WorldWideScience

Sample records for insecticide impregnated curtains

  1. The cost of routine Aedes aegypti control and of insecticide-treated curtain implementation.

    Science.gov (United States)

    Baly, Alberto; Flessa, Steffen; Cote, Marilys; Thiramanus, Thirapong; Vanlerberghe, Veerle; Villegas, Elci; Jirarojwatana, Somchai; Van der Stuyft, Patrick

    2011-05-01

    Insecticide-treated curtains (ITCs) are promoted for controlling the Dengue vector Aedes aegypti. We assessed the cost of the routine Aedes control program (RACP) and the cost of ITC implementation through the RACP and health committees in Venezuela and through health volunteers in Thailand. The yearly cost of the RACP per household amounted to US$2.14 and $1.89, respectively. The ITC implementation cost over three times more, depending on the channel used. In Venezuela the RACP was the most efficient implementation-channel. It spent US$1.90 (95% confidence interval [CI]: 1.83; 1.97) per curtain distributed, of which 76.9% for the curtain itself. Implementation by health committees cost significantly (P = 0.02) more: US$2.32 (95% CI: 1.93; 2.61) of which 63% for the curtain. For ITC implementation to be at least as cost-effective as the RACP, at equal effectiveness and actual ITC prices, the attained curtain coverage and the adulticiding effect should last for 3 years.

  2. Insecticide treated curtains and residual insecticide treatment to control Aedes aegypti: An acceptability study in Santiago de Cuba.

    Directory of Open Access Journals (Sweden)

    Dennis Pérez

    2018-01-01

    Full Text Available Within the context of a field trial conducted by the Cuban vector control program (AaCP, we assessed acceptability of insecticide-treated curtains (ITCs and residual insecticide treatment (RIT with deltamethrin by the community. We also assessed the potential influence of interviewees' risk perceptions for getting dengue and disease severity.We embedded a qualitative study using in-depth interviews in a cluster randomized trial (CRT testing the effectiveness of ITCs and RIT in Santiago de Cuba. In-depth interviews (N = 38 were conducted four and twelve months after deployment of the tools with people who accepted the tools, who stopped using them and who did not accept the tools. Data analysis was deductive. Main reasons for accepting ITCs at the start of the trial were perceived efficacy and not being harmful to health. Constraints linked to manufacturer instructions were the main reason for not using ITCs. People stopped using the ITCs due to perceived allergy, toxicity and low efficacy. Few heads of households refused RIT despite the noting reasons for rejection, such as allergy, health hazard and toxicity. Positive opinions of the vector control program influenced acceptability of both tools. However, frequent insecticide fogging as part of routine AaCP vector control actions diminished perceived efficacy of both tools and, therefore, acceptability. Fifty percent of interviewees did feel at risk for getting dengue and considered dengue a severe disease. However, this did not appear to influence acceptability of ITCs or RIT.Acceptability of ITCs and RIT was linked to acceptability of AaCP routine vector control activities. However, uptake and use were not always an indication of acceptability. Factors leading to acceptability may be best identified using qualitative methods, but more research is needed on the concept of acceptability and its measurement.

  3. Insecticide treated curtains and residual insecticide treatment to control Aedes aegypti: An acceptability study in Santiago de Cuba.

    Science.gov (United States)

    Pérez, Dennis; Van der Stuyft, Patrick; Toledo, María Eugenia; Ceballos, Enrique; Fabré, Francisco; Lefèvre, Pierre

    2018-01-01

    Within the context of a field trial conducted by the Cuban vector control program (AaCP), we assessed acceptability of insecticide-treated curtains (ITCs) and residual insecticide treatment (RIT) with deltamethrin by the community. We also assessed the potential influence of interviewees' risk perceptions for getting dengue and disease severity. We embedded a qualitative study using in-depth interviews in a cluster randomized trial (CRT) testing the effectiveness of ITCs and RIT in Santiago de Cuba. In-depth interviews (N = 38) were conducted four and twelve months after deployment of the tools with people who accepted the tools, who stopped using them and who did not accept the tools. Data analysis was deductive. Main reasons for accepting ITCs at the start of the trial were perceived efficacy and not being harmful to health. Constraints linked to manufacturer instructions were the main reason for not using ITCs. People stopped using the ITCs due to perceived allergy, toxicity and low efficacy. Few heads of households refused RIT despite the noting reasons for rejection, such as allergy, health hazard and toxicity. Positive opinions of the vector control program influenced acceptability of both tools. However, frequent insecticide fogging as part of routine AaCP vector control actions diminished perceived efficacy of both tools and, therefore, acceptability. Fifty percent of interviewees did feel at risk for getting dengue and considered dengue a severe disease. However, this did not appear to influence acceptability of ITCs or RIT. Acceptability of ITCs and RIT was linked to acceptability of AaCP routine vector control activities. However, uptake and use were not always an indication of acceptability. Factors leading to acceptability may be best identified using qualitative methods, but more research is needed on the concept of acceptability and its measurement.

  4. Insecticide mixtures for mosquito net impregnation against malaria vectors

    Directory of Open Access Journals (Sweden)

    Corbel V.

    2002-09-01

    Full Text Available Insecticides belonging to the pyrethroid family are the only compounds currently available for the treatment of mosquito nets. Unfortunately, some malaria vector species have developed resistance to pyrethroids and the lack of alternative chemical categories is a great concern. One strategy for resistance management would be to treat mosquito nets with a mixture associating two insecticides having different modes of action. This study presents the results obtained with insecticide mixtures containing several proportions of bifenthrin (a pyrethroid insecticide and carbosulfan (a carbamate insecticide. The mixtures were sprayed on mosquito net samples and their efficacy were tested against a susceptible strain of Anopheles gambiae, the major malaria vector in Africa. A significant synergism was observed with a mixture containing 25 mg/m2 of bifenthrin (half the recommended dosage for treated nets and 6.25 mg/m2 of carbosulfan (about 2 % of the recommended dosage. The observed mortality was significantly more than expected in the absence of any interaction (80 % vs 41 % and the knock-down effect was maintained, providing an effective barrier against susceptible mosquitoes.

  5. Theoretical impact of insecticide-impregnated school uniforms on dengue incidence in Thai children.

    Science.gov (United States)

    Massad, Eduardo; Amaku, Marcos; Coutinho, Francisco Antonio Bezerra; Kittayapong, Pattamaporn; Wilder-Smith, Annelies

    2013-03-28

    Children carry the main burden of morbidity and mortality caused by dengue. Children spend a considerable amount of their day at school; hence strategies that reduce human-mosquito contact to protect against the day-biting habits of Aedes mosquitoes at schools, such as insecticide-impregnated uniforms, could be an effective prevention strategy. We used mathematical models to calculate the risk of dengue infection based on force of infection taking into account the estimated proportion of mosquito bites that occur in school and the proportion of school time that children wear the impregnated uniforms. The use of insecticide-impregnated uniforms has efficacy varying from around 6% in the most pessimistic estimations, to 55% in the most optimistic scenarios simulated. Reducing contact between mosquito bites and human hosts via insecticide-treated uniforms during school time is theoretically effective in reducing dengue incidence and may be a valuable additional tool for dengue control in school-aged children. The efficacy of this strategy, however, is dependent on the compliance of the target population in terms of proper and consistent wearing of uniforms and, perhaps more importantly, the proportion of bites inflicted by the Aedes population during school time.

  6. Theoretical impact of insecticide-impregnated school uniforms on dengue incidence in Thai children

    Directory of Open Access Journals (Sweden)

    Eduardo Massad

    2013-03-01

    Full Text Available Background: Children carry the main burden of morbidity and mortality caused by dengue. Children spend a considerable amount of their day at school; hence strategies that reduce human–mosquito contact to protect against the day-biting habits of Aedes mosquitoes at schools, such as insecticide-impregnated uniforms, could be an effective prevention strategy. Methodology: We used mathematical models to calculate the risk of dengue infection based on force of infection taking into account the estimated proportion of mosquito bites that occur in school and the proportion of school time that children wear the impregnated uniforms. Principal findings: The use of insecticide-impregnated uniforms has efficacy varying from around 6% in the most pessimistic estimations, to 55% in the most optimistic scenarios simulated. Conclusions: Reducing contact between mosquito bites and human hosts via insecticide-treated uniforms during school time is theoretically effective in reducing dengue incidence and may be a valuable additional tool for dengue control in school-aged children. The efficacy of this strategy, however, is dependent on the compliance of the target population in terms of proper and consistent wearing of uniforms and, perhaps more importantly, the proportion of bites inflicted by the Aedes population during school time.

  7. Laboratory investigations of insecticide impregnated materials for the control of New World screwworm flies

    International Nuclear Information System (INIS)

    Harris, E.G.; Brown, M.; Smith, S.

    1992-01-01

    In laboratory tests, New World screwworm flies were found to be at least three orders of magnitude less susceptible to the insecticides deltamethrin, alphacypermethrin and cyfluthrin than are tsetse flies. Deltamethrin was the most toxic of the three insecticides to screwworm flies. For topical application, the LD50s for deltamethrin 20% suspension concentrate were 33 ng and 25 ng for male and female screwworm flies respectively, compared with 0.04 ng for tsetse, G.m. morsitans. In various tests simulating contact of screwworm flies with cloth or netting targets impregnated with insecticide, 100% kill was only achieved with 3.2% deltamethrin and contact times of at least 10 sec, although 100% knockdown for up to 24 hours was obtained with lower concentrations. No repellent effect was observed at the higher concentrations. Cloth targets impregnated with a high dose of insecticide and baited with an attractant could be effective against NWS flies, especially if after ''knockdown'' flies are removed by predators. 1 fig., 9 tabs

  8. Towards a Casa Segura: A Consumer Product Study of the Effect of Insecticide-Treated Curtains on Aedes aegypti and Dengue Virus Infections in the Home

    Science.gov (United States)

    Loroño-Pino, María Alba; García-Rejón, Julián E.; Machain-Williams, Carlos; Gomez-Carro, Salvador; Nuñez-Ayala, Guadalupe; del Rosario Nájera-Vázquez, Maria; Losoya, Arturo; Aguilar, Lyla; Saavedra-Rodriguez, Karla; Lozano-Fuentes, Saul; Beaty, Meaghan K.; Black, William C.; Keefe, Thomas J.; Eisen, Lars; Beaty, Barry J.

    2013-01-01

    The home, or domicile, is the principal environment for transmission of dengue virus (DENV) between humans and mosquito vectors. Community-wide distribution of insecticide-treated curtains (ITCs), mimicking vector control program-driven interventions, has shown promise to reduce DENV infections. We conducted a Casa Segura consumer product intervention study in Mérida, Mexico to determine the potential to reduce intradomicillary DENV transmission through ITC use in individual homes. Dengue virus infections in mosquitoes and in humans were reduced in homes with ITCs in one of two study subareas. Overall, ITCs reduced intradomicillary DENV transmission; ITC homes were significantly less likely to experience multiple DENV infections in humans than NTC homes. Dengue virus–infected Aedes aegypti females were reduced within the ITC homes where curtain use was highest. Some homes yielded up to nine infected Ae. aegypti females. This study provides insights regarding best practices for Casa Segura interventions to protect homes from intradomicillary DENV transmission. PMID:23732254

  9. Effectiveness and feasibility of long-lasting insecticide-treated curtains and water container covers for dengue vector control in Colombia: a cluster randomised trial.

    Science.gov (United States)

    Quintero, Juliana; García-Betancourt, Tatiana; Cortés, Sebastian; García, Diana; Alcalá, Lucas; González-Uribe, Catalina; Brochero, Helena; Carrasquilla, Gabriel

    2015-02-01

    Long-lasting insecticide-treated net (LLIN) window and door curtains alone or in combination with LLIN water container covers were analysed regarding effectiveness in reducing dengue vector density, and feasibility of the intervention. A cluster randomised trial was conducted in an urban area of Colombia comparing 10 randomly selected control and 10 intervention clusters. In control clusters, routine vector control activities were performed. The intervention delivered first, LLIN curtains (from July to August 2013) and secondly, water container covers (from October to March 2014). Cross-sectional entomological surveys were carried out at baseline (February 2013 to June 2013), 9 weeks after the first intervention (August to October 2013), and 4-6 weeks after the second intervention (March to April 2014). Curtains were installed in 922 households and water container covers in 303 households. The Breteau index (BI) fell from 14 to 6 in the intervention group and from 8 to 5 in the control group. The additional intervention with LLIN covers for water containers showed a significant reduction in pupae per person index (PPI) (p=0.01). In the intervention group, the PPI index showed a clear decline of 71% compared with 25% in the control group. Costs were high but options for cost savings were identified. Short term impact evaluation indicates that the intervention package can reduce dengue vector density but sustained effect will depend on multiple factors. © The author 2015. The World Health Organization has granted Oxford University Press permission for the reproduction of this article.

  10. Synergistic insecticidal and repellent effects of combined pyrethroid and repellent-impregnated bed nets using a novel long-lasting polymer-coating multi-layer technique.

    Science.gov (United States)

    Faulde, Michael K; Nehring, Oliver

    2012-08-01

    -coating LLIRNs may overcome LLIN-triggered selection pressure for development of new kdr- and metabolic pyrethroid resistances while simultaneously increasing protective efficacy also against kdr- and metabolic pyrethroid-resistant mosquitoes substantially due to the repellent-induced effects of LLIRNs thus indicating that this approach is a promising new candidate for future bed net, curtain, and window screen impregnation aiming at optimized prevention from mosquito-borne diseases.

  11. Cost of intensive routine control and incremental cost of insecticide-treated curtain deployment in a setting with low Aedes aegypti infestation

    Directory of Open Access Journals (Sweden)

    Alberto Baly

    Full Text Available Abstract: INTRODUCTION Information regarding the cost of implementing insecticide-treated curtains (ITCs is scarce. Therefore, we evaluated the ITC implementation cost, in addition to the costs of intensive conventional routine activities of the Aedes control program in the city of Guantanamo, Cuba. METHODS A cost-analysis study was conducted from the perspective of the Aedes control program, nested in an ITC effectiveness trial, during 2009-2010. Data for this study were obtained from bookkeeping records and activity registers of the Provincial Aedes Control Programme Unit and the account records of the ITC trial. RESULTS The annual cost of the routine Aedes control program activities was US$16.80 per household (p.h. Among 3,015 households, 6,714 ITCs were distributed. The total average cost per ITC distributed was US$3.42, and 74.3% of this cost was attributed to the cost of purchasing the ITCs. The annualized costs p.h. of ITC implementation was US$3.80. The additional annualized cost for deploying ITCs represented 19% and 48.4% of the total cost of the routine Aedes control and adult-stage Aedes control programs, respectively. The trial did not lead to further reductions in the already relatively low Aedes infestation levels. CONCLUSIONS At current curtain prices, ITC deployment can hardly be considered an efficient option in Guantanamo and other comparable environments.

  12. Cost of intensive routine control and incremental cost of insecticide-treated curtain deployment in a setting with low Aedes aegypti infestation.

    Science.gov (United States)

    Baly, Alberto; Toledo, Maria Eugenia; Lambert, Isora; Benítez, Elizabeth; Rodriguez, Karina; Rodriguez, Esther; Vanlerberghe, Veerle; Stuyft, Patrick Van der

    2016-01-01

    Information regarding the cost of implementing insecticide-treated curtains (ITCs) is scarce. Therefore, we evaluated the ITC implementation cost, in addition to the costs of intensive conventional routine activities of the Aedes control program in the city of Guantanamo, Cuba. A cost-analysis study was conducted from the perspective of the Aedes control program, nested in an ITC effectiveness trial, during 2009-2010. Data for this study were obtained from bookkeeping records and activity registers of the Provincial Aedes Control Programme Unit and the account records of the ITC trial. The annual cost of the routine Aedes control program activities was US$16.80 per household (p.h). Among 3,015 households, 6,714 ITCs were distributed. The total average cost per ITC distributed was US$3.42, and 74.3% of this cost was attributed to the cost of purchasing the ITCs. The annualized costs p.h. of ITC implementation was US$3.80. The additional annualized cost for deploying ITCs represented 19% and 48.4% of the total cost of the routine Aedes control and adult-stage Aedes control programs, respectively. The trial did not lead to further reductions in the already relatively low Aedes infestation levels. At current curtain prices, ITC deployment can hardly be considered an efficient option in Guantanamo and other comparable environments.

  13. Unit costs for house spraying and bednet impregnation with residual insecticides in Colombia: a management tool for the control of vector-borne disease.

    Science.gov (United States)

    Kroeger, A; Ayala, C; Medina Lara, A

    2002-06-01

    A study of unit costs and cost components of two malaria-control strategies (house spraying and bednet impregnation with residual insecticides) was undertaken in 11 malaria-endemic states (departamentos) of Colombia, using data provided by control staff on self-administered questionnaires. The accuracy of the data was verified by personal visits, telephone conversations and complementary information from 10 other states. Allthe financial-cost components of the malaria-control operations carried out in the previous 6 months and the results of the control operations themselves (including the numbers of houses sprayed and numbers of bednets impregnated/day) were recorded. The information was stratified according to whether the target communities were 'near' or 'far away' from an operational base, the far-away communities being those that needed overnight stays by the control staff. The main variables analysed were unit costs/house treated, and annual cost/person protected. The results show that house spraying was generally more expensive for the health services than bednet impregnation. This is particularly the case in 'nearby' communities, where most of those at-risk live. In such communities, spraying one house was 7.2 times more expensive than impregnating one bednet. Even if only those sleeping under an impregnated net were assumed to be protected, the unit costs/person protected in a 'nearby' community were twice as high for house spraying than for bednet impregnation. In 'nearby' communities, where technicians could return to the operational base each evening, insecticides made up 80% of the total spraying costs and 42% of the costs of bednet impregnation. In 'far-away' communities, however, salaries and 'per diems' were the most important cost components, representing, respectively, 23% and 22% of the costs of spraying, and 34% plus 27% of the costs of impregnation. Insecticide wastage and non-use of discounts on insecticide prices (available through the

  14. Determining and addressing obstacles to the effective use of long-lasting insecticide-impregnated nets in rural Tanzania

    Directory of Open Access Journals (Sweden)

    Benziger Peter W

    2009-12-01

    Full Text Available Abstract Background The objective of this project was to achieve high, sustainable levels of net coverage in a village in rural Tanzania by combining free distribution of long-lasting insecticide-impregnated nets (LLINs with community-tailored education. In Tanzania, malaria is the leading cause of morbidity and mortality. Although malaria bed nets have a well-established role in reducing disease burden, few rural households have access to nets, and effective use depends on personal practices and attitudes. Methods Five practices and attitudes inconsistent with effective LLIN use were identified from household interviews (n = 10. A randomized survey of villagers (n = 132 verified local prevalence of these practices and attitudes. Community leaders held an educational session for two members of every household addressing these practice and attitudes, demonstrating proper LLIN use, and emphasizing behaviour modification. Attendees received one or two LLINs per household. Surveys distributed three weeks (n = 104 and 15 months (n = 104 post-intervention assessed corrected practices and attitudes. Project efficacy was defined by correction of baseline practices and attitudes as well as high rates of reported daily net use, with statistical significance determined by chi-square test. Results Baseline interviews and surveys revealed incorrect practices and attitudes regarding 1 use of nets in dry season, 2 need to retreat LLINs, 3 children napping under nets, 4 need to repair nets, and 5 net procurement as a priority, with 53- 88.6% incorrect responses (11.4-47% correct responses. A three-week follow-up demonstrated 83-95% correct responses. Fifteen-month follow-up showed statistically significant (p Conclusions Results suggest that addressing community-specific practices and attitudes prior to LLIN distribution promotes consistent and correct use, and helps change attitudes towards bed nets as a preventative health measure. Future LLIN distributions

  15. Use of insecticide-impregnated mosquito nets and other impregnated materials for malaria control in the Americas Uso de mosquiteros y otros materiales impregnados para el control de la malaria en las Américas

    Directory of Open Access Journals (Sweden)

    R. H. Zimmerman

    1997-07-01

    Full Text Available This article reviews the current status of the use of insecticide-impregnated mosquito nets and other impregnated materials in the Americas. Studies from Brazil, Colombia, Ecuador, Guatemala, Peru, Suriname, and Venezuela are examined. It is concluded that most studies have suffered from experimental design errors, short duration problems, and/or inadequate measurement of health indicators. The review brings out the great difficulty of conducting scientific studies that attempt to measure the impact of insecticide-treated materials on malaria incidence. In particular, the low incidence of malaria in the Americas, the high prevalences of P. vivax and relapsing cases, and the relationship between human activity patterns and the crepuscular biting patterns of certain malaria vectors stand in the way of easy experimental design and execution. The utilization of impregnated mosquito nets or other impregnated materials as a major component of an integrated malaria control program would be premature at this time. However, it is recommended that well-conceived large-scale trials and interventions be considered when they are based on a thorough understanding of the dynamics of malaria transmission in the area of study.En este artículo se revisa el uso actual en las Américas de mosquiteros y otros materiales impregnados con insecticida. Se examinan diversos estudios efectuados en el Brasil, Colombia, Ecuador, Guatemala, Perú, Suriname y Venezuela y se llega a la conclusión de que en su mayor parte estos estudios adolecen de graves deficiencias de diseño, problemas de excesiva brevedad, o de una medición inadecuada de los indicadores de salud. La revisión resalta la gran dificultad de llevar a cabo estudios que buscan medir el impacto de los materiales tratados con insecticidas sobre la incidencia de malaria. En particular, la baja incidencia de malaria en las Américas, las altas prevalencias de Plasmodium vivax y de casos recurrentes y la relaci

  16. Insecticidal, acaricidal and repellent effects of DEET- and IR3535-impregnated bed nets using a novel long-lasting polymer-coating technique.

    Science.gov (United States)

    Faulde, Michael K; Albiez, Gunther; Nehring, Oliver

    2010-03-01

    A novel long-lasting repellent-treated net (LLRTN) has been designed by binding the skin repellents N,N-diethyl-m-toluamide (DEET), or IR3535, onto the fibres of bed net fabric using a new polymer-coating technique. The repellent toxicological effectiveness and residual activity of a factory-based repellent-impregnated fabric has been evaluated by laboratory testing against adult Aedes aegypti mosquitoes and nymphal Ixodes ricinus ticks. By using this repellent-embedding impregnation technique, concentrations exceeding 10 g/m(2) could be achieved with one single polymer layer. Both DEET- and IR3535-impregnated fabrics revealed a dose-dependent insecticidal as well as acaricidal activity. One hundred percent knockdown times of DEET-treated bed nets ranged from 187.5 +/- 31.8 to 27.5 +/- 3.5 min against A. aegypti, and between 214 +/- 47 and 22.6 +/- 5 min against nymphal I. ricinus, linked to a DEET concentration of 1.08 and 10.58 g/m(2), respectively. With IR3535, A. aegypti produced dose-dependent 100% knockdown times varying from 87.5 +/- 10.6 to 57.5 +/- 3.5 min and between 131.4 +/- 6.5 and 33.8 +/- 5 min against nymphal I. ricinus, respectively, linked to concentrations between 1.59 and 10.02 g/m(2). One hundred percent repellency measured by complete landing and biting protection of impregnated fabric by using the arm-in-cage test could be achieved at DEET concentrations exceeding 3.7 to 3.9 g/m(2), and for IR3535 concentrations over 10 g/m(2). One hundred percent landing and biting protection could be preserved with DEET-treated fabrics for 29 weeks at an initial concentration of 4.66 g/m(2), 54 weeks at 8.8 g/m(2), 58 weeks at 9.96 g/m(2) and 61 weeks at 10.48 g/m(2) for DEET, and 23 weeks for IR3535-treated fabric at a concentration of 10.02 g/m(2). Unlike repellent-treated fabric, a brand of a commercially available long-lasting insecticide-treated net tested containing 500 mg permethrin/m(2) did not protect from mosquito bites. First results on

  17. Uso de mosquiteros y otros materiales impregnados con insecticida para el control de la malaria en las Américas Use of insecticide-impregnated mosquito nets and other impregnated materials for malaria control in the Americas

    Directory of Open Access Journals (Sweden)

    R. H. Zimmerman

    1997-01-01

    Full Text Available En el presente artículo se analiza el uso actual de mosquiteros y de otros materiales impregnados con insecticida en las Américas. Se examinan diversos estudios efectuados en Brasil, Colombia, Ecuador, Guatemala, Perú, Suriname y Venezuela y se llega a la conclusión de que, en su mayor parte, estos estudios adolecen de graves deficiencias de diseño experimental, problemas de excesiva brevedad, y medición inadecuada de indicadores de salud. En el análisis se resalta la gran dificultad de llevar a cabo estudios científicos que buscan determinar el efecto de los materiales tratados con insecticida en la incidencia de malaria. En particular, la baja incidencia de malaria en las Américas, la elevada prevalencia de Plasmodium vivax y de casos recurrentes, y la relación existente entre los patrones de actividad del ser humano y los hábitos de picadura crepusculares de ciertos vectores de la malaria impiden hacer experimentos de fácil diseño y ejecución. Por ahora sería prematuro usar mosquiteros u otros materiales impregnados con insecticida como componentes principales de un programa integral para el control de la malaria. No obstante, se recomienda que se considere la posibilidad de realizar ensayos e intervenciones bien diseñados a gran escala, siempre que se basen en un conocimiento profundo de la dinámica de la transmisión de la malaria en la zona en estudio.This article reviews the current status of insecticide-impregnated mosquito nets and other impregnated materials in the Americas. Studies from Brazil, Colombia, Ecuador, Guatemala, Peru, Suriname, and Venezuela are examined. It is concluded that most studies have suffered from experimental design errors, short duration problems, and/or inadequate measurement of health indicators. The review brings out the great difficulty of conducting scientific studies that attempt to measure the impact of insecticide-treated materials on malaria incidence. In particular, the low incidence

  18. Water curtain

    Energy Technology Data Exchange (ETDEWEB)

    Kutepov, A.I.; Fedotov, I.N.; Prokopov, O.I.

