it is necessary to identify areas that are affected currently and those that will be affected in the future. As a consequence, we predicted potential exposure to insecticide (insecticide runoff potential, RP) under current conditions (1990) and under a model scenario of future climate and land use (2090) using a spatially explicit model on a continental scale, with a focus on Europe. Space-for-time substitution was used to predict future levels of insecticide application, intensity of agricultural land use, and cultivated crops. To assess the indirect effects of climate change, evaluation of the risk of insecticide exposure was based on a trait-based, climate-insensitive indicator system (SPEAR, SPEcies At Risk). To this end, RP and landscape characteristics that are relevant for the recovery of affected populations were combined to estimate the ecological risk (ER) of insecticides for freshwater communities. We predicted a strong increase in the application of, and aquatic exposure to, insecticides under the future scenario, especially in central and northern Europe. This, in turn, will result in a severe increase in ER in these regions. Hence, the proportion of stream sites adjacent to arable land that do not meet the requirements for good ecological status as defined by the EU Water Framework Directive will increase (from 33% to 39% for the EU-25 countries), in particular in the Scandinavian and Baltic countries (from 6% to 19%). Such spatially explicit mapping of risk enables the planning of adaptation and mitigation strategies including vegetated buffer strips and

  18. Biting deterrence and insecticidal activity of hydrazide-hydrazones and their corresponding 3-acetyl-2,5-disubstituted-2,3-dihydro-1,3,4-oxadiazoles against Aedes aegypti.

    Science.gov (United States)

    Tabanca, Nurhayat; Ali, Abbas; Bernier, Ulrich R; Khan, Ikhlas A; Kocyigit-Kaymakcioglu, Bedia; Oruç-Emre, Emine E; Unsalan, Seda; Rollas, Sevim

    2013-06-01

    Taking into account the improvement in insecticidal activity by the inclusion of fluorine in the hydrazone moiety, the authors synthesized new 4-fluorobenzoic acid hydrazides and 3-acetyl-2,5-disubstituted-2,3-dihydro-1,3,4-oxadiazoles, substituting a phenyl group or a heteroaryl ring carrying one or two atoms of F, Cl and Br, and investigated their biting deterrent and larvicidal activities against Aedes aegypti for the first time. The compound 3-acetyl-5-(4-fluorophenyl)-2-[4-(dimethylamino)phenyl]-2,3-dihydro-1,3,4-oxadiazole (17) produced the highest biting deterrent activity (BDI = 1.025) against Ae. Aegypti, followed by 4-fluorobenzoic acid [(phenyl)methylene] hydrazide (1). These activity results were similar to those of N,N-diethyl-meta-toluamide (DEET), which showed a proportion not biting of 0.8-0.92. When compounds 1 and 17 were tested on cloth worn on human volunteers, compound 1 was not repellent for some volunteers until present in excess of 500 nmol cm(-2) , while compound 17 was not repellent at the highest concentration tested (1685 nmol cm(-2) ). In the larvicidal screening bioassays, only compounds 10, 11, 12 and 17 showed 100% mortality at the highest screening dose of 100 ppm against Ae. aegypti larvae. Compounds 11 and 12 with LD50 values of 24.1 and 30.9 ppm showed significantly higher mortality than 10 (80.3 ppm) and 17 (58.7 ppm) at 24-h post-treatment. The insecticidal and biting deterrent activities were correlated with the presence of a halogen atom on the phenyl or heteroaryl substituent of the hydrazone moiety. © 2012 Society of Chemical Industry.

  19. Water repellence assessment in humid mediterranean carbonated environments: influence of shrubland species

    Science.gov (United States)

    Oscar, Gonzalez-Pelayo; Vicente, Andreu; Luis, Rubio Jose; Carla Sofia, Ferreira; Dinis, Ferreira Antonio Jose

    2010-05-01

    The importance of natural or induced (fire) water repellence in terms of water redistribution in the soil profile, reduction in soil infiltration capacity and thus, in runoff magnification, is well established. Hydrophobicity has been identified around the world in different climatic conditions, land covers, soil and vegetation types. Regarding soil and vegetation, many studies are based on coarse acidic soils with pine forest, eucalyptus, deciduous trees, grassland, cropland, chaparral vegetation type, and lately in shrublands. However, few studies are related to shrubland in wet Mediterranean carbonated environments. This work is oriented to the study of soil water repellence in these environments by means of WDPT. The study was carried out in Podentes (Coimbra), central Portugal, on 4 ha of shrubland (mainly Quercus coccifera, Pistacia lentiscus and Arbutus unedo), developed on Umbric leptosol and Calcaric cambisol soil types (WRB). The WDPT was assessed depending on the shrubland type, slope orientation, soil depth (0-2 cm and 2-5 cm) and on different soil fractions (unedo. Soil water repellence decreased with depth. The studied shrubland species showed an increasing trend on the soil hydrophobicity persistence: A. unedo > Q. coccifera ≈ P. lentiscus; and depending on the orientation: NE > SW. Direct relationships were obtained between the soil organic matter content and the log WDPT on almost all the surface soil samples. The soil pH and carbonate content did not display correlation with soil water repellence. The different hydrophobic compounds generated by waxes and resins of the different shrubland types, which could be incorporated to the soil as binding agents, seem to be the explanation for the differences of the WDPT data. The patchy distribution of the vegetation rules the persistence of the natural soil water repellence, restraining water infiltration mainly by micropore flow, being then the soil hydrology controlled by the macropore flow, cracks

  20. Effects of a layer of vegetative ash layer on wettable and water repellent soil hydrology

    Science.gov (United States)

    Bodí, Merche B.; Doerr, Stefan H.; Cerdà, Artemi; Mataix-Solera, Jorge

    2010-05-01

    Following a wildfire, a layer of vegetative ash often covers the ground until it is dissolved or redistributed by wind and water erosion. Much of the existing literature suggests that the ash layer temporally reduces infiltration by clogging soil pores or by forming a surface crust (Mallik et al., 1984; Onda et al., 2008). However, an increasing number of field-based studies have found that, at least in the short term, ash increases infiltration by storing rainfall and protecting the underlying soil from sealing (Cerdà and Doerr, 2008; Woods and Balfour, 2008). On the other hand, after a fire the soil may have produced, enhanced or reduced its water repellency (Doerr et al., 2000). Very few studies have been taken into account the interaction of the ash and the repellent soil. The layer of ash may have similar role as a litter layer in delaying runoff and reducing erosion by storing water. In order to examine this interaction, it was been made a series of experiments using a laboratory rainfall simulation. It has been assessed the effects of an ash layer i) on a wettable and water repellent soil (WDPT > 7200s), ii) with different ash thicknesses (bare soil and 5 mm, 15 mm and 30 mm of ash), iii) preceding and following the first rain after a fire when the ground is still wetted and after being partially dried. Three replicates were done, being a total of 40 simulations. The ash used was collected from a Wildfire in Teruel (Spain) during summer of 2009. The simulations were conducted in metal boxes of 30x30 cm and filled with 3 cm of soil. The slope of the box was set at 10° (17%) and the intensity applied was 78-84 mm h-1during 40 minutes. The splash detachment was determined also using four splash cups. Overland flow and subsurface drainage was collected at 1-minute intervals and the former stored every 5 min to allow determination of sediment concentrations, yield and erosion rates. Each sample was examined at the end in terms of water repellency, infiltration

  1. Spatial probability of soil water repellency in an abandoned agricultural field in Lithuania

    Science.gov (United States)

    Pereira, Paulo; Misiūnė, Ieva

    2015-04-01

    Water repellency is a natural soil property with implications on infiltration, erosion and plant growth. It depends on soil texture, type and amount of organic matter, fungi, microorganisms, and vegetation cover (Doerr et al., 2000). Human activities as agriculture can have implications on soil water repellency (SWR) due tillage and addition of organic compounds and fertilizers (Blanco-Canqui and Lal, 2009; Gonzalez-Penaloza et al., 2012). It is also assumed that SWR has a high small-scale variability (Doerr et al., 2000). The aim of this work is to study the spatial probability of SWR in an abandoned field testing several geostatistical methods, Organic Kriging (OK), Simple Kriging (SK), Indicator Kriging (IK), Probability Kriging (PK) and Disjunctive Kriging (DK). The study area it is located near Vilnius urban area at (54 49' N, 25 22', 104 masl) in Lithuania (Pereira and Oliva, 2013). It was designed a experimental plot with 21 m2 (07x03 m). Inside this area it was measured SWR was measured every 50 cm using the water drop penetration time (WDPT) (Wessel, 1998). A total of 105 points were measured. The probability of SWR was classified in 0 (No probability) to 1 (High probability). The methods accuracy was assessed with the cross validation method. The best interpolation method was the one with the lowest Root Mean Square Error (RMSE). The results showed that the most accurate probability method was SK (RMSE=0.436), followed by DK (RMSE=0.437), IK (RMSE=0.448), PK (RMSE=0.452) and OK (RMSE=0.537). Significant differences were identified among probability tests (Kruskal-Wallis test =199.7597 ptested technique. Simple Kriging, DK, IK and PK methods identified the high SWR probabilities in the northeast and central part of the plot, while OK observed mainly in the south-western part of the plot. In conclusion, before predict the spatial probability of SWR it is important to test several methods in order to identify the most accurate. Acknowledgments COST action ES

  2. The entomopathogenic fungus Beauveria bassiana reduces instantaneous blood feeding in wild multi-insecticide-resistant Culex quinquefasciatus mosquitoes in Benin, West Africa

    Directory of Open Access Journals (Sweden)

    Howard Annabel FV

    2010-09-01

    Full Text Available Abstract Background Mosquito-borne diseases are still a major health risk in many developing countries, and the emergence of multi-insecticide-resistant mosquitoes is threatening the future of vector control. Therefore, new tools that can manage resistant mosquitoes are required. Laboratory studies show that entomopathogenic fungi can kill insecticide-resistant malaria vectors but this needs to be verified in the field. Methods The present study investigated whether these fungi will be effective at infecting, killing and/or modifying the behaviour of wild multi-insecticide-resistant West African mosquitoes. The entomopathogenic fungi Metarhizium anisopliae and Beauveria bassiana were separately applied to white polyester window netting and used in combination with either a permethrin-treated or untreated bednet in an experimental hut trial. Untreated nets were used because we wanted to test the effect of fungus alone and in combination with an insecticide to examine any potential additive or synergistic effects. Results In total, 1125 female mosquitoes were collected during the hut trial, mainly Culex quinquefasciatus Say. Unfortunately, not enough wild Anopheles gambiae Giles were collected to allow the effect the fungi may have on this malaria vector to be analysed. None of the treatment combinations caused significantly increased mortality of Cx. quinquefasciatus when compared to the control hut. The only significant behaviour modification found was a reduction in blood feeding by Cx. quinquefasciatus, caused by the permethrin and B. bassiana treatments, although no additive effect was seen in the B. bassiana and permethrin combination treatment. Beauveria bassiana did not repel blood foraging mosquitoes either in the laboratory or field. Conclusions This is the first time that an entomopathogenic fungus has been shown to reduce blood feeding of wild mosquitoes. This behaviour modification indicates that B. bassiana could potentially be a new

  3. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal]. E-mail: marcio.dionizio@gmail.com; picanco@ufv.br; guedes@ufv.br; mateusc3@yahoo.com.br; agronomiasilva@yahoo.com.br

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  4. Insecticide mixtures for mosquito net impregnation against malaria vectors

    Directory of Open Access Journals (Sweden)

    Corbel V.

    2002-09-01

    Full Text Available Insecticides belonging to the pyrethroid family are the only compounds currently available for the treatment of mosquito nets. Unfortunately, some malaria vector species have developed resistance to pyrethroids and the lack of alternative chemical categories is a great concern. One strategy for resistance management would be to treat mosquito nets with a mixture associating two insecticides having different modes of action. This study presents the results obtained with insecticide mixtures containing several proportions of bifenthrin (a pyrethroid insecticide and carbosulfan (a carbamate insecticide. The mixtures were sprayed on mosquito net samples and their efficacy were tested against a susceptible strain of Anopheles gambiae, the major malaria vector in Africa. A significant synergism was observed with a mixture containing 25 mg/m2 of bifenthrin (half the recommended dosage for treated nets and 6.25 mg/m2 of carbosulfan (about 2 % of the recommended dosage. The observed mortality was significantly more than expected in the absence of any interaction (80 % vs 41 % and the knock-down effect was maintained, providing an effective barrier against susceptible mosquitoes.

  5. Mass spectrometric analyses of organophosphate insecticide oxon protein adducts.

    Science.gov (United States)

    Thompson, Charles M; Prins, John M; George, Kathleen M

    2010-01-01

    Organophosphate (OP) insecticides continue to be used to control insect pests. Acute and chronic exposures to OP insecticides have been documented to cause adverse health effects, but few OP-adducted proteins have been correlated with these illnesses at the molecular level. Our aim was to review the literature covering the current state of the art in mass spectrometry (MS) used to identify OP protein biomarkers. We identified general and specific research reports related to OP insecticides, OP toxicity, OP structure, and protein MS by searching PubMed and Chemical Abstracts for articles published before December 2008. A number of OP-based insecticides share common structural elements that result in predictable OP-protein adducts. The resultant OP-protein adducts show an increase in molecular mass that can be identified by MS and correlated with the OP agent. Customized OP-containing probes have also been used to tag and identify protein targets that can be identified by MS. MS is a useful and emerging tool for the identification of proteins that are modified by activated organophosphate insecticides. MS can characterize the structure of the OP adduct and also the specific amino acid residue that forms the key bond with the OP. Each protein that is modified in a unique way by an OP represents a unique molecular biomarker that with further research can lead to new correlations with exposure.

  6. Insecticides promote viral outbreaks by altering herbivore competition.

    Science.gov (United States)

    Pan, Huipeng; Preisser, Evan L; Chu, Dong; Wang, Shaoli; Wu, Qingjun; Carriére, Yves; Zhou, Xuguo; Zhang, Youjun

    2015-09-01

    While the management of biological invasions is often characterized by a series of single-specieg decisions, invasive species exist within larger food webs. These biotic interactions can alter the impact of control/eradication programs and may cause suppression efforts to inadvertently facilitate invasion spread and impact. We document the rapid replacement of the invasive Bemisia Middle East-Asia Minor I (MEAM1) cryptic biotype by the cryptic Mediterranean (MED) biotype throughout China and demonstrate that MED is more tolerant of insecticides and a better vector of tomato yellow leaf curl virus (TYLCV) than MEAMJ. While MEAM1 usually excludes MED under natural conditions, insecticide application reverses the MEAM1-MED competitive hierarchy and allows MED to exclude MEAMI. The insecticide-mediated success of MED has led to TYLCV outbreaks throughout China. Our work strongly supports the hypothesis that insecticide use in China reverses the MEAMl-MED competitive hierarchy and allows MED to displace MEAM1 in managed landscapes. By promoting the dominance of a Bemisia species that is a competent viral vector, insecticides thus increase the spread and impact of TYLCV in heterogeneous agroecosystems.