    1982-01-01

    The patented water curtain is used to eliminate gas-oil gushers and is distinguished by the fact that in order to simplify operation, the water-line collector is made out of two symmetrical parts installed with the possibility of relative rotation. The collector is equipped with at least one pipe arranged in the zone of the collector and has openings for the supply of water.

  19. Benefit of insecticide-treated nets, curtains and screening on vector borne diseases, excluding malaria: a systematic review and meta-analysis

    NARCIS (Netherlands)

    Wilson, A.L.; Dhiman, R.C.; Kitron, U.; Scott, T.W.; Berg, van den H.; Lindsay, S.W.

    2014-01-01

    Introduction Insecticide-treated nets (ITNs) are one of the main interventions used for malaria control. However, these nets may also be effective against other vector borne diseases (VBDs). We conducted a systematic review and meta-analysis to estimate the efficacy of ITNs, insecticide-treated

  20. Timber Curtain

    DEFF Research Database (Denmark)

    2015-01-01

    Timber Curtain is a site specific architectural installation, which is part of a research project conducted at the Aarhus School of Architecture as collaboration between Ph.D. and associate professor Niels Martin Larsen and the author. Through a digitally scripted associative model we performed s...... of pinewood timber, machined with a CMS Antares 5-axis CNC router. The digital process generation and simulation was implemented with Rhinoceros 3D, Grasshopper and GHPython, and AlphaCAM was used for preparing the CNC-routing....

  1. The additional benefit of residual spraying and insecticide-treated curtains for dengue control over current best practice in Cuba: Evaluation of disease incidence in a cluster randomized trial in a low burden setting with intensive routine control.

    Science.gov (United States)

    Toledo, Maria Eugenia; Vanlerberghe, Veerle; Rosales, Julio Popa; Mirabal, Mayelin; Cabrera, Pedro; Fonseca, Viviana; Gómez Padrón, Tania; Pérez Menzies, Mirtha; Montada, Domingo; Van der Stuyft, Patrick

    2017-11-01

    Aedes control interventions are considered the cornerstone of dengue control programmes, but there is scarce evidence on their effect on disease. We set-up a cluster randomized controlled trial in Santiago de Cuba to evaluate the entomological and epidemiological effectiveness of periodical intra- and peri-domiciliary residual insecticide (deltamethrin) treatment (RIT) and long lasting insecticide treated curtains (ITC). Sixty three clusters (around 250 households each) were randomly allocated to two intervention (RIT and ITC) and one control arm. Routine Aedes control activities (entomological surveillance, source reduction, selective adulticiding, health education) were applied in the whole study area. The outcome measures were clinical dengue case incidence and immature Aedes infestation. Effectiveness of tools was evaluated using a generalized linear regression model with a negative binomial link function. Despite significant reduction in Aedes indices (Rate Ratio (RR) 0.54 (95%CI 0.32-0.89) in the first month after RIT, the effect faded out over time and dengue incidence was not reduced. Overall, in this setting there was no protective effect of RIT or ITC over routine in the 17months intervention period, with for house index RR of 1.16 (95%CI 0.96-1.40) and 1.25 (95%CI 1.03-1.50) and for dengue incidence RR of 1.43 (95%CI 1.08-1.90) and 0.96 (95%CI 0.72-1.28) respectively. The monthly dengue incidence rate (IR) at cluster level was best explained by epidemic periods (Incidence Rate Ratio (IRR) 5.50 (95%CI 4.14-7.31)), the IR in bordering houseblocks (IRR 1.03 (95%CI 1.02-1.04)) and the IR pre-intervention (IRR 1.02 (95%CI 1.00-1.04)). Adding RIT to an intensive routine Aedes control programme has a transient effect on the already moderate low entomological infestation levels, while ITC did not have any effect. For both interventions, we didn't evidence impact on disease incidence. Further studies are needed to evaluate impact in settings with high Aedes

  2. Radiation shielding curtain

    International Nuclear Information System (INIS)

    Winkler, N.T.

    1976-01-01

    A radiation shield is described in the form of a stranded curtain made up of bead-chains whose material and geometry are selected to produce a cross-sectional density that is the equivalent of 0.25 mm or more of lead and which curtain may be mounted on various radiological devices to shield against scattered radiation while offering a minimum of obstruction to the radiologist

  3. Retrofit curtain for overhead doors

    Energy Technology Data Exchange (ETDEWEB)

    Leckie, R E

    1987-12-29

    A heat insulating curtain has been developed for reducing heat losses through overhead doors of the type commonly found in industrial warehouses. The curtain consists of a reinforced polyester fabric attached to the outside top of the overhead door and moves with the door as it opens and closes. A T-shaped edge track seals the edges of the curtain to the door frame; the edge of the curtain is also T-shaped and runs up and down the track as the curtain is raised and lowered. The curtain fabric is ultraviolet resistant, durable, flexible, and transparent, and transforms the door into a solar collector which provides solar heated air to the building interior. Two curtains have been satisfactorily installed and tested at a warehouse in Calgary, Alberta. A market evaluation study was conducted to determine the possible buyers for such a door curtain. A target market consisting of those wishing to fix old, leaky doors was selected and a marketing strategy developed. The described strategy includes product development, pricing, distribution, promotion, and advertising. 2 figs., 1 tab.

  4. Electrostatic curtain studies

    International Nuclear Information System (INIS)

    Meyer, L.C.

    1992-05-01

    This report presents the results of experiments using electrostatic curtains (ESCS) as a transuranic (TRU) contamination control technique. The TRU contaminants included small (micrometer to sub micrometer) particles of plutonium and americium compounds associated with defense-related waste. Three series of experiments were conducted. The first was with uncontaminated Idaho National Engineering Laboratory (INEL) soil, the second used contaminated soil containing plutonium-239 (from a mixture of Rocky Flats Plant contaminated soil and INEL uncontaminated soil), and the third was uncontaminated INEL soil spiked with plutonium-239. All experiments with contaminated soil were conducted inside a glove box containing a dust generator, low volume cascade impactor (LVCI), electrostatic separator, and electrostatic materials. The data for these experiments consisted of the mass of dust collected on the various material coupons, plates, and filters; radiochemical analysis of selected samples; and photographs, as well as computer printouts giving particle size distributions and dimensions from the scanning electron microscope (SEM). The following results were found: (a) plutonium content (pCi/g) was found to increase with smaller soil particle sizes and (b) the electrostatic field had a stronger influence on smaller particle sizes compared to larger particle sizes. The SEM analysis indicated that the particle size of the tracer Pu239 used in the spiked soil experiments was below the detectable size limit (0.5 μm) of the SEM and, thus, may not be representative of plutonium particles found in defense-related waste. The use of radiochemical analysis indicated that plutonium could be found on separator plates of both polarities, as well as passing through the electric field and collecting on LVCI filters

  5. Overview of fire curtains in construction

    Directory of Open Access Journals (Sweden)

    Nedryshkin Oleg

    2016-01-01

    Full Text Available A fire curtain is use where, if there is a fire, it is necessary to create a temporary barrier within an opening, which seals off the area on fire. The curtain descends and prevents any fire and smoke from spreading from one area to another. It also allows people access to protected escape routes without any loss of fire resistance. The paper aims to presents the results of analysis of the scientific literature on the subject of fire curtains.

  6. Mixture for Controlling Insecticide-Resistant Malaria Vectors

    OpenAIRE

    Pennetier, Cédric; Costantini, Carlo; Corbel, Vincent; Licciardi, Séverine; Dabire, R. K.; Lapied, B.; Chandre, Fabrice; Hougard, Jean-Marc

    2008-01-01

    The spread of resistance to pyrethroids in the major Afrotropical malaria vectors Anopheles gambiae s.s. necessitates the development of new strategies to control resistant mosquito populations. To test the efficacy of nets treated with repellent and insecticide against susceptible and insecticide-resistant An. gambiae mosquito populations, we impregnated mosquito bed nets with an insect repellent mixed with a low dose of organophosphorous insecticide and tested them in a rice-growing area ne...

  7. Effect of Viscosity on Liquid Curtain Stability

    Science.gov (United States)

    Mohammad Karim, Alireza; Suszynski, Wieslaw; Francis, Lorraine; Carvalho, Marcio; Dow Chemical Company Collaboration; PUC Rio Collaboration; University of Minnesota, Twin Cities Collaboration

    2016-11-01

    The effect of viscosity on the stability of Newtonian liquid curtains was explored by high-speed visualization. Glycerol/water solutions with viscosity ranging from 19.1 to 210 mPa.s were used as coating liquids. The experimental set-up used a slide die delivery and steel tube edge guides. The velocity along curtain at different positions was measured by tracking small particles at different flow conditions. The measurements revealed that away from edge guides, velocity is well described by free fall effect. However, close to edge guides, liquid moves slower, revealing formation of a viscous boundary layer. The size of boundary layer and velocity near edge guides are strong function of viscosity. The critical condition was determined by examining flow rate below which curtain broke. Curtain failure was initiated by growth of a hole within liquid curtain, close to edge guides. Visualization results showed that the hole forms in a circular shape then becomes elliptical as it grows faster in vertical direction compared to horizontal direction. As viscosity rises, minimum flow rate for destabilization of curtain increased, indicating connection between interaction with edge guides and curtain stability. We would like to acknowledge the financial support from the Dow Chemical Company.

  8. Study of the efficacy of a Wheaton coated bottle with permethrin and deltamethrin in laboratory conditions and a WHO impregnated paper with bendiocarb in field conditions

    Directory of Open Access Journals (Sweden)

    Nazaire Aïzoun

    2014-06-01

    Conclusions: The day storage and the number of times that a WHO impregnated paper and a CDC coated bottle maintained their efficacy are useful in the assessment of insecticide vectors susceptibility tests.

  9. The Stars behind the Curtain

    Science.gov (United States)

    2010-02-01

    ESO is releasing a magnificent VLT image of the giant stellar nursery surrounding NGC 3603, in which stars are continuously being born. Embedded in this scenic nebula is one of the most luminous and most compact clusters of young, massive stars in our Milky Way, which therefore serves as an excellent "local" analogue of very active star-forming regions in other galaxies. The cluster also hosts the most massive star to be "weighed" so far. NGC 3603 is a starburst region: a cosmic factory where stars form frantically from the nebula's extended clouds of gas and dust. Located 22 000 light-years away from the Sun, it is the closest region of this kind known in our galaxy, providing astronomers with a local test bed for studying intense star formation processes, very common in other galaxies, but hard to observe in detail because of their great distance from us. The nebula owes its shape to the intense light and winds coming from the young, massive stars which lift the curtains of gas and clouds revealing a multitude of glowing suns. The central cluster of stars inside NGC 3603 harbours thousands of stars of all sorts (eso9946): the majority have masses similar to or less than that of our Sun, but most spectacular are several of the very massive stars that are close to the end of their lives. Several blue supergiant stars crowd into a volume of less than a cubic light-year, along with three so-called Wolf-Rayet stars - extremely bright and massive stars that are ejecting vast amounts of material before finishing off in glorious explosions known as supernovae. Using another recent set of observations performed with the SINFONI instrument on ESO's Very Large Telescope (VLT), astronomers have confirmed that one of these stars is about 120 times more massive than our Sun, standing out as the most massive star known so far in the Milky Way [1]. The clouds of NGC 3603 provide us with a family picture of stars in different stages of their life, with gaseous structures that are

  10. Scientific communication across the Iron Curtain

    CERN Document Server

    Hollings, Christopher D

    2016-01-01

    This monograph provides a concise introduction to the tangled issues of communication between Russian and Western scientists during the Cold War. It details the extent to which mid-twentieth-century researchers and practitioners were able to communicate with their counterparts on the opposite side of the Iron Curtain. Drawing upon evidence from a range of disciplines, a decade-by-decade account is first given of the varying levels of contact that existed via private correspondence and conference attendance. Next, the book examines the exchange of publications and the availability of one side's work in the libraries of the other. It then goes on to compare general language abilities on opposite sides of the Iron Curtain, with comments on efforts in the West to learn Russian and the systematic translation of Russian work. In the end, author Christopher Hollings argues that physical accessibility was generally good in both directions, but that Western scientists were afflicted by greater linguistic difficultie...

  11. Timber Curtain: Designing with material capabilities

    DEFF Research Database (Denmark)

    Lahmy, Maya; Larsen, Niels Martin

    2015-01-01

    of the generative phase to fabrication of the artefact. Brought together by various conceptual and structural elements the Timber Curtain forms a 4.5 x 2.5 x 0.5 m construct of assembled wood components, digitally crafted through advanced production techniques. Concerned with materiality and processing of the wood......Timber Curtain explores relations between digital precision and material indeterminacy. It is an installation engaging spatially through its presence as a 1:1 architectural component as well as it is exploring novel technologies in the architectural design process from the very beginning...... an associative digital model that could gather and compute in put from material behaviour and out put manufacturing data was scripted. This method enables material capacity to be pushed to the limit of its performance allowing novel sensuous and structural qualities to emerge. The method is developed with use...

  12. Qualitative evaluation of same insecticides sold in Kinshasa and users behavior survey

    International Nuclear Information System (INIS)

    Basilua, K.; Essassi El, M.; Himmi, O.; Said Gmouh; Watsenga, T.

    2009-01-01

    Malaria is a serious public health problem in the tropical countries and particularly into Kinshasa. Anopheles gambiae sl. is the mean vector of this illness. The use of impregnated bednets is the national strategy; the chemical insecticides are used too in figthing the malaria vectors. The survey carried out on 144 households randomly selected in Kinshasa have showed that 61,1% are favourable with using bednets insecticide impregnated and 96,5% of these households use too chemical insecticides, meanly the pyrethroids one (90,5%) and the organophosphates (9,5%). Mass spectrometer analysis revealed that 87,5% of identified insecticides, essentially pyrethroinids have tetramethrine as active substance; the dichlorvos is the only one to be detected as organophosphate and that in some insecticides, the detected molecules are not avowed or different from those avowed or different from those avowed by the manufacturer.

  13. Drawing the Curtain on Enceladus' South-Polar Eruptions

    Science.gov (United States)

    Spitale, Joseph N.; Hurford, Terry A.; Rhoden, Alyssa R.; Berkson, Emily E.; Platts, Symeon S.

    2015-11-01

    For a comprehensive description of Enceladus' south-polar eruptions observed at high resolution, they must be represented as broad curtains rather than discrete jets. Meanders in the fractures from which the curtains of material erupt give rise to optical illusions that look like discrete jets, even along fractures with no local variations in eruptive activity, implying that many features previously identified as "jets" are in fact phantoms. By comparing Cassini images with model curtain eruptions, we are able to obtain maps of eruptive activity that are not biased by the presence of those phantom jets. The average of our activity maps over all times agrees well with thermal maps produced by Cassini CIRS. We can best explain the observed curtains by assuming spreading angles with altitude of up to 14° and zenith angles of up to 8°, for curtains observed in geometries that are sensitive to those quantities.

  14. Air curtain incinerator equipment performance evaluation report

    Energy Technology Data Exchange (ETDEWEB)

    1987-01-01

    About 50 tonnes of oil-contaminated debris and related wood products were successfully incinerated in a 10-h performance evaluation of a mobile air curtain incinerator. The test was conducted to evaluate the incinerator's ability to combust oil-contaminated trash and debris obtained from oil spill sites. The operating principle of the apparatus involves a diesel engine driving an air blower to deliver ca 20,000 scfm of air into a 5-m long manifold angled at a 30{degree} slope into an incineration tank. A bottomhole aerator is lowered to the bottom of the tank and compressed air is injected into the aerator to control burn efficiency. The blower is engaged once the debris in the tank is burning sufficiently after starting a fire in the debris. The air curtain effect created by the air deflecting off the opposite wall from the blower manifold and bouncing off the bottom and up the side of the incineration tank results in repeated combustion of the gases, thereby significantly reducing the degree of visible smoke emission. The unit is capable of incinerating ca 5 tonnes/h and of generating ca 16 m{sup 3}/h of hot water which can be used for flushing spill sites and cleaning shorelines. 12 figs.

  15. Acoustic assessment of speech privacy curtains in two nursing units.

    Science.gov (United States)

    Pope, Diana S; Miller-Klein, Erik T

    2016-01-01

    Hospitals have complex soundscapes that create challenges to patient care. Extraneous noise and high reverberation rates impair speech intelligibility, which leads to raised voices. In an unintended spiral, the increasing noise may result in diminished speech privacy, as people speak loudly to be heard over the din. The products available to improve hospital soundscapes include construction materials that absorb sound (acoustic ceiling tiles, carpet, wall insulation) and reduce reverberation rates. Enhanced privacy curtains are now available and offer potential for a relatively simple way to improve speech privacy and speech intelligibility by absorbing sound at the hospital patient's bedside. Acoustic assessments were performed over 2 days on two nursing units with a similar design in the same hospital. One unit was built with the 1970s' standard hospital construction and the other was newly refurbished (2013) with sound-absorbing features. In addition, we determined the effect of an enhanced privacy curtain versus standard privacy curtains using acoustic measures of speech privacy and speech intelligibility indexes. Privacy curtains provided auditory protection for the patients. In general, that protection was increased by the use of enhanced privacy curtains. On an average, the enhanced curtain improved sound absorption from 20% to 30%; however, there was considerable variability, depending on the configuration of the rooms tested. Enhanced privacy curtains provide measureable improvement to the acoustics of patient rooms but cannot overcome larger acoustic design issues. To shorten reverberation time, additional absorption, and compact and more fragmented nursing unit floor plate shapes should be considered.

  16. Acoustic assessment of speech privacy curtains in two nursing units

    Directory of Open Access Journals (Sweden)

    Diana S Pope

    2016-01-01

    Full Text Available Hospitals have complex soundscapes that create challenges to patient care. Extraneous noise and high reverberation rates impair speech intelligibility, which leads to raised voices. In an unintended spiral, the increasing noise may result in diminished speech privacy, as people speak loudly to be heard over the din. The products available to improve hospital soundscapes include construction materials that absorb sound (acoustic ceiling tiles, carpet, wall insulation and reduce reverberation rates. Enhanced privacy curtains are now available and offer potential for a relatively simple way to improve speech privacy and speech intelligibility by absorbing sound at the hospital patient′s bedside. Acoustic assessments were performed over 2 days on two nursing units with a similar design in the same hospital. One unit was built with the 1970s′ standard hospital construction and the other was newly refurbished (2013 with sound-absorbing features. In addition, we determined the effect of an enhanced privacy curtain versus standard privacy curtains using acoustic measures of speech privacy and speech intelligibility indexes. Privacy curtains provided auditory protection for the patients. In general, that protection was increased by the use of enhanced privacy curtains. On an average, the enhanced curtain improved sound absorption from 20% to 30%; however, there was considerable variability, depending on the configuration of the rooms tested. Enhanced privacy curtains provide measureable improvement to the acoustics of patient rooms but cannot overcome larger acoustic design issues. To shorten reverberation time, additional absorption, and compact and more fragmented nursing unit floor plate shapes should be considered.

  17. Acoustic assessment of speech privacy curtains in two nursing units

    Science.gov (United States)

    Pope, Diana S.; Miller-Klein, Erik T.

    2016-01-01

    Hospitals have complex soundscapes that create challenges to patient care. Extraneous noise and high reverberation rates impair speech intelligibility, which leads to raised voices. In an unintended spiral, the increasing noise may result in diminished speech privacy, as people speak loudly to be heard over the din. The products available to improve hospital soundscapes include construction materials that absorb sound (acoustic ceiling tiles, carpet, wall insulation) and reduce reverberation rates. Enhanced privacy curtains are now available and offer potential for a relatively simple way to improve speech privacy and speech intelligibility by absorbing sound at the hospital patient's bedside. Acoustic assessments were performed over 2 days on two nursing units with a similar design in the same hospital. One unit was built with the 1970s’ standard hospital construction and the other was newly refurbished (2013) with sound-absorbing features. In addition, we determined the effect of an enhanced privacy curtain versus standard privacy curtains using acoustic measures of speech privacy and speech intelligibility indexes. Privacy curtains provided auditory protection for the patients. In general, that protection was increased by the use of enhanced privacy curtains. On an average, the enhanced curtain improved sound absorption from 20% to 30%; however, there was considerable variability, depending on the configuration of the rooms tested. Enhanced privacy curtains provide measureable improvement to the acoustics of patient rooms but cannot overcome larger acoustic design issues. To shorten reverberation time, additional absorption, and compact and more fragmented nursing unit floor plate shapes should be considered. PMID:26780959

  18. Baixa aderência e alto custo como fatores de insucesso do uso de mosquiteiros impregnados com inseticida no controle da malária na Amazônia Brasileira Low adherence and high cost as failure factors of impregnated bed nets with insecticide for malaria control in the Brazilian Amazon

    Directory of Open Access Journals (Sweden)

    João Barberino Santos

    1999-08-01

    Full Text Available Em 1992, durante um ensaio com mosquiteiros impregnados com deltametrina, conduzido em Porto Murtinho, município de Costa Marques, Rondônia, na Amazônia Brasileira, analisou-se a aderência e os fatores econômicos capazes de reduzir o impacto do uso de mosquiteiros impregnados sobre a morbidade da malária. Os mosquiteiros impregnados tiveram excelente receptividade pela população local. No entanto, a aderência foi muito baixa, principalmente pelos adultos maiores de 15 anos de idade e, durante a estiagem. O preço do mosquiteiro impregnado foi calculado em US$18,83 para casal e, em US$13,82, para solteiro. Apesar das vantagens econômicas do emprego dos mosquiteiros impregnados em larga escala, desde que subsidiados pelas agências governamentais, a baixa aderência verificada, aliada aos fatores epidemiológicos locais, não permitem indicar o uso de mosquiteiros impregnados como medida de proteção em massa na Amazônia.In 1992 during a trial with deltamethrin-impregnated bed nets conducted in Porto Murtinho, municipality of Costa Marques, Rondonia, in the Brazilian Amazon, we investigated community compliance and the economic aspects capable of reducing the impact of this intervention on malaria morbidity. Impregnated bed nets were well accepted by the local population. However, compliance was found to be very low among adults over 15 years of age and mainly during the dry season. The cost of impregnated bed nets was US$18.83 for double-bed nets and US$13.82 for single bed nets. Despite the economic advantages of using impregnated bed nets subsidized by the government, the low compliance and local epidemiological factors do not allow to indicate the use of impregnated bed nets for mass malaria control in the Amazon region.

  19. Methods for the characterization of impregnating pitches

    Energy Technology Data Exchange (ETDEWEB)

    Compin, S.; Ben Aim, R.; Couderc, P.; Saint-Romain, J.L.

    1987-11-01

    This paper discusses modification of the impregnation performance of various pitches. The filtration ability, which expresses the impregnation performance, was studied using gel permeation chromatography and scanning electron microscopy. 16 refs., 5 figs., 2 tabs.

  20. Effect of Rheological Properties on Liquid Curtain Coating

    Science.gov (United States)

    Mohammad Karim, Alireza; Suszynski, Wieslaw; Griffith, William; Pujari, Saswati; Carvalho, Marcio; Francis, Lorraine; Dow Chemical Company Collaboration; PUC-Rio Collaboration

    2017-11-01

    Curtain coating is one of the preferred methods for high-speed precision application of single-layer and multi-layer coatings in technology. However, uniform coatings are only obtained in a certain range of operating parameters, called coating window. The two main physical mechanisms that limit successful curtain coating are liquid curtain breakup and air entrainment. The rheological properties of the liquid play an important role on these mechanisms, but the fundamental understanding of these relations is still not complete. The effect of rate-dependent shear and extensional viscosities on the stability of viscoelastic and shear thinning liquid curtains were explored by high-speed visualization. Aqueous solutions of polyethylene oxide (PEO) and polyethylene glycol (PEG) were used as viscoelastic liquids. Xanthan Gum in water and glycerol solutions with a range of compositions were used as shear thinning liquids. The critical condition was determined by examining flow rate below which curtain broke. In this work, we also analyze relative importance of rate-dependent shear and extensional viscosity on both curtain breakup and air entrainment. We would like to acknowledge the financial support from the Dow Chemical Company.

  1. Controlling allergens in animal rooms by using curtains

    DEFF Research Database (Denmark)

    Krohn, Thomas Cæcius; Itter, Gabi; Fosse, Richard

    2006-01-01

    The reduction and control of allergens in the animal facility is important for staff working with laboratory animals. This study was designed to evaluate the efficiency of perforated Makrolon curtains in front of racks as a method to reduce the amount of allergen in the animal room. The experimen......The reduction and control of allergens in the animal facility is important for staff working with laboratory animals. This study was designed to evaluate the efficiency of perforated Makrolon curtains in front of racks as a method to reduce the amount of allergen in the animal room....... The experimental situation we studied provides some information regarding allergen disposition in animal rooms but is clearly artificial and does not reflect a typical, ‘real-world’ environment in terms of preventing exposure of workers to allergens. Plastic curtains with holes were placed in front of racks......, and a corridor between the racks and a curtain was present. The room was ventilated with air, which was blown into the room through the middle of the corridor, flowing downstream and passing through the holes in the curtain. This set-up resulted in air flow from the corridor through the curtain. Air samples were...

  2. Impregnation transition in a powder

    Science.gov (United States)

    Raux, Pascal; Cockenpot, Heloise; Quere, David; Clanet, Christophe

    2011-11-01

    When an initially dry pile of micrometrical grains comes into contact with a liquid, one can observe different behaviors, function of the wetting properties. If the contact angle with the solid is low, the liquid will invade the pile (impregnation), while for higher contact angles, the grains will stay dry. We present an experimental study of this phenomenon: a dry pile of glass beads is deposed on the liquid surface, and we vary the contact angle of the liquid on the grains. We report a critical contact angle below which impregnation always occurs, and develop a model to explain its value. Different parameters modifying this critical contact angle are also investigated. Collaboration with Marco Ramaioli, Nestle Research Center, Lausanne, Switzerland.

  3. Oil-Impregnated Polyethylene Films

    Science.gov (United States)

    Mukherjee, Ranit; Habibi, Mohammad; Rashed, Ziad; Berbert, Otacilio; Shi, Shawn; Boreyko, Jonathan

    2017-11-01

    Slippery liquid-infused porous surfaces (SLIPS) minimize the contact angle hysteresis of a wide range of liquids and aqueous food products. Although hydrophobic polymers are often used as the porous substrate for SLIPS, the choice of polymer has been limited to silicone-based or fluorine-based materials. Hydrocarbon-based polymers, such as polyethylene, are cost effective and widely used in food packaging applications where SLIPS would be highly desirable. However, to date there have been no reports on using polyethylene as a SLIPS substrate, as it is considered highly impermeable. Here, we show that thin films of low-density polyethylene can be stably impregnated with carbon-based oils without requiring any surface modification. Wicking tests reveal that oils with sufficient chemical compatibility follow Washburn's equation. The nanometric effective pore size of the polyethylene does result in a very low wicking speed, but by using micro-thin films and a drawdown coater, impregnation can still be completed in under one second. The oil-impregnated polyethylene films promoted ultra-slippery behavior for water, ketchup, and yogurt while remaining durable even after being submerged in ketchup for over one month. This work was supported by Bemis North America (AT-23981).

  4. Experimental investigation of hysteresis in the break-up of liquid curtains

    KAUST Repository

    Marston, Jeremy; Thoroddsen, Sigurdur T; Thompson, John W.; Blyth, Mark G.; Henry, Daniel; Uddin, Jamal

    2014-01-01

    Findings from an experimental investigation of the break-up of liquid curtains are reported, with the overall aim of examining stability windows for multi-layer liquid curtains composed of Newtonian fluids, where the properties of each layer can

  5. Insecticide solvents: interference with insecticidal action.

    Science.gov (United States)

    Brattsten, L B; Wilkinson, C F

    1977-06-10

    Several commercial solvent mixtures commonly used as insecticide carriers in spray formulations increase by more than threefold the microsomal N-demethylation of p-chloro N-methylaniline in midgut preparations of southern army-worm (Spodoptera eridania) larvae exposed orally to the test solvents. Under laboratory conditions, the same solvent mixtures exhibit a protective action against the in vivo toxicity of the insecticide carbaryl to the larvae. The data are discussed with respect to possible solvent-insecticide interactions occurring under field conditions and, more broadly, to potential toxicological hazards of these solvents to humans.

  6. Curtain Antenna Array Simulation Research Based on MATLAB

    Directory of Open Access Journals (Sweden)

    Hongbo LIU

    2014-01-01

    Full Text Available For the radiating capacity of curtain antenna array, this paper constructs a three- line-four-column curtain antenna array using cage antenna as the antenna array element and obtains a normalizing 3D radiation patterns through conducting simulation with MATLAB. Meanwhile, the relationships between the antenna spacing and the largest directivity coefficient, as well as the communication frequency and largest directivity coefficient are analyzed in this paper. It turns out that the max value will generate when the antenna spacing is around 18 m and the best communication effect will be achieved when the communication frequency is about 12.4 MHz.

  7. Solar collector wall with active curtain system; Lasikatteinen massiivienen aurinkokeraeaejaeseinae

    Energy Technology Data Exchange (ETDEWEB)

    Ojanen, T.; Heimonen, I. [VTT Building Technology, Espoo (Finland). Building Physics, Building Services and Fire Technology

    1998-12-01

    Integration of solar collector into the building envelope structure brings many advantages. The disadvantage of a passive solar collector wall is that its thermal performance can not be controlled, which may cause temporary overheating and low thermal efficiency of the collector. The thermal performance of the collector wall can be improved by using controllable, active collector systems. In this paper a solar collector wall with a controllable curtain between the transparent and absorption layers is investigated. The curtain is made of several low-emissivity foil layers, which ensures low radiation heat transfer through the curtain. The curtain decreases the heat losses out from the collector wall and it improves the U-value of the wall. The curtain is used when the solar radiation intensity to the wall is not high enough or when the wall needs protection against overheating during warm weather conditions. The materials and building components used in the collector wall, except those of the curtain, are ordinary in buildings. The transparent layer can be made by using normal glazing technology and the thermal storage layer can be made out of brick or similar material. The solar energy gains through the glazing can be utilised better than in passive systems, because the curtain provides the wall with high thermal resistance outside the solar radiation periods. The thermal performance of the collector wall was studied experimentally using a Hot-Box apparatus equipped with a solar lamp. Numerical simulations were carried out to study the yearly performance of the collector wall under real climate conditions. The objectives were to determine the thermal performance of the collector wall and to study how to optimise the use of solar radiation in this system. When the curtain with high thermal resistance is used actively, the temperature level of the thermal storage layer in the wall is relatively high also during dark periods and the heat losses out from the storage

  8. 40 CFR 60.1445 - What are the emission limits for air curtain incinerators that burn 100 percent yard waste?

    Science.gov (United States)

    2010-07-01

    ... curtain incinerators that burn 100 percent yard waste? 60.1445 Section 60.1445 Protection of Environment... Air Curtain Incinerators That Burn 100 Percent Yard Waste § 60.1445 What are the emission limits for air curtain incinerators that burn 100 percent yard waste? If your air curtain incinerator combusts...

  9. The Solar Dynamic Buffer Zone (SDBZ) curtain wall: Validation and design of a solar air collector curtain wall

    Science.gov (United States)

    Richman, Russell Corey

    Given the increases in both the environmental and economic costs of energy, there is a need to design and building more sustainable and low-energy building systems now. Curtain wall assemblies show great promise---the spandrel panels within them can be natural solar collectors. By using a Solar Dynamic Buffer Zone (SDBZ) in the spandrel cavity, solar energy can be efficiently gathered using the movement of air. There is a need for a numerical model capable of predicting performance of an SDBZ Curtain Wall system. This research designed, constructed and quantified a prototype SDBZ curtain wall system through by experimental testing in a laboratory environment. The laboratory experiments focussed on three main variables: air flow through the system, incoming radiation and collector surface type. Results from the experimental testing were used to validate a one-dimensional numerical model of the prototype. Results from this research show a SDBZ curtain wall system as an effective means of reducing building heating energy consumption through the preheating of incoming exterior ventilation air during the heating season in cold climates. The numerical model showed good correlation with experimental results at higher operating flows and at lower flows when using an apparent velocity at the heat transfer boundary layer. A seasonal simulation for Toronto, ON predicted energy savings of 205 kWh/m2 with an average seasonal efficiency of 28%. This is considered in the upper range when compared to other solar air collectors. Given the lack of published literature for similar systems, this research acts to introduce a simple, innovative approach to collect solar energy that would otherwise be lost to the exterior using already existing components within a curtain wall. Specifically, the research has provided: results from experiments and simulation, a first generation numerical model, aspects of design and construction of the SDBZ curtain wall and specific directions for further

  10. Winston Churchill's "Iron Curtain" Address: Implications for the Present.

    Science.gov (United States)

    Bush, George

    1988-01-01

    Evaluates the "Iron Curtain" speech made by Winston Churchill in 1946, discussing its relevance and implications for the present. Examines Churchill's predictions for the future and his assessment of the USSR. Reviews world developments since the speech and proposes foreign policy goals for the next 40 years. (GEA)

  11. Flow of a falling liquid curtain onto a moving substrate

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yekun; Itoh, Masahiro [Graduate school of Engineering Mechanics and Systems, University of Tsukuba, Tsukuba, Ibaraki 302-8573 (Japan); Kyotoh, Harumichi, E-mail: yekunliu@hotmail.com [Division of Engineering Mechanics and Systems, University of Tsukuba, Tsukuba, Ibaraki 302-8573 (Japan)

    2017-10-15

    In this study, we investigate a low-Weber-number flow of a liquid curtain bridged between two vertical edge guides and the upper surface of a moving substrate. Surface waves are observed on the liquid curtain, which are generated due to a large pressure difference between the inner and outer region of the meniscus on the substrate, and propagate upstream. They are categorized as varicose waves that propagate upstream on the curtain and become stationary because of the downstream flow. The Kistler’s equation, which governs the flow in thin liquid curtains, is solved under the downstream boundary conditions, and the numerical solutions are studied carefully. The solutions are categorized into three cases depending on the boundary conditions. The stability of the varicose waves is also discussed as wavelets were observed on these waves. The two types of modes staggered and peak-valley patterns are considered in the present study, and they depend on the Reynolds number, the Weber number, and the amplitude of the surface waves. The former is observed in our experiment, while the latter is predicted by our calculation. Both the types of modes can be derived using the equations with periodic coefficients that originated from the periodic base flow due to the varicose waves. The stability analysis of the waves shows that the appearance of the peak-valley pattern requires a significantly greater amplitude of the waves, and a significantly higher Weber number and Reynolds number compared to the condition in which the staggered pattern is observed. (paper)

  12. Flow of a falling liquid curtain onto a moving substrate

    International Nuclear Information System (INIS)

    Liu, Yekun; Itoh, Masahiro; Kyotoh, Harumichi

    2017-01-01

    In this study, we investigate a low-Weber-number flow of a liquid curtain bridged between two vertical edge guides and the upper surface of a moving substrate. Surface waves are observed on the liquid curtain, which are generated due to a large pressure difference between the inner and outer region of the meniscus on the substrate, and propagate upstream. They are categorized as varicose waves that propagate upstream on the curtain and become stationary because of the downstream flow. The Kistler’s equation, which governs the flow in thin liquid curtains, is solved under the downstream boundary conditions, and the numerical solutions are studied carefully. The solutions are categorized into three cases depending on the boundary conditions. The stability of the varicose waves is also discussed as wavelets were observed on these waves. The two types of modes staggered and peak-valley patterns are considered in the present study, and they depend on the Reynolds number, the Weber number, and the amplitude of the surface waves. The former is observed in our experiment, while the latter is predicted by our calculation. Both the types of modes can be derived using the equations with periodic coefficients that originated from the periodic base flow due to the varicose waves. The stability analysis of the waves shows that the appearance of the peak-valley pattern requires a significantly greater amplitude of the waves, and a significantly higher Weber number and Reynolds number compared to the condition in which the staggered pattern is observed. (paper)

  13. Detailed analysis of turbulent flows in air curtains

    NARCIS (Netherlands)

    Jaramillo, Julian E.; Perez-Segarra, Carlos D.; Lehmkuhl, Oriol; Castro, Jesus

    2011-01-01

    In order to prevent entrainment, an air curtain should provide a jet with low turbulence level, and enough momentum to counteract pressure differences across the opening. Consequently, the analysis of the discharge plenum should be taken into consideration. Hence, the main object of this paper is to

  14. Effect of Air-Curtain Discharge Speed on the Effectiveness of Vortex-like Air-Curtain Approach for Severe Accident Management

    International Nuclear Information System (INIS)

    Ullah, Sana; Yim, Man Sung

    2017-01-01

    The purpose of air-curtain installation is to isolate reactor containment from outside environment, confine the leaking radioactive material in a localized area, and minimize the impact of outside wind. The wind could blow away airborne radioactive material immediately after discharge leaving little room for effective capturing. Therefore, vortex-like air-curtain plays an important role in this process, and its effectiveness could severely influence the performance of overall system. An approach based on vortex-like air-curtain was proposed earlier for preventing spread of radioactive material to the environment and mitigate subsequent radiological consequences. Effect of air-curtain discharge speed, and discharge angle was studied, and a quantitative account of air curtain in terms of effectiveness parameter was performed in this work. It was found that for given wind speed, air-curtain effectiveness would improve with increase in air-curtain discharge speed to an extent, after which any increase in discharge velicity could deteriorate the performance, due to imbalance between discharge and wind speed. Keeping air-curtain discharge at an angle of 15° opposite to the predominant flow direction is devised.

  15. Mobility of adult Tribolium castaneum (Coleoptera: Tenebrionidae) and Rhyzopertha dominica (Coleoptera: Bostrichidae) after exposure to long-lasting insecticide netting

    Science.gov (United States)

    Stored products represent an enormous economic output, but insects regularly immigrate into stored products from the surrounding landscape throughout the post-harvest supply chain. Long-lasting insecticide netting (LLIN), which usually contains an impregnated pyrethroid, has been used as part of a s...

  16. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2002-01-01

    Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...

  17. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2001-01-01

    Behavioral, neurochemical, and immunocytochemical studies characterized the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and permethrin (PM...

  18. Insecticide Exposure in Parkinsonism

    National Research Council Canada - National Science Library

    Bloomquist, Jeffrey

    2003-01-01

    Behavioral, neurochemical, and immunocytochemical studies are characterizing the possible role of insecticide exposure in the etiology of Parkinson's disease as it may relate to Gulf War Syndrome. Chlorpyrifos (CP) and/or permethrin (PM...

  19. 3 Insecticide Use Practice

    African Journals Online (AJOL)

    Administrator

    500,000 metric tonnes in the 1964/1965 season. Problems ... insecticides on the open market. ... effective in the management of insect pests of cocoa. .... Effectiveness and profitability of pest ... Youth in Agriculture; Programme Policy, Strategy.

  20. Insecticides and Biological Control

    Science.gov (United States)

    Furness, G. O.

    1972-01-01

    Use of insecticides has been questioned due to their harmful effects on edible items. Biological control of insects along with other effective practices for checking spread of parasites on crops are discussed. (PS)

  1. Assessment of Adiantum incisum, Alternanthera pungens and Trichodesma indicum as bio-insecticides against stored grain pests

    International Nuclear Information System (INIS)

    Safdar, N.; Yasmin, A.

    2017-01-01

    This study investigated the insecticidal potential of Adiantum incisum Forssk (Pteridaceae), Alternanthera pungens Kunth (Amaranthaceae) and Trichodesma indicum L. (Boraginaceae). Aqueous, methanolic and n-hexane extracts of whole plants (roots, stem and leaves) were prepared using maceration technique. Insecticidal activities of aqueous, methanolic and n-hexane extracts of three plants (10, 20 and 30 mg/mL) were evaluated by impregnated filter paper insecticidal assay. Methanol and hexane extracts of Adiantum incisum gave effective LD 50 (15.3 mg/mL) against Callosobruchus chinensis and Sitophilus oryzae (LD5022 mg/mL) after 24 hours respectively. Present research elucidates the important phytochemicals (alkaloids, saponins and tannins) in three plants by FTIR and good insecticidal activity (LD50 < 25 mg/mL in 24 hours) against Callosobruchus chinensis and Sitophilus oryzae. Current study promotes further investigations for using these plant extracts as anti-feedants, repellents, fumigants and formulation of non-toxic bio-insecticides. (author)

  2. Botanical Insecticides in Plant Protection

    OpenAIRE

    Grdiša, Martina; Gršić, Kristina

    2013-01-01

    Botanical insecticides are natural compounds with insecticidal properties and their use in crop protection is as old as agricultural practice. Although they have been in use for over one hundred years, the advent of synthetic insecticides has unfortunately displaced their use today. Due to fast action, low cost, easy application and efficiency against a wide range of harmful species, synthetic insecticides have become an important part of pest management in modern agricultural systems....

  3. Improving the performance of infrared reflective night curtains for warming field plots

    DEFF Research Database (Denmark)

    Bruhn, Dan; Larsen, Klaus S.; de Dato, Giovanbattista D.

    2013-01-01

    Infrared reflective (IR) curtains have been widely used to obtain passive nighttime warming in field ecosystem experiments in order to simulate and study climate warming effects on ecosystems. For any field installation with IR-reflective curtains in an ecosystem the achieved heating effect depen...

  4. 40 CFR 60.1450 - How must I monitor opacity for air curtain incinerators that burn 100 percent yard waste?

    Science.gov (United States)

    2010-07-01

    ... curtain incinerators that burn 100 percent yard waste? 60.1450 Section 60.1450 Protection of Environment... Air Curtain Incinerators That Burn 100 Percent Yard Waste § 60.1450 How must I monitor opacity for air curtain incinerators that burn 100 percent yard waste? (a) Use EPA Reference Method 9 in appendix A of...

  5. 40 CFR 60.1925 - How must I monitor opacity for air curtain incinerators that burn 100 percent yard waste?

    Science.gov (United States)

    2010-07-01

    ... curtain incinerators that burn 100 percent yard waste? 60.1925 Section 60.1925 Protection of Environment... or Before August 30, 1999 Model Rule-Air Curtain Incinerators That Burn 100 Percent Yard Waste § 60.1925 How must I monitor opacity for air curtain incinerators that burn 100 percent yard waste? (a) Use...

  6. 40 CFR 62.15375 - What are the emission limits for air curtain incinerators that burn 100 percent yard waste?

    Science.gov (United States)

    2010-07-01

    ... curtain incinerators that burn 100 percent yard waste? 62.15375 Section 62.15375 Protection of Environment... Combustion Units Constructed on or Before August 30, 1999 Air Curtain Incinerators That Burn 100 Percent Yard Waste § 62.15375 What are the emission limits for air curtain incinerators that burn 100 percent yard...

  7. 40 CFR 60.2973 - What are the recordkeeping and reporting requirements for air curtain incinerators that burn only...

    Science.gov (United States)

    2010-07-01

    ... reporting requirements for air curtain incinerators that burn only wood waste, clean lumber, and yard waste... Qualification Air Curtain Incinerators That Burn Only Wood Waste, Clean Lumber, and Yard Waste § 60.2973 What are the recordkeeping and reporting requirements for air curtain incinerators that burn only wood...

  8. 40 CFR 62.15380 - How must I monitor opacity for air curtain incinerators that burn 100 percent yard waste?

    Science.gov (United States)

    2010-07-01

    ... curtain incinerators that burn 100 percent yard waste? 62.15380 Section 62.15380 Protection of Environment... Combustion Units Constructed on or Before August 30, 1999 Air Curtain Incinerators That Burn 100 Percent Yard Waste § 62.15380 How must I monitor opacity for air curtain incinerators that burn 100 percent yard...

  9. 40 CFR 60.1455 - What are the recordkeeping and reporting requirements for air curtain incinerators that burn 100...

    Science.gov (United States)

    2010-07-01

    ... reporting requirements for air curtain incinerators that burn 100 percent yard waste? 60.1455 Section 60... Reconstruction is Commenced After June 6, 2001 Air Curtain Incinerators That Burn 100 Percent Yard Waste § 60.1455 What are the recordkeeping and reporting requirements for air curtain incinerators that burn 100...

  10. 40 CFR 60.1920 - What are the emission limits for air curtain incinerators that burn 100 percent yard waste?

    Science.gov (United States)

    2010-07-01

    ... curtain incinerators that burn 100 percent yard waste? 60.1920 Section 60.1920 Protection of Environment... or Before August 30, 1999 Model Rule-Air Curtain Incinerators That Burn 100 Percent Yard Waste § 60.1920 What are the emission limits for air curtain incinerators that burn 100 percent yard waste? If...

  11. 40 CFR 62.14825 - What are the recordkeeping and reporting requirements for air curtain incinerators that burn 100...

    Science.gov (United States)

    2010-07-01

    ... Commenced Construction On or Before November 30, 1999 Air Curtain Incinerators That Burn 100 Percent Wood... reporting requirements for air curtain incinerators that burn 100 percent wood wastes, clean lumber, and/or... for air curtain incinerators that burn 100 percent wood wastes, clean lumber, and/or yard waste? (a...

  12. Impregnation of leather during "freeze-drying"

    DEFF Research Database (Denmark)

    Storch, Mikkel; Vestergaard Poulsen Sommer, Dorte; Hovmand, Ida

    2016-01-01

    Freeze-drying is a recognized method for the preservation of waterlogged objects. Naturally, freeze-drying has also been used for waterlogged archaeological leather often after treatment with Na2.EDTA and impregnation with PEG; but the treated leather sometimes suffers from “excessive drying......” becoming too stiff and brittle. The aim of this study was to examine the effect of a conventional freeze-drying method against an alternative freeze-drying method that preserves the natural moisture content of the leather. Both new and archaeological waterlogged leather were included in the study...... suggest that the process which takes place within the leather during the freeze-drying in not actual freeze-drying, but rather a sophisticated way of distributing the impregnating agent. The pure ice phase freezes out, but the impregnating agent remains liquid as the temperature does not become low enough...

  13. Drug smuggling using clothing impregnated with cocaine.

    Science.gov (United States)

    McDermott, Seán D; Power, John D

    2005-11-01

    A case study is presented where a woman travelling from South America to the Republic of Ireland was detained at Dublin Airport and articles of clothing she had in her luggage were found to be impregnated with cocaine. The study shows that the amount of powder recovered from the garments was approximately 14% of the total weight of the garments. The cocaine was in the form of cocaine hydrochloride and the purity was approximately 80%. An examination of the garments under filtered light highlighted the areas exposed to cocaine and indicated that the method of impregnation was by pouring liquid containing cocaine onto the clothing.

  14. Delivering COBie data - Focus on curtain walls and building envelopes

    DEFF Research Database (Denmark)

    Karlshøj, Jan; Borin, P.; Carradori, M.

    COBie is a standard data framework whose main purpose is to transmit useful, reliable and us-able information collected throughout the whole building process and to be consumed in order to properly maintain the facility. Focusing on Facility Management information exchanges and considering the UK...... BIM policies and requirements, this paper shows the results obtained applying COBie to complex products such as curtain walls. Two Information Delivery Manuals (IDMs) were also developed, in order to provide a com-monly known and standardized framework, which can regulate the COBie-based information...

  15. Anticholinesterase insecticide retrospective.

    Science.gov (United States)

    Casida, John E; Durkin, Kathleen A

    2013-03-25

    The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down

  16. Titanium impregnated borosilicate zeolites for epoxidation catalysis

    Czech Academy of Sciences Publication Activity Database

    Přech, Jan; Vitvarová, Dana; Lupínková, Lenka; Kubů, Martin; Čejka, Jiří

    2015-01-01

    Roč. 212, AUG 2015 (2015), s. 28-34 ISSN 1387-1811 R&D Projects: GA ČR GAP106/11/0819 Institutional support: RVO:61388955 Keywords : borosilicate * titanium impregnation * epoxidation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.349, year: 2015

  17. Flammability studies of impregnated paper sheets

    Science.gov (United States)

    Ivan Simkovic; Anne Fuller; Robert White

    2011-01-01

    Paper sheets impregnated with flame retardants made from agricultural residues and other additives were studied with the cone calorimeter. The use of sugar beet ethanol eluent (SBE), CaCl2, and ZnCl2 lowered the peak rate of heat release (PRHR) the most in comparison to water treated material. The average effective heat of...

  18. Combustion properties of wood impregnated with commercial ...

    African Journals Online (AJOL)

    The objective of this study was to determine some combustion properties of Calabrian pine (Pinus brutia Ten.) wood specimens impregnated with aqueous solutions of commercial fertilizers. Ammonium sulphate (AS) and diammonium phosphate (DAP) were used as commercial fertilizers. Diammonium phosphate and ...

  19. Curtain eruptions from Enceladus' south-polar terrain

    Science.gov (United States)

    Spitale, Joseph N.; Hurford, Terry A.; Rhoden, Alyssa R.; Berkson, Emily E.; Platts, Symeon S.

    2015-05-01

    Observations of the south pole of the Saturnian moon Enceladus revealed large rifts in the south-polar terrain, informally called `tiger stripes', named Alexandria, Baghdad, Cairo and Damascus Sulci. These fractures have been shown to be the sources of the observed jets of water vapour and icy particles and to exhibit higher temperatures than the surrounding terrain. Subsequent observations have focused on obtaining close-up imaging of this region to better characterize these emissions. Recent work examined those newer data sets and used triangulation of discrete jets to produce maps of jetting activity at various times. Here we show that much of the eruptive activity can be explained by broad, curtain-like eruptions. Optical illusions in the curtain eruptions resulting from a combination of viewing direction and local fracture geometry produce image features that were probably misinterpreted previously as discrete jets. We present maps of the total emission along the fractures, rather than just the jet-like component, for five times during an approximately one-year period in 2009 and 2010. An accurate picture of the style, timing and spatial distribution of the south-polar eruptions is crucial to evaluating theories for the mechanism controlling the eruptions.

  20. Stability of an unsupported multi-layer surfactant laden liquid curtain under gravity

    KAUST Repository

    Henry, D.