  7. The global status of insect resistance to neonicotinoid insecticides.

    Science.gov (United States)

    Bass, Chris; Denholm, Ian; Williamson, Martin S; Nauen, Ralf

    2015-06-01

    The first neonicotinoid insecticide, imidacloprid, was launched in 1991. Today this class of insecticides comprises at least seven major compounds with a market share of more than 25% of total global insecticide sales. Neonicotinoid insecticides are highly selective agonists of insect nicotinic acetylcholine receptors and provide farmers with invaluable, highly effective tools against some of the world's most destructive crop pests. These include sucking pests such as aphids, whiteflies, and planthoppers, and also some coleopteran, dipteran and lepidopteran species. Although many insect species are still successfully controlled by neonicotinoids, their popularity has imposed a mounting selection pressure for resistance, and in several species resistance has now reached levels that compromise the efficacy of these insecticides. Research to understand the molecular basis of neonicotinoid resistance has revealed both target-site and metabolic mechanisms conferring resistance. For target-site resistance, field-evolved mutations have only been characterized in two aphid species. Metabolic resistance appears much more common, with the enhanced expression of one or more cytochrome P450s frequently reported in resistant strains. Despite the current scale of resistance, neonicotinoids remain a major component of many pest control programmes, and resistance management strategies, based on mode of action rotation, are of crucial importance in preventing resistance becoming more widespread. In this review we summarize the current status of neonicotinoid resistance, the biochemical and molecular mechanisms involved, and the implications for resistance management. Copyright © 2015 Elsevier Inc. All rights reserved.

  8. Insecticidal and Nematicidal Activities of Novel Mimosine Derivatives

    Directory of Open Access Journals (Sweden)

    Binh Cao Quan Nguyen

    2015-09-01

    Full Text Available Mimosine, a non-protein amino acid, is found in several tropical and subtropical plants, which has high value for medicine and agricultural chemicals. Here, in continuation of works aimed to development of natural product-based pesticidal agents, we present the first significant findings for insecticidal and nematicidal activities of novel mimosine derivatives. Interestingly, mimosinol and deuterated mimosinol (D-mimosinol from mimosine had strong insecticidal activity which could be a result of tyrosinase inhibition (IC50 = 31.4 and 46.1 μM, respectively. Of synthesized phosphoramidothionate derivatives from two these amino alcohols, two compounds (1a and 1b showed high insecticidal activity (LD50 = 0.5 and 0.7 μg/insect, respectively with 50%–60% mortality at 50 μg/mL which may be attributed to acetylcholinesterase inhibition. Compounds 1a and 1b also had strong nematicidal activity with IC50 = 31.8 and 50.2 μM, respectively. Our results suggest that the length of the alkyl chain and the functional group at the C5-position of phosphoramidothionates derived from mimosinol and d-mimosinol are essential for the insecticidal and nematicidal activities. These results reveal an unexplored scaffold as new insecticide and nematicide.

  9. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal; br, picanco@ufv; br, guedes@ufv; br, mateusc3@yahoo com; br, agronomiasilva@yahoo com

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  10. Plant compounds insecticide activity against Coleoptera pests of stored products

    International Nuclear Information System (INIS)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio; julioufv@yahoo.com.br

    2007-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD 50 from 2.72 to 39.71 mg g -1 a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  11. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  12. Intermediate Syndrome Following Organophosphate Insecticide Poisoning

    Directory of Open Access Journals (Sweden)

    Chen-Chang Yang

    2007-11-01

    Full Text Available Acute organophosphate insecticide poisoning can manifest 3 different phases of toxic effects, namely, acute cholinergic crisis, intermediate syndrome (IMS, and delayed neuropathy. Among them, IMS has been considered as a major contributing factor of organophosphate-related morbidity and mortality because of its frequent occurrence and probable consequence of respiratory failure. Despite a high incidence, the pathophysiology that underlies IMS remains unclear. Previously proposed mechanisms of IMS include different susceptibility of various cholinergic receptors, muscle necrosis, prolonged acetylcholinesterase inhibition, inadequate oxime therapy, downregulation or desensitization of postsynaptic acetylcholine receptors, failure of postsynaptic acetylcholine release, and oxidative stress-related myopathy. The clinical manifestations of IMS typically occur within 24 to 96 hours, affecting conscious patients without cholinergic signs, and involve the muscles of respiration, proximal limb muscles, neck flexors, and muscles innervated by motor cranial nerves. With appropriate therapy that commonly includes artificial respiration, complete recovery develops 5–18 days later. Patients with atypical manifestations of IMS, especially a relapse or a continuum of acute cholinergic crisis, however, were frequently reported in clinical studies of IMS. The treatment of IMS is mainly supportive. Nevertheless, because IMS generally concurs with severe organophosphate toxicity and persistent inhibition of acetylcholinesterase, early aggressive decontamination, appropriate antidotal therapy, and prompt institution of ventilatory support should be helpful in ameliorating the magnitude and/or the incidence of IMS. Although IMS is well recognized as a disorder of neuromuscular junctions, its exact etiology, incidence, and risk factors are not clearly defined because existing studies are largely small-scale case series and do not employ a consistent and rigorous

  13. Influence on sensitivity to insecticides: a case study of a settled area ...

    African Journals Online (AJOL)

    monitoring for successful alternative insecticides. There are currently two ... behaviour or modification avoid landing on insecticide .... aquarium fish food18. When they .... National Statistical Office (NSO) Malawi Government 1998 Census. 16.

  14. Mechanistic modeling of insecticide risks to breeding birds in North American agroecosystems

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of ...

  15. Influence of Pyrethroid Insecticides on Sodium and Calcium Influx in Neocortical Neurons

    Science.gov (United States)

    Pyrethroid insecticides bind to voltage-gated sodium channels and modify their gating kinetics, thereby disrupting neuronal function. Using murine neocortical neurons in primary culture, we have compared the ability of 11 structurally diverse pyrethroid insecticides to evoke Na+ ...

  16. Efficacy of an insecticide paint against insecticide-susceptible and resistant mosquitoes - Part 1: Laboratory evaluation

    Directory of Open Access Journals (Sweden)

    Carnevale Pierre

    2010-11-01

    Full Text Available Abstract Background The main malaria vector Anopheles gambiae and the urban pest nuisance Culex quinquefasciatus are increasingly resistant to pyrethroids in many African countries. There is a need for new products and strategies. Insecticide paint Inesfly 5A IGR™, containing two organophosphates (OPs, chlorpyrifos and diazinon, and insect growth regulator (IGR, pyriproxyfen, was tested under laboratory conditions for 12 months following WHOPES Phase I procedures. Methods Mosquitoes used were laboratory strains of Cx. quinquefasciatus susceptible and resistant to OPs. The paint was applied at two different doses (1 kg/6 m2 and 1 kg/12 m2 on different commonly used surfaces: porous (cement and stucco and non-porous (softwood and hard plastic. Insecticide efficacy was studied in terms of delayed mortality using 30-minute WHO bioassay cones. IGR efficacy on fecundity, fertility and larval development was studied on OP-resistant females exposed for 30 minutes to cement treated and control surfaces. Results After treatment, delayed mortality was high (87-100% even against OP-resistant females on all surfaces except cement treated at 1 kg/12 m2. Remarkably, one year after treatment delayed mortality was 93-100% against OP-resistant females on non-porous surfaces at both doses. On cement, death rates were low 12 months after treatment regardless of the dose and the resistance status. Fecundity, fertility and adult emergence were reduced after treatment even at the lower dose (p -3. A reduction in fecundity was still observed nine months after treatment at both doses (p -3 and adult emergence was reduced at the higher dose (p -3. Conclusions High mortality rates were observed against laboratory strains of the pest mosquito Cx. quinquefasciatus susceptible and resistant to insecticides. Long-term killing remained equally important on non-porous surfaces regardless the resistance status for over 12 months. The paint's effect on fecundity, fertility and

  17. Insecticide Usage and Chemical Contamination Assessment in Asiatic Pennywort

    Science.gov (United States)

    Bumroongsook, S.

    2017-07-01

    The insecticide usage in commercially grown asiatic pennywort plantations in Nakhonpatum and Nonthaburi province, Thailand was surveyed during January-June, 2016. The results showed that asiatic pennywort cuttworms was leaf destructive and caused the most damge to the production. The growers used organophosphate insecticides to control the caterpillars the most, followed by pyrethoid, abamectin, carbamate and organochlorine, respectively. The chemical contaminants of pennywort from 9 fresh markets in Bangkok was monitored, the result indicated that lead was not detected in the samples. The amount of arsenic was less than 0.075 mg / kg. The insecticide residue measurement of dicofol, chlorpyrifos and methidathion was 0.98, 2.84 and 0.46 mg / kg, respectively.

  18. Insecticide resistance in the western flower thrips, Frankliniella occidentalis

    DEFF Research Database (Denmark)

    Jensen, Sten Erik

    of acetylcholinesterase, the target site enzyme for methiocarb. The results from bioassays with synergists included indicated involvement of cytochrome P450- monooxygenases and esterases in methiocarb resistance in the most resistant populations. Selection with methiocarb on one of the populations to increase the level......The western flower thrips, Frankliniella occidentalis (Pergande) is a serious pest on a wide range of crops throughout the world. In Denmark F. occidentalis is a pest in greenhouses. F. occidentalis is difficult to control with insecticides because of its thigmokinetic behaviour and resistance...... to insecticides. Since F. occidentulis spread to become a worldwide pest in 1980’es, resistance to a number of different insecticides has been shown in many populations of F. occidentalis. This flower thrips has the potential of fast development of resistance owing to the short generation time, high fecundity...

  19. Repellent effects of the essential oils of Cymbopogon citratus and Tagetes minuta on the sandfly, Phlebotomus duboscqi.

    Science.gov (United States)

    Kimutai, Albert; Ngeiywa, Moses; Mulaa, Margaret; Njagi, Peter G N; Ingonga, Johnstone; Nyamwamu, Lydia B; Ombati, Cyprian; Ngumbi, Philip

    2017-02-15

    The sandfly, Phlebotomus duboscqi is a vector of zoonotic cutaneous leishmaniasis (ZCL) that is an important public health problem in Eastern Africa. Repellents have been used for protection of humans against vectors of ZCL and other vectors that transmit killer diseases including malaria, Rift Valley fever, dengue, and yellow fever. The repellent effects of different doses of the essential oils from the lemon grass, Cymbopogon citratus and Mexican marigold, Tagetes minuta were evaluated in a two-chamber bioassay against 3- to 7-day-old unfed females of P. duboscqi in the laboratory. The results were compared with those that were obtained when test animals were treated with an equivalent dose of diethyl-3-methylbenzamide, which is a repellent that is commonly used as a positive control. Overall, percentage repellency increased with increasing doses of the essential oils while biting rates decreased with increasing concentrations of the oils. Further, the oil of C. citratus was more potent than that of T. minuta with regard to protection time and biting deterrence. The effective doses at 50% (ED 50 ) and at 90% (ED 90 ) for the oil of C. citratus, were 0.04 and 0.79 mg/ml, respectively. Those of the oil of T. minuta were 0.10 and 12.58 mg/ml. In addition, the percentage repellency of 1 mg/ml of the essential oils of C. citratus and T. minuta against sandflies was 100% and 88.89%, respectively. A lower dose of 0.5 mg/ml of the oils, elicited 89.13% repellency for C. citratus and 52.22% for T. minuta. The laboratory tests showed that the essential oils of the two plants were highly repellent to adult sand flies, P. duboscqi. Thus, the two essential oils are candidate natural repellents that can be used against P. duboscqi due to their high efficacy at very low doses, hence, the envisaged safety in their use over chemical repellents. It remains to carry out clinical studies on human subjects with appropriate formulations of the oils prior to recommending their

  20. POTENTIATION OF COPAÍBA OIL-RESIN WITH SYNTHETIC INSECTICIDES TO CONTROL OF FALL ARMYWORM

    OpenAIRE

    ALMEIDA, WALDIANE ARAÚJO DE; SILVA, IGOR HONORATO LEDUÍNO DA; SANTOS, ANA CLÁUDIA VIEIRA DOS; BARROS JÚNIOR, AURÉLIO PAES; SOUSA, ADALBERTO HIPÓLITO DE

    2017-01-01

    ABSTRACT The control of Spodoptera frugiperda (J. E. SMITH) (Lepidoptera: Noctuidae) has been carried out mainly with pyrethroids and organophosphates insecticides. The continuous and indiscriminate use of synthetic insecticides, for decades, has led to the selection of resistant populations and has caused concerns for human health and the environment. An alternative is the use of botanical insecticides, including through the mixtures with synthetic insecticides. This study aimed to investiga...

  1. Efficacy of Some Wearable Devices Compared with Spray-On Insect Repellents for the Yellow Fever Mosquito, Aedes aegypti (L.) (Diptera: Culicidae).

    Science.gov (United States)

    Rodriguez, Stacy D; Chung, Hae-Na; Gonzales, Kristina K; Vulcan, Julia; Li, Yiyi; Ahumada, Jorge A; Romero, Hector M; De La Torre, Mario; Shu, Fangjun; Hansen, Immo A

    2017-01-01

    The current Zika health crisis in the Americas has created an intense interest in mosquito control methods and products. Mosquito vectors of Zika are of the genus Aedes, mainly the yellow fever mosquito, Aedes aegypti. L. The use of repellents to alter mosquito host seeking behavior is an effective method for the prevention of mosquito-borne diseases. A large number of different spray-on repellents and wearable repellent devices are commercially available. The efficacies of many repellents are unknown. This study focuses on the efficacy of eleven different repellents in reducing the number of Ae. aegypti female mosquitoes attracted to human bait. We performed attraction-inhibition assays using a taxis cage in a wind tunnel setting. One person was placed upwind of the taxis cage and the mosquito movement towards or away from the person was recorded. The person was treated with various spray-on repellents or equipped with different mosquito repellent devices. We found that the spray-on repellents containing N,N-Diethyl-meta-toluamide and p-menthane-3,8-diol had the highest efficacy in repelling mosquitoes compared to repellents with other ingredients. From the five wearable devices that we tested, only the one that releases Metofluthrin significantly reduced the numbers of attracted mosquitoes. The citronella candle had no effect. We conclude that many of the products that we tested that were marketed as repellents do not reduce mosquito attraction to humans. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America.

  2. Chemical composition and repellency of essential oils from four medicinal plants against Ixodes ricinus nymphs (Acari: Ixodidae).

    Science.gov (United States)

    El-Seedi, Hesham R; Khalil, Nasr S; Azeem, Muhammad; Taher, Eman A; Göransson, Ulf; Pålsson, Katinka; Borg-Karlson, Anna-Karin

    2012-09-01

    In our search for effective tick repellents from plant origin, we investigated the effect of essential oils of four medicinal and culinary plants belonging to the family Lamiaceae on nymphs of the tick Ixodes ricinus (L.). The essential oils of the dry leaves of Rosmarinus officinalis (Rosemary) (L.), Mentha spicata (Spearmint) (L.), Origanum majorana (Majoram) (L.), and Ocimum basilicum (Basil) (L.) were isolated by steam distillation and 15 microg/cm2 concentration of oils was tested against ticks in a laboratory bioassay. The oils of R. officinalis, M. spicata, and O. majorana showed strong repellency against the ticks 100, 93.2, and 84.3%, respectively, whereas O. basilicum only showed 64.5% repellency. When tested in the field, the oils of R. officinalis and M. spicata showed 68.3 and 59.4% repellency at a concentration of 6.5 microg/cm2 on the test cloths. The oils were analyzed by gas chromatography mass spectrometry and the major compounds from the most repellent oils were 1,8-cineole, camphor, linalool, 4-terpineol, borneol, and carvone.

  3. Laboratory and field evaluation of the impact of exercise on the performance of regular and polymer-based deet repellents.

    Science.gov (United States)

    Schofield, Steven; Tepper, Martin; Gadawski, Randy

    2007-11-01

    Studies were done in Manitoba, Canada, to evaluate the impact of exercise on repellent performance against mosquitoes. Two products containing the active ingredient N,N-diethyl-3-methylbenzamide (deet) were tested; one product was a polymer-based cream (3M Ultrathon Insect Repellent) and the other product was an alcohol-based pump spray formulation (Muskol Insect Repellent). Assessments were done in the laboratory using Aedes aegypti (L.) and in the field with naturally occurring populations of mosquitoes. Repellent was applied to the forearms (laboratory) or a lower leg (field) of test subjects at 1.5 g of test product per 600 cm2 surface area (0.75 or 0.83 mg deet/cm2). For a given test day, subjects exercised or did not. Exposure to mosquito attack was for 1 min at 30-min intervals in laboratory procedures, and it was continuous in field tests. Performance was measured as complete protection time (CPT). Moderate levels of physical activity resulted in a >40% decline in mean CPT, from 468 to 267 min in the laboratory experiments and from 359 to 203 min in field tests. Repellent product did not affect the magnitude of the decline. Mean biting pressure during field trials was 21.3 bites per min, and mosquito collections were made up primarily of Ochlerotatus sticticus (Meigen) and Aedes vexans (Meigen).

  4. Optimal Cotton Insecticide Application Termination Timing: A Meta-Analysis.

    Science.gov (United States)

    Griffin, T W; Zapata, S D

    2016-08-01

    The concept of insecticide termination timing is generally accepted among cotton (Gossypium hirsutum) researchers; however, exact timings are often disputed. Specifically, there is uncertainty regarding the last economic insecticide application to control fruit-feeding pests including tarnished plant bug (Lygus lineolaris (Palisot de Beauvois)), boll weevil (Anthonomus grandis), bollworm (Helicoverpa zea), tobacco budworm (Heliothis virescens), and cotton fleahopper (Pseudatomoscelis seriatus). A systematic review of prior studies was conducted within a meta-analytic framework. Nine publicly available articles were amalgamated to develop an optimal timing principle. These prior studies reported 53 independent multiple means comparison field experiments for a total of 247 trial observations. Stochastic plateau theory integrated with econometric meta-analysis methodology was applied to the meta-database to determine the shape of the functional form of both the agronomic optimal insecticide termination timing and corresponding yield potential. Results indicated that current university insecticide termination timing recommendations are later than overall estimated timing suggested. The estimated 159 heat units (HU) after the fifth position above white flower (NAWF5) was found to be statistically different than the 194 HU termination used as the status quo recommended termination timing. Insecticides applied after 159 HU may have been applied in excess, resulting in unnecessary economic and environmental costs. Empirical results also suggested that extending the insecticide termination time by one unit resulted in a cotton lint yield increase of 0.27 kilograms per hectare up to the timing where the plateau began. Based on economic analyses, profit-maximizing producers may cease application as soon as 124 HU after NAWF5. These results provided insights useful to improve production systems by applying inputs only when benefits were expected to be in excess of the

  5. Insecticide resistance in vector Chagas disease: evolution, mechanisms and management.

    Science.gov (United States)

    Mougabure-Cueto, Gastón; Picollo, María Inés

    2015-09-01

    Chagas disease is a chronic parasitic infection restricted to America. The disease is caused by the protozoa Trypanosoma cruzi, which is transmitted to human through the feces of infected triatomine insects. Because no treatment is available for the chronic forms of the disease, vector chemical control represents the best way to reduce the incidence of the disease. Chemical control has been based principally on spraying dwellings with insecticide formulations and led to the reduction of triatomine distribution and consequent interruption of disease transmission in several areas from endemic region. However, in the last decade it has been repeatedly reported the presence triatomnes, mainly Triatoma infestans, after spraying with pyrethroid insecticides, which was associated to evolution to insecticide resistance. In this paper the evolution of insecticide resistance in triatomines is reviewed. The insecticide resistance was detected in 1970s in Rhodnius prolixus and 1990s in R. prolixus and T. infestans, but not until the 2000s resistance to pyrthroids in T. infestans associated to control failures was described in Argentina and Bolivia. The main resistance mechanisms (i.e. enhanced metabolism, altered site of action and reduced penetration) were described in the T. infestans resistant to pyrethrods. Different resistant profiles were demonstrated suggesting independent origin of the different resistant foci of Argentina and Bolivia. The deltamethrin resistance in T. infestans was showed to be controlled by semi-dominant, autosomally inherited factors. Reproductive and developmental costs were also demonstrated for the resistant T. infestans. A discussion about resistance and tolerance concepts and the persistence of T. infestans in Gran Chaco region are presented. In addition, theoretical concepts related to toxicological, evolutionary and ecological aspects of insecticide resistance are discussed in order to understand the particular scenario of pyrethroid

  6. Correlation of lipophilicity with mosquito larvicidal and repellent activities of novel trifluoromethylphenyl amides

    Science.gov (United States)

    For a chemical to have a biological impact on an organism, the molecules must be capable of being transported across the membranes of cells. Lipophilic insecticides that can pass through lipid bilayers and penetrate the insect cuticle can lead to rapid intoxication or mortality by acting on the nerv...

  7. Field and Laboratory Evaluations of Insecticides for Southern Pine Beetle Control

    Science.gov (United States)

    Felton L. Hastings; Jack E. Coster; [Editors

    1981-01-01

    Reports results of laboratory screenings and field studies of insecticides for use against the southern pine beetle. Preventive as webas remedial efficacywere observed, along with phytotoxicity to pine and understory hardwood species, effects of insecticides on soil microbial and mesofaunal populations, and degradation of insecticides by selected soil microbes.

  8. Pollution Of Insecticide Residues In PPTN Pasar Jumat Area

    International Nuclear Information System (INIS)

    Syahrir, Ulfa T.; Chairul, Sofnie M.

    2000-01-01

    Measurement of insecticide residue pollution from some organochlorin and organo-phosphat in soil and water samples were carried out 1999-2000 periode. The aim of the measurement was to get information about impact of laboratorium activity on insecticide contents in PPTN PASAR JUMAT. Gas chromatograph with electron capture and flame ionization detector were used to measure the pesticide content. Result of the measurement in PPTN area showed that organo-chlorin were alpha BHC, endosulfan band DDT and organo-phosphat were klorphyriphos and malation and were lower than tolerance level

  9. Characterizing the insecticide resistance of Anopheles gambiae in Mali.

    Science.gov (United States)

    Cisse, Moussa B M; Keita, Chitan; Dicko, Abdourhamane; Dengela, Dereje; Coleman, Jane; Lucas, Bradford; Mihigo, Jules; Sadou, Aboubacar; Belemvire, Allison; George, Kristen; Fornadel, Christen; Beach, Raymond

    2015-08-22

    The impact of indoor residual spraying (IRS) and long-lasting insecticide nets (LLINs), key components of the national malaria control strategy of Mali, is threatened by vector insecticide resistance. The objective of this study was to assess the level of insecticide resistance in Anopheles gambiae sensu lato populations from Mali against four classes of insecticide recommended for IRS: organochlorines (OCs), pyrethroids (PYs), carbamates (CAs) and organophosphates (OPs). Characterization of resistance was done in 13 sites across southern Mali and assessed presence and distribution of physiological mechanisms that included target-site modifications: knockdown resistance (kdr) and altered acetycholinesterase (AChE), and/or metabolic mechanisms: elevated esterases, glutathione S-transferases (GSTs), and monooxygenases. The World Health Organization (WHO) tube test was used to determine phenotypic resistance of An. gambiae s.l. to: dichlorodiphenyltrichloroethane (DDT) (OC), deltamethrin (PY), lambda-cyhalothrin (PY), bendiocarb (CA), and fenitrothion (OP). Identification of sibling species and presence of the ace-1 (R) and Leu-Phe kdr, resistance-associated mutations, were determined using polymerase chain reaction (PCR) technology. Biochemical assays were conducted to detect increased activity of GSTs, oxidases and esterases. Populations tested showed high levels of resistance to DDT in all 13 sites, as well as increased resistance to deltamethrin and lambda-cyhalothrin in 12 out of 13 sites. Resistance to fenitrothion and bendiocarb was detected in 1 and 4 out of 13 sites, respectively. Anopheles coluzzii, An. gambiae sensu stricto and Anopheles arabiensis were identified with high allelic frequencies of kdr in all sites where each of the species were found (13, 12 and 10 sites, respectively). Relatively low allelic frequencies of ace-1 (R) were detected in four sites where this assessment was conducted. Evidence of elevated insecticide metabolism, based on oxidase

  10. Insecticide applications to soil contribute to the development of Burkholderia mediating insecticide resistance in stinkbugs.

    Science.gov (United States)

    Tago, Kanako; Kikuchi, Yoshitomo; Nakaoka, Sinji; Katsuyama, Chie; Hayatsu, Masahito

    2015-07-01

    Some soil Burkholderia strains are capable of degrading the organophosphorus insecticide, fenitrothion, and establish symbiosis with stinkbugs, making the host insects fenitrothion-resistant. However, the ecology of the symbiotic degrading Burkholderia adapting to fenitrothion in the free-living environment is unknown. We hypothesized that fenitrothion applications affect the dynamics of fenitrothion-degrading Burkholderia, thereby controlling the transmission of symbiotic degrading Burkholderia from the soil to stinkbugs. We investigated changes in the density and diversity of culturable Burkholderia (i.e. symbiotic and nonsymbiotic fenitrothion degraders and nondegraders) in fenitrothion-treated soil using microcosms. During the incubation with five applications of pesticide, the density of the degraders increased from less than the detection limit to around 10(6)/g of soil. The number of dominant species among the degraders declined with the increasing density of degraders; eventually, one species predominated. This process can be explained according to the competitive exclusion principle using V(max) and K(m) values for fenitrothion metabolism by the degraders. We performed a phylogenetic analysis of representative strains isolated from the microcosms and evaluated their ability to establish symbiosis with the stinkbug Riptortus pedestris. The strains that established symbiosis with R. pedestris were assigned to a cluster including symbionts commonly isolated from stinkbugs. The strains outside the cluster could not necessarily associate with the host. The degraders in the cluster predominated during the initial phase of degrader dynamics in the soil. Therefore, only a few applications of fenitrothion could allow symbiotic degraders to associate with their hosts and may cause the emergence of symbiont-mediated insecticide resistance. © 2015 John Wiley & Sons Ltd.

  11. orco mutant mosquitoes lose strong preference for humans and are not repelled by volatile DEET.

    Science.gov (United States)

    DeGennaro, Matthew; McBride, Carolyn S; Seeholzer, Laura; Nakagawa, Takao; Dennis, Emily J; Goldman, Chloe; Jasinskiene, Nijole; James, Anthony A; Vosshall, Leslie B

    2013-06-27

    Female mosquitoes of some species are generalists and will blood-feed on a variety of vertebrate hosts, whereas others display marked host preference. Anopheles gambiae and Aedes aegypti have evolved a strong preference for humans, making them dangerously efficient vectors of malaria and Dengue haemorrhagic fever. Specific host odours probably drive this strong preference because other attractive cues, including body heat and exhaled carbon dioxide (CO2), are common to all warm-blooded hosts. Insects sense odours via several chemosensory receptor families, including the odorant receptors (ORs), membrane proteins that form heteromeric odour-gated ion channels comprising a variable ligand-selective subunit and an obligate co-receptor called Orco (ref. 6). Here we use zinc-finger nucleases to generate targeted mutations in the orco gene of A. aegypti to examine the contribution of Orco and the odorant receptor pathway to mosquito host selection and sensitivity to the insect repellent DEET (N,N-diethyl-meta-toluamide). orco mutant olfactory sensory neurons have greatly reduced spontaneous activity and lack odour-evoked responses. Behaviourally, orco mutant mosquitoes have severely reduced attraction to honey, an odour cue related to floral nectar, and do not respond to human scent in the absence of CO2. However, in the presence of CO2, female orco mutant mosquitoes retain strong attraction to both human and animal hosts, but no longer strongly prefer humans. orco mutant females are attracted to human hosts even in the presence of DEET, but are repelled upon contact, indicating that olfactory- and contact-mediated effects of DEET are mechanistically distinct. We conclude that the odorant receptor pathway is crucial for an anthropophilic vector mosquito to discriminate human from non-human hosts and to be effectively repelled by volatile DEET.