    2015-11-07

    The industrial process of curtain coating has long been an important method in coating applications, by which a thin liquid curtain is formed to impinge upon a moving substrate, due to its highly lucrative advantage of being able to coat multiple layers simultaneously. We investigate the linear stability of an unsupported two-layer liquid curtain, which has insoluble surfactants in both liquids, which are widely used in industry to increase the stability of the curtain. We formulate the governing equations, simplified by making a thin film approximation, from which we obtain equations describing the steady-state profiles. We then examine the response of the curtain to small perturbations about this steady state to identify conditions under which the curtain is unstable, finding the addition of surfactants stabilizes the curtain. Our results are then compared to experimental data, showing a favourable trend and thereby extending the works of Brown (J Fluid Mech 10:297–305, 1960) and Dyson et al. (J Eng Math 64:237–250, 2009).

  1. Flash X-ray measurements on the shock-induced dispersal of a dense particle curtain

    Science.gov (United States)

    Wagner, Justin L.; Kearney, Sean P.; Beresh, Steven J.; DeMauro, Edward P.; Pruett, Brian O.

    2015-12-01

    The interaction of a Mach 1.67 shock wave with a dense particle curtain is quantified using flash radiography. These new data provide a view of particle transport inside a compressible, dense gas-solid flow of high optical opacity. The curtain, composed of 115-µm glass spheres, initially spans 87 % of the test section width and has a streamwise thickness of about 2 mm. Radiograph intensities are converted to particle volume fraction distributions using the Beer-Lambert law. The mass in the particle curtain, as determined from the X-ray data, is in reasonable agreement with that given from a simpler method using a load cell and particle imaging. Following shock impingement, the curtain propagates downstream and the peak volume fraction decreases from about 23 to about 4 % over a time of 340 µs. The propagation occurs asymmetrically, with the downstream side of the particle curtain experiencing a greater volume fraction gradient than the upstream side, attributable to the dependence of particle drag on volume fraction. Bulk particle transport is quantified from the time-dependent center of mass of the curtain. The bulk acceleration of the curtain is shown to be greater than that predicted for a single 115-µm particle in a Mach 1.67 shock-induced flow.

  2. Recycling of impregnated wood and impregnating agents - combustion plant technology; Kyllaestetyn puutavaran ja kyllaestysaineiden kierraetys - polttolaitostekniikka

    Energy Technology Data Exchange (ETDEWEB)

    Syrjaenen, T.; Kangas, E. [Kestopuu Oy, Helsinki (Finland)

    2000-07-01

    It has been estimated that in the 20th century it is possible to recycle about 70 000 m{sup 3} of impregnated wood, corresponding to about 48 % of the total amount of annually demolished impregnated wood. The amount is estimated to grow up to 130 000 m{sup 3} in 2015 (about 65% of demolished impregnated wood). In the beginning half of the recyclable impregnated wood is poles, but the share of sawn timber will increase as the time goes by. The poles and pieces of them are demolished and transported to an intermediate storage e.g. on the yard of an electricity supply company, from which they can be fetched in larger quantities. Even wood impregnation plant can act as intermediate storage sites. Collection points for impregnated construction timber can be established on timer sales companies, but most of it will be collected at waste processing sites. The economy of impregnated wood recycling chain depends on the sales income of generated energy. Calculations show that collection, transportation and processing costs can be covered with the sales of impregnated wood for energy generation and with recycling fees. The recycling fee for sawn timber would be 20 FIM/m{sup 3} and that for poles 64 FIM/m{sup 3}. In 2001 recycling fees were set for impregnated wood, the fees being 11 FIM/m{sup 3} for sawn timber and 42 FIM/m{sup 3} for poles. Collected impregnated wood can be crushed with either fixed or movable crushers used for crushing of waste wood. The impurities of wood (bolts, nails, stones, etc.), large dimensions of wood, in- homogenous material and dust require special features for the crushing equipment. Crushing device can be equipped with feeding crane and saw for processing of large-dimension wood, and metal detectors and magnetic separators if needed, but the large metal scrap has to be removed before crushing. At present in Finland there is not a combustion plant capable for combustion of impregnated wood without any modification. Improvements of flue gas

  3. Experimental investigation of hysteresis in the break-up of liquid curtains

    KAUST Repository

    Marston, Jeremy

    2014-09-01

    Findings from an experimental investigation of the break-up of liquid curtains are reported, with the overall aim of examining stability windows for multi-layer liquid curtains composed of Newtonian fluids, where the properties of each layer can be kept constant or varied. For a single-layer curtain it is known that the minimum flow rate required for initial stability can be violated by carefully reducing the flow rate below this point, which defines a hysteresis region. However, when two or three layers are used to form a composite curtain, the hysteresis window can be considerably reduced depending on the experimental procedure used. Extensive quantitative measurements of this hysteresis region are provided alongside an examination of the influence of physical properties such as viscosity and surface tension. The origins of curtain break-up for two different geometries are analysed; first where the curtain width remains constant, pinned by straight edge guides; and second where the curtain is tapered by angled edge guides. For both cases, the rupture speed is measured, which appears to be consistent with the Taylor-Culick velocity. Observations of the typical linearly spaced jets which form after the break-up has transpired and the periodicity of these jets are compared to the Rayleigh-Taylor wavelength and previous experimental measurements. Furthermore, the curtain stability criterion originally developed by Brown (1961), summarised in terms of a Weber number, has recently been extended to multi-layer curtains by Dyson et al. (2009); thus this report provides the first experimental measurements which puts this to the test. Ultimately, it is found that only the most viscous and polymer-based liquids violate this criterion. © 2014 Elsevier Ltd.

  4. Mitigating Diseases Transmitted by Aedes Mosquitoes: A Cluster-Randomised Trial of Permethrin-Impregnated School Uniforms.

    Directory of Open Access Journals (Sweden)

    Pattamaporn Kittayapong

    2017-01-01

    Full Text Available Viral diseases transmitted via Aedes mosquitoes are on the rise, such as Zika, dengue, and chikungunya. Novel tools to mitigate Aedes mosquitoes-transmitted diseases are urgently needed. We tested whether commercially insecticide-impregnated school uniforms can reduce dengue incidence in school children.We designed a cluster-randomised controlled trial in Thailand. The primary endpoint was laboratory-confirmed dengue infections. Secondary endpoints were school absenteeism; and impregnated uniforms' 1-hour knock-down and 24 hour mosquito mortality as measured by standardised WHOPES bioassay cone tests at baseline and after repeated washing. Furthermore, entomological assessments inside classrooms and in outside areas of schools were conducted.We enrolled 1,811 pupils aged 6-17 from 5 intervention and 5 control schools. Paired serum samples were obtained from 1,655 pupils. In the control schools, 24/641 (3.7% and in the intervention schools 33/1,014 (3.3% students had evidence of new dengue infections during one school term (5 months. There was no significant difference in proportions of students having incident dengue infections between the intervention and control schools, with adjustment for clustering by school. WHOPES cone tests showed a 100% knock down and mortality of Aedes aegypti mosquitoes exposed to impregnated clothing at baseline and up to 4 washes, but this efficacy rapidly declined to below 20% after 20 washes, corresponding to a weekly reduction in knock-down and mosquito mortality by 4.7% and 4.4% respectively. Results of the entomological assessments showed that the mean number of Aedes aegypti mosquitoes caught inside the classrooms of the intervention schools was significantly reduced in the month following the introduction of the impregnated uniforms, compared to those collected in classrooms of the control schools (p = 0.04.Entomological assessments showed that the intervention had some impact on the number of Aedes

  5. Mitigating Diseases Transmitted by Aedes Mosquitoes: A Cluster-Randomised Trial of Permethrin-Impregnated School Uniforms.

    Science.gov (United States)

    Kittayapong, Pattamaporn; Olanratmanee, Phanthip; Maskhao, Pongsri; Byass, Peter; Logan, James; Tozan, Yesim; Louis, Valérie; Gubler, Duane J; Wilder-Smith, Annelies

    2017-01-01

    Viral diseases transmitted via Aedes mosquitoes are on the rise, such as Zika, dengue, and chikungunya. Novel tools to mitigate Aedes mosquitoes-transmitted diseases are urgently needed. We tested whether commercially insecticide-impregnated school uniforms can reduce dengue incidence in school children. We designed a cluster-randomised controlled trial in Thailand. The primary endpoint was laboratory-confirmed dengue infections. Secondary endpoints were school absenteeism; and impregnated uniforms' 1-hour knock-down and 24 hour mosquito mortality as measured by standardised WHOPES bioassay cone tests at baseline and after repeated washing. Furthermore, entomological assessments inside classrooms and in outside areas of schools were conducted. We enrolled 1,811 pupils aged 6-17 from 5 intervention and 5 control schools. Paired serum samples were obtained from 1,655 pupils. In the control schools, 24/641 (3.7%) and in the intervention schools 33/1,014 (3.3%) students had evidence of new dengue infections during one school term (5 months). There was no significant difference in proportions of students having incident dengue infections between the intervention and control schools, with adjustment for clustering by school. WHOPES cone tests showed a 100% knock down and mortality of Aedes aegypti mosquitoes exposed to impregnated clothing at baseline and up to 4 washes, but this efficacy rapidly declined to below 20% after 20 washes, corresponding to a weekly reduction in knock-down and mosquito mortality by 4.7% and 4.4% respectively. Results of the entomological assessments showed that the mean number of Aedes aegypti mosquitoes caught inside the classrooms of the intervention schools was significantly reduced in the month following the introduction of the impregnated uniforms, compared to those collected in classrooms of the control schools (p = 0.04). Entomological assessments showed that the intervention had some impact on the number of Aedes mosquitoes inside

  6. Community cooperatives and insecticide-treated materials for malaria control: a new experience in Latin America.

    Science.gov (United States)

    Kroeger, Axel; Aviñna, Ana; Ordoñnez-Gonzalez, José; Escandon, Celia

    2002-11-15

    Insecticide-treated materials (ITMs) are effective in substantially reducing the burden of malaria and other vector-borne diseases; but how can high coverage rates of ITMs be achieved and maintained? In south Mexico and on the Pacific and Atlantic coasts of Colombia 14 community-based cooperatives offering three different kinds of ITM services (sale of impregnation services; sale of impregnated nets; production of nets and sale of impregnated nets) were formed and supervised by a national health service (IMSS-SOLIDARIDAD, Mexico) and by an academic institution (the Colombian Institute of Tropical Medicine) along with local district health services. The objectives of this research were to analyse the processes and results of this approach and to identify the favourable and limiting factors. The methods used for data collection and analysis were group discussions, individual and semi-structured interviews with users and non-users of ITMs, individual in-depth interviews with cooperative members and supervisors, checks of sales book and observation of impregnation services. Coverage with unimpregnated nets was above 50% in all study areas. The fastest increase of ITM coverage was achieved through the exclusive sale of impregnation services. Low-cost social marketing techniques were used to increase demand. The large-scale production of nets in two cooperatives was only possible with the aid of an international NGO which ordered impregnated bednets for their target group. A number of favourable and limiting factors relating to the success of ITM cooperatives were identified. Of particular importance for the more successful Mexican cooperatives were: a) support by health services, b) smaller size, c) lesser desire for quick returns and d) lower ITM unit costs. ITM community cooperatives supported and supervised by the health services have good potential in the Latin American context for achieving and maintaining high impregnation rates.

  7. Community cooperatives and insecticide-treated materials for malaria control: a new experience in Latin America

    Directory of Open Access Journals (Sweden)

    Ordoñnez-Gonzalez José

    2002-11-01

    Full Text Available Abstract Background and objectives Insecticide-treated materials (ITMs are effective in substantially reducing the burden of malaria and other vector-borne diseases; but how can high coverage rates of ITMs be achieved and maintained? In south Mexico and on the Pacific and Atlantic coasts of Colombia 14 community-based cooperatives offering three different kinds of ITM services (sale of impregnation services; sale of impregnated nets; production of nets and sale of impregnated nets were formed and supervised by a national health service (IMSS-SOLIDARIDAD, Mexico and by an academic institution (the Colombian Institute of Tropical Medicine along with local district health services. The objectives of this research were to analyse the processes and results of this approach and to identify the favourable and limiting factors. Methods The methods used for data collection and analysis were group discussions, individual and semi-structured interviews with users and non-users of ITMs, individual in-depth interviews with cooperative members and supervisors, checks of sales book and observation of impregnation services. Results Coverage with unimpregnated nets was above 50% in all study areas. The fastest increase of ITM coverage was achieved through the exclusive sale of impregnation services. Low-cost social marketing techniques were used to increase demand. The large-scale production of nets in two cooperatives was only possible with the aid of an international NGO which ordered impregnated bednets for their target group. A number of favourable and limiting factors relating to the success of ITM cooperatives were identified. Of particular importance for the more successful Mexican cooperatives were: a support by health services, b smaller size, c lesser desire for quick returns and d lower ITM unit costs. Conclusions ITM community cooperatives supported and supervised by the health services have good potential in the Latin American context for achieving

  8. A short history of insecticides

    Directory of Open Access Journals (Sweden)

    Oberemok Volodymyr Volodymyrovych

    2015-07-01

    Full Text Available This review contains a brief history of the use of insecticides. The peculiarities, main advantages, and disadvantages of some modern insecticides are described. The names of the discoverers of some of the most popular insecticide preparations on the world market, are listed. The tendencies to find new insecticides to control the quantity of phytophagous insects are discussed. Special attention is paid to the perspective of creating preparations based on nucleic acids, in particular DNA insecticides. The use of insect-specific, short single-stranded DNA fragments as DNA insecticides, is paving the way in the field of “intellectual” insecticides that “think” before they act. It is worth noting, though, that in the near future, the quantity of produced insecticides will increase due to the challenges associated with food production for a rapidly growing population. It is concluded, that an agreeable interaction of scientists and manufacturers of insecticides should lead to the selection of the most optimal solutions for insect pest control, which would be safe, affordable, and effective at the same time.

  9. The use of sparge curtains for contaminant plume control

    International Nuclear Information System (INIS)

    Molnaa, B.; Dablow, J.

    1994-01-01

    Contamination by petroleum hydrocarbons and organic solvents represents a major impact to soil and groundwater. Following recent research and development, several technologies have evolved to treat saturated zone adsorbed- and dissolved-phase contaminants in situ. These technologies include bioremediation and air sparging. Funnel and gate approaches have been developed at the Waterloo Center for Groundwater Research to control contaminant plume migration and treat dissolved-phase contaminants before allowing migration downgradient and off site. The process consists of using low hydraulic conductivity cutoff walls to funnel groundwater flow through gates that contain in situ bioreactors. These systems can maintain hydraulic control and treat dissolved-phase contaminants at the downgradient margins of plumes, while minimizing, or in some cases eliminating, the need for groundwater pumping. Sparge curtains can be applied to treat dissolved-phase contaminants and prevent downgradient, off-site migration of contaminated groundwater

  10. AA, radiation shielding curtain along the target area

    CERN Multimedia

    CERN PhotoLab

    1980-01-01

    At the far left is the beam tube for the high-intensity proton beam from the 26 GeV PS. The tube ends in a thin window and the proton beam continues in air through a hole in the shielding blocks (see also 8010308), behind which the target (see 7905091, 7905094)was located. After the target followed the magnetic horn, focusing the antiprotons, and the first part of the injection line with a proton dump. The antiprotons, deflected by a magnet, left the target area through another shielding wall, to make their way to the AA ring. Laterally, this sequence of components was shielded with movable, suspended, concrete blocks: the "curtain". Balasz Szeless, who had constructed it, is standing at its side.

  11. Country-level operational implementation of the Global Plan for Insecticide Resistance Management.

    Science.gov (United States)

    Hemingway, Janet; Vontas, John; Poupardin, Rodolphe; Raman, Jaishree; Lines, Jo; Schwabe, Chris; Matias, Abrahan; Kleinschmidt, Immo

    2013-06-04

    Malaria control is reliant on the use of long-lasting pyrethroid-impregnated nets and/or indoor residual spraying (IRS) of insecticide. The rapid selection and spread of operationally significant pyrethroid resistance in African malaria vectors threatens our ability to sustain malaria control. Establishing whether resistance is operationally significant is technically challenging. Routine monitoring by bioassay is inadequate, and there are limited data linking resistance selection with changes in disease transmission. The default is to switch insecticides when resistance is detected, but limited insecticide options and resistance to multiple insecticides in numerous locations make this approach unsustainable. Detailed analysis of the resistance situation in Anopheles gambiae on Bioko Island after pyrethroid resistance was detected in this species in 2004, and the IRS program switched to carbamate bendiocarb, has now been undertaken. The pyrethroid resistance selected is a target-site knock-down resistance kdr-form, on a background of generally elevated metabolic activity, compared with insecticide-susceptible A. gambiae, but the major cytochrome P450-based metabolic pyrethroid resistance mechanisms are not present. The available evidence from bioassays and infection data suggests that the pyrethroid resistance mechanisms in Bioko malaria vectors are not operationally significant, and on this basis, a different, long-lasting pyrethroid formulation is now being reintroduced for IRS in a rotational insecticide resistance management program. This will allow control efforts to be sustained in a cost-effective manner while reducing the selection pressure for resistance to nonpyrethroid insecticides. The methods used provide a template for evidence-based insecticide resistance management by malaria control programs.

  12. Utilizing adequate intake line curtain air quantities to maintain respirable dust compliance

    Energy Technology Data Exchange (ETDEWEB)

    Schultz, M.J.; Tomko, D.M.; Rumbaugh, V.E. [United States Dept. of Labor, Mine Safety and Health Administration, Pittsburgh, PA (United States). Safety and Health Technical Center

    2010-07-01

    Mine operators are obligated to ensure the effectiveness of their dust controls and implement practices to minimize the generation of dust in their mines. The 2 main types of face ventilation are blowing and exhaust ventilation. With blowing face ventilation, intake air is directed behind a line curtain or through ventilation tubing and then discharged from the end of the line curtain toward the working face. This paper presented specific information for mine operators regarding where and when exhausting or blowing ventilation will be used. Mine operators should establish the line curtain for directing the face ventilating air as a specific distance from the point of deepest penetration of the face. The location of curtains where roof bolting is being performed should also be specified. The distance from the face is important to the effectiveness of ventilation. 4 refs., 3 tabs., 2 figs.

  13. Microbiological contamination of cubicle curtains in an out-patient podiatry clinic

    Directory of Open Access Journals (Sweden)

    O'Neil Bill

    2010-11-01

    Full Text Available Abstract Background Exposure to potential pathogens on contaminated healthcare garments and curtains can occur through direct or indirect contact. This study aimed to identify the microorganisms present on podiatry clinic curtains and measure the contamination pre and post a standard hospital laundry process. Method Baseline swabs were taken to determine colony counts present on cubical curtains before laundering. Curtains were swabbed again immediately after, one and three weeks post laundering. Total colony counts were calculated and compared to baseline, with identification of micro-organisms. Results Total colony counts increased very slightly by 3% immediately after laundry, which was not statistically significant, and declined significantly (p = 0.0002 by 56% one-week post laundry. Three weeks post laundry colony counts had increased by 16%; although clinically relevant, this was not statistically significant. The two most frequent microorganisms present throughout were Coagulase Negative Staphylococcus and Micrococcus species. Laundering was not completely effective, as both species demonstrated no significant change following laundry. Conclusion This work suggests current laundry procedures may not be 100% effective in killing all microorganisms found on curtains, although a delayed decrease in total colony counts was evident. Cubicle curtains may act as a reservoir for microorganisms creating potential for cross contamination. This highlights the need for additional cleaning methods to decrease the risk of cross infection and the importance of maintaining good hand hygiene.

  14. Design, construction and performance of the Oldman River Dam grout curtain

    Energy Technology Data Exchange (ETDEWEB)

    Hartmaier, H.; Davachi, M. [Acres International Ltd., Calgary, AB (Canada); Dharmawardene, W. [Alberta Environment, Edmonton, AB (Canada); Sinclair, B. [Acres International Ltd., Niagara Falls, ON (Canada)

    2002-07-01

    The 76 m high Oldman River Dam was constructed between 1986 and 1991 near Pincher Creek, Alberta to provide flow regulation and on-stream storage of water for multi-purpose use and irrigation services as well as hydroelectric development. The dam's main structure includes an earth- and rockfill dam, a low earthfill dyke 1500 m long, twin diversion/low level outlet tunnels, a gated spillways structure, and 2 drainage tunnels. A 1.3 km long, three-line grout curtain up to 100 m deep extends below the foundation of the dam and spillway. The grout curtain was built in undeformed Paleocene sedimentary rocks affected by stress relief due to river valley erosion. 80 per cent of the grout consumption was from bedrock structural features. Piezometers, slope indicators and flow measurement weirs were installed in the dam and abutment areas both during and after construction to monitor the performance of the grout curtain. Instrument readings indicate that the grout curtain is successfully preventing the transmission of reservoir pressures to the foundation beneath the downstream shell of the dam. The piezometric pressures downstream of the grout curtain are the same as they were in the foundation before impounding. A small amount of seepage has appeared at the end of the grout curtain at the eastern end of the abutment of the spillway but it is not considered to be significant. 3 refs., 4 figs.

  15. Design of automatic curtain controlled by wireless based on single chip 51 microcomputer

    Science.gov (United States)

    Han, Dafeng; Chen, Xiaoning

    2017-08-01

    In order to realize the wireless control of the domestic intelligent curtains, a set of wireless intelligent curtain control system based on 51 single chip microcomputer have been designed in this paper. The intelligent curtain can work in the manual mode, automatic mode and sleep mode and can be carried out by the button and mobile phone APP mode loop switch. Through the photosensitive resistance module and human pyroelectric infrared sensor to collect the indoor light value and the data whether there is the person in the room, and then after single chip processing, the motor drive module is controlled to realize the positive inversion of the asynchronous motor, the intelligent opening and closing of the curtain have been realized. The operation of the motor can be stopped under the action of the switch and the curtain opening and closing and timing switch can be controlled through the keys and mobile phone APP. The optical fiber intensity, working mode, curtain state and system time are displayed by LCD1602. The system has a high reliability and security under practical testing and with the popularity and development of smart home, the design has broad market prospects.

  16. Experimental Study of Impregnation Birch and Aspen Samples

    Directory of Open Access Journals (Sweden)

    Igor Vladislavovich Grigorev

    2014-10-01

    Full Text Available An experimental study of wood impregnation was implemented by applying centrifugal methods. The impregnants were a 10% aqueous solution of potassium chloride and a 2% aqueous solution of borax. Birch (Betula pendula and aspen (Populus tremula wood samples in different moisture content were tested. The impregnation time in the centrifugal device were 30 seconds repeated 21 times, and the samples were measured after every 30 seconds. The experimental results were fitted to a nonlinear filtration law, which indicated that the centrifugal wood impregnation was dependent on wood species, wood moisture, rotational speed, and radius. Determination of rotational speed and centrifuge radius for impregnating aspen and birch at varying lengths and humidity under conditions of the nonlinear impregnant filtration law can be done using the example charts that were developed and presented in this study.

  17. The importance of considering community-level effects when selecting insecticidal malaria vector products

    Directory of Open Access Journals (Sweden)

    Coosemans Marc

    2011-08-01

    Full Text Available Abstract Background Insecticide treatment of nets, curtains or walls and ceilings of houses represent the primary means for malaria prevention worldwide. Direct personal protection of individuals and households arises from deterrent and insecticidal activities which divert or kill mosquitoes before they can feed. However, at high coverage, community-level reductions of mosquito density and survival prevent more transmission exposure than the personal protection acquired by using a net or living in a sprayed house. Methods A process-explicit simulation of malaria transmission was applied to results of 4 recent Phase II experimental hut trials comparing a new mosaic long-lasting insecticidal net (LLIN which combines deltamethrin and piperonyl butoxide with another LLIN product by the same manufacturer relying on deltamethrin alone. Results Direct estimates of mean personal protection against insecticide-resistant vectors in Vietnam, Cameroon, Burkina Faso and Benin revealed no clear advantage for combination LLINs over deltamethrin-only LLINs (P = 0.973 unless both types of nets were extensively washed (Relative mean entomologic inoculation rate (EIR ± standard error of the mean (SEM for users of combination nets compared to users of deltamethrin only nets = 0.853 ± 0.056, P = 0.008. However, simulations of impact at high coverage (80% use predicted consistently better impact for the combination net across all four sites (Relative mean EIR ± SEM in communities with combination nets, compared with those using deltamethrin only nets = 0.613 ± 0.076, P Conclusion Process-explicit simulations of community-level protection, parameterized using locally-relevant experimental hut studies, should be explicitly considered when choosing vector control products for large-scale epidemiological trials or public health programme procurement, particularly as growing insecticide resistance necessitates the use of multiple active ingredients.

  18. Wood construction and magnetic characteristics of impregnated type magnetic wood

    International Nuclear Information System (INIS)

    Oka, Hideo; Hojo, Atsushi; Seki, Kyoushiro; Takashiba, Toshio

    2002-01-01

    The results of experiments involving the AC and DC magnetic characteristics of impregnated type magnetic wood were studied by taking into consideration the wood construction and fiber direction. The experimental results show that the sufficient amount of impregnated magnetic fluid varies depending on the fiber direction and length, and the grain face of the wood material. The impregnated type magnetic wood sample that is fully impregnated by magnetic fluid has a 60% saturation magnetization compared to the saturation magnetization of magnetic fluid. Samples for which the wood fiber direction was the same as the direction of the magnetic path had a higher magnetization intensity and permeability

  19. METHOD OF IMPREGNATING A POROUS MATERIAL

    Science.gov (United States)

    Steele, G.N.