  12. Greek Pinus essential oils: larvicidal activity and repellency against Aedes albopictus (Diptera: Culicidae).

    Science.gov (United States)

    Koutsaviti, Katerina; Giatropoulos, Athanassios; Pitarokili, Danae; Papachristos, Dimitrios; Michaelakis, Antonios; Tzakou, Olga

    2015-02-01

    The needle volatiles metabolites of seven Pinus spp.: Pinus nigra (3 samples), Pinus stankewiczii, Pinus brutia, Pinus halepensis, Pinus canariensis, Pinus pinaster and Pinus strobus from Greece were determined by gas chromatography and gas chromatography-mass spectrometry. P. nigra and P. canariensis essential oils were dominated by α-pinene (24.9-28.9 % and 15 %, respectively) and germacrene D (20.3-31.9 % and 55.8 %, respectively), whereas P. brutia and P. strobus by α-pinene (20.6 % and 31.4 %, respectively) and β-pinene (31.7 % and 33.6 %, respectively). P. halepensis and P. pinaster oils were characterized by β-caryophyllene (28.5 % and 22.5 %, respectively). Finally, β-pinene (31.4 %), germacrene D (23.3 %) and α-pinene (17.5 %) were the most abundant compounds in the needle oil of P. stankewiczii. Additionally the larvicidal and repellent properties of their essential oils were evaluated against Aedes albopictus, a mosquito of great ecological and medical importance. The results of bioassays revealed that repellent abilities of the tested essential oils were more potent than their larvicidal activities. The essential oils of P. brutia, P. halepensis and P. stankewiczii presented considerable larvicidal activity (LC50 values 67.04 mgL(-1) and 70.21 mgL(-1), respectively), while the others were weak to inactive against larvae. The essential oils of P. halepensis, P. brutia, and P. stankewiczii presented a high repellent activity, even at the dose of 0.2 μL cm(-2), while in the dose of 0.4 μL cm(-2), almost all the tested EOs displayed protection against the mosquito.

  13. Consolidating and water repellent treatments applied to wet and salt contaminated granite

    Directory of Open Access Journals (Sweden)

    Silva, B.

    2000-03-01

    Full Text Available A comparison was made of the efficacy of two consolidants and two water repellents applied to samples of granite under optimum conditions, with the efficacy of the same products applied to the granite in the presence of soluble salts or water. The amount of product absorbed and the amount of dry polymer remaining after treatment were compared. The results show that the presence of water and soluble salts in the stone significantly modifies the consumption of the products (in particular the water repellents and also the level of dry polymer retained. The water repellents were found to be much less effective when the substrate contained salts, whereas the presence of water did not appear to influence their efficacy. The lack of correlation between uptake, active dry polymer, and efficacy led to the conclusion that the presence of salts or water markedly changes the kinetics of the polymerization of the products.

    Se analiza la eficacia de dos consolidantes y dos hidrofugantes aplicados a rocas graníticas en condiciones óptimas comparativamente a la eficacia de los mismos productos aplicados sobre los mismos sustratos conteniendo cierta cantidad de sales solubles o de agua. Se compara la cantidad de producto absorbido y la cantidad de materia seca presente tras el curado. Los resultados indican que la presencia de agua y de sales solubles en la piedra modifica significativamente el consumo de los productos, sobre todo el de los hidrofugantes, así como la cantidad de materia seca. Se observa, asimismo, un fuerte detrimento en la eficacia de los hidrofugantes cuando el sustrato contiene sales mientras que, al contrario, la presencia de agua no parece infiuir en dicha eficacia. La falta de correlación entre el consumo, materia seca activa y eficacia lleva a concluir que la presencia de sales o agua modifica sensiblemente la cinética de la polimeración de los productos.

  14. Higher glandular trichome density in tomato leaflets and repellence to spider mites Alta densidade de tricomas glandulares em tomateiro e aumento da repelência a ácaros rajados

    Directory of Open Access Journals (Sweden)

    Wilson Roberto Maluf

    2007-09-01

    Full Text Available The objective of this work was to evaluate the feasibility of selection for higher glandular trichome densities, as an indirect criterion of selection for increasing repellence to spider mites Tetranychus urticae, in tomato populations derived from an interspecific cross between Lycopersicon esculentum x L. hirsutum var. glabratum PI 134417. Trichome densities were evaluated in 19 genotypes, including 12 from advanced backcross populations, derived from the original cross L. esculentum x L. hirsutum var. glabratum PI 134417. Counts were made both on the adaxial and abaxial leaf surfaces, and trichomes were classified into glandular types IV and VI, other glandular types (types I+VII, and nonglandular types. Mite repellence was measured by distances walked by mites onto the tomato leaf surface after 20, 40 and 60 min. Spider mite repellence biotests indicated that higher densities of glandular trichomes (especially type VI decreased the distances walked by the mites onto the tomato leaf surface. Selection of plants with higher densities of glandular trichomes can be an efficient criterion to obtain tomato genotypes with higher resistance (repellence to spider mites.O objetivo deste trabalho foi avaliar a eficiência da seleção para maior densidade de tricomas glandulares na resistência (repelência ao ácaro Tetranychus urticae, em populações de tomate derivadas do cruzamento interespecífico Lycopersicon esculentum x L. hirsutum var. glabratum PI 134417. Foram avaliados 19 genótipos quanto à densidade de tricomas, que incluíram 12 derivados de populações avançadas de retrocruzamentos, obtidos a partir do cruzamento original L. esculentum x L. hirsutum var. glabratum PI 134417. Nas faces abaxial e adaxial dos folíolos, realizaram-se as contagens e os tricomas foram classificados em glandulares tipo IV e VI, outros glandulares (tipo I e VII e não glandulares. A repelência aos ácaros foi medida pela distância média, percorrida pelo

  15. Repellent activity of desiccant dusts and conidia of the entomopathogenic fungus Beauveria bassiana when tested against poultry red mites (Dermanyssus gallinae) in laboratory experiments

    DEFF Research Database (Denmark)

    Kilpinen, Ole; Steenberg, Tove

    2016-01-01

    on both dose and relative humidity (RH). However, one desiccant dust was significantly less repellent compared to other dusts with similar levels of efficacy. Further, dry conidia of the fungus Beauveria bassiana were also shown to be repellent to poultry red mites, both when applied on its own and when...

  16. Chemosensory responses to the repellent nepeta essential oil and its major component nepetalactone by the yellow fever mosquito, aedes aegypti, a vector of zika virus

    Science.gov (United States)

    Nepeta essential oil (Neo) (catnip) and its major component, nepetalactone, have long been known to repel insects including mosquitoes. However, the neural mechanisms through which these repellents are detected by mosquitoes, including the yellow fever mosquito Aedes aegypti, an important vector of...

  17. Near-surface distributions of soil water and water repellency under three effluent irrigation scemes in a blue gum (Eucalyptus globulus) plantation

    NARCIS (Netherlands)

    Thwaites, L.A.; Rooij, de G.H.; Salzman, S.; Allinson, G.; Stagnitti, F.; Carr, R.; Versace, V.; Struck, S.; March, T.

    2006-01-01

    Water repellent soils are difficult to irrigate and susceptible to preferential flow, which enhances the potential for accelerated leaching to groundwater of hazardous substances. Over 5 Mha of Australian soil is water repellent, while treated municipal sewage is increasingly used for irrigation.

  18. DEET, Active Substance Of Repellent That Effective And Safe For Travelers

    Directory of Open Access Journals (Sweden)

    Made Ika Lestari

    2013-10-01

    Full Text Available Normal 0 false false false EN-US X-NONE X-NONE Increased flow of tourism to the tropics and the changing patterns of vector-borne diseases require increased protection against insects. To prevent transmission of the disease is done several ways that increase self-protection by using mosquito repellent can protect travelers while outdoor activities. One option is active formula mosquito repellent DEET. The purpose of this paper is to determine the best dosage forms for travelers DEET., To determine the effectiveness and safety of DEET and to know the workings of the active ingredient DEET. The method of writing is the literature search through medical journals and articles. From the search was obtained, the most appropriate anti-mosquito travelers to use while on the move outdoors in the dosage form is DEET lotion applied to the skin as the most secure and durable because it does not easily evaporate. Mosquito repellent containing DEET has been proven effective and safe for use in adults, children, and pregnant women, but should still follow the instructions. The workings of the mosquito repellent DEET mosquito dispel is manipulating 1-Octen-3-ol used by mosquitoes to detect human presence. So ORN (olfactory receptor neurons in the mosquitoes can not respond anymore to the maximum, so that people avoid the bites nyamuk. /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New

  19. Wet-dry cycles effect on ash water repellency. A laboratory experiment.

    Science.gov (United States)

    Pereira, Paulo; Cerdà, Artemi; Oliva, Marc; Mataix, Jorge; Jordán, Antonio

    2014-05-01

    In the immediate period after the fire, the ash layer has a strong influence on soil hydrological processes, as runoff, infiltration and erosion. Ash is very dynamic in the space and time. Until the first rainfall periods, ash is (re)distributed by the wind. After it can cover the soil surface, infiltrate or transported to other areas by water transport (Pereira et al., 2013a, b). This will have strong implications on nutrient redistribution and vegetation recovery. Ash layer may affect soil water repellency in different ways, depending on fire severity, soil properties and vegetation. Ash produced at low temperatures after low-severity burning is usually hydrophobic (Bodi et al., 2011, 2012). Wet-dry cycles have implications on ash physical and chemical properties, changing their effects in space and time. The aim of this study is to analyse the effects of fire temperature and severity on ash water repellency. Pinus sylvestris needles were collected in a Lithuania forest in Dzukija National Park (53º 54' N and 24º 22' E), transported to laboratory and washed with deionized water to remove soil particles and other residues. Needle samples were dried during 24 hours and exposed to different temperatures: 200, 300, 400 and 500 ºC, during 2 hours. Ash colour was analysed according to the Munsell Soil Color charts. Ash was black (10 YR 2/1) at 200 ºC, very dark grey (10YR 3/1) at 300 ºC, gray (10YR 5/1) at 400 ºC and light gray (10YR 7/1) at 500 ºC. Ten samples of ash released after each treatment were placed in plastic dishes (50 mm in diameter) in an amount enough to form a 5 mm thick layer, and ash water repellency was measured according to the Water Drop Penetration Test. Later, ash was carefully wetted with 15 ml of deionized water and placed in an oven during 4 days (96 hours), as in Bodí et al. (2012). This procedure was repeated 5 times in order to observe the effects of wet-dry cycles in ash water repellency. The results showed significant differences

  20. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth.

    Science.gov (United States)

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-02-19

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments.

  1. Influence of Long-term Application of Feedlot Manure Amendments on Water Repellency of a Clay Loam Soil.

    Science.gov (United States)

    Miller, Jim J; Beasley, Bruce W; Hazendonk, Paul; Drury, Craig F; Chanasyk, David S

    2017-05-01

    Long-term application of feedlot manure to cropland may increase the quantity of soil organic carbon (C) and change its quality, which may influence soil water repellency. The objective was to determine the influence of feedlot manure type (stockpiled vs. composted), bedding material (straw [ST] vs. woodchips [WD]), and application rate (13, 39, or 77 Mg ha) on repellency of a clay loam soil after 17 annual applications. The repellency was determined on all 14 treatments using the water repellency index ( index), the water drop penetration time (WDPT) method, and molarity of ethanol (MED) test. The C composition of particulate organic matter in soil of five selected treatments after 16 annual applications was also determined using C nuclear magnetic resonance-direct polarization with magic-angle spinning (NMR-DPMAS). Manure type had no significant ( > 0.05) effect on index and WDPT, and MED classification was similar. Mean index and WDPT values were significantly greater and MED classification more hydrophobic for WD than ST. Application rate had no effect on the index, but WDPT was significantly greater and MED classification more hydrophobic with increasing application rate. Strong ( > 0.7) but nonsignificant positive correlations were found between index and WDPT versus hydrophobic (alkyl + aromatic) C, lignin at 74 ppm (O-alkyl), and unspecified aromatic compounds at 144 ppm. Specific aromatic compounds also contributed more to repellency than alkyl, O-alkyl, and carbonyl compounds. Overall, all three methods consistently showed that repellency was greater for WD- than ST-amended clay loam soil, but manure type had no effect. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

  2. 'Natural background' soil water repellency in conifer forests of the north-western USA: Its prediction and relationship to wildfire occurrence

    Science.gov (United States)

    Doerr, S.H.; Woods, S.W.; Martin, D.A.; Casimiro, M.

    2009-01-01

    Soils under a wide range of vegetation types exhibit water repellency following the passage of a fire. This is viewed by many as one of the main causes for accelerated post-fire runoff and soil erosion and it has often been assumed that strong soil water repellency present after wildfire is fire-induced. However, high levels of repellency have also been reported under vegetation types not affected by fire, and the question arises to what degree the water repellency observed at burnt sites actually results from fire. This study aimed at determining 'natural background' water repellency in common coniferous forest types in the north-western USA. Mature or semi-mature coniferous forest sites (n = 81), which showed no evidence of recent fires and had at least some needle cast cover, were sampled across six states. After careful removal of litter and duff at each site, soil water repellency was examined in situ at the mineral soil surface using the Water Drop Penetration Time (WDPT) method for three sub-sites, followed by collecting near-surface mineral soil layer samples (0-3 cm depth). Following air-drying, samples were further analyzed for repellency using WDPT and contact angle (??sl) measurements. Amongst other variables examined were dominant tree type, ground vegetation, litter and duff layer depth, slope angle and aspect, elevation, geology, and soil texture, organic carbon content and pH. 'Natural background' water repellency (WDPT > 5 s) was detected in situ and on air-dry samples at 75% of all sites examined irrespective of dominant tree species (Pinus ponderosa, Pinus contorta, Picea engelmanii and Pseudotsuga menziesii). These findings demonstrate that the soil water repellency commonly observed in these forest types following burning is not necessarily the result of recent fire but can instead be a natural characteristic. The notion of a low background water repellency being typical for long-unburnt conifer forest soils of the north-western USA is

  3. Experimental use of two standard tick collection methods to evaluate the relative effectiveness of several plant-derived and synthetic repellents against Ixodes scapularis and Amblyomma americanum (Acari: Ixodidae).

    Science.gov (United States)

    Schulze, Terry L; Jordan, Robert A; Dolan, Marc C

    2011-12-01

    We used two standard tick collection methods to test the relative effectiveness of two natural product compounds (nootkatone and carvacrol, classified as an eremophilene sesquiterpene and a monoterpene, respectively, that are derived from botanical sources) with commercially-available plant-derived (EcoSMART Organic Insect Repellent, comprised of plant essential oils) and permethrin-based (Repel Permanone) repellents against Ixodes scapularis Say and Amblyomma americanum (L.). Cloth drags were equally effective in sampling both species of host-seeking nymphs, whereas CO, traps attracted primarily A. americanum. All four repellents performed well on drags, with nootkatone and Permanone Repel (100% repelled through 14 d) slightly more effective than carvacrol and EcoSMART (90.7% and 97.7% repelled at 14 d, respectively) at repelling I. scapularis nymphs. Although the same trend in percent repellency was noted in the CO2 trap trial against both A. americanum nymphs and adults, EcoSMART outperformed Permanone in repelling A. Americanum nymphs after 14 d in the drag trial. Generally, the effectiveness of all repellents tested declined over time. The use of tick drags and CO2 traps was rapid, inexpensive, and easy to use in determining the relative effectiveness of repellents in the field.

  4. Role of cytochrome P450s in insecticide resistance: impact on the control of mosquito-borne diseases and use of insecticides on Earth

    OpenAIRE

    David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham

    2013-01-01

    The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementat...

  5. Insecticidal Potential of an Orally Administered Metabolic Extract of ...

    African Journals Online (AJOL)

    The insecticidal activity of Aspergillus niger IHCS-4 metabolic extract against Chrysomya chloropyga larvae was examined in vitro. The toxicity test revealed that 0.04 mg/g and 0.08 mg/g extract concentration significantly (P>0.05) affected the insect larvae, inducing 20% and 65% mortality respectively, within 24 hours.

  6. Effectiveness of plant based insecticides as a sustainable means of ...

    African Journals Online (AJOL)

    Cucumber (Cucumis sativus) is an important crop in Pakistan. It is affected by many biotic and abiotic factors. Among these, Cucumber mosaic virus is the important disease with economic losses. The purpose of this study was to evaluate the effectiveness of plant based insecticides as a sustainable means to control the ...

  7. Studies .on the efficacy of some biorational insecticides against the ...

    African Journals Online (AJOL)

    W. Tin znara*, C. Na11kinga, l Kashaija & W. Tu.vhemereirwe ... Biorat!onal insecticides obtained from tobacco, ash, urine, pepper and a concoction (mixture) were ... Cultural control ... single components were made by adding I 00 ml of tap.

  8. Risk of transmission of viral haemorrhagic fevers and the insecticide ...

    African Journals Online (AJOL)

    ... of transmission of viral haemorrhagic fevers and the insecticide susceptibility status of Ae. aegypti in some sites in Accra, Ghana. Design: Larval surveys were carried to inspect containers within households and estimate larval indices and adult Aedes mosquitoes were collected using human landing collection technique.

  9. The comparative insecticidal and residual efficacy of sniper and ...

    African Journals Online (AJOL)

    Otoigiakih

    Chemical control is still the main approach for urban pest control (Castle et al., 1999; Rozendaal, 1997; Marrs,. 1993; Lee and Yap, 2003; Tidwell et al., 1994). The use of insecticides is seen as the most effective tool in cockroach control program (WHO, 1996; Chavasse and. Yap, 1997; Lee and Yap, 2003; Tidwell et al., ...

  10. Susceptibility of Adult Mosquitoes to Insecticides in Aqueous Sucrose Baits

    Science.gov (United States)

    2011-06-01

    Lee, and A.H. Azahari. 2005. Adult and larval insecticide susceptibility status of Culex quinquefasciatus (Say) mosquitoes in Kuala Lumpur Malaysia ...Trop. Biomed. 22: 63-68. Nayar, J.K. and D.M. Sauerman, Jr. 1971. The effects of diet on life-span, fecundity and flight potential of Aedes

  11. Efficacy of some synthetic insecticides for control of cotton bollworms ...

    African Journals Online (AJOL)

    ... and Betsulfan at 3.2 l ha-1 recorded the highest and lowest yields, respectively. For effective control of cotton bollworms for maximum yield in the ecology, Thionex applied at 2.8 l ha-1 is recommended. Keywords: Control, cotton bollworms, efficacy, Ghana, synthetic insecticides. African Crop Science Journal, Vol. 20, No.

  12. Insecticide use and practices among cotton farmers in northern ...

    African Journals Online (AJOL)

    Cotton (Gossypium hirsutum L.) is an important cash crop in Uganda. Insecticide application practices among cotton growers in northern Uganda were examined to determine the pests targeted and the compliance of control measures with the standards recommended by the Uganda's Cotton Development Organization ...

  13. Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

    Energy Technology Data Exchange (ETDEWEB)

    Weston, D.P., E-mail: dweston@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Asbell, A.M., E-mail: aasbell@berkeley.edu [Department of Integrative Biology, University of California, 3060 Valley Life Sciences Bldg., Berkeley, CA 94720-3140 (United States); Hecht, S.A., E-mail: scott.hecht@noaa.gov [NOAA Fisheries, Office of Protected Resources, 510 Desmond Drive S.E., Lacey, WA 98503 (United States); Scholz, N.L., E-mail: nathaniel.scholz@noaa.gov [NOAA Fisheries, Northwest Fisheries Science Center, 2725 Montlake Blvd. E., Seattle, WA 98112 (United States); Lydy, M.J., E-mail: mlydy@siu.edu [Fisheries and Illinois Aquaculture Center and Department of Zoology, Southern Illinois University, 171 Life Sciences II, Carbondale, IL 62901 (United States)

    2011-10-15

    Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: > Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. > Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. > Two creeks contained concentrations acutely lethal to sensitive invertebrates. > Bifenthrin was of greatest concern, though less than in prior studies. > Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

  14. Pyrethroid insecticides in urban salmon streams of the Pacific Northwest

    International Nuclear Information System (INIS)

    Weston, D.P.; Asbell, A.M.; Hecht, S.A.; Scholz, N.L.; Lydy, M.J.

    2011-01-01

    Urban streams of the Pacific Northwest provide spawning and rearing habitat for a variety of salmon species, and food availability for developing salmon could be adversely affected by pesticide residues in these waterbodies. Sediments from Oregon and Washington streams were sampled to determine if current-use pyrethroid insecticides from residential neighborhoods were reaching aquatic habitats, and if they were at concentrations acutely toxic to sensitive invertebrates. Approximately one-third of the 35 sediment samples contained measurable pyrethroids. Bifenthrin was the pyrethroid of greatest concern with regards to aquatic life toxicity, consistent with prior studies elsewhere. Toxicity to Hyalella azteca and/or Chironomus dilutus was found in two sediment samples at standard testing temperature (23 deg. C), and in one additional sample at a more environmentally realistic temperature (13 deg. C). Given the temperature dependency of pyrethroid toxicity, low temperatures typical of northwest streams can increase the potential for toxicity above that indicated by standard testing protocols. - Highlights: → Salmon-bearing creeks can be adversely impacted by insecticides from urban runoff. → Pyrethroid insecticides were found in one-third of the creeks in Washington and Oregon. → Two creeks contained concentrations acutely lethal to sensitive invertebrates. → Bifenthrin was of greatest concern, though less than in prior studies. → Standard toxicity testing underestimates the ecological risk of pyrethroids. - Pyrethroid insecticides are present in sediments of urban creeks of Oregon and Washington, though less commonly than in studies elsewhere in the U.S.

  15. Metaflumizone is a novel sodium channel blocker insecticide.

    Science.gov (United States)

    Salgado, V L; Hayashi, J H

    2007-12-15

    Metaflumizone is a novel semicarbazone insecticide, derived chemically from the pyrazoline sodium channel blocker insecticides (SCBIs) discovered at Philips-Duphar in the early 1970s, but with greatly improved mammalian safety. This paper describes studies confirming that the insecticidal action of metaflumizone is due to the state-dependent blockage of sodium channels. Larvae of the moth Spodoptera eridania injected with metaflumizone became paralyzed, concomitant with blockage of all nerve activity. Furthermore, tonic firing of abdominal stretch receptor organs from Spodoptera frugiperda was blocked by metaflumizone applied in the bath, consistent with the block of voltage-dependent sodium channels. Studies on native sodium channels, in primary-cultured neurons isolated from the CNS of the larvae of the moth Manduca sexta and on Para/TipE sodium channels heterologously expressed in Xenopus (African clawed frog) oocytes, confirmed that metaflumizone blocks sodium channels by binding selectively to the slow-inactivated state, which is characteristic of the SCBIs. The results confirm that metaflumizone is a novel sodium channel blocker insecticide.

  16. Insecticide resistance testing in malaria vectors in Tanzania ...

    African Journals Online (AJOL)

    mosquito survived much better and the scientists had a total of 467 mosquitoes to run the insecticide susceptibility tests. Innovative ways are necessary under field conditions for mosquito breeding in susceptibility studies. Key words: Malaria, Anopheles gambiae complex, larvae, fabric, resistance, susceptibility, Tanzania.

  17. Effective utilization period of long-lasting insecticide treated nets ...

    African Journals Online (AJOL)

    The study was conducted to evaluate the bioefficacy of long-lasting insecticide treated nets (LLITNs) (PermaNet®2.0) over time and the species composition of Anopheles mosquitoes around Bahir Dar. The space spray collection method was used to determine the species composition of indoor resting Anopheles ...

  18. Insecticide resistance and glutathione S-transferases in mosquitoes ...

    African Journals Online (AJOL)

    Mosquito glutathione S-transferases (GSTs) have received considerable attention in the last 20 years because of their role in insecticide metabolism producing resistance. Many different compounds, including toxic xenobiotics and reactive products of intracellular processes such as lipid peroxidation, act as GST substrates.

  19. Larvicidal, pupicidal and insecticidal activities of Cosmos bipinnatus ...

    African Journals Online (AJOL)

    Purpose: To evaluate the larvicidal, pupicidal and insecticidal activities of Cosmos bipinnatus, Foenuculum vulgare and Tagetes minuta leaf extracts against Culex quinquefasciatus mosquitoes. Methods: The leaves of the plants were extracted with distilled water, ethanol (95 %), and hexane and the extracts screened for ...

  20. Effect of natural and chemical insecticides on Hyalopterus pruni and ...

    African Journals Online (AJOL)

    Experiments were carried out to evaluate the effect of water extracts of Fagonia arabica, Salix alba and Anthmis pseudocotula and their mixtures with chemical insecticide (Malathion) on growth of. Hyalopterus pruni and characters of Armeniaca vulgaris plants and their soils. The data revealed that F.arabica extract at 20% ...

  1. Biological efficacy of the ecotoxically favourable insecticides and ...

    African Journals Online (AJOL)

    The high biologic efficacy, mechanism of action, resistance to water rinsing, high selectivity, and small quantities of application, anticipated a bright future for them. Since results of researches of biological efficacy of insecticides in laboratory and field conditions are statistically different, studies done in natural conditions ...

  2. Insecticide assays against the brown stink bug feeding on pecan

    Science.gov (United States)

    The brown stink bug, Euschistus servus (Say) (Hemiptera: Pentatomidae), is an economic pest of pecan, Carya illinoinensis (Wangenh) K. Koch (Juglandaceae), and other agronomic crops across the southeastern U.S. Management of this pest is mainly via insecticides. Many commercial products indicate o...

  3. Environmental insecticide residues from tsetse fly control measures in Uganda

    International Nuclear Information System (INIS)

    Sserunjoji-Sebalija, J.

    1976-01-01

    Up to June 1974 areas in Uganda totalling 8600km 2 have been successfully reclaimed from tsetse fly infestation by ground spray of 3% dieldrin water emulsions. A search for equally effective but less persistent and toxic compounds against tsetse flies has been unsuccessful. Fourteen insecticide formulations have been tested for their persistence on tree bark surfaces and, therefore, their availability and toxicity to the target tsetse flies. Only those compounds with a high immediate insecticidal activity (some higher than dieldrin) like endosulfan, Chlorfenvinphos and propoxur could merit further consideration in tsetse control. While some were toxic to tsetse as fresh deposits, they lacked sufficient persistence. A study of the environmental implication from the continued use of the highly persistent and toxic dieldrin has provided useful data on residues likely to be found both in terrestrial and aquatic fauna and flora. These are generally low. Moreover, there is evidence of degradation in some fish species (Protopterus aethiopicus and Clarias). Also, dilution factors and adsorption involving the muddy nature of water run-off, etc., and controlled burning of grasses after tsetse eradication would tend to inactivate the residual insecticide and protect aquatic systems. The general findings have indicated less risk than anticipated of the environmental contamination from tsetse control by application of persistent and toxic insecticides. (author)

  4. Chemical Composition and Insecticidal Activity of the Essential Oil of ...

    African Journals Online (AJOL)

    Purpose: To investigate the chemical composition and insecticidal activity of the essential oil of the aerial parts of Ostericum grosseserratum against the maize weevil, Sitophilus zeamaisD. Methods: Steam distillation of the aerial parts of O. grosseserratum during the flowering stage was carried out using a Clavenger ...

  5. Chemical composition and insecticidal properties of essential oil ...

    African Journals Online (AJOL)

    Purpose: To determine the insecticidal properties of essential oil from Mosla soochowensis aerial parts against two insect pests, Sitophilus zeamais and Tribolium castaneum. Methods: Hydro-distillation of M. soochowensis was used to extract the essential oil. Gas chromatography/mass spectrometry (GC/MS) analysis was ...

  6. Bio-insecticides and mating disruption in cranberries

    Science.gov (United States)

    Surveys of native entomopathogenic nematodes in Wisconsin have produced a new bio-insecticide involving two particular nematode species (Oscheius onirici and Heterorhabditis georgiana). In field studies, these nematodes have shown high virulence against flea beetles; in the laboratory, these nematod...

  7. Insecticide Use Practices in Cocoa Production in Four Regions in ...

    African Journals Online (AJOL)

    Most of the insecticides used are classified as class II under WHO Hazard category, and the farmers used very minimal protective clothing during pesticides application. The results of this study show that there is the need to intensify education on safe handling and use of pesticides to reduce pesticide abuse, especially by ...

  8. Cytotoxic effects of delfin insecticide (Bacillus thuringiensis) on cell ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-04

    Aug 4, 2008 ... In acute exposure cells showed deformities such as swelling of cells, oval shaped deformity, and ... Commercial grade of delfin insecticide used in this study was manufactured by .... exposure to cigarette extracts. Antibiotics caused .... administration of a neem pesticide on rat metabolic enzymes. J. Environ.

  9. Material gain: bednets treated with insecticides improve the lives of ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2011-07-15

    ... 700 mosquito nets each day, marketed under brand names such as "Health Net" and ... Material gain: bednets treated with insecticides improve the lives of Tanzanians. July 15, 2011. Image ... The kit is one of the key elements of PSI's Social Marketing of ... The national strategy will work to change this by involving the full ...