    1960-06-01

    A method of impregnating a porous body with an inorganic uranium- containing salt is outlined and comprises dissolving a water-soluble uranium- containing salt in water; saturating the intercommunicating pores of the porous body with the salt solution; infusing ammonia gas into the intercommunicating pores of the body, the ammonia gas in water chemically reacting with the water- soluble uranium-containing salt in the water solvent to form a nonwater-soluble uranium-containing precipitant; and evaporating the volatile unprecipitated products from the intercommunicating pores whereby the uranium-containing precipitate is uniformly distributed in the intercommunicating peres of the porous body.

  20. Comparison of the compressive strength of impregnated and nonimpregnated eucalyptus subjected to two different pressures and impregnation times

    Directory of Open Access Journals (Sweden)

    Waldemir Rodrigues

    2004-06-01

    Full Text Available The durability of wood is affected by several factors. For this reason, much research has been done on a variety of chemical compounds for impregnating wood, aimed at preserving it while simultaneously improving its properties. Recent studies of the properties of impregnated wood have demonstrated the possibility of substantially improving its mechanical characteristics. Thus, the purpose of this work was to compare the strength to parallel compression of wooden fibers (Eucalyptus grandis, both nonimpregnated and impregnated with a monocomponent resin, from the standpoint of pressure and impregnation time, aiming at its structural utilization. The results demonstrate that the compressive strength of impregnated test specimens is greater than that of nonimpregnated ones, indicating that monocomponent polyurethane resin can be considered suitable for impregnating wood, since it increases the compressive strength of eucalyptus.

  1. Effectiveness of dog collars impregnated with 4% deltamethrin in controlling visceral leishmaniasis in Lutzomyia longipalpis (Diptera: Psychodidade: Phlebotominae) populations.

    Science.gov (United States)

    Silva, Rafaella Albuquerque E; Andrade, Andrey José de; Quint, Bruno Beust; Raffoul, Gabriel Elias Salmen; Werneck, Guilherme Loureiro; Rangel, Elizabeth Ferreira; Romero, Gustavo Adolfo Sierra

    2018-03-26

    There is little information on the effect of using deltamethrin-impregnated dog collars for the control of canine visceral leishmaniasis. The objective of this study was to evaluate the effectiveness of the use of 4% deltamethrin-impregnated collars (Scalibor®) in controlling visceral leishmaniasis in Lutzomyia longipalpis by comparing populations in intervention and non-intervention areas. Phlebotomine flies were captured over 30 months in four neighbourhoods with intense visceral leishmaniasis transmission in Fortaleza and Montes Claros. We calculated the rates of domicile infestation, relative abundance of Lu. longipalpis, and Lu. longipalpis distribution in each site, capture location (intra- and peridomestic locations) and area (intervention and non-intervention areas). In the control area in Fortaleza, the relative abundance of Lu. longipalpis was 415 specimens at each capture site, whereas in the intervention area it was 159.25; in Montes Claros, the relative abundance was 5,660 specimens per capture site in the control area, whereas in the intervention area it was 2,499.4. The use of dog collars was associated with a reduction in captured insects of 15% (p = 0.004) and 60% (p < 0.001) in Montes Claros and Fortaleza, respectively. We observed a lower vector abundance in the intervention areas, suggesting an effect of the insecticide-impregnated collars.

  2. Neurotoxicology of insecticides and pheromones

    National Research Council Canada - National Science Library

    Narahashi, Toshio

    1979-01-01

    The purpose of this symposium was to provide a forum where a variety of scientists who were interested in the interactions of insecticides and pheromones with the nervous system got together to exchange their views...

  3. A renaissance for botanical insecticides?

    Science.gov (United States)

    Isman, Murray B

    2015-12-01

    Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product. © 2015 Society of Chemical Industry.

  4. A Cost–Benefit Analysis to Assess the Effectiveness of Frontal Center Curtain Airbag

    Directory of Open Access Journals (Sweden)

    Bo Kyeong Lee

    2017-09-01

    Full Text Available Several new varieties of airbags are under consideration for development. However, their commercialization decision must be backed by a positive Cost–Benefit Analysis (CBA outcome. In this study, we propose a CBA framework for the frontal center curtain airbag, a newly designed safety system intended to reduce the injury risk of rear-seat passengers. The proposed CBA covers not only economic benefits of the producer but also the effectiveness in sustainable reduction of the fatal and injury rate. In this context, with accumulated field data on road traffic accidents, a forecasting method reflecting the reduced casualties and the market share of vehicle sales associated with frontal center curtain airbag is utilized. Our results suggest that the use of frontal center curtain airbags helps to reduce the number of casualties with a Maximum Abbreviated Injury Scale (MAIS of 3 or above by 87.4%. Furthermore, both the initial market penetration rate and price of the frontal center curtain airbag significantly influence its socioeconomic benefits. By evaluating the effectiveness of the frontal center curtain airbag, our study can contribute to the decision making for its commercialization.

  5. Evaluation of Strategies to Improve the Thermal Performance of Steel Frames in Curtain Wall Systems

    Directory of Open Access Journals (Sweden)

    Ji Hyun Oh

    2016-12-01

    Full Text Available Recently, metal curtain wall systems have been widely used in high-rise buildings due to many advantages, including being lightweight, rapid construction, and aesthetic features. Since the metal frame may lead to lower energy performance, thermal discomfort, and condensation risk due to the high thermal conductivity, its thermal performance can be important for the improvement of the overall thermal performance of the curtain wall system, as well as the energy efficiency of the building envelope. This study aims to evaluate variety of design strategies to improve the thermal performance of steel curtain wall frames. Five base cases and three further steps were selected for two different head profile shapes based on a state-of-the art technology review, and their thermal transmittances were calculated through simulations according to the ISO 12631 standard which is an international standard for calculating thermal transmittance of curtain wall system. Measured results that were obtained from hot-box tests were compared with the calculated results to validate the simulation method of this study. The shape of the head profile did not strongly influence the overall thermal transmittance, and the choice of strategies for the rabbet space was more important. More effective strategies could be decided according to the steps for variation development. This result can serve as a guideline for the design of high-performance curtain wall frames.

  6. Iron impregnated carbon materials with improved physicochemical characteristics

    International Nuclear Information System (INIS)

    Shah, Irfan; Adnan, Rohana; Wan Ngah, Wan Saime; Mohamed, Norita

    2015-01-01

    Highlights: • The morphology of raw AC was altered upon Fe impregnation and surface oxidation. • Surface modification had increased the pores diameter and surface functionalities. • Development of iron oxides have been expected on Fe impregnated carbon materials. • The M1, M2 and M3 have revealed magnetic susceptibility in applied magnetic field. • Dyes removal efficiency of M3 was notably higher (90–99%) than the raw AC (60–85%). - Abstract: This paper highlights the effect of iron impregnation and surface oxidation on the physicochemical characteristics of iron impregnated carbon materials. These materials were characterized by various techniques like surface area, pore size distribution, SEM/EDX, CHN, XRD, FTIR, TG/DT, VSM and XPS analyses. The increase in the surface functionalities and pores diameter (3.51–5.49 nm) of the iron-impregnated carbon materials was observed with the increase in iron contents and surface oxidation. The saturated magnetization values (0.029–0.034 emu/g) for the iron-impregnated carbon materials reflected the magnetic tendency due to the development of small size iron oxides on their surfaces. The XPS spectra revealed the existence of different oxidation states of the corresponding metals on the iron impregnated carbon materials. The percentage removal of model dyes (Methylene Blue and Methyl Orange) by iron-impregnated carbon materials was enhanced (>90%) with the increase in iron contents and pores diameters.

  7. Effects of impregnation with boron compounds on the surface ...

    African Journals Online (AJOL)

    Liebl.) which met the requirements of ASTM D 358 were impregnated according to ASTM D 1413 with boric acid (Ba) and borax (Bx) by vacuum technique. After impregnation, surfaces were coated with cellulosic, synthetic, polyurathane, water-based, acrylic and acid hardening varnishes in accordance with ASTM D 3023 ...

  8. Impact of impregnation with boron compounds on combustion ...

    African Journals Online (AJOL)

    This study examined the impacts of varnishing after impregnation with boron compounds on combustion properties of oriental beech. The test samples prepared from oriental beech (Fagus orientalis Lipsky) wood were impregnated according to ASTM D 1413–76–99 with boric acid (Ba) or borax (Bx) using a vacuum ...

  9. Studies of properties of rubber wood with impregnation of polymer

    Indian Academy of Sciences (India)

    Impregnation of rubber wood has been carried out under different conditions by using styrene as grafting monomer and glycidyl methacrylate (GMA) as crosslinker. Properties such as dimensional stability, water absorption, hardness, tensile strength, flexural strength, etc of the impregnated wood have been checked and ...

  10. Impregnation of Ibuprofen into Polycaprolactone using supercritical carbon dioxide

    Energy Technology Data Exchange (ETDEWEB)

    Yoganathan, Roshan; Mammucari, Raffaella; Foster, Neil R, E-mail: n.foster@unsw.edu.a [Supercritical Fluids Research Group, School of Chemical Sciences and Engineering, University of New South Wales, NSW 2052 (Australia)

    2010-03-01

    Polycaprolactone (PCL) is a Food and Drug Administration (FDA) approved biodegradable polyester used in tissue engineering applications. Ibuprofen is an anti-inflammatory drug which has good solubility in supercritical CO{sub 2} (SCCO{sub 2}). The solubility of CO{sub 2} in PCL allows for the impregnation of CO{sub 2}-soluble therapeutic agents into the polymer via a supercritical fluid (SCF) process. Polymers impregnated with bio-active compounds are highly desired for medical implants and controlled drug delivery. In this study, the use of CO{sub 2} to impregnate PCL with ibuprofen was investigated. The effect of operating conditions on the impregnation of ibuprofen into PCL was investigated over two pressure and two temperature levels, 150bar and 200bar, 35{sup 0}C and 40 {sup 0}C, respectively. Polycaprolactone with drug-loadings as high as 27% w/w were obtained. Impregnated samples exhibited controlled drug release profiles over several days.

  11. Impregnation of Ibuprofen into Polycaprolactone using supercritical carbon dioxide

    International Nuclear Information System (INIS)

    Yoganathan, Roshan; Mammucari, Raffaella; Foster, Neil R

    2010-01-01

    Polycaprolactone (PCL) is a Food and Drug Administration (FDA) approved biodegradable polyester used in tissue engineering applications. Ibuprofen is an anti-inflammatory drug which has good solubility in supercritical CO 2 (SCCO 2 ). The solubility of CO 2 in PCL allows for the impregnation of CO 2 -soluble therapeutic agents into the polymer via a supercritical fluid (SCF) process. Polymers impregnated with bio-active compounds are highly desired for medical implants and controlled drug delivery. In this study, the use of CO 2 to impregnate PCL with ibuprofen was investigated. The effect of operating conditions on the impregnation of ibuprofen into PCL was investigated over two pressure and two temperature levels, 150bar and 200bar, 35 0 C and 40 0 C, respectively. Polycaprolactone with drug-loadings as high as 27% w/w were obtained. Impregnated samples exhibited controlled drug release profiles over several days.

  12. 40 CFR 62.15385 - What are the recordkeeping and reporting requirements for air curtain incinerators that burn 100...

    Science.gov (United States)

    2010-07-01

    ... reporting requirements for air curtain incinerators that burn 100 percent yard waste? 62.15385 Section 62... Incinerators That Burn 100 Percent Yard Waste § 62.15385 What are the recordkeeping and reporting requirements for air curtain incinerators that burn 100 percent yard waste? (a) Provide a notice of construction...

  13. 40 CFR 60.1930 - What are the recordkeeping and reporting requirements for air curtain incinerators that burn 100...

    Science.gov (United States)

    2010-07-01

    ... reporting requirements for air curtain incinerators that burn 100 percent yard waste? 60.1930 Section 60... Incinerators That Burn 100 Percent Yard Waste § 60.1930 What are the recordkeeping and reporting requirements for air curtain incinerators that burn 100 percent yard waste? (a) Provide a notice of construction...

  14. Water Curtain System Pre-design for Crude Oil Storage URCs : A Numerical Modeling and Genetic Programming Approach

    NARCIS (Netherlands)

    Ghotbi Ravandi, Ebrahim; Rahmannejad, Reza; Karimi-Nasab, Saeed; Sarrafi, Amir; Raoof, Amir

    In this paper the main criteria of the water curtain system for unlined rock caverns (URCs) is described. By the application of numerical modeling and genetic programming (GP), a method for water curtain system pre-design for Iranian crude oil storage URCs (common dimension worldwide) is presented.

  15. New options for the cold storage air curtain in the food sector; Koelruimte-luchtgordijn biedt nieuwe mogelijkheden

    Energy Technology Data Exchange (ETDEWEB)

    Bruins, K. [Biddle, Kootstertille (Netherlands)

    1997-10-01

    Based on a newly developed so-called multi air jet technology air curtains in front of cold spaces prevent warm air from infiltrating the cold space. The principles and performance of the cold space air curtain are briefly outlined. 2 figs.

  16. 40 CFR 62.14815 - What are the emission limitations for air curtain incinerators that burn 100 percent wood wastes...

    Science.gov (United States)

    2010-07-01

    ... air curtain incinerators that burn 100 percent wood wastes, clean lumber and/or yard waste? 62.14815... Requirements for Commercial and Industrial Solid Waste Incineration Units That Commenced Construction On or Before November 30, 1999 Air Curtain Incinerators That Burn 100 Percent Wood Wastes, Clean Lumber And/or...

  17. 40 CFR 60.3066 - What are the emission limitations for air curtain incinerators that burn only wood waste, clean...

    Science.gov (United States)

    2010-07-01

    ... air curtain incinerators that burn only wood waste, clean lumber, and yard waste? 60.3066 Section 60... Waste Incineration Units That Commenced Construction On or Before December 9, 2004 Model Rule-Air Curtain Incinerators That Burn Only Wood Waste, Clean Lumber, and Yard Waste § 60.3066 What are the...

  18. 40 CFR 60.3068 - What are the recordkeeping and reporting requirements for air curtain incinerators that burn only...

    Science.gov (United States)

    2010-07-01

    ... reporting requirements for air curtain incinerators that burn only wood waste, clean lumber, and yard waste... Times for Other Solid Waste Incineration Units That Commenced Construction On or Before December 9, 2004 Model Rule-Air Curtain Incinerators That Burn Only Wood Waste, Clean Lumber, and Yard Waste § 60.3068...

  19. 40 CFR 60.2971 - What are the emission limitations for air curtain incinerators that burn only wood waste, clean...

    Science.gov (United States)

    2010-07-01

    ... air curtain incinerators that burn only wood waste, clean lumber, and yard waste? 60.2971 Section 60... Incinerators That Burn Only Wood Waste, Clean Lumber, and Yard Waste § 60.2971 What are the emission limitations for air curtain incinerators that burn only wood waste, clean lumber, and yard waste? (a) Within...

  20. Orthogonal design on range hood with air curtain and its effects on kitchen environment.

    Science.gov (United States)

    Liu, Xiaomin; Wang, Xing; Xi, Guang

    2014-01-01

    Conventional range hoods cannot effectively prevent the oil fumes containing cooking-induced harmful material from escaping into the kitchen Air curtains and guide plates have been used in range hoods to reduce the escape of airborne emissions and heat, thereby improving the kitchen environment and the cook's degree of comfort. In this article, numerical simulations are used to study the effects of the jet velocity of an air curtain, the jet angle of the air curtain, the width of the jet slot, the area of the guide plate, and the exhaust rate of the range hood on the perceived temperature, the perceived concentration of oil fumes, the release temperature of oil fumes, and the concentration of escaped oil fumes in a kitchen. The orthogonal experiment results show that the exhaust rate of the range hood is the main factor influencing the fumes concentration and the temperature distribution in the kitchen. For the range hood examined in the present study, the optimum values of the exhaust rate, the jet velocity of the air curtain, the jet angle of the air curtain, the width of the jet slot, and the area of the guide plate are 10.5 m(3)/min, 1.5 m/s, -5°, 4 mm, and 0.22 m(2), respectively, based on the results of the parametric study. In addition, the velocity field, temperature field, and oil fumes concentration field in the kitchen using the proposed range hood with the air curtain and guide plate are analyzed for those parameters. The study's results provide significant information needed for improving the kitchen environment.

  1. Bubble Curtains: Herbivore Exclusion Devices for Ecology and Restoration of Marine Ecosystems?

    Directory of Open Access Journals (Sweden)

    Scott Bennett

    2017-09-01

    Full Text Available Herbivorous fishes play a critical role in maintaining or disrupting the ecological resilience of many kelp forests, coral reefs and seagrass ecosystems, worldwide. The increasing rate and scale of benthic habitat loss under global change has magnified the importance of herbivores and highlights the need to study marine herbivory at ecologically relevant scales. Currently, underwater herbivore exclusions (or inclusions have been restricted to small scale experimental plots, in large part due to the challenges of designing structures that can withstand the physical forces of waves and currents, without drastically altering the physical environment inside the exclusion area. We tested the ability of bubble curtains to deter herbivorous fishes from feeding on seaweeds as an alternative to the use of rigid exclusion cages. Kelps (Ecklonia radiata were transplanted onto reefs with high browsing herbivore pressure into either unprotected plots, exclusion cages or plots protected by bubble curtains of 0.785 m2 and 3.14 m2. Remote underwater video was used to compare the behavioral response of fishes to kelps protected and unprotected by bubble curtains. Kelp biomass loss was significantly lower inside the bubble curtains compared to unprotected kelps and did not differ from kelp loss rates in traditional exclusion cages. Consistent with this finding, no herbivorous fishes were observed entering into the bubble curtain at any point during the experiment. In contrast, fish bite rates on unprotected kelps were 1,621 ± 702 bites h−1 (mean ± SE. Our study provides initial evidence that bubble curtains can exclude herbivorous fishes, paving the way for future studies to examine their application at larger spatial and temporal scales, beyond what has been previously feasible using traditional exclusion cages.

  2. Case study installation of a HDPE curtain wall with sheetpile tie-in on both ends

    International Nuclear Information System (INIS)

    Schindler, R.M.; Maltese, P.C.

    1997-01-01

    The plans for eliminating the off-site migration of non-aqueous phase liquid (NAPL) from a refinery into a nearby river included the installation of a High Density Polyethylene (HDPE) curtain wall and an underdrain system. A 640 m (2100 lineal feet) HDPE Curtain Wall was installed along the river boundary, tying into an existing sheet pile wall on both ends. The wall varied from approximately 4.5 m (15 feet) deep at the northern end to about 7 m (23 feet) deep at the southern end, running approximately 3 to 3.6 m (10 to 12 feet) inland of an existing wooden bulkhead. The curtain wall was successfully installed through a slurry supported trench. A 930 m (3050 lineal feet) interception/collection trench was installed parallel to the HDPE Curtain Wall, continuing on beyond the curtain wall on the southern end. The depth of the trench varied from approximately 3 to 4 m (10 to 13 feet) deep. A 20.32 cm (8 inch) diameter perforated HDPE header pipe was placed in the trench to convey groundwater and product to two sumps. The trench is 53.34 cm (21 inches) wide and contained aggregate to approximately 0.9 m (3 feet) below ground. This work was accomplished using the bio-polymer slurry drainage trench (BP Drain) technique. This paper briefly describes the construction methods utilized during this project, specifically HDPE curtain wall installation thru a bentonite slurry and tie-in to the existing sheet pile wall

  3. Some properties of castor oil affecting its performance as a capacitor impregnant and their significance to future impregnant research

    International Nuclear Information System (INIS)

    Boicourt, G.P.

    1975-01-01

    For a considerable time castor oil and polychlorinated biphenyl (PCB) have been the principal impregnants used in energy-storage capacitors. Castor oil has proven to be better than PCB for pulsed applications. PCB's have come under attack as an environmental hazard, while castor oil is a vegetable product and its supply and quality are subject to fluctuation. These two facts make the development of new impregnants desirable. The properties of PCB as a capacitor impregnant are well known. This paper first compares a number of properties of castor oil and PCB's. A comparison is made between the lives of castor oil capacitors and comparable PCB energy-storage capacitors. Some of the physical and chemical properties of castor oil which make it a good pulse capacitor impregnant are examined. These properties can be used as a guide for future research on new pulse capacitor impregnants

  4. The domestic veil: exploring the net curtain through the uncanny and the gothic

    OpenAIRE

    Quarini, Carol

    2015-01-01

    This research aims to develop original creative practice, using the net curtain to reconsider the domestic, through the lenses of the uncanny and the gothic. The net curtain, hanging in the liminal space between the public and the private, is used to embody Freud’s 1919 definition of the uncanny, as the point of slippage between the homely and the unhomely. Also central to this research are ideas about the gothic and gendered domesticity, in particular, the gothic fiction of the mid-nineteent...

  5. A new intelligent curtain control system based on 51 single chip microcomputer

    Science.gov (United States)

    Sun, Tuan; Wang, Yanhua; Wu, Mengmeng

    2017-04-01

    This paper uses 51 (single chip microcomputer) SCM as the operation and data processing center. According to the change of sunshine intensity and ambient temperature, a new type of intelligent curtain control system is designed by adopting photosensitive element and temperature sensor. In addition, the design also has a manual control mode. In the rain, when the light intensity is weak, the open position of the curtain can be set by the user. The system can maximize the user to provide user-friendly operation and comfortable living environment. The system can be applied to home or office environment, with a wide range of applications and simple operation and so on.

  6. Air curtain technology improves working conditions with open hall doors; Luftschleiertechnik verbessert Arbeitsbedingungen bei geoeffneten Hallentoren

    Energy Technology Data Exchange (ETDEWEB)

    Multhauf, R. [Biddle GmbH, Koeln (Germany)

    1998-11-01

    Hall doors are indispensable for short logistic distances of product or raw materials management. Air curtain systems make it possible to keep doors open independent of the weather and season. The heating energy requiremens of modern air curtain systems has been reduced significantly. (orig.) [Deutsch] Hallentore sind fuer moeglichst kurze Logistikwege der Waren oder Rohstoffe im industriellen Betrieb unvermeidlich. Luftschleieranlagen ermoeglichen offene Tore unabhaengig von der Witterung und der Jahreszeit. Die zur Betreibung der Luftschleieranlagen notwendige Heizenergie wurde durch neue Entwicklungen stark reduziert. (orig.)

  7. The use of water curtains to protect firemen in case of heavy gas dispersion

    Energy Technology Data Exchange (ETDEWEB)

    Bara, A.; Dusserre, G. [Ecole Nationale Superieure des Techniques Industrielles et des Mines d`Ales (France). Lab. Genie de l`Environnement Industriel

    1997-05-01

    The aim of this paper is to study the effectiveness of the water curtains used by firemen in France to protect people fighting chemical spillage. The effectiveness of these barriers is a reduction in concentration behind it by a factor of 10 at a distance of approximately 13 m and a factor of 3 at a distance of approximately 20 m in the case of ammonia releases. The results of similar studies of a wide variety of toxic gases will provide a quick and reliable tool for firefighters, which will help to define at what distance to place the curtain and predict the concentrations behind it. (UK)

  8. Experimental investigations of an air curtain device subjected to external perturbations

    International Nuclear Information System (INIS)

    Havet, M.; Rouaud, O.; Solliec, C.

    2003-01-01

    Although plane air jets are often used as dynamic barriers to separate two environments, only a few works have explored their sensitivity to perturbations. We investigated the influence of sharp changes of pressure on the flow field of a device designed to avoid air-borne contamination. Laser tomography and tracer gas experiments clearly indicate that the air curtain is strongly sensitive to perturbations such as draughts. The results highlight that the control of air curtains used in open protection devices should be further investigated

  9. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.

  10. Protection against head injuries should not be optional: a case for mandatory installation of side-curtain air bags.

    Science.gov (United States)

    Stuke, Lance E; Nirula, Raminder; Gentilello, Larry M; Shafi, Shahid

    2010-10-01

    More than 9,000 vehicle occupants die each year in side-impact vehicle collisions, primarily from head injuries. The authors hypothesized that side-curtain air bags significantly improve head and neck safety in side-impact crash testing. Side-impact crash-test data were obtained from the Insurance Institute for Highway Safety, which ranks occupant protection as good, acceptable, marginal, or poor. Vehicles of the same make and model that underwent side-impact crash testing both with and without side-curtain air bags were compared, as well as the protective effect of these air bags on occupants' risk for head and neck injury. Of all the passenger vehicles, 25 models have undergone side-impact crash testing with and without side-curtain air bags by the Insurance Institute for Highway Safety. Only 3 models without side-curtain air bags (12%) provided good head and neck protection for drivers, while 21 cars with side-curtain air bags (84%) provided good protection (P bags was less dramatic but significant (84% without vs 100% with side-curtain air bags, P = .04). Side-curtain air bags significantly improve vehicle occupant safety in side-impact crash tests. Installation of these air bags should be federally mandated in all passenger vehicles. Copyright © 2010 Elsevier Inc. All rights reserved.

  11. Numerical study on the effect of width of single curtain on the performance of Savonius wind turbine

    Directory of Open Access Journals (Sweden)

    Yuwono Triyogi

    2018-01-01

    Full Text Available This is a preliminary results of the flow around the Savonius wind turbine with installing curtain plate in front of the returning blade turbine. It was investigated numerically in a uniform flow at Reynolds number of 30,000 and 90,000. The velocity vector and pressure distribution around the turbine were simulate by varying the width of curtain plate relative to the diameter of rotor blade (S/D of = 1.00, 1.02, 1.03, 1.15, 1.41, and 2.00, using STAR CCM++ Software. The k-ɛ realizable as turbulence model was used to visualize the flow phenomena occurred around the turbine, and where in this simulation, the rotor turbine was set static. The results show that it seems the width of the curtain installed in front of the returning blade of the turbine plays an important role in the performance of the turbine. In general, the installing of the curtain in front of the returning blade of the turbine is more effective to improve the turbine performance. This is not necessarily, but depends on the width of the curtain and the number of Reynolds (Re. For the width of the large curtain of S/D = 2 at Re = 90,000, the performance of the turbine is estimated lower than when the turbine without the curtain.

  12. Comparison of heat transfer and soil impacts of air curtain burner burning and slash pile burning

    Science.gov (United States)

    Woongsoon Jang; Deborah S. Page-Dumroese; Han-Sup Han

    2017-01-01

    We measured soil heating and subsequent changes in soil properties between two forest residue disposal methods: slash pile burning (SPB) and air curtain burner (ACB). The ACB consumes fuels more efficiently and safely via blowing air into a burning container. Five burning trials with different fuel sizes were implemented in northern California, USA. Soil temperature...

  13. Optimization of air-curtain sealing efficiency with respect to heat transfer in naturally ventilated buildings

    NARCIS (Netherlands)

    Khayrullina, A.; Hooff, van T.A.J.; Blocken, B.J.E.; van Heijst, G.J.F.; Sun, Y.; Pei, J.; Zhao, X

    This study presents results of coupled 3D steady Reynolds-averaged Navier-Stokes (RANS) Computational Fluid Dynamics (CFD) simulations of an isolated naturally-ventilated building with the application of an air curtain to prevent heat transfer across a doorway. The considered parameters include air

  14. Boron concentration evolution in the temporary curtains of a BWR reactor. Burcur code

    International Nuclear Information System (INIS)

    Cano Aguado, M.; Perlado Martin, J.M.; Minguez Torres, E.

    1977-01-01

    The theoretical model and the user's guide of the code Burcur is included. This code analyzes the burnable poison concentration of the temporary curtains as a function of time, for BWR reactors of the 7 x 7 design. The computing time being reasonably short, the number of burnup steps is as high as necessary.(author) [es

  15. PECULIARITIES OF DESIGN OF CURTAIN WALL SYSTEMS TO ASSURE THERMAL INSULATION

    Directory of Open Access Journals (Sweden)

    Golunov Sergej Anatolevich

    2012-10-01

    The results of laboratory tests (given the adjustments for permissible tolerances may be regarded as the principal criteria in the assessment of applicability of a curtain wall system in the course of a major building repair project or a new construction to assure the required reliability and durability.

  16. Blast Analysis of Laminated Glass Curtain Walls Equipped by Viscoelastic Dissipative Devices

    Directory of Open Access Journals (Sweden)

    Chiara Bedon

    2012-09-01

    Full Text Available Nonlinear numerical simulations are reported for a conventional unitized laminated glass curtain wall subjected to high- and low-level air blast loading. The studied curtain wall, spanning floor to floor, consisted of a laminated glass panel, a continuous bead of structural silicone sealant, a split screw spline frame and four rigid brackets. Firstly, a linear elastic FE-model (M01 is presented to investigate dynamic stresses and deflections due to explosion, by taking into account geometrical nonlinearities. Since, in similar glazing systems, it is important to take into account the possible cracking of glass lites, a second model (M02, calibrated to previous experimental data, is proposed. In it, glass behaves as a brittle-elastic material, whereas an elastoplastic characteristic curve is assumed for mullions. As a result, the design explosion seriously affects the main components of the curtain wall, especially the bead of silicone. To address these criticalities, additional viscoelastic (VE devices are installed at the frame corners (M03. Their effectiveness explains the additional deformability provided to the conventional curtain wall, as well as the obvious dissipation of the incoming energy due to blast loading. Structural and energy capabilities provided by devices are highlighted by means of numerical simulations.

  17. 40 CFR 60.3062 - What is an air curtain incinerator?

    Science.gov (United States)

    2010-07-01

    ... Other Solid Waste Incineration Units That Commenced Construction On or Before December 9, 2004 Model Rule-Air Curtain Incinerators That Burn Only Wood Waste, Clean Lumber, and Yard Waste § 60.3062 What is... this subpart. (1) 100 percent wood waste. (2) 100 percent clean lumber. (3) 100 percent yard waste. (4...

  18. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors

    OpenAIRE

    Reid, Molly C.; McKenzie, F. Ellis

    2016-01-01

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malari...

  19. Acceptability of impregnated school uniforms for dengue control in Thailand: a mixed methods approach.

    Science.gov (United States)

    Murray, Natasha; Jansarikij, Suphachai; Olanratmanee, Phanthip; Maskhao, Pongsri; Souares, Aurélia; Wilder-Smith, Annelies; Kittayapong, Pattamaporn; Louis, Valérie R

    2014-01-01

    As current dengue control strategies have been shown to be largely ineffective in reducing dengue in school-aged children, novel approaches towards dengue control need to be studied. Insecticide-impregnated school uniforms represent an innovative approach with the theoretical potential to reduce dengue infections in school children. This study took place in the context of a randomised control trial (RCT) to test the effectiveness of permethrin-impregnated school uniforms (ISUs) for dengue prevention in Chachoengsao Province, Thailand. The objective was to assess the acceptability of ISUs among parents, teachers, and principals of school children involved in the trial. Quantitative and qualitative tools were used in a mixed methods approach. Class-clustered randomised samples of school children enrolled in the RCT were selected and their parents completed 321 self-administered questionnaires. Descriptive statistics and logistic regression were used to analyse the quantitative data. Focus group discussions and individual semi-structured interviews were conducted with parents, teachers, and principals. Qualitative data analysis involved content analysis with coding and thematic development. The knowledge and experience of dengue was substantial. The acceptability of ISUs was high. Parents (87.3%; 95% CI 82.9-90.8) would allow their child to wear an ISU and 59.9% (95% CI 53.7-65.9) of parents would incur additional costs for an ISU over a normal uniform. This was significantly associated with the total monthly income of a household and the educational level of the respondent. Parents (62.5%; 95% CI 56.6-68.1) indicated they would be willing to recommend ISUs to other parents. Acceptability of the novel tool of ISUs was high as defined by the lack of concern along with the willingness to pay and recommend. Considering issues of effectiveness and scalability, assessing acceptability of ISUs over time is recommended.

  20. Acceptability of impregnated school uniforms for dengue control in Thailand: a mixed methods approach

    Directory of Open Access Journals (Sweden)

    Natasha Murray

    2014-09-01

    Full Text Available Background: As current dengue control strategies have been shown to be largely ineffective in reducing dengue in school-aged children, novel approaches towards dengue control need to be studied. Insecticide-impregnated school uniforms represent an innovative approach with the theoretical potential to reduce dengue infections in school children. Objectives: This study took place in the context of a randomised control trial (RCT to test the effectiveness of permethrin-impregnated school uniforms (ISUs for dengue prevention in Chachoengsao Province, Thailand. The objective was to assess the acceptability of ISUs among parents, teachers, and principals of school children involved in the trial. Methodology: Quantitative and qualitative tools were used in a mixed methods approach. Class-clustered randomised samples of school children enrolled in the RCT were selected and their parents completed 321 self-administered questionnaires. Descriptive statistics and logistic regression were used to analyse the quantitative data. Focus group discussions and individual semi-structured interviews were conducted with parents, teachers, and principals. Qualitative data analysis involved content analysis with coding and thematic development. Results: The knowledge and experience of dengue was substantial. The acceptability of ISUs was high. Parents (87.3%; 95% CI 82.9–90.8 would allow their child to wear an ISU and 59.9% (95% CI 53.7–65.9 of parents would incur additional costs for an ISU over a normal uniform. This was significantly associated with the total monthly income of a household and the educational level of the respondent. Parents (62.5%; 95% CI 56.6–68.1 indicated they would be willing to recommend ISUs to other parents. Conclusions: Acceptability of the novel tool of ISUs was high as defined by the lack of concern along with the willingness to pay and recommend. Considering issues of effectiveness and scalability, assessing acceptability of ISUs

  1. Impregnation of soft biological specimens with thermosetting resins and elastomers.

    Science.gov (United States)

    von Hagens, G

    1979-06-01

    A new method for impregnation of biological specimens with thermosetting resins and elastomers is described. The method has the advantage that the original relief of the surface is retained. The impregnation is carried out by utilizing the difference between the high vapor tension of the intermedium (e.g., methylene chloride) and the low vapor tension of the solution to be polymerized. After impregnation, the specimen is subject to polymerization conditions without surrounding embedding material. The optical and mechanical properties can be selected by proper choice from various kinds of resins and different procedures, for example, by complete or incomplete impregnation. Acrylic resins, polyester resins, epoxy resins, polyurethanes and silicone rubber have been found suitable for the method. Excellent results have been obtained using transparent silicone rubber since after treatment the specimens are still flexible and resilient, and have retained their natural appearance.

  2. Reactions of sulphur mustard on impregnated carbons.

    Science.gov (United States)

    Prasad, G K; Singh, Beer

    2004-12-31

    Activated carbon of surface area 1100 m2/gm is impregnated with 4% sodium hydroxide plus 3% Cr(VI) as CrO3 with and without 5% ethylene diamine (EDA), 4% magnesium nitrate and 5% ruthenium chloride by using their aqueous solutions. These carbons are characterized for surface area analysis by BET conventional method and exposed to the vapours of sulphur mustard (HD) at room temperature (30 degrees C). After 24 h, the reaction products are extracted in dichloromethane and analyzed using gas chromatography and mass spectrometry (GC-MS). Hemisulphur mustard, thiodiglycol, 1,4-oxathiane are observed to be the products of reaction between sulphur mustard and NaOH/CrO3/C system, whereas on NaOH/CrO3/EDA/C system HD reacted to give 1,4-thiazane. On Mg(NO3)2/C system it gave hemisulphur mustard and thiodiglycol. On RuCl3/C system it degraded to divinyl sulphone. Residual sulphur mustard is observed along with reaction products in all systems studied. Reaction mechanisms are also proposed for these interesting surface reactions. Above-mentioned carbons can be used in filtration systems for protection against hazardous gases such as sulphur mustard.

  3. Reactions of sulphur mustard on impregnated carbons

    International Nuclear Information System (INIS)

    Prasad, G.K.; Singh, Beer

    2004-01-01

    Activated carbon of surface area 1100 m 2 /gm is impregnated with 4% sodium hydroxide plus 3% Cr(Vi) as CrO 3 with and without 5% ethylene diamine (EDA), 4% magnesium nitrate and 5% ruthenium chloride by using their aqueous solutions. These carbons are characterized for surface area analysis by BET conventional method and exposed to the vapours of sulphur mustard (HD) at room temperature (30 deg. C). After 24 h, the reaction products are extracted in dichloromethane and analyzed using gas chromatography and mass spectrometry (GC-MS). Hemisulphur mustard, thiodiglycol, 1,4-oxathiane are observed to be the products of reaction between sulphur mustard and NaOH/CrO 3 /C system, whereas on NaOH/CrO 3 /EDA/C system HD reacted to give 1,4-thiazane. On Mg(NO 3 ) 2 /C system it gave hemisulphur mustard and thiodiglycol. On RuCl 3 /C system it degraded to divinyl sulphone. Residual sulphur mustard is observed along with reaction products in all systems studied. Reaction mechanisms are also proposed for these interesting surface reactions. Above-mentioned carbons can be used in filtration systems for protection against hazardous gases such as sulphur mustard

  4. Fracture in Phenolic Impregnated Carbon Ablator

    Science.gov (United States)

    Agrawal, Parul; Chavez-Garcia, Jose; Pham, John

    2013-01-01

    This paper describes the development of a novel technique to understand the failure mechanisms inside thermal protection materials. The focus of this research is on the class of materials known as phenolic impregnated carbon ablators. It has successfully flown on the Stardust spacecraft and is the thermal protection system material chosen for the Mars Science Laboratory and SpaceX Dragon spacecraft. Although it has good thermal properties, structurally, it is a weak material. To understand failure mechanisms in carbon ablators, fracture tests were performed on FiberForm(Registered TradeMark) (precursor), virgin, and charred ablator materials. Several samples of these materials were tested to investigate failure mechanisms at a microstructural scale. Stress-strain data were obtained simultaneously to estimate the tensile strength and toughness. It was observed that cracks initiated and grew in the FiberForm when a critical stress limit was reached such that the carbon fibers separated from the binder. However, both for virgin and charred carbon ablators, crack initiation and growth occurred in the matrix (phenolic) phase. Both virgin and charred carbon ablators showed greater strength values compared with FiberForm samples, confirming that the presence of the porous matrix helps in absorbing the fracture energy.

  5. Irritability Levels of Field and Laboratory Population of Culex pipiens Complex in Tehran to Different Groups of Insecticides

    Directory of Open Access Journals (Sweden)

    Sara Rahimi

    2016-01-01

    Full Text Available Background: The irritant effect of some insecticides can cause a proportion of mosquitoes to leave the sprayed rooms before acquiring a lethal dose, so the repeated contact al sub-lethal dose may lead to extent the resistance.Methods: Larvae and pupae of Culex pipiens complex were collected in mass from open canals of waste water in capital city Tehran and reared to obtain the first generation at laboratory. Sugar-fed 2–3 days female mosquitoes were used for the experiments and compared with laboratory strain. The irritability tests of insecticides impregnated pa­pers were measured in plastic conical exposure chambers placed which implemented at controlled conditions ac­cording  to  the  method  described  by WHO .Number of take-offs were counted during 15  minutes of exposure  time.Results: DDT had the most irritancy effect against field population of Cx. pipiens. DDT, permethrin and deltamethrin was moderately irritable against laboratory strain, whereas, addition to three previous insecticides, malathion, cyfluthrin and propoxur should be also considered as moderately irritable insecticides for field population of. Irritability level of etofenprox, fenithrothion, bendiocarb, and lambdacyhalothrin did not differ from control group.Conclusion: The irritability response of mosquitoes may have a negative impact on control measures. Periodical execution of irritability tests with insecticides that routinely used in vector control program is highly recommended.

  6. A kinetic study of pyrolysis in pitch impregnated electrodes

    Energy Technology Data Exchange (ETDEWEB)

    Kocaefe, D.; Charette, A.; Ferland, J.; Couderc, P.; Saint-Romain, J.L. (Universite du Quebec a Chicoutini, Chicoutini, PQ (Canada))

    1990-12-01

    A study was conducted on carbon electrodes which were impregnated with three different pitches. The focus of the study was to investigate the pyrolysis of pitch impregnated electrodes. For the purposes of the research an experimental technique and calculation procedure were developed. A kinetic model was used to interpret the data, comparison of model predictions and experimental data showed good agreement. 17 refs., 10 figs., 2 tabs.

  7. Curtain color and lighting program in broiler production: I - general performance

    Directory of Open Access Journals (Sweden)

    Valéria Maria Nascimento Abreu

    2011-09-01

    Full Text Available The objective of the present study was to evaluate mortality and performance, darkling beetle population (Alphitobius diaperinus, light intensity, electrical energy consumption and economic efficiency of broilers reared under two lighting programs (nearly continuous or intermittent and two curtain colors (yellow or blue. The experiment was conducted between June, 2004 and May, 2005. Six flocks were sequentially housed in four 12 × 10 m broiler houses divided into 4 pens with 200 birds each. Litter was reused six times or until flock 6. Body weight and feed conversion were determined on days 21, 35, and 42 of each flock. Mortality was recorded daily. Electrical energy consumption was recorded at the end of the grow-out of each flock (every 42 days. A completely randomized design in a 6 × 2 × 2 factorial arrangement (flocks, lighting programs, curtains with four replicates per treatment was applied. Broilers reared in houses with yellow curtains and under nearly continuous lighting programs presented the best feed conversion ratio and the highest body weight. Nearly continuous lighting programs resulted in 1.48 times more sudden deaths and 1.34 times higher general mortality when compared with intermittent lighting programs. Electrical energy consumption was 2.12 times higher in nearly continuous lighting programs in relation to intermittent lighting programs. The presence of darkling beetles was higher in broiler houses with blue curtains and intermittent lighting program. The economic analysis showed the feasibility of using a mixed system, with intermittent light program in winter and spring and nearly continuous lighting program in the summer and autumn, both in broiler houses with yellow curtains.

  8. Pyrethrum flowers and pyrethroid insecticides.

    OpenAIRE

    Casida, J E

    1980-01-01

    The natural pyrethrins from the daisy-like flower, Tanacetum or Chrysanthemum cinerariifolium, are nonpersistent insecticides of low toxicity to mammals. Synthetic analogs or pyrethroids, evolved from the natural compounds by successive isosteric modifications, are more potent and stable and are the newest important class of crop protection chemicals. They retain many of the favorable properties of the pyrethrins.

  9. Limonene--A Natural Insecticide.

    Science.gov (United States)

    Beatty, Joseph H.

    1986-01-01

    Describes a high school chemistry student's research project in which limonene was isolated from the oil of lemons and oranges. Outlines the students' tests on the use of this chemical as an insecticide. Discusses possible extensions of the exercises based on questions generated by the students. (TW)

  10. Radioligand Recognition of Insecticide Targets.

    Science.gov (United States)

    Casida, John E

    2018-04-04

    Insecticide radioligands allow the direct recognition and analysis of the targets and mechanisms of toxic action critical to effective and safe pest control. These radioligands are either the insecticides themselves or analogs that bind at the same or coupled sites. Preferred radioligands and their targets, often in both insects and mammals, are trioxabicyclooctanes for the γ-aminobutyric acid (GABA) receptor, avermectin for the glutamate receptor, imidacloprid for the nicotinic receptor, ryanodine and chlorantraniliprole for the ryanodine receptor, and rotenone or pyridaben for NADH + ubiquinone oxidoreductase. Pyrethroids and other Na + channel modulator insecticides are generally poor radioligands due to lipophilicity and high nonspecific binding. For target site validation, the structure-activity relationships competing with the radioligand in the binding assays should be the same as that for insecticidal activity or toxicity except for rapidly detoxified or proinsecticide analogs. Once the radioligand assay is validated for relevance, it will often help define target site modifications on selection of resistant pest strains, selectivity between insects and mammals, and interaction with antidotes and other chemicals at modulator sites. Binding assays also serve for receptor isolation and photoaffinity labeling to characterize the interactions involved.

  11. Efficacy of bifenthrin-impregnated bednets against Anopheles funestus and pyrethroid-resistant Anopheles gambiae in North Cameroon

    Directory of Open Access Journals (Sweden)

    Chouaibou Mouhamadou

    2006-09-01

    Full Text Available Abstract Background Recent field studies indicated that insecticide-treated bednets (ITNs maintain their efficacy despite a high frequency of the knock-down resistance (kdr gene in Anopheles gambiae populations. It was essential to evaluate ITNs efficacy in areas with metabolic-based resistance. Methods Bifenthrin was used in this experiment because it is considered a promising candidate for bednets impregnation. Nets were treated at 50 mg/m2, a dose that has high insecticidal activity on kdr mosquitoes and at 5 mg/m2, a dose that kills 95% of susceptible mosquitoes under laboratory conditions with 3 minutes exposure. Bednets were holed to mimic physical damage. The trial was conducted in three experimental huts from Pitoa, North-Cameroon where Anopheles gambiae displays metabolic resistance and cohabits with An. funestus. Results Bifenthrin at 50 mg/m2 significantly reduced anophelines' entry rate (>80%. This was not observed at 5 mg/m2. Both treatments increased exophily in An. gambiae, and to a lesser extent in An. funestus. With bifenthrin at high dosage, over 60% reduction in blood feeding and 75–90% mortality rates were observed in both vectors. Despite presence of holes, only a single An. gambiae and two An. funestus females were collected inside the treated net, and all were found dead. The same trends were observed with low dosage bifenthrin though in most cases, no significant difference was found with the untreated control net. Conclusion Bifenthrin-impregnated bednets at 50 mg/m2 were efficient in the reduction of human-vector contact in Pitoa. Considerable personal protection was gained against An. funestus and metabolic pyrethroid resistant An. gambiae populations.

  12. Efficacy of bifenthrin-impregnated bednets against Anopheles funestus and pyrethroid-resistant Anopheles gambiae in North Cameroon

    Science.gov (United States)

    Chouaibou, Mouhamadou; Simard, Frédéric; Chandre, Fabrice; Etang, Josiane; Darriet, Frédéric; Hougard, Jean-Marc

    2006-01-01

    Background Recent field studies indicated that insecticide-treated bednets (ITNs) maintain their efficacy despite a high frequency of the knock-down resistance (kdr) gene in Anopheles gambiae populations. It was essential to evaluate ITNs efficacy in areas with metabolic-based resistance. Methods Bifenthrin was used in this experiment because it is considered a promising candidate for bednets impregnation. Nets were treated at 50 mg/m2, a dose that has high insecticidal activity on kdr mosquitoes and at 5 mg/m2, a dose that kills 95% of susceptible mosquitoes under laboratory conditions with 3 minutes exposure. Bednets were holed to mimic physical damage. The trial was conducted in three experimental huts from Pitoa, North-Cameroon where Anopheles gambiae displays metabolic resistance and cohabits with An. funestus. Results Bifenthrin at 50 mg/m2 significantly reduced anophelines' entry rate (>80%). This was not observed at 5 mg/m2. Both treatments increased exophily in An. gambiae, and to a lesser extent in An. funestus. With bifenthrin at high dosage, over 60% reduction in blood feeding and 75–90% mortality rates were observed in both vectors. Despite presence of holes, only a single An. gambiae and two An. funestus females were collected inside the treated net, and all were found dead. The same trends were observed with low dosage bifenthrin though in most cases, no significant difference was found with the untreated control net. Conclusion Bifenthrin-impregnated bednets at 50 mg/m2 were efficient in the reduction of human-vector contact in Pitoa. Considerable personal protection was gained against An. funestus and metabolic pyrethroid resistant An. gambiae populations. PMID:16961938

  13. Logistic advantages of an air curtain in a cold store; Heiploeg ervaart logistieke voordelen van vrieshuis-luchtgordijn

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-07-01

    Fog and ice are problems in cold storage warehouses. A manufacturer of air conditioning equipment (Biddle in Kootstertille, Netherlands) claims to have found the solution in the so-called Multi Air stream Technology, an air curtain for cold stores.

  14. PROTECTIVE TREATMENT OF WOOD IMPREGNATING COMPOSITION OF PETROCHEMICAL WASTE

    Directory of Open Access Journals (Sweden)

    T. V. Maslakova

    2015-01-01

    Full Text Available The paper presents results of experimental and theoretical studies aimed at expanding the applications of the copolymers on the basis of the waste styrene production. One of the areas is used as impregnating compositions of wood materials, selection of optimal conditions modification on samples of the most widely used in the industry of wood, such as birch, aspen and other. Studies were conducted to obtain and use an impregnating compositions based on copolymers synthesized from waste products of styrene and the cubic remainder rectification of ethylbenzene (CRRE for the protective treatment of birch wood. Identified physic-chemical characteristics of physical mixtures of copolymers «CORS», «STAM», CRRE at different ratios. Studied the process of modification birch using the method of experiment planning greco-latin square of the fourth order, and the influence of such factors as the temperature of the impregnating composition, the duration of the impregnation, the temperature and duration of thermal treatment on the performance moisture resistance of wood. Were established optimal conditions modification birch wood treated impregnating compositions on the basis of physical mixtures of copolymer «CORS» with CRRE and copolymer «STAM» with CRRE is the mixing ratio 2:1, the duration and temperature of the impregnation 7 h and 95 0C, time and temperature of heat treatment 7 h and 170 0C, respectively. A sealing composition containing CRRE with copolymer «STAM» 1:2 is more preferable, as in the structure of the copolymer «STAM» contains carboxyl and anhydrite group. Thus was justified use for the modification of natural wood impregnating compositions on the basis of physical mixtures of CRRE with copolymers «CORS» and «STAM», which improve the properties of wood, increase moisture and weather resistance more than twice.

  15. The contribution of agricultural insecticide use to increasing insecticide resistance in African malaria vectors.

    Science.gov (United States)

    Reid, Molly C; McKenzie, F Ellis

    2016-02-19

    The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malaria vectors were identified. In 23 of the 25 relevant recent publications from across Africa, higher resistance in mosquito populations was associated with agricultural insecticide use. This association appears to be affected by crop type, farm pest management strategy and urban development.

  16. Draught control by means of industrial air curtains. Background information on the design of industrial air curtains; Tochtbestrijding met industriele luchtgordijnen. Achtergronden bij ontwerp van industriele luchtgrodijnen

    Energy Technology Data Exchange (ETDEWEB)

    Cremers, B. [Biddle, Kootstertille (Netherlands); Traversar, R. [TNO Milieu, Energie en Procesinnovatie TNO-MEP, Apeldoorn (Netherlands)

    2008-02-15

    In industrial buildings a balanced ventilation is not common property. Due to increasing differences in pressure across the front much cold outside air enters the building, resulting in poor comfort near the door. A good air curtain can heat up large amounts of incoming cold outside air in such a way that energy saving is optimal and comfort remains high. (mk) [Dutch] Bij industriele gebouwen is gebalanceerde ventilatie geen gemeengoed. Door oplopende drukverschillen over de gevel komt veel koude buitenlucht naar binnen en is het comfort vlak achter de deur erg laag. Een goed luchtgordijn kan grote hoeveelheden binnenkomende koude buitenlucht zodanig opwarmen dat de energiebesparing optimaal is en het comfort hoog blijft.