  10. Flupyradifurone: a brief profile of a new butenolide insecticide

    Science.gov (United States)

    Nauen, Ralf; Jeschke, Peter; Velten, Robert; Beck, Michael E; Ebbinghaus-Kintscher, Ulrich; Thielert, Wolfgang; Wölfel, Katharina; Haas, Matthias; Kunz, Klaus; Raupach, Georg

    2015-01-01

    BACKGROUND The development and commercialisation of new chemical classes of insecticides for efficient crop protection measures against destructive invertebrate pests is of utmost importance to overcome resistance issues and to secure sustainable crop yields. Flupyradifurone introduced here is the first representative of the novel butenolide class of insecticides active against various sucking pests and showing an excellent safety profile. RESULTS The discovery of flupyradifurone was inspired by the butenolide scaffold in naturally occurring stemofoline. Flupyradifurone acts reversibly as an agonist on insect nicotinic acetylcholine receptors but is structurally different from known agonists, as shown by chemical similarity analysis. It shows a fast action on a broad range of sucking pests, as demonstrated in laboratory bioassays, and exhibits excellent field efficacy on a number of crops with different application methods, including foliar, soil, seed treatment and drip irrigation. It is readily taken up by plants and translocated in the xylem, as demonstrated by phosphor imaging analysis. Flupyradifurone is active on resistant pests, including cotton whiteflies, and is not metabolised by recombinantly expressed CYP6CM1, a cytochrome P450 conferring metabolic resistance to neonicotinoids and pymetrozine. CONCLUSION The novel butenolide insecticide flupyradifurone shows unique properties and will become a new tool for integrated pest management around the globe, as demonstrated by its insecticidal, ecotoxicological and safety profile. © 2014 The Authors. Pest Management Science published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry. PMID:25351824

  11. Seed coating with a neonicotinoid insecticide negatively affects wild bees.

    Science.gov (United States)

    Rundlöf, Maj; Andersson, Georg K S; Bommarco, Riccardo; Fries, Ingemar; Hederström, Veronica; Herbertsson, Lina; Jonsson, Ove; Klatt, Björn K; Pedersen, Thorsten R; Yourstone, Johanna; Smith, Henrik G

    2015-05-07

    Understanding the effects of neonicotinoid insecticides on bees is vital because of reported declines in bee diversity and distribution and the crucial role bees have as pollinators in ecosystems and agriculture. Neonicotinoids are suspected to pose an unacceptable risk to bees, partly because of their systemic uptake in plants, and the European Union has therefore introduced a moratorium on three neonicotinoids as seed coatings in flowering crops that attract bees. The moratorium has been criticized for being based on weak evidence, particularly because effects have mostly been measured on bees that have been artificially fed neonicotinoids. Thus, the key question is how neonicotinoids influence bees, and wild bees in particular, in real-world agricultural landscapes. Here we show that a commonly used insecticide seed coating in a flowering crop can have serious consequences for wild bees. In a study with replicated and matched landscapes, we found that seed coating with Elado, an insecticide containing a combination of the neonicotinoid clothianidin and the non-systemic pyrethroid β-cyfluthrin, applied to oilseed rape seeds, reduced wild bee density, solitary bee nesting, and bumblebee colony growth and reproduction under field conditions. Hence, such insecticidal use can pose a substantial risk to wild bees in agricultural landscapes, and the contribution of pesticides to the global decline of wild bees may have been underestimated. The lack of a significant response in honeybee colonies suggests that reported pesticide effects on honeybees cannot always be extrapolated to wild bees.

  12. A Simple Beta-Function Model for Soil-Water Repellency as a Function of Water and Organic Carbon Contents

    DEFF Research Database (Denmark)

    Karunarathna, Anurudda Kumara; Kawamoto, Ken; Møldrup, Per

    2010-01-01

    Soil-water content (θ) and soil organic carbon (SOC) are key factors controlling the occurrence and magnitude of soil-water repellency (WR). Although expressions have recently been proposed to describe the nonlinear variation of WR with θ, the inclusion of easily measurable parameters in predictive...... conditions for 19 soils were used to test the model. The beta function successfully reproduced all the measured soil-water repellency characteristic, α(θ), curves. Significant correlations were found between model parameters and SOC content (1%-14%). The model was independently tested against data...

  13. Pharyngeal cavity and the gills are the target organ for the repellent action of pardaxin in shark.

    Science.gov (United States)

    Primor, N

    1985-05-15

    Pardaxin, an active principle of the repellent secretion of the Red Sea flatfish, Pardachirus marmoratus, elicited severe struggling, mouth paralysis, and transient increase in urea leakage from the gills only when administered to the medium bathing the shark's pharyngeal cavity and gills. An apparatus was constructed which prevents a mixing of the outflow from shark's gills with water bathing its surface skin. It is concluded that in sharks the gills and/or the pharyngeal cavity are the target organ for the repellent action of pardaxin.

  14. Field evaluation of the efficacy of proprietary repellent formulations with IR3535 and picaridin against Aedes aegypti.

    Science.gov (United States)

    Naucke, T J; Kröpke, R; Benner, G; Schulz, J; Wittern, K P; Rose, A; Kröckel, U; Grünewald, H W

    2007-06-01

    Seven proprietary repellent formulations (3 hydro-alcoholic spray solutions and 4 skin lotions) with active ingredient IR3,535 (ethyl butylacetylaminopropionate, EBAAP) or Picaridin (hydroxyethyl isobutyl piperidine carboxylate, KBR 3,023, Bayrepel) were tested in a field study on 10 test persons over a period of 10 h for their efficacy at preventing bites. The tests were conducted in Belo Horizonte, Brazil on field populations of the yellow fever mosquito Aedes aegypti. The concentration of the active substances ranged from 10% to 20%. All the tested samples provided lasting protection (time to first bite) over several hours: ranging from 5 h 20 min to 6 h 50 min with a mean of approximately 6 h. The longest protection until the second bite (=first confirmation bite) was approximately 7 h 40 min, whereas the shortest protection was 6 h 50 min. The longest protection until the third bite (=second confirmation bite) was 8 h 35 min, whereas the shortest protection was 7 h 40 min. In the control tests in which none of the samples were applied, the mean times until the first, second and third bites were 26, 46 and 59 min, respectively. The basis for this field study was provided by two American guidelines, which have the greatest international acceptance. The first is a draft guideline from the Environmental Protection Agency (EPA (United States Environmental Protection Agency), Product performance test guidelines. OPPTS 810.3700. Insect repellents for human skin and outdoor premises. Public Draft, 1999) and the second is a standard from the American Society for Testing and Materials (ASTM (American Society for Testing and Materials International), E 939-94 (reapproved 2,000): standard test method of field testing topical applications of compounds as repellents for medically important and pest arthropods (including insects, ticks, and mites): I. Mosquitoes, 2,000). Both guidelines recommend measuring the duration of protection until the first and second bites and also

  15. An elaborated feeding cycle model for reductions in vectorial capacity of night-biting mosquitoes by insecticide-treated nets.

    Science.gov (United States)

    Le Menach, Arnaud; Takala, Shannon; McKenzie, F Ellis; Perisse, Andre; Harris, Anthony; Flahault, Antoine; Smith, David L

    2007-01-25

    Insecticide Treated Nets (ITNs) are an important tool for malaria control. ITNs are effective because they work on several parts of the mosquito feeding cycle, including both adult killing and repelling effects. Using an elaborated description of the classic feeding cycle model, simple formulas have been derived to describe how ITNs change mosquito behaviour and the intensity of malaria transmission, as summarized by vectorial capacity and EIR. The predicted changes are illustrated as a function of the frequency of ITN use for four different vector populations using parameter estimates from the literature. The model demonstrates that ITNs simultaneously reduce mosquitoes' lifespans, lengthen the feeding cycle, and by discouraging human biting divert more bites onto non-human hosts. ITNs can substantially reduce vectorial capacity through small changes to all of these quantities. The total reductions in vectorial capacity differ, moreover, depending on baseline behavior in the absence of ITNs. Reductions in lifespan and vectorial capacity are strongest for vector species with high baseline survival. Anthropophilic and zoophilic species are affected differently by ITNs; the feeding cycle is lengthened more for anthrophilic species, and the proportion of bites that are diverted onto non-human hosts is higher for zoophilic species. This model suggests that the efficacy of ITNs should be measured as a total reduction in transmission intensity, and that the quantitative effects will differ by species and by transmission intensity. At very high rates of ITN use, ITNs can generate large reductions in transmission intensity that could provide very large reductions in transmission intensity, and effective malaria control in some areas, especially when used in combination with other control measures. At high EIR, ITNs will probably not substantially reduce the parasite rate, but when transmission intensity is low, reductions in vectorial capacity combine with reductions in

  16. Novel and viable acetylcholinesterase target site for developing effective and environmentally safe insecticides.

    Science.gov (United States)

    Pang, Yuan-Ping; Brimijoin, Stephen; Ragsdale, David W; Zhu, Kun Yan; Suranyi, Robert

    2012-04-01

    Insect pests are responsible for human suffering and financial losses worldwide. New and environmentally safe insecticides are urgently needed to cope with these serious problems. Resistance to current insecticides has resulted in a resurgence of insect pests, and growing concerns about insecticide toxicity to humans discourage the use of insecticides for pest control. The small market for insecticides has hampered insecticide development; however, advances in genomics and structural genomics offer new opportunities to develop insecticides that are less dependent on the insecticide market. This review summarizes the literature data that support the hypothesis that an insect-specific cysteine residue located at the opening of the acetylcholinesterase active site is a promising target site for developing new insecticides with reduced off-target toxicity and low propensity for insect resistance. These data are used to discuss the differences between targeting the insect-specific cysteine residue and targeting the ubiquitous catalytic serine residue of acetylcholinesterase from the perspective of reducing off-target toxicity and insect resistance. Also discussed is the prospect of developing cysteine-targeting anticholinesterases as effective and environmentally safe insecticides for control of disease vectors, crop damage, and residential insect pests within the financial confines of the present insecticide market.

  17. Biological alterations and self-reported symptoms among insecticides-exposed workers in Burkina Faso.

    Science.gov (United States)

    Toe, Adama M; Ilboudo, Sylvain; Ouedraogo, Moustapha; Guissou, Pierre I

    2012-03-01

    Occupationally exposed workers, farm workers and plant protection agents in the Sahel region of Burkina Faso were interviewed to assess adverse health effects of insecticides. The subjects were also examined for changes in both hematological and biochemical parameters. The prevalence of liver and kidney dysfunction was found to be quite high among insecticide applicators, especially among plant protection agents. The prevalence of biochemical alterations seems to be correlated to the frequency of insecticide use. However, no significant differences were found between the hematological parameters among farm workers and plant protection agents. The hematological parameters of all the insecticide applicators were normal. The great majority of insecticide applicators (85%) reported symptoms related to insecticide exposure. The use of insecticides in the agriculture of Burkina Faso is threatening to human health.

  18. Toxicity of some insecticides to the haemocytes of giant honeybee, Apis dorsata F. under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Nighat Perveen

    2017-07-01

    Full Text Available Quantitative studies concerning total and differential haemocyte counts and abnormalities were performed under laboratory conditions for larvae, pupae and adults collected from a wild Apis dorsata colony. Haemolymph samples were observed immediately, thirty and sixty minutes after field recommended concentration exposure of five different insecticides. Total haemocyte counts were significantly higher for larvae and pupae but less for adult bees, however, differential haemocyte counts insignificantly different. Exposure of insecticides showed variable response for tested insecticides with immediate increased change with ethofenprox, diafenthiuron and imidacloprid but decreased for all tested insecticides after sixty minutes. For differential haemocyte counts, plasmatocytes and granulocytes increased with exposure of insecticides. Immune response of haemocytes against insecticides showed different degrees of abnormalities like agglutination, denucleation and cell shape distortion. Such studies may help in possible identification of insect defense mechanisms against their exposure to external hazards for instance insecticide exposure.

  19. Radiation fixation of vinyl chloride in an insecticide aerosol container

    International Nuclear Information System (INIS)

    Kagiya, V.T.; Takemoto, K.

    1975-01-01

    Recently, a large quantity of vinyl chloride has been used as spraying additive for insecticide aerosols. Since January 1974 when the Food and Drug Administration of the United States of America announced that vinyl chloride causes liver cancer, it has been forbidden in Japan and the United States of America to market insecticide aerosol containers containing vinyl chloride. In Japan, following a government order, about 20 million insecticide aerosol containers have been collected and put into storage. A report is given on the radiation fixation of vinyl chloride as polyvinylchloride powder by gamma-ray-induced polymerization in the aerosol container. Insecticide aerosol containers containing vinyl chloride were irradiated by gamma rays from 60 Co at room temperature. Vinyl chloride polymerized to form powdered polymer in the container. Polymerization conversion increased with the irradiation dose, and after 10 Mrad irradiation, vinyl chloride was not found in the sprayed gas. This establishes that vinyl chloride can be fixed by gamma-ray irradiation in the aerosol container. To accelerate the reaction rate, the effect of various additives on the reaction was investigated. It was found that halogenated hydrocarbons, such as chloroform and carbon tetrachloride, accelerated the initiation of the polymerization, and that a vinyl monomer such as vinyl acetate accelerated the reaction rate due to the promotion of the initiation and the high reactivity of the polyvinylacetate radical to vinyl chloride. Consequently, the required irradiation dose for the fixation of vinyl chloride was decreased to less than 5 Mrad by the addition of various kinds of additives. Following the request of the Ministry of Public Welfare, various technical problems for large-scale treatment are being studied with the co-operation of the Federation of Insecticide Aerosols. (author)

  20. Agricultural insecticides threaten surface waters at the global scale.

    Science.gov (United States)

    Stehle, Sebastian; Schulz, Ralf

    2015-05-05

    Compared with nutrient levels and habitat degradation, the importance of agricultural pesticides in surface water may have been underestimated due to a lack of comprehensive quantitative analysis. Increasing pesticide contamination results in decreasing regional aquatic biodiversity, i.e., macroinvertebrate family richness is reduced by ∼30% at pesticide concentrations equaling the legally accepted regulatory threshold levels (RTLs). This study provides a comprehensive metaanalysis of 838 peer-reviewed studies (>2,500 sites in 73 countries) that evaluates, for the first time to our knowledge on a global scale, the exposure of surface waters to particularly toxic agricultural insecticides. We tested whether measured insecticide concentrations (MICs; i.e., quantified insecticide concentrations) exceed their RTLs and how risks depend on insecticide development over time and stringency of environmental regulation. Our analysis reveals that MICs occur rarely (i.e., an estimated 97.4% of analyses conducted found no MICs) and there is a complete lack of scientific monitoring data for ∼90% of global cropland. Most importantly, of the 11,300 MICs, 52.4% (5,915 cases; 68.5% of the sites) exceeded the RTL for either surface water (RTLSW) or sediments. Thus, the biological integrity of global water resources is at a substantial risk. RTLSW exceedances depend on the catchment size, sampling regime, and sampling date; are significantly higher for newer-generation insecticides (i.e., pyrethroids); and are high even in countries with stringent environmental regulations. These results suggest the need for worldwide improvements to current pesticide regulations and agricultural pesticide application practices and for intensified research efforts on the presence and effects of pesticides under real-world conditions.