  17. Durability of Gamma Irradiated Polymer Impregnated Blended Cement Pastes

    International Nuclear Information System (INIS)

    Khattab, M.M.; Abdel-Rahman, H.A.; Younes, M.M.

    2010-01-01

    This study is focusing on durability and performance of the neat blended cement paste as well as those of the polymer-impregnated paste towards seawater and various concentrations of magnesium sulfate solutions up to 6 months of curing. The neat blended cement paste is prepared by a partial substitution of ordinary Portland cement with 5% of active rice husk ash (RHA). These samples were cured under tap water for 7 days. Similar samples were impregnated with unsaturated polyester resin (UPE) and subjected to various doses of gamma rays ranging from 10 to 50 kGy. The results showed that the irradiated impregnated specimens gave higher values of compressive strength than the neat blended cement paste specimens. On immersing the neat blended cement specimens and polymer impregnated specimens especially that irradiated at 30 kGy in seawater and different concentrations of magnesium sulfate solutions up to 6 months of curing, the results showed that the polymer impregnated blended cement (OPC-RHA-UPE) paste have a good resistance towards aggressive media as compared to the neat blended cement (OPC-RHA) paste. The results also indicated that the sea water has a greater corrosive effect than the magnesium sulfate solutions. These results were confirmed by scanning electron microscopy (SEM) and mercury intrusion porosimetry (MIP)

  18. Impregnated Fibrous Materials. Report of a Study Group on Impregnated Fibrous Materials

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1968-10-15

    There has recently been renewed interest in the use of radiation from radioisotopes or particle accelerators to initiate and sustain chemical reactions. Particular attention is being paid to the production of wood-plastic composites, a process which is now a commercial reality with radiation competing against chemical methods to enhance the properties of wood. It has been reported that water repellancy, hardness, weathering, insect and chemical resistance, compressive, bending and shear strength can be significantly improved by the process, but so far there has been a limited commercial outlet for the product. Papers on this subject were presented at the International Atomic Energy Agency's Symposium on Industrial Uses of Large Radiation Sources, Salzburg, May 1963, and since then the Agency has been aware of the interest of developing countries in conducting research on wood and other fibrous materials as a means of further exploiting natural resources. It was felt that some attempt should be made to co-ordinate, on a regional basis, the work being done in this field and at the same time review the world status, including the associated technology in such areas as monomer-polymer chemistry and impregnation techniques where they are directly related to this work. Because of the wide range of fibrous materials being studied there, Asia and the Far East was chosen as the most representative area and 39 participants from 13 countries, and from international organizations, met in Bangkok from 20 to 24 November 1967 to assess the potential of impregnated fibrous materials. This report is a record of the meeting and is based not only on work performed both inside and outside the region but also on details of the resources and industries in the area.

  19. Study on construction technology of metro tunnel under a glass curtain wall

    Science.gov (United States)

    Zhang, Jian; Yu, Deqiang

    2018-03-01

    To ensure the safety of the glass curtain wall building above loess tunnel and get an optimal scheme, an elastic-plastic FEM model is established to simulate three reinforcement schemes based on a tunnel section in Xi’an Metro Line 3. The results show that the settlement value of the optimal scheme is reduced by 69.89% compared with the drainage measures, and the uneven settlement value is reduced by 57.5%. The construction points, technical processes and technical indexes of the optimal scheme are introduced. According to the actual project, the cumulative settlement of the building under construction is 16mm, which meets the control standards. According to the actual project, the cumulative settlement of the glass curtain wall building is 16mm, which meets the control standards. The reinforcement scheme can provide some reference for the design and construction of the metro in loess area.

  20. Generator of a dense atomic gas curtain (for use in Intersecting Storage Rings)

    CERN Document Server

    Zankel, K

    1975-01-01

    A supersonic beam source is described which continuously generates a gas curtain for the proton beam profile observation in the Intersecting Storage Rings at CERN. Its maximum intensity is 10/sup 20 / atoms/sr s. A commonly used theoretical model for the determination of the intensity downstream of the source is discussed. Some results about the condensation behaviour of sodium vapour on metallic substrate surfaces are reported. (8 refs).

  1. PERMEABILITY OF SAVCIBEY DAM (BİLECİK AXIS LOCATION AND DESIGN OF GROUT CURTAIN

    Directory of Open Access Journals (Sweden)

    Mustafa Can Canoğlu

    2016-12-01

    Full Text Available This study comprise the design of the planned grout curtain in Savcıbey Dam (Söğüt/Bilecik in order to provide impermeability along the dam axis. Within the context of field studies, engineering geology map was generated, ground investigation drilling was realized and permeability tests were performed. Within the field studies, the joint conditions of the geological units (Triassic aged Bozuyük Metamorphic schists under the dam axis and its effect on permeability was observed considering the positions of the discontinuities with regard to the dam axis location. Orientation of discontinuities generally have strikes changing between N – S and NNE – SSW. 5 boreholes on dam axis, 2 boreholes on cofferdam, 3 boreholes on diversion tunnel and 2 boreholes on spillway total 245 m ground investigation borehole were drilled. In order to determine the permeability profile of dam axis and design the grout curtain, Lugeon tests in Bozuyük Metamorphic units observed in dam axis, falling head permeability tests in alluviums observed in thalveg and slope debris observed in right abutment were performed. Lugeon tests realized in Bozuyük Metamorphic units show that the unit is generally permeable and partly low permeable. Alluvium and slope debris are highly permeable. In addition, drilling works realized in dam axis shows that the augmentation of the weathering degree cause an increase of permeability in Triassic aged Bozüyük Metamorphic schists. As a result of these studies information about the permeability of Savcıbey Dam was collected and the grout curtain hole was designed. Accordingly, it is predicted that approximately 40 m depth of grout curtain from the stripping excavation with the depth of 1.50 m would prevent the possible leakages.

  2. The use of an air curtain in a cold store; Vrieshuis toegankelijker en veiliger met luchtscherm

    Energy Technology Data Exchange (ETDEWEB)

    Bruins, K. [Biddle, Kootstertille (Netherlands)

    1998-04-01

    A food distribution centre of a German chain of supermarkets applies an air curtain in one of their distribution centres (Neudietendorf, Erfurt). The door of the distribution centre building can be left open constantly which improves internal transport of the goods (next to dry products also many frozen products). Even more important is that ice forming in the passage is reduced to a minimum and the safety for the workers has improved considerably

  3. On the use of infrared thermography in studies with air curtain devices

    OpenAIRE

    Neto, Luís P. C.; Silva, Manuel Gameiro da; Costa, José J.

    2006-01-01

    Among the different existing methods to characterise the aerodynamic sealing effect provided by an air curtain device placed over the opening between two contiguous compartments, infrared thermography has revealed to be a very useful tool. Besides allowing the capture, in an expedite way, of instantaneous images of the temperature field in the neighbourhood of the door, the technique hereon described has other advantages, in terms of quick and easy setup, low intrusive character and liability ...

  4. Starch-modified magnetite nanoparticles for impregnation into cartilage

    Energy Technology Data Exchange (ETDEWEB)

    Soshnikova, Yulia M., E-mail: yuliasoshnikova@gmail.com [Russian Academy of Sciences, Institute on Laser and Information Technologies (Russian Federation); Roman, Svetlana G.; Chebotareva, Natalia A. [A.N. Bach Institute of Biochemistry (Russian Federation); Baum, Olga I. [Russian Academy of Sciences, Institute on Laser and Information Technologies (Russian Federation); Obrezkova, Mariya V. [Lomonosov Moscow State University, Department of Chemistry (Russian Federation); Gillis, Richard B.; Harding, Stephen E. [University of Nottingham, National Centre for Macromolecular Hydrodynamics (United Kingdom); Sobol, Emil N. [Russian Academy of Sciences, Institute on Laser and Information Technologies (Russian Federation); Lunin, Valeriy V. [Lomonosov Moscow State University, Department of Chemistry (Russian Federation)

    2013-11-15

    The paper presents preparation and characterization of starch-modified Fe{sub 3}O{sub 4} nanoparticles (NPs) in aqueous dispersion after impregnation into healthy and damaged types of cartilage. We show that starch-modified dispersion has a narrower size distribution than a non‐stabilized one. The average hydrodynamic radius of magnetite NPs in a dispersion used for impregnation into cartilage is (48 ± 1) nm with the width of the distribution from 5 to 200 nm. We investigate stability of aqueous magnetite NPs dispersions during storage and with increase in temperature (up to 70 °C). We find that polydisperse magnetite NPs can penetrate into cartilage and the size and concentration of impregnated particles depend on the organization of the tissue structure. The results confirm the possibility of application of magnetite NPs in diagnostics and laser treatment of degenerative cartilage deceases.

  5. Physical and chemical durability of cement impregnated epoxy resin

    International Nuclear Information System (INIS)

    Suryantoro

    1997-01-01

    Immobilization of simulation radioactive waste contains Cs and Sr with cement impregnated epoxy resin has been done. Low level liquid waste in 30% weight mixed cement homogeneously and then set in its curing time about 28 days. Waste from was impregnated with epoxy resin (Bisphenol-A-diglycidylether) and use Triethylenteramin as catalyst. the sample of cement impregnated epoxy resin 2.5 cm x 2.5 cm in diameter and length was tested by Paul Weber. The compressive strength was obtained of 4.08 kN.cm - 2. The sochxlet apparatus was run on flow rate of 300 ml/hour at 100 o C and during 24 hours. The leaching rate of Cs was round on 5.5 x 10 - 4 g.cm - 2.d - 1 and Sr was 6.1 x 10 - 4 g.cm - 2.d - 1 (author)

  6. Resin impregnation process for producing a resin-fiber composite

    Science.gov (United States)

    Palmer, Raymond J. (Inventor); Moore, William E. (Inventor)

    1994-01-01

    Process for vacuum impregnation of a dry fiber reinforcement with a curable resin to produce a resin-fiber composite, by drawing a vacuum to permit flow of curable liquid resin into and through a fiber reinforcement to impregnate same and curing the resin-impregnated fiber reinforcement at a sufficient temperature and pressure to effect final curing. Both vacuum and positive pressure, e.g. autoclave pressure, are applied to the dry fiber reinforcement prior to application of heat and prior to any resin flow to compact the dry fiber reinforcement, and produce a resin-fiber composite of reduced weight, thickness and resin content, and improved mechanical properties. Preferably both a vacuum and positive pressure, e.g. autoclave pressure, are also applied during final curing.

  7. Automatic control of air curtains with CHIPS technology; Automatische regeling van luchtgordijnen met CHIPS-technologie

    Energy Technology Data Exchange (ETDEWEB)

    Cremers, B.E. [Biddle, Kloostertille (Netherlands)

    2010-03-15

    In times of drastic automation air curtains cannot lag behind. Yet, how do you control a product whose operation depends not only on own settings but also on the conditions in which it is used. This article describes the latest development in the automation of the air curtain above an open door. The automated air curtain now has the highest separation efficiency, low energy use and optimal comfort under changing circumstances without any need for manual adjustment. CHIPS refers to Corrective Heating and Impulse Prediction System. [Dutch] In een tijd van verregaande automatisering kan een luchtgordijn niet achterblijven. Maar hoe regel je een product waarvan de werking niet alleen afhangt van de eigen instellingen, maar ook van de omstandigheden waarin het wordt gebruikt? Dit artikel beschrijft de nieuwste stap in de automatisering van een luchtgordijn boven een openstaande deur. Hiermee heeft het automatisch geregelde luchtgordijn het hoogste scheidingsrendement, laag energiegebruik en optimaal comfort onder wisselende omstandigheden zonder het luchtgordijn handmatig te hoeven bijstellen. CHIPS staat voor Corrective Heating and Impulse Prediction System.

  8. Parameters Optimization of Curtain Grouting Reinforcement Cycle in Yonglian Tunnel and Its Application

    Directory of Open Access Journals (Sweden)

    Qingsong Zhang

    2015-01-01

    Full Text Available For practical purposes, the curtain grouting method is an effective method to treat geological disasters and can be used to improve the strength and permeability resistance of surrounding rock. Selection of the optimal parameters of grouting reinforcement cycle especially reinforcement cycle thickness is one of the most interesting areas of research in curtain grouting designs. Based on the fluid-structure interaction theory and orthogonal analysis method, the influence of reinforcement cycle thickness, elastic modulus, and permeability on water inflow of tunnel after grouting and stability of surrounding rock was analyzed. As to the water inflow of tunnel after grouting used as performance evaluation index of grouting reinforcement cycle, it can be concluded that the permeability was the most important factor followed by reinforcement cycle thickness and elastic modulus. Furthermore, pore water pressure field, stress field, and plastic zone of surrounding rock were calculated by using COMSOL software under different conditions of reinforcement cycle thickness. It also can be concluded that the optimal thickness of reinforcement cycle and permeability can be adopted as 8 m and 1/100 of the surrounding rock permeability in the curtain grouting reinforcement cycle. The engineering case provides a reference for similar engineering.

  9. The Perforated Curtain: Configuring the Public and the Private in Calcutta’s Cabin Culture

    Directory of Open Access Journals (Sweden)

    Twisha Deb

    2017-04-01

    Full Text Available When I was very young, eating out was not a regular activity for our family. On one of such rare occasion we ended up in a restaurant where the waiter made us sit in a cubicle with a curtain on one side. You pull the curtain and it creates a weird sense of privacy. That idea of intimate space in the middle of a busy city intrigued me. Later I found many restaurants in Kolkata where they have this sort of cabin, a private eating area. Starting from pre-independence when they were there to provide some privacy to the ladies of the family who were not allowed to eat in public, the cabin witnessed many private affairs with time, from political discussions to lovers’ silence. With changing time and the emergence of posh cafes with quirky interiors, the shabby little cabins have lost their charm, but the almost empty cabins, some even without the curtains stand there to tell a story of a time gone by.

  10. Evaluation of compatibility of flowing liquid lithium curtain for blanket with core plasma in fusion reactors

    International Nuclear Information System (INIS)

    Deng Baiquan; Huang Jinhua; Peng Lilin; Yan Jiancheng

    2003-01-01

    A global model analysis of the compatibility of flowing liquid lithium curtain for blanket with core plasma has been performed. The relationships between the surface temperature of lithium curtain and mean effective plasma charges, fuel dilution and produced fusion power have been obtained. Results show that under normal circumstances, the evaporation of liquid lithium does not affect Z eff seriously, but affects fuel dilution and fusion power sensitively. The authors have investigated the relationships between the flow velocity of liquid lithium and its surface temperature rise based on the conditions of the option II of the fusion experimental breeder (FEB-E) design with reversed shear configuration and fairly high power density. The authors concluded that the effects of evaporation from liquid lithium curtain for FEB-E on plasma are negligible even if the flow velocity of liquid lithium is as low as 0.5 m·s -1 . Finally, the sputtering yield of liquid lithium saturated by hydrogen isotopes is briefly discussed

  11. Supercritical CO2 impregnation of polyethylene components for medical purposes

    Directory of Open Access Journals (Sweden)

    Gamse Thomas

    2007-01-01

    Full Text Available Modem hip and knee endoprosthesis are produced in titanium and to reduce the friction at the contact area polymer parts, mainly ultra-high molecular weight polyethylene (UHMW-PE, are installed. The polyethylene is impregnated with a-tocopherol (vitamin E before processing for remarkable decrease of oxidative degradation. Cross linked UHMW-PE offers much higher stability, but a-tocopherol cannot be added before processing, because a-tocopherol hinders the cross linking process accompanied by a heavy degradation of the vitamin. The impregnation of UHMW-PE with a-tocopherol has to be performed after the cross linking process and an accurate concentration has to be achieved over the cross section of the whole material. In the first tests UHMW-PE-cubes were stored in pure a-tocopherol under inert atmosphere at temperatures from 100 to 150 °C resulting in a high mass fraction of a-tocopherol in the edge zones and no constant concentration over the cross section. For better distribution and for regulating the mass fraction of a-tocopherol in the cross linked UHMW-PE material supercritical CO2 impregnation tests were investigated. Again UHMW-PE-cubes were impregnated in an autoclave with a-tocopherol dissolved in supercritical CO2 at different pressures and temperatures with variable impregnation times and vitamin E concentrations. Based on the excellent results of supercritical CO2 impregnation standard hip and knee cups were stabilized nearly homogeneously with varying mass fraction of a-tocopherol.

  12. Dengue vector management using insecticide treated materials and targeted interventions on productive breeding-sites in Guatemala

    Directory of Open Access Journals (Sweden)

    Rizzo Nidia

    2012-10-01

    households, tropical rains occurred in the area and lead to an increase of the vector population, more pronounced (but statistically not significant in the control arm than in the intervention arm. In the second intervention (17 months later and six weeks after implementing the second intervention the combined approach of ITMs and a combination of appropriate interventions against productive containers (Temephos in >200 L water drums, elimination of small discarded tins and bottles lead to significant differences on reductions of the total number of pupae (P = 0.04 and the House index (P = 0.01 between intervention and control clusters, and to borderline differences on reductions of the Pupae per Person and Breteau indices (P = 0.05. The insecticide residual activity on treated curtains was high until month 18 but the chemical concentration showed a high variability. The cost per house protected with treated curtains and drum covers and targeting productive breeding-sites of the dengue vector was $ 5.31 USD. The acceptance of the measure was generally high, particularly in families who had experienced dengue. Conclusion Even under difficult environmental conditions (open houses, tropical rainfall, challenging container types mainly in the peridomestic environment the combination of insecticide treated curtains and to a less extent drum covers and interventions targeting the productive container types can reduce the dengue vector population significantly.

  13. Dengue vector management using insecticide treated materials and targeted interventions on productive breeding-sites in Guatemala.

    Science.gov (United States)

    Rizzo, Nidia; Gramajo, Rodrigo; Escobar, Maria Cabrera; Arana, Byron; Kroeger, Axel; Manrique-Saide, Pablo; Petzold, Max

    2012-10-30

    lead to an increase of the vector population, more pronounced (but statistically not significant) in the control arm than in the intervention arm. In the second intervention (17 months later and six weeks after implementing the second intervention) the combined approach of ITMs and a combination of appropriate interventions against productive containers (Temephos in >200 L water drums, elimination of small discarded tins and bottles) lead to significant differences on reductions of the total number of pupae (P = 0.04) and the House index (P = 0.01) between intervention and control clusters, and to borderline differences on reductions of the Pupae per Person and Breteau indices (P = 0.05). The insecticide residual activity on treated curtains was high until month 18 but the chemical concentration showed a high variability. The cost per house protected with treated curtains and drum covers and targeting productive breeding-sites of the dengue vector was $ 5.31 USD. The acceptance of the measure was generally high, particularly in families who had experienced dengue. Even under difficult environmental conditions (open houses, tropical rainfall, challenging container types mainly in the peridomestic environment) the combination of insecticide treated curtains and to a less extent drum covers and interventions targeting the productive container types can reduce the dengue vector population significantly.

  14. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  15. CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram

    Science.gov (United States)

    Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.

  16. Chiral separation of amino-alcohols using extractant impregnated resins

    NARCIS (Netherlands)

    Babic, K.; Driessen, G.H.M.; van der Ham, Aloysius G.J.; de Haan, A.B.

    2007-01-01

    The performance of extractant impregnated resin (EIR) technology for chiral separation of amino-alcohols has been investigated. Phenylglycinol was selected as an archetype model enantiomer and azophenolic crown ether was used as a versatile enantioselective extractant. 1-Phenyloctane was selected as

  17. Properties of carbonisation products obtained from impregnated coal

    Czech Academy of Sciences Publication Activity Database

    Plevová, Eva; Šugárková, Věra; Kaloč, M.; Vaculíková, Lenka

    -, - (2008), s. 52-61. ISBN 978-80-248-1939-6 Grant - others:GA CŘ(CZ) GA105/00/1698 Institutional research plan: CEZ:AV0Z30860518 Keywords : chlorides * impregnation * coal Subject RIV: CC - Organic Chemistry

  18. Arsenic removal using silver-impregnated Prosopis spicigera L ...

    African Journals Online (AJOL)

    Arsenic removal using silver-impregnated Prosopis spicigera L. wood (PSLW) activated carbon: batch and column studies. ... Arsenic uptake has no regular trend with increasing pH; contains two adsorption maxima, the first adsorption maximum at pH 4.0 and a second adsorption maximum at pH 10.0. The extent of As (III) ...

  19. Impregnation of LSM Based Cathodes for Solid Oxide Fuel Cells

    DEFF Research Database (Denmark)

    Højberg, Jonathan; Søgaard, Martin

    2011-01-01

    Composites cathodes consisting of strontium doped lanthanum manganite (LSM) and yttria stabilized zirconia have been impregnated with the nitrates corresponding to the nominal compositions: La0.75Sr0.25Mn1.05O3 +/-delta (LSM25), Ce0.8Sm0.2O2 (SDC) and a combination of both (dual). The latter...

  20. Leaching of Silver from Silver-Impregnated Food Storage Containers

    Science.gov (United States)

    Hauri, James F.; Niece, Brian K.

    2011-01-01

    The use of silver in commercial products has proliferated in recent years owing to its antibacterial properties. Food containers impregnated with micro-sized silver promise long food life, but there is some concern because silver can leach out of the plastic and into the stored food. This laboratory experiment gives students the opportunity to…

  1. Fabrication of HTR fuel elements by a gaseous impregnation process

    International Nuclear Information System (INIS)

    Blin, J.C.; Berthier, J.; Devillard, J.

    1976-01-01

    The results obtained with the gaseous impregnation process are described. The successive steps of the fabrication in their present state of realization are given together with the results obtained after irradiation. A comparison between this process and a classical method is presented

  2. Textile impregnation with thermoplastic resin - models and application

    NARCIS (Netherlands)

    Loendersloot, Richard; Grouve, Wouter Johannes Bernardus; Lamers, E.A.D.; Wijskamp, Sebastiaan; Kelly, P.A.; Bickerton, S.; Lescher, P.; Govignon, Q.

    2012-01-01

    One of the key issues of the development of cost-effective thermoplastic composites for the aerospace industry is the process quality control. A complete, void free impregnation of the textile reinforcement by the thermoplastic resin is an important measure of the quality of composites. The

  3. Determination of atmospheric nitrogen dioxide by sampling with impregnated filters

    International Nuclear Information System (INIS)

    Galiano, J.A.; Palomares, F.

    1978-01-01

    The performance of filters impregnated with triethanolamine for the collection and subsequent determination of atmospheric nitrogen dioxide is studied taking into account the influence of several parameters: storage of filters, reagents, elapsed time, sampling efficiency, etc. The results obtained for sampling times of 24 hours are satisfactory. (author) [es

  4. Forecasting the condition of petroleum impregnated load bearing ...

    African Journals Online (AJOL)

    Petroleum products (PP) used in industrial processes systematically fall on the load-bearing CRC structures and gradually impregnate therein. Currently, available guidelines for the assessment of technical condition and reliability of load-bearing CRC structures do not fully take into account the effect of viscosity of PP that ...

  5. X-ray initiated polymerization of wood impregnants

    Energy Technology Data Exchange (ETDEWEB)

    Cleland, Marshall R.; Galloway, Richard A. [IBA Industrial, Inc., Edgewood, NY (United States); Berejka, Anthony J. [Ionicorp, Huntington, NY 11743 (United States)], E-mail: berejka@msn.com; Montoney, Daniel [Strathmore Products, Syracuse, NY (United States); Driscoll, Mark; Smith, Leonard; Scott Larsen, L. [State University of New York, SUNY-ESF, Syracuse, NY (United States)

    2009-07-15

    X-rays, derived from a high energy, high-current electron beam (EB), initiated in-situ polymerization of a unique class of monomers that were found to penetrate the cell walls of wood. X-rays initiated an auto-catalytic acrylic polymerization and penetrated through thick pieces of wood. The final cured product having the polymerizate, a polymer, both in the wood cell lumens and in the cell walls is called wood impregnated with a wood-polymer penetrant (WPP). The controlled lower dose rate of X-rays overcame disproportionation encountered when using higher dose-rate electron beam initiation. With X-rays, the in-situ polymerization took place in one exposure of modest dose. With EB, multiple passes were needed to avoid excessive heat build-up and monomer volatilization. Having entered the cell walls of the wood and then being polymerized within the cell walls, these radiation-cured unique monomers imparted outstanding dimensional stability upon exposure of the impregnated wood to humidity cycling. The preferred monomer system was also chemically modified prior to impregnation with agents that would remain in the wood and prevent the growth of fungi and other microbials. This technique differs from historic uses of monomers that merely filled the lumens of the wood (historic wood-polymer composites), which are only suitable for indoor use. The WPP impregnated wood that was either X-ray cured or EB cured demonstrated enhanced structural properties, dimensional stability, and decay resistance.

  6. X-ray initiated polymerization of wood impregnants

    International Nuclear Information System (INIS)

    Cleland, Marshall R.; Galloway, Richard A.; Berejka, Anthony J.; Montoney, Daniel; Driscoll, Mark; Smith, Leonard; Scott Larsen, L.

    2009-01-01

    X-rays, derived from a high energy, high-current electron beam (EB), initiated in-situ polymerization of a unique class of monomers that were found to penetrate the cell walls of wood. X-rays initiated an auto-catalytic acrylic polymerization and penetrated through thick pieces of wood. The final cured product having the polymerizate, a polymer, both in the wood cell lumens and in the cell walls is called wood impregnated with a wood-polymer penetrant (WPP). The controlled lower dose rate of X-rays overcame disproportionation encountered when using higher dose-rate electron beam initiation. With X-rays, the in-situ polymerization took place in one exposure of modest dose. With EB, multiple passes were needed to avoid excessive heat build-up and monomer volatilization. Having entered the cell walls of the wood and then being polymerized within the cell walls, these radiation-cured unique monomers imparted outstanding dimensional stability upon exposure of the impregnated wood to humidity cycling. The preferred monomer system was also chemically modified prior to impregnation with agents that would remain in the wood and prevent the growth of fungi and other microbials. This technique differs from historic uses of monomers that merely filled the lumens of the wood (historic wood-polymer composites), which are only suitable for indoor use. The WPP impregnated wood that was either X-ray cured or EB cured demonstrated enhanced structural properties, dimensional stability, and decay resistance.

  7. Monomer-Polymer Chemistry and the Impregnation Process

    Energy Technology Data Exchange (ETDEWEB)

    Stannett, V. [North Carolina State University, Raleigh, NC (United States)

    1968-10-15

    A brief outline of early polymerization techniques is followed by a description of polymerization process chemistry, impregnation and polymerization methods and criteria for the choice of monomer. General considerations, including the effects of polymerization inhibitors, swelling agents, radiation dose rate and sample thickness, are enumerated. (author)

  8. 2 Assessmen of the Efficiency of Insecticide

    African Journals Online (AJOL)

    Administrator

    malaria vectors and nuisance in West Africa – a-part. 2. Field evaluation. Malar J. 9: 341. Mosqueira B., Duchon S., Chandre F., Hougard, J. M., Carnevale P. and Mas-Coma S. (2010). Efficacy of an insecticide paint against insecticide- susceptible and resistant mosquitoes – b- Part 1: Laboratory evaluation. Malar J. 9: 340.

  9. Trifluoromethylphenyl amides as novel insecticides and fungicides

    Science.gov (United States)

    Because of increased resistance to insecticides in arthropods, it is necessary to identify new chemicals that may have novel modes of action. Following an extensive literature search for compounds with insecticidal and mosquito repellent activity, we have designed and synthesized a set of 20 trifluo...

  10. Insecticide Resistance Reducing Effectiveness of Malaria Control

    Centers for Disease Control (CDC) Podcasts

    2007-01-24

    Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.  Created: 1/24/2007 by Emerging Infectious Diseases.   Date Released: 3/13/2007.

  11. The edible cocktail: the effect of sugar and alcohol impregnation on the crunchiness of fruit

    NARCIS (Netherlands)

    Scholten, E.; Peters, M.M.J.P.

    2012-01-01

    Vacuum impregnation is seen as a valuable technique for flavor pairing in the catering industry. One of the applications of this technique is the creation of edible cocktails by impregnating of fruits with liquors, leading to an interplay of different flavors. However, the effect of the impregnation

  12. Radiation hardenable impregnating agents for the consolidating conservation of wooden objects

    International Nuclear Information System (INIS)

    Schaudy, R.

    1985-01-01

    Radiation hardenable impregnating agents offer some advantages over the conventional agents. At the author's institution objects up to 110 cm length can be impregnated for conservation. More than 200 monomers and resins have been investigated. The procedure of impregnation is outlined and some kinds of wooden objects conserved in this way listed. (G.W.)

  13. Curtain color and lighting program in broiler production: II. carcass and parts yield and abdominal fat deposition

    Directory of Open Access Journals (Sweden)

    Valéria Maria Nascimento Abreu

    2011-09-01

    Full Text Available The objective of the present study was to evaluate carcass and parts' yield, abdominal fat deposition and breast and foot pad blisters of broilers reared under two lighting programs (nearly continuous or intermittent in broilers houses with yellow and blue curtains. The experiment was conducted between June, 2004 and May, 2005. Six flocks were sequentially housed in four 12 × 10 m broiler houses divided into 4 pens with 200 birds each. The litter was reused six times or until flock 6. A completely randomized design in a 6 × 2 × 2 factorial arrangement (flocks, lighting programs, curtains with four replicates per treatment was applied. A total of 288 birds were evaluated for carcass yield. Curtain color did not affect carcass or parts' yield. The effect of lighting program and curtain color on carcass yield may depend on other factors related to flock. Intermittent lighting program promoted the highest drumstick and thigh yields. Lighting programs and curtain colors did not affect abdominal fat deposition or the presence of breast and foot pad blisters.

  14. of Several Organophosphorus Insecticide Metabolites

    Directory of Open Access Journals (Sweden)

    Russell L. Carr

    2015-01-01

    Full Text Available Paraoxonase (PON1 is a calcium dependent enzyme that is capable of hydrolyzing organophosphate anticholinesterases. PON1 activity is present in most mammals and previous research established that PON1 activity differs depending on the species. These studies mainly used the organophosphate substrate paraoxon, the active metabolite of the insecticide parathion. Using serum PON1 from different mammalian species, we compared the hydrolysis of paraoxon with the hydrolysis of the active metabolites (oxons of two additional organophosphorus insecticides, methyl parathion and chlorpyrifos. Paraoxon hydrolysis was greater than that of methyl paraoxon, but the level of activity between species displayed a similar pattern. Regardless of the species tested, the hydrolysis of chlorpyrifos-oxon was significantly greater than that of paraoxon or methyl paraoxon. These data indicate that chlorpyrifos-oxon is a better substrate for PON1 regardless of the species. The pattern of species differences in PON1 activity varied with the change in substrate to chlorpyrifos-oxon from paraoxon or methyl paraoxon. For example, the sex difference observed here and reported elsewhere in the literature for rat PON1 hydrolysis of paraoxon was not present when chlorpyrifos-oxon was the substrate.

  15. Insecticide resistance and intracellular proteases.

    Science.gov (United States)

    Wilkins, Richard M

    2017-12-01

    Pesticide resistance is an example of evolution in action with mechanisms of resistance arising from mutations or increased expression of intrinsic genes. Intracellular proteases have a key role in maintaining healthy cells and in responding to stressors such as pesticides. Insecticide-resistant insects have constitutively elevated intracellular protease activity compared to corresponding susceptible strains. This increase was shown for some cases originally through biochemical enzyme studies and subsequently putatively by transcriptomics and proteomics methods. Upregulation and expression of proteases have been characterised in resistant strains of some insect species, including mosquitoes. This increase in proteolysis results in more degradation products (amino acids) of intracellular proteins. These may be utilised in the resistant strain to better protect the cell from stress. There are changes in insect intracellular proteases shortly after insecticide exposure, suggesting a role in stress response. The use of protease and proteasome inhibitors or peptide mimetics as synergists with improved application techniques and through protease gene knockdown using RNA interference (possibly expressed in crop plants) may be potential pest management strategies, in situations where elevated intracellular proteases are relevant. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  16. 40 CFR 60.3069 - Am I required to apply for and obtain a title V operating permit for my air curtain incinerator...

    Science.gov (United States)

    2010-07-01

    ... title V operating permit for my air curtain incinerator that burns only wood waste, clean lumber, and... and Compliance Times for Other Solid Waste Incineration Units That Commenced Construction On or Before December 9, 2004 Model Rule-Air Curtain Incinerators That Burn Only Wood Waste, Clean Lumber, and Yard...

  17. 40 CFR 60.3063 - When must I comply if my air curtain incinerator burns only wood waste, clean lumber, and yard...

    Science.gov (United States)

    2010-07-01

    ... incinerator burns only wood waste, clean lumber, and yard waste? 60.3063 Section 60.3063 Protection of... Units That Commenced Construction On or Before December 9, 2004 Model Rule-Air Curtain Incinerators That Burn Only Wood Waste, Clean Lumber, and Yard Waste § 60.3063 When must I comply if my air curtain...

  18. 40 CFR 60.3064 - What must I do if I close my air curtain incinerator that burns only wood waste, clean lumber...

    Science.gov (United States)

    2010-07-01

    ... curtain incinerator that burns only wood waste, clean lumber, and yard waste and then restart it? 60.3064... Other Solid Waste Incineration Units That Commenced Construction On or Before December 9, 2004 Model Rule-Air Curtain Incinerators That Burn Only Wood Waste, Clean Lumber, and Yard Waste § 60.3064 What...

  19. 40 CFR 60.3067 - How must I monitor opacity for air curtain incinerators that burn only wood waste, clean lumber...

    Science.gov (United States)

    2010-07-01

    ... curtain incinerators that burn only wood waste, clean lumber, and yard waste? 60.3067 Section 60.3067... Incineration Units That Commenced Construction On or Before December 9, 2004 Model Rule-Air Curtain Incinerators That Burn Only Wood Waste, Clean Lumber, and Yard Waste § 60.3067 How must I monitor opacity for...

  20. 40 CFR 60.3065 - What must I do if I plan to permanently close my air curtain incinerator that burns only wood...

    Science.gov (United States)

    2010-07-01

    ... close my air curtain incinerator that burns only wood waste, clean lumber, and yard waste and not... Compliance Times for Other Solid Waste Incineration Units That Commenced Construction On or Before December 9, 2004 Model Rule-Air Curtain Incinerators That Burn Only Wood Waste, Clean Lumber, and Yard Waste § 60...

  1. 40 CFR 62.14820 - How must I monitor opacity for air curtain incinerators that burn 100 percent wood wastes, clean...

    Science.gov (United States)

    2010-07-01

    ... curtain incinerators that burn 100 percent wood wastes, clean lumber, and/or yard waste? 62.14820 Section... Requirements for Commercial and Industrial Solid Waste Incineration Units That Commenced Construction On or Before November 30, 1999 Air Curtain Incinerators That Burn 100 Percent Wood Wastes, Clean Lumber And/or...

  2. Insecticide control of vector-borne diseases: when is insecticide resistance a problem?

    Directory of Open Access Journals (Sweden)

    Ana Rivero

    Full Text Available Many of the most dangerous human diseases are transmitted by insect vectors. After decades of repeated insecticide use, all of these vector species have demonstrated the capacity to evolve resistance to insecticides. Insecticide resistance is generally considered to undermine control of vector-transmitted diseases because it increases the number of vectors that survive the insecticide treatment. Disease control failure, however, need not follow from vector control failure. Here, we review evidence that insecticide resistance may have an impact on the quality of vectors and, specifically, on three key determinants of parasite transmission: vector longevity, competence, and behaviour. We argue that, in some instances, insecticide resistance is likely to result in a decrease in vector longevity, a decrease in infectiousness, or in a change in behaviour, all of which will reduce the vectorial capacity of the insect. If this effect is sufficiently large, the impact of insecticide resistance on disease management may not be as detrimental as previously thought. In other instances, however, insecticide resistance may have the opposite effect, increasing the insect's vectorial capacity, which may lead to a dramatic increase in the transmission of the disease and even to a higher prevalence than in the absence of insecticides. Either way-and there may be no simple generality-the consequence of the evolution of insecticide resistance for disease ecology deserves additional attention.

  3. Ambience control by air-curtains; Controle d'ambiance par rideaux d'air

    Energy Technology Data Exchange (ETDEWEB)

    Blanchet, F.X.; Gouriou, Y.; Gupta, S.; Pavageau, M.; Solliec, C. [Ecole des Mines de Nantes, UMR 6144 CNRS-EMN-Univ. de Nantes, Dept. Systemes Energetiques et Environnement, 44 (France); Cassin, C.; Maubert, P.; Rey, C. [Aix-Marseille-3 Univ. Paul Cezanne, IUT de Saint Jerome, Dept. GTE, 13 - Marseille (France)

    2005-08-01

    Air curtains are plane air jets blown across openings so as to isolate from each other two adjacent volumes. Such apparatus are commonly used in applications where it is sought to minimise heat or mass transfers between two areas while it is necessary to keep free the way for people or material from one area to the next one. Experimental facilities were designed to investigate various air-curtain arrangements with the aim to work out efficient solutions for energy saves or smoke confining in case of fire in a road tunnel. In the first stage, the emphasis was put on flow dynamics. The different configurations considered in this work include systems made of one or two curtains of single or double jets. They were specifically designed to perform measurements using Particle Image Velocimetry (PIV). (authors)

  4. The Effects of Curtain Airbag on Occupant Kinematics and Injury Index in Rollover Crash

    Directory of Open Access Journals (Sweden)

    Hongyun Li

    2018-01-01

    Full Text Available Background. Occupant injuries in rollover crashes are associated with vehicle structural performance, as well as the restraint system design. For a better understanding of the occupant kinematics and injury index in certain rollover crash, it is essential to carry out dynamic vehicle rollover simulation with dummy included. Objective. This study focused on effects of curtain airbag (CAB parameters on occupant kinematics and injury indexes in a rollover crash. Besides, optimized parameters of the CAB were proposed for the purpose of decreasing the occupant injuries in such rollover scenario. Method and Material. The vehicle motion from the physical test was introduced as the input for the numerical simulation, and the 50% Hybrid III dummy model from the MADYMO database was imported into a simulation model. The restraint system, including a validated CAB module, was introduced for occupant kinematics simulation and injury evaluation. TTF setting, maximum inflator pressure, and protection area of the CAB were analysed. Results. After introducing the curtain airbag, the maximum head acceleration was reduced from 91.60 g to 49.52 g, and the neck Mx and neck Fz were reduced significantly. Among these CAB parameters, the TTF setting had the largest effect on the head acceleration which could reduce 8.6 g furthermore after optimization. The neck Fz was decreased from 3766.48 N to 2571.77 N after optimization of CAB protection area. Conclusions. Avoiding hard contact is critical for the occupant protection in the rollover crashes. The simulation results indicated that occupant kinematics and certain injury indexes were improved with the help of CAB in such rollover scenario. Appropriate TTF setting and inflator selection could benefit occupant kinematics and injury indexes. Besides, it was advised to optimize the curtain airbag thickness around the head contact area to improve head and neck injury indexes.

  5. Radiative and conductive heat transfer in a nongrey semitransparent medium. Application to fire protection curtains

    Energy Technology Data Exchange (ETDEWEB)

    Berour, Nacer; Lacroix, David E-mail: david.lacroix@lemta.uhp-nancy.fr; Boulet, Pascal; Jeandel, Gerard

    2004-06-01

    This paper deals with heat transfer in nongrey media which scatter, absorb and emit radiation. Considering a two dimensional geometry, radiative and conductive phenomena through the medium have been taken into account. The radiative part of the problem was solved using the discrete ordinate method with classical S{sub n} quadratures. The absorption and scattering coefficients involved in the radiative transfer equation (RTE) were obtained from the Mie theory. Conduction inside the medium was linked to the RTE through the energy conservation. Validation of the model has been achieved with several simulation of water spray curtains used as fire protection walls.

  6. Simultaneous density-field visualization and PIV of a shock-accelerated gas curtain

    Energy Technology Data Exchange (ETDEWEB)

    Prestridge, K.; Rightley, P.M.; Vorobieff, P. [Los Alamos Nat. Lab., NM (United States). Dynamic Exp. Div.; Benjamin, R.F.; Kurnit, N.A.

    2000-10-01

    We describe a highly-detailed experimental characterization of the Richtmyer-Meshkov instability (the impulsively driven Rayleigh-Taylor instability) (Meshkov 1969; Richtmyer 1960). In our experiment, a vertical curtain of heavy gas (SF{sub 6}) flows into the test section of an air-filled, horizontal shock tube. The instability evolves after a Mach 1.2 shock passes through the curtain. For visualization, we pre-mix the SF{sub 6} with a small ({proportional_to}10{sup -5}) volume fraction of sub-micron-sized glycol/water droplets. A horizontal section of the flow is illuminated by a light sheet produced by a combination of a customized, burst-mode Nd:YAG laser and a commercial pulsed laser. Three CCD cameras are employed in visualization. The ''dynamic imaging camera'' images the entire test section, but does not detect the individual droplets. It produces a sequence of instantaneous images of local droplet concentration, which in the post-shock flow is proportional to density. The gas curtain is convected out of the test section about 1 ms after the shock passes through the curtain. A second camera images the initial conditions with high resolution, since the initial conditions vary from test to test. The third camera, ''PIV camera,'' has a spatial resolution sufficient to detect the individual droplets in the light sheet. Images from this camera are interrogated using particle image velocimetry (PIV) to recover instantaneous snapshots of the velocity field in a small (19 x 14 mm) field of view. The fidelity of the flow-seeding technique for density-field acquisition and the reliability of the PIV technique are both quantified in this paper. In combination with wide-field density data, PIV measurements give us additional physical insight into the evolution of the Richtmyer-Meshkov instability in a problem which serves as an excellent test case for general transition-to-turbulence studies. (orig.)

  7. Evaluation of optimal silver amount for the removal of methyl iodide on silver-impregnated adsorbents

    International Nuclear Information System (INIS)

    Park, G.I.; Cho, I.H.; Kim, J.H.; Oh, W.Z.

    2001-01-01

    The adsorption characteristics of methyl iodide generated from the simulated off-gas stream on various adsorbents such as silver-impregnated zeolite (AgX), zeocarbon and activated carbon were investigated. An extensive evaluation was made on the optimal silver impregnation amount for the removal of methyl iodide at temperatures up to 300 deg. C. The degree of adsorption efficiency of methyl iodide on silver-impregnated adsorbent is strongly dependent on impregnation amount and process temperature. A quantitative comparison of adsorption efficiencies on three adsorbents in a fixed bed was investigated. The influence of temperature, methyl iodide concentration and silver impregnation amount on the adsorption efficiency is closely related to the pore characteristics of adsorbents. It shows that the effective impregnation ratio was about 10wt%, based on the degree of silver utilization for the removal of methyl iodide. The practical applicability of silver-impregnated zeolite for the removal of radioiodine generated from the DUPIC process was consequently proposed. (author)

  8. Weevil x Insecticide: Does 'Personality' Matter?

    Science.gov (United States)

    Morales, Juliana A; Cardoso, Danúbia G; Della Lucia, Terezinha Maria C; Guedes, Raul Narciso C

    2013-01-01

    An insect's behavior is the expression of its integrated physiology in response to external and internal stimuli, turning insect behavior into a potential determinant of insecticide exposure. Behavioral traits may therefore influence insecticide efficacy against insects, compromising the validity of standard bioassays of insecticide activity, which are fundamentally based on lethality alone. By extension, insect 'personality' (i.e., an individual's integrated set of behavioral tendencies that is inferred from multiple empirical measures) may also be an important determinant of insecticide exposure and activity. This has yet to be considered because the behavioral studies involving insects and insecticides focus on populations rather than on individuals. Even among studies of animal 'personality', the relative contributions of individual and population variation are usually neglected. Here, we assessed behavioral traits (within the categories: activity, boldness/shyness, and exploration/avoidance) of individuals from 15 populations of the maize weevil (Sitophilus zeamais), an important stored-grain pest with serious problems of insecticide resistance, and correlated the behavioral responses with the activity of the insecticide deltamethrin. This analysis was performed at both the population and individual levels. There was significant variation in weevil 'personality' among individuals and populations, but variation among individuals within populations accounted for most of the observed variation (92.57%). This result emphasizes the importance of individual variation in behavioral and 'personality' studies. When the behavioral traits assessed were correlated with median lethal time (LT50) at the population level and with the survival time under insecticide exposure, activity traits, particularly the distance walked, significantly increased survival time. Therefore, behavioral traits are important components of insecticide efficacy, and individual variation should be

  9. Physical modeling of steel flow in a tun dish equipped with a turbulence inhibitor and a gas curtain

    International Nuclear Information System (INIS)

    Perez-Labra, M.; Diaz-Cruz, M.; Palafox-Ramos, J.; Avila-Davila, E. O.; Patino-Cardona, F.

    2005-01-01

    A 2/5 scale model with a transparent plastic sheet was built based on Froude criterion in which eight cases were studied by PIV technique, maintaining a constant gas flow rate of 596 ml/min and only varying the gas curtain position. The results permitted to get Residence Time Distribution (RTD) curves, and from the data processing it was found that combining Turbulence Inhibitor (TI) with the adequate gas curtain position it is enhanced the plug volume. The case VII presented the best results increasing the plug volume in 131.85% in comparison with the case IV which was taken as the reference one. (Author) 10 refs

  10. Fungal degradation of organophosphorous insecticides

    Energy Technology Data Exchange (ETDEWEB)

    Bumpus, J.A. [Notre Dame Univ., IN (United States); Kakar, S.N.; Coleman, R.D. [Argonne National Lab., IL (United States)

    1992-07-01

    Organophosphorous insecticides are used extensively to treat a variety of pests and insects. Although as a group they are easily degraded by bacteria in the environment, a number of them have half-lives of several months. Little is known about their biodegradation by fungi. We have shown that Phanerochaete chrysosporium can substantially degrade chlorpyrifos, fonofos, and terbufos (27.5%, 12.2%, and 26.6%, respectively) during 18-day incubation in nitrogen-limited stationary cultures. The results demonstrate that the clorinated pyridinyl ring of chlorpyrifos and the phenyl ring of fonofos undergo ring cleavage during biodegradation by the fungus. The usefulness of the fungus system for bioremediation is discussed. 16 refs., 7 figs., 2 tabs.

  11. Fungal degradation of organophosphorous insecticides

    Energy Technology Data Exchange (ETDEWEB)

    Bumpus, J.A. (Notre Dame Univ., IN (United States)); Kakar, S.N.; Coleman, R.D. (Argonne National Lab., IL (United States))

    1992-01-01

    Organophosphorous insecticides are used extensively to treat a variety of pests and insects. Although as a group they are easily degraded by bacteria in the environment, a number of them have half-lives of several months. Little is known about their biodegradation by fungi. We have shown that Phanerochaete chrysosporium can substantially degrade chlorpyrifos, fonofos, and terbufos (27.5%, 12.2%, and 26.6%, respectively) during 18-day incubation in nitrogen-limited stationary cultures. The results demonstrate that the clorinated pyridinyl ring of chlorpyrifos and the phenyl ring of fonofos undergo ring cleavage during biodegradation by the fungus. The usefulness of the fungus system for bioremediation is discussed. 16 refs., 7 figs., 2 tabs.

  12. Barium depletion study on impregnated cathodes and lifetime prediction

    International Nuclear Information System (INIS)

    Roquais, J.M.; Poret, F.; Doze, R. le; Ricaud, J.L.; Monterrin, A.; Steinbrunn, A.

    2003-01-01

    In the thermionic cathodes used in cathode ray-tubes (CRTs), barium is the key element for the electronic emission. In the case of the dispenser cathodes made of a porous tungsten pellet impregnated with Ba, Ca aluminates, the evaporation of Ba determines the cathode lifetime with respect to emission performance in the CRT. The Ba evaporation results in progressive depletion of the impregnating material inside the pellet. In the present work, the Ba depletion with time has been extensively characterized over a large range of cathode temperature. Calculations using the depletion data allowed modeling of the depletion as a function of key parameters. The link between measured depletion and emission in tubes has been established, from which an end-of-life criterion was deduced. Taking modeling into account, predicting accelerated life-tests were performed using high-density maximum emission current (MIK)

  13. Heavy metal ion adsorption onto polypyrrole-impregnated porous carbon.

    Science.gov (United States)

    Choi, Moonjung; Jang, Jyongsik

    2008-09-01

    Polypyrrole-impregnated porous carbon was readily synthesized using vapor infiltration polymerization of pyrrole monomers. The results show that the functionalized polymer layer was successfully coated onto the pore surface of carbon without collapse of mesoporous structure. The modified porous carbon exhibited an improved complexation affinity for heavy metal ions such as mercury, lead, and silver ions due to the amine group of polypyrrole. The introduced polypyrrole layer could provide the surface modification to be applied for heavy metal ion adsorbents. Especially, polymer-impregnated porous carbon has an enhanced heavy metal ion uptake, which is 20 times higher than that of adsorbents with amine functional groups. Furthermore, the relationship between the coated polymer amount and surface area was also investigated in regard to adsorption capacity.

  14. Performance of Conformable Phenolic Impregnated Carbon Ablator in Aerothermal Environments

    Science.gov (United States)

    Thornton, Jeremy; Fan, Wendy; Stackpoole, Mairead; Kao, David; Skokova, Kristina; Chavez-Garcia, Jose

    2012-01-01

    Conformable Phenolic Impregnated Carbon Ablator, a cousin of Phenolic Impregnated Carbon Ablator (PICA), was developed at NASA Ames Research Center as a lightweight thermal protection system under the Fundamental Aeronautics Program. PICA is made using a brittle carbon substrate, which has a very low strain to failure. Conformable PICA is made using a flexible carbon substrate, a felt in this case. The flexible felt significantly increases the strain to failure of the ablator. PICA is limited by its thermal mechanical properties. Future NASA missions will require heatshields that are more fracture resistant than PICA and, as a result, NASA Ames is working to improve PICA's performance by developing conformable PICA to meet these needs. Research efforts include tailoring the chemistry of conformable PICA with varying amounts of additives to enhance mechanical properties and testing them in aerothermal environments. This poster shows the performance of conformable PICA variants in arc jets tests. Some mechanical and thermal properties will also be presented.

  15. Rhodamine 6G impregnated porous silica: A photoluminescence study

    Energy Technology Data Exchange (ETDEWEB)

    Anedda, A. [Dipartimento di Fisica, Universita degli Studi di Cagliari and INMF UdR Cagliari, SP no8, Km 0700, 09042, Monserrato (Canada) (Italy); Carbonaro, C.M. [Dipartimento di Fisica, Universita degli Studi di Cagliari and INMF UdR Cagliari, SP no8, Km 0700, 09042, Monserrato (Canada) (Italy)]. E-mail: cm.carbonaro