  1. Insecticide resistance status of Aedes aegypti (L.) from Colombia.

    Science.gov (United States)

    Fonseca-González, Idalyd; Quiñones, Martha L; Lenhart, Audrey; Brogdon, William G

    2011-04-01

    To evaluate the insecticide susceptibility status of Aedes aegypti (L.) in Colombia, and as part of the National Network of Insecticide Resistance Surveillance, 12 mosquito populations were assessed for resistance to pyrethroids, organophosphates and DDT. Bioassays were performed using WHO and CDC methodologies. The underlying resistance mechanisms were investigated through biochemical assays and RT-PCR. All mosquito populations were susceptible to malathion, deltamethrin and cyfluthrin, and highly resistant to DDT and etofenprox. Resistance to lambda-cyhalothrin, permethrin and fenitrothion ranged from moderate to high in some populations from Chocó and Putumayo states. In Antioquia state, the Santa Fe population was resistant to fenitrothion. Biochemical assays showed high levels of both cytochrome P450 monooxygenases (CYP) and non-specific esterases (NSE) in some of the fenitrothion- and pyrethroid-resistant populations. All populations showed high levels of glutathione-S-transferase (GST) activity. GSTe2 gene was found overexpressed in DDT-resistant populations compared with Rockefeller susceptible strain. Differences in insecticide resistance status were observed between insecticides and localities. Although the biochemical assay results suggest that CYP and NSE could play an important role in the pyrethroid and fenitrothion resistance detected, other mechanisms remain to be investigated, including knockdown resistance. Resistance to DDT was high in all populations, and GST activity is probably the main enzymatic mechanism associated with this resistance. The results of this study provide baseline data on insecticide resistance in Colombian A. aegypti populations, and will allow comparison of changes in susceptibility status in this vector over time. Copyright © 2011 Society of Chemical Industry.

  2. Underpinning sustainable vector control through informed insecticide resistance management.

    Directory of Open Access Journals (Sweden)

    Edward K Thomsen

    Full Text Available There has been rapid scale-up of malaria vector control in the last ten years. Both of the primary control strategies, long-lasting pyrethroid treated nets and indoor residual spraying, rely on the use of a limited number of insecticides. Insecticide resistance, as measured by bioassay, has rapidly increased in prevalence and has come to the forefront as an issue that needs to be addressed to maintain the sustainability of malaria control and the drive to elimination. Zambia's programme reported high levels of resistance to the insecticides it used in 2010, and, as a result, increased its investment in resistance monitoring to support informed resistance management decisions.A country-wide survey on insecticide resistance in Zambian malaria vectors was performed using WHO bioassays to detect resistant phenotypes. Molecular techniques were used to detect target-site mutations and microarray to detect metabolic resistance mechanisms. Anopheles gambiae s.s. was resistant to pyrethroids, DDT and carbamates, with potential organophosphate resistance in one population. The resistant phenotypes were conferred by both target-site and metabolic mechanisms. Anopheles funestus s.s. was largely resistant to pyrethroids and carbamates, with potential resistance to DDT in two locations. The resistant phenotypes were conferred by elevated levels of cytochrome p450s.Currently, the Zambia National Malaria Control Centre is using these results to inform their vector control strategy. The methods employed here can serve as a template to all malaria-endemic countries striving to create a sustainable insecticide resistance management plan.

  3. Secondary Metabolite Profile, Antioxidant Capacity, and Mosquito Repellent Activity of Bixa orellana from Brazilian Amazon Region

    Directory of Open Access Journals (Sweden)

    Annamaria Giorgi

    2013-01-01

    Full Text Available The Brazilian flora was widely used as source of food and natural remedies to treat various diseases. Bixa orellana L. (Bixaceae, also known as annatto, urucù, or achiote, is a symbol for the Amazonian tribes that traditionally use its seeds as coloured ink to paint their bodies for religious ceremonies. The aim of this study was to investigate the volatile organic compounds (VOCs profile of B. orellana fresh fruits (in vivo sampled, dried seeds, wood, bark, and leaves analyzed with Headspace solid-phase microextraction coupled with gas chromatography and mass spectrometry. A screening on phenolic content (the Folin-Ciocalteu assay and antiradical activity (DPPH assay of seeds was also conducted. In addition, the repellent properties of seed extracts against Aedes aegypti L. were investigated. Volatile compounds detected in B. orellana samples consisted mainly of sesquiterpenes, monoterpenes, and arenes: α-humulene is the major volatile compound present in seed extracts followed by D-germacrene, γ-elemene, and caryophyllene. B. orellana proved to be a good source of antioxidants. Preliminary data on repellency against A. aegypti of three different dried seed extracts (hexane, ethanol, and ethanol/water indicated a significant skin protection activity. A protection of 90% and 73% for hexane and ethanol/water extracts was recorded.

  4. Super Water-Repellent Fractal Surfaces of a Photochromic Diarylethene Induced by UV Light

    Science.gov (United States)

    Izumi, Norikazu; Minami, Takayuki; Mayama, Hiroyuki; Takata, Atsushi; Nakamura, Shinichiro; Yokojima, Satoshi; Tsujii, Kaoru; Uchida, Kingo

    2008-09-01

    Photochromic diarylethene forms super water-repellent surfaces upon irradiation with UV light. Microfibril-like crystals grow on the solid diarylethene surface after UV irradiation, and the contact angle of water on the surface becomes larger with increasing surface roughness with time. The fractal analysis was made by the box-counting method for the rough surfaces. There are three regions in the roughness size having the fractal dimension of ca. 2.4 (size of roughness smaller than 5 µm), of ca. 2.2 (size of roughness between 5-40 µm), and of ca. 2.0 (size of roughness larger than 40 µm). The fractal dimension of ca. 2.4 was due to the fibril-like structures generated gradually by UV irradiation on diarylethene surfaces accompanied with an increase in the contact angle. The surface structure with larger fractal dimension mainly contributes to realizing the super water-repellency of the diarylethene surfaces. This mechanism of spontaneous formation of fractal surfaces is similar to that for triglyceride and alkylketene dimer waxes.

  5. Repellency of essential oil of Piper aduncum against Aedes albopictus in the laboratory.

    Science.gov (United States)

    Misni, Norashiqin; Sulaiman, Sallehudin; Othman, Hidayatulfathi; Omar, Baharudin

    2009-12-01

    The repellent activity of Piper aduncum essential oil against Aedes albopictus was investigated under laboratory conditions with human volunteers. The lowest median effective dose (ED50) value was 1.5 microg/cm2 at 60 sec of exposure when compared to 90 sec (2.1 microg/cm2) and 120 sec (1.8 microg/cm2) of exposure. At 0.4 g, the essential oil gave a high protection (95.2%) against Ae. albopictus bites or landing at 2 h postapplication. The percentage of protection was reduced to 83.3% after 4 h, 64.5% after 6 h, and 51.6% after 8 h postapplication. As a comparison, treatment with 10% deet gave 100% protection against mosquito biting/landing for 4 h postapplication. There was no significant difference in percentage protection reduction between the plant extract and the commercial product deet, respectively (P = 0.739). The essential oil, which was not as good as deet, still gave moderate protection against Ae. albopictus biting even until 4 h postapplication. In conclusion, the P. aduncum essential oil has the potential to be used as a repellent against the dengue/dengue hemorrhagic fever vector, Ae. albopictus.

  6. Characterizing pollutant emissions from mosquito repellents incenses and implications in risk assessment of human health.

    Science.gov (United States)

    Wang, Lina; Zheng, Xinran; Stevanovic, Svetlana; Xiang, Zhiyuan; Liu, Jing; Shi, Huiwen; Liu, Jing; Yu, Mingzhou; Zhu, Chun

    2018-01-01

    Mosquito-repellent incense is one of the most popular products used for dispelling mosquitos during summer in China. It releases large amounts of particulate and gaseous pollutants which constitute a potential hazard to human health. We conducted chamber experiment to characterize major pollutants from three types of mosquito-repellent incenses, further assessed the size-fractionated deposition in human respiratory system, and evaluated the indoor removing efficiency by fresh air. Results showed that the released pollutant concentrations were greater than permissible levels in regulations in GB3095-2012, as well as suggested by the World Health Organization (WHO). Formaldehyde accounted for 10-20% of the total amount of pollutants. Fine particles dominated in the total particulate concentrations. Geometric standard deviation (GSD) of particle number size distributions was in the range of 1.45-1.93. Count median diameter (CMD) ranged from 100 to 500 nm. Emission rates, burning rates and emission factors of both particulate and gaseous pollutants were compared and discussed. The deposition fractions in pulmonary airway from the disc solid types reached up to 52.7% of the total deposition, and the largest deposition appeared on juvenile group. Computational Fluid Dynamics (CFD) modellings indicated air-conditioner on and windows closed was the worst case. The highest concentration was 180-200 times over the standard limit. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. Amount of leachant and water absorption levels of wood treated with borates and water repellents.

    Science.gov (United States)

    Baysal, Ergun; Sonmez, Abdullah; Colak, Mehmet; Toker, Hilmi

    2006-12-01

    Wood protection efficacy of borates against biological agents, flame retardancy, and suitability to the environment is well known. Since borates can be applied to timber as water based solutions, they are preferred economically as well. Even though they are highly mobile in wood, boron compounds are widely used in timber preservation. Borates migrate in liquid and increase the hygroscopicity of wood in damp conditions. This study deals with the physical restriction of water access in wood by impregnating water repellent agents into wood to limit amount of leachant and water absorption levels of wood after boron treatment. Borates were incorporated with polyethylene glycol-400 (PEG-400) their bulking effect in wood was considered. Results indicated that the amount of leachates from wood treated with borates in PEG-400 was remarkably higher compared to those of wood treated with the aqueous solutions of borates. Water absorption (WA) levels of wood treated with aqueous solutions of borates were higher than those of their treated samples with the solutions in PEG-400. Secondary treatments of wood with the water repellent (WR) chemicals following borate impregnation reduced the leaching of chemicals from wood in water and also WA of the specimens were less than those of the wood treated with only borates from aqueous and PEG solutions. Styrene (St) was the most effective monomer among the other agents used in terms of immobility effect on borates and WA.

  8. Fumigant and repellent properties of sesquiterpene-rich essential oil from Teucrium polium subsp. capitatum (L.)

    Institute of Scientific and Technical Information of China (English)

    Abbas Khani; Monireh Heydarian

    2014-01-01

    Objective:To test fumigant and repellent properties of sesquiterpene-rich essential oil from Teucrium polium subsp.capitatum(L.).Methods:The fumigant toxicity test was performed at(27±1)℃,(65±5)% relative humidity, and under darkness condition and24 h exposure time.The chemical composition of the isolated oils was examined by gas chromatography-mass spectrometry.Results:The major compounds wereα-cadinol(46.2%), caryophyllene oxide(25.9%), α muurolol epi(8.1%), cadalene(3.7%) and longiverbenone(2.9%).In all cases, considerable differences in mortality of insect to essential oil vapor were observed in different concentrations and exposure times.Callosobruchus maculatus(C. maculates)(LC50=148.9 μL/L air) was more susceptible to the tested plant product thanTeucrium castaneum(T. castaneum) (LC50=360.2 μL/L air) based onLC50 values.In the present investigation, the concentration of3 μL /mL acetone showed60% and52% repellency againstT. casteneumandC. maculatus adults, respectively.Conclusions:The results suggests that sesquiterpene-rich essential oils from the tested plant could be used as a potential control agent for stored-product insects.

  9. On the analysis of effectiveness in mass application of mosquito repellent for dengue disease prevention

    Science.gov (United States)

    Aldila, D.; Soewono, E.; Nuraini, N.

    2012-05-01

    Dengue disease has been known as one of dangerous vector-borne diseases and become serious threat in many tropical countries. With no vaccine and antiviral available until nowadays, and frequent appearance of extraordinary dengue outbreaks, many governments are forced to declare national problem for dengue. At this moment, the only method available to prevent dengue disease transmission is to combat the disease-carrying mosquitoes as well as to reduce the contact between human and mosquitoes. The fast growing dengue transmission in many countries in recent years indicates that the mosquito control programs are far from successful. The use of mosquito repellent is one possible instrument which could be used as an effective mass treatment to prevent the dengue outbreak during endemic period. Here in this paper a Susceptible-Infectious-Recovered (S-I-R) dengue transmission model with repellent mass treatment is being applied to portions of children and adult compartments. Analysis of the basic reproductive ratio (Ro) of the model is done. It is shown, with reasonable choices of portions of treated children and adults, in combination with reduction of mosquito population, the basic reproductive ratio can be significantly reduced and occurrence of endemic can be avoided. Numerical simulations are shown for various treatment scenarios.

  10. Repellent Action Of Neem (Azadiracta India Seed Oil Against Aedes Aegypti Mosquitoes

    Directory of Open Access Journals (Sweden)

    Hati A K

    1995-01-01

    Full Text Available Neem (Azadiracta India seed oil in appropriate amount when smeared on the surface of the hand showed excellent repellent action against Aedes aegypti mosquitoes. When 1 ml of oil was spread on the hand, with an approximate area of 160 sq cm the percentage of alighting and blood fed mosquitoes in the experimental cages varied from 14 to 78 and 4 to 46 respectively. This percentage decreased to 6 to 18 and 0 to 16 respectively when the amount of oil applied was 1.5 ml. Only 0-4% of the mosquitoes alighted on the skin of which 2% only took the blood meal when 2 ml of the oil was used to cover the hand. In the control cages cent percent of the mosquitoes alighted and sucked blood. The repellent action was directly proportional to the hour of exposure to the oil. It was also observed that even after alighting on a oil- smeared skin a sizeable proportion of mosquitoes were not able to imbibe blood meal. Neem seed oil was non-toxic, non- irritating to skin.

  11. Evaluation of water repellent treatments applied to stones used in andalusian cathedrals. II. Salt crystallization test

    Directory of Open Access Journals (Sweden)

    Villegas Sánchez, R.

    1993-06-01

    Full Text Available In a previous paper we have studied the changes that have ocurred in the properties related to water access and movement in the stone after the application of water repellent treatments. In this work we compare the weathering resistance of treated and untreated samples by means of sodium sulphate crystallization test. After finishing the test (75 cycles properties related to water have been measured again to know if the treatments have undergone any kind of deterioration and lose their water repellent characteristics.

    En un artículo anterior se han evaluado los cambios producidos en las propiedades relacionadas con el acceso y movimiento de agua en la piedra como consecuencia de la aplicación de tratamientos de hidrofugación. En este trabajo se compara la resistencia a la alteración producida por sales de las probetas tratadas y sin tratar, sometiéndolas al ensayo de cristalización de sulfato sódico. Tras finalizar el ensayo (75 ciclos se han medido nuevamente las propiedades relacionadas con el agua, con objeto de comprobar si los tratamientos han sufrido alguna alteración y si mantienen sus características hidrófugas.

  12. TiO2 nanowire-templated hierarchical nanowire network as water-repelling coating

    Science.gov (United States)

    Hang, Tian; Chen, Hui-Jiuan; Xiao, Shuai; Yang, Chengduan; Chen, Meiwan; Tao, Jun; Shieh, Han-ping; Yang, Bo-ru; Liu, Chuan; Xie, Xi

    2017-12-01

    Extraordinary water-repelling properties of superhydrophobic surfaces make them novel candidates for a great variety of potential applications. A general approach to achieve superhydrophobicity requires low-energy coating on the surface and roughness on nano- and micrometre scale. However, typical construction of superhydrophobic surfaces with micro-nano structure through top-down fabrication is restricted by sophisticated fabrication techniques and limited choices of substrate materials. Micro-nanoscale topographies templated by conventional microparticles through surface coating may produce large variations in roughness and uncontrollable defects, resulting in poorly controlled surface morphology and wettability. In this work, micro-nanoscale hierarchical nanowire network was fabricated to construct self-cleaning coating using one-dimensional TiO2 nanowires as microscale templates. Hierarchical structure with homogeneous morphology was achieved by branching ZnO nanowires on the TiO2 nanowire backbones through hydrothermal reaction. The hierarchical nanowire network displayed homogeneous micro/nano-topography, in contrast to hierarchical structure templated by traditional microparticles. This hierarchical nanowire network film exhibited high repellency to both water and cell culture medium after functionalization with fluorinated organic molecules. The hierarchical structure templated by TiO2 nanowire coating significantly increased the surface superhydrophobicity compared to vertical ZnO nanowires with nanotopography alone. Our results demonstrated a promising strategy of using nanowires as microscale templates for the rational design of hierarchical coatings with desired superhydrophobicity that can also be applied to various substrate materials.

  13. Field Method for Testing Repellency of an Icaridin-Containing Skin Lotion against Vespid Wasps

    Directory of Open Access Journals (Sweden)

    Jean-Luc Boevé

    2016-06-01

    Full Text Available Vespid wasps are ecologically beneficial predators of insects but their stings also pose a human health risk. Current control methods based on killing vespids are suboptimal. Here, the repellent effect against Vespula vulgaris of a 20% icaridin skin lotion was evaluated under field conditions. An experimental setup was designed in which six artificial skin pieces (10 × 10 cm were video-recorded for 1 h, to count each min the numbers of flying and feeding vespids. Prior to monitoring, five pieces were successively smeared with 2 mg of cream per cm2, in 30 min intervals, from t = −120 min to 0. The sixth sheet remained untreated to serve as a control. One milliliter of an attractant, fruit jam, was deposited on each of the six surfaces at t = 0. The control surface was free of any flying or feeding vespid during an average period of 25 min, whereas the other five surfaces (treated at t = −120, −90, −60, −30, and 0 min remained vespid-free for 39, 40, 45, 49, and 51 min, respectively. The skin lotion remained significantly active for at least 2 h. The experimental methodology is adjustable and allows the study of repellents against vespids in semi-natural conditions.

  14. Enhancement of flame retardancy and water repellency properties of cotton fabrics using silanol based nano composites.

    Science.gov (United States)

    Mohamed, Amina L; El-Sheikh, Manal A; Waly, Ahmed I

    2014-02-15

    Environmental concerns related to fluorinated and organophosphorus compounds led to a consideration of the methods for imparting flame retardancy and water/oil repellency to textiles. A simple and facile method for fabricating the cotton fabric with superhydrophobicity and flame retardancy is described in the present work. Complex coating with amino-functionalized silica nano-particles on epoxy-functionalized cotton accompanied with ZnO nano-particles coating are carried out. In This context, new preparation techniques were used to prepare both aminated silica and ZnO nano-particles. The particle size was investigated using Transition Electron Microscope (TEM) and the chemical structure was investigated using FT-IR analysis and other analytical techniques. Cotton was functionalized with epoxy and carboxyl via grafting cotton with nano-emulsion consisted of mixture of glycidyl methacrylate (GMA) and acrylic acid (AA), and then treated for functional finishing through conventional pad-dry-cure method. The treated fabrics showed good water repellency and excellent flame retardant properties as determined by the standard test methods. Copyright © 2013 Elsevier Ltd. All rights reserved.

  15. Repellent Activity of Botanical Oils against Asian Citrus Psyllid, Diaphorina citri (Hemiptera: Liviidae

    Directory of Open Access Journals (Sweden)

    Emily H. Kuhns

    2016-07-01

    Full Text Available The Asian citrus psyllid, Diaphorina citri Kuwayama, is the insect vector of the pathogen causing huanglongbing. We selected three botanical oils to evaluate behavioral activity against D. citri. In laboratory olfactometer assays, fir oil was repellent to D. citri females, while litsea and citronella oils elicited no response from D. citri females. In choice settling experiments, D. citri settled almost completely on control plants rather than on plants treated with fir oil at a 9.5 mg/day release rate. Therefore, we conducted field trials to determine if fir oil reduced D. citri densities in citrus groves. We found no repellency of D. citri from sweet orange resets that were treated with fir oil dispensers releasing 10.4 g/day/tree as compared with control plots. However, we found a two-week decrease in populations of D. citri as compared with controls when the deployment rate of these dispensers was doubled. Our results suggest that treatment of citrus with fir oil may have limited activity as a stand-alone management tool for D. citri and would require integration with other management practices.

  16. Repellent Activity of Botanical Oils against Asian Citrus Psyllid, Diaphorina citri (Hemiptera: Liviidae).

    Science.gov (United States)

    Kuhns, Emily H; Martini, Xavier; Hoyte, Angel; Stelinski, Lukasz L

    2016-07-14

    The Asian citrus psyllid, Diaphorina citri Kuwayama, is the insect vector of the pathogen causing huanglongbing. We selected three botanical oils to evaluate behavioral activity against D. citri. In laboratory olfactometer assays, fir oil was repellent to D. citri females, while litsea and citronella oils elicited no response from D. citri females. In choice settling experiments, D. citri settled almost completely on control plants rather than on plants treated with fir oil at a 9.5 mg/day release rate. Therefore, we conducted field trials to determine if fir oil reduced D. citri densities in citrus groves. We found no repellency of D. citri from sweet orange resets that were treated with fir oil dispensers releasing 10.4 g/day/tree as compared with control plots. However, we found a two-week decrease in populations of D. citri as compared with controls when the deployment rate of these dispensers was doubled. Our results suggest that treatment of citrus with fir oil may have limited activity as a stand-alone management tool for D. citri and would require integration with other management practices.

  17. Determination of the efficacy of two water repellents applied to granite

    Directory of Open Access Journals (Sweden)

    Rivas, T.

    1998-03-01

    Full Text Available We evaluated the efficacy of two water-repellents applied to three types of granitic rock widely used in building construction and restoration in Galicia (NW Spain. The depth of penetration of the water-repellents was determined by measuring capillary absorption by the treated rock. The efficacies of the water-repellent were evaluated in terms of two parameters characteristic of surface wet: water-rock contact angle and the time taken for absorption of microgroplets. The effects of the treatments on the rocks' surface color and permeability to water vapor were also determined. The results indicate that neither water-repellent effectively penetrates the rock surface, and both induce undesirably high reductions in vapor permeability. Notwithstanding, both agents effectively improved the rocks' resistance to surface wetting, without altering its surface color. Overall, determination of water-rock contact angle and the time taken for absorption of microdroplets, together with colorimetric characterization of the treated rock, constitutes an useful approach to evaluation of the effects of water-repellents on granitic rocks. Nonetheless, it should be borne in mind that the marked heterogeneity of this type of rock, and the associated mineralogy and dominant type of fissuration are sources of considerable variation in the measurement parameters.

    Se presentan los resultados de la aplicación de dos tratamientos hidrofugantes a tres rocas graníticas ampliamente utilizadas en la construcción y restauración en Galicia. Se ha determinado la profundidad de penetración de los hidrofugantes a través de la absorción capilar, la eficacia de los tratamientos comparando dos parámetros relacionados con el mojado superficial (ángulo de contacto roca-agua y tiempo de absorción de microgotas, y las variaciones en el color y en la permeabilidad al vapor. Se comprueba que si bien ambos tratamientos penetran deforma muy escasa en las rocas graníticas y

  18. Polymeric nanoencapsulation of insect repellent: Evaluation of its bioefficacy on Culex quinquefasciatus mosquito population and effective impregnation onto cotton fabrics for insect repellent clothing

    Directory of Open Access Journals (Sweden)

    A.P.B. Balaji

    2017-10-01

    Full Text Available Diethylphenylacetamide (Bulk-DEPA, an organic insect repellent was subjected to Poly(ethylene glycol (PEG polymerization followed by Phase Inversion Temperature (PIT emulsification method to yield the polymeric nanodroplets of DEPA (Nano-DEPA. The mean hydrodynamic diameter was found to be 149 ± 1.06 nm. The efficacy of Bulk-DEPA and Nano-DEPA was comparatively investigated on the Culex quinquefasciatus mosquito population. The larvicidal bioassay was performed on the 1st, 2nd, and 3rd instar larvae of Culex quinquefasciatus and the median lethal indices (LC50 of was found to be 0.055, 0.208, 1.397 mg/L and 0.023, 0.144, 0.260 mg/L for Bulk-DEPA and Nano-DEPA respectively. The histopathological studies were found to be corroborative with the larvicidal bioassay. The median knockdown indices (KD50 on 2–3 day old sucrose fed adult mosquitoes determined by WHO cone bioassay and was found to be 55.168 and 33.277 mg/L for Bulk-DEPA and Nano-DEPA. The obtained results indicate the improved efficacy possessed by the Nano-DEPA as comparative to Bulk-DEPA even at lower concentrations. Further, the Nano-DEPA was impregnated onto the alginate cross-linked (ACL and Plain (PL cotton fabrics, and the Washing resistance index (WRI was determined. The obtained results indicate the higher WRI possessed by the ACL cotton fabric than the PL cotton fabric. This was owing to the effective physical entrapment of Nano-DEPA onto the alginate matrices, which was further substantiated by high-resolution scanning electron microscopic (HR-SEM studies. Overall, the present study has emphasized the benefit of formulating Bulk-DEPA into Nano-DEPA to exert higher efficacy on the mosquito population. In addition, study has provided the methodology for the effective impregnation of Nano-DEPA onto the cotton fabrics for the reliable application in long lasting insect repellent clothing.

  19. Fresh, dried or smoked? repellent properties of volatiles emitted from ethnomedicinal plant leaves against malaria and yellow fever vectors in Ethiopia

    Directory of Open Access Journals (Sweden)

    Dube Fitsum

    2011-12-01

    Full Text Available Abstract Background In the search for plant-based mosquito repellents, volatile emanations were investigated from five plant species, Corymbia citriodora, Ocimum suave, Ocimum lamiifolium, Olea europaea and Ostostegia integrifolia, traditionally used in Ethiopia as protection against mosquitoes. Methods The behaviour of two mosquitoes, the malaria vector Anopheles arabiensis and the arbovirus vector Aedes aegypti, was assessed towards volatiles collected from the headspace of fresh and dried leaves, and the smoke from burning the dried leaves in a two-choice landing bioassay and in the background of human odour. Results Volatile extracts from the smoke of burning dried leaves were found to be more repellent than those from fresh leaves, which in turn were more repellent to mosquitoes than volatiles from dried leaves. Of all smoke and fresh volatile extracts, those from Co. citriodora (52-76% and Oc. suave (58-68% were found to be the most repellent, Os. integrifolia (29-56% to be intermediate while Ol. europaea (23-40% and Os. integrifolia (19-37% were the least repellent. One volatile present in each of the fresh leaf extracts of Co. citriodora, Oc. suave and Os. integrifolia was ß-ocimene. The levels of ß-ocimene reflected the mosquito repellent activity of these three fresh leaf extracts. Female host-seeking mosquitoes responded dose-dependently to ß-ocimene, both physiologically and behaviourally, with a maximal behavioural repulsion at 14% ß-ocimene. ß-ocimene (14% repels mosquitoes in our 6-minute landing assays comparable to the synthetic insect repellent N,N-diethyl-m-toluamide (10% DEET. Conclusions Volatiles in the smoke of burning as well as fresh leaves of Co. citriodora and Oc. suave have significant repellent properties against host seeking An. arabiensis and Ae. aegypti mosquitoes. ß-ocimene, present in the fresh leaf headspace of Co. citriodora, Oc. suave and Os. integrifolia, is a significantly effective volatile mosquito

  20. Bioassay-Guided Investigation of Two Monarda Essential Oils as Repellents of Yellow Fever Mosquito Aedes aegypti

    Science.gov (United States)

    2013-08-06

    suppressed the postprandial elevation of blood triacylglycerol concentrations in mice in vivo; however, five other monoterpene glycosides that were isolated...components, leading to the isolation of compounds with mosquito repellent activity, but without any cytotoxicity. The monoterpene hydrocarbon p-cymene...Kobayashi, K.; Miyase, T.; Yoshizaki, F. A lipase inhibitor monoterpene and monoterpene glycosides from Monarda punctata. Phytochemistry 2010, 71, 1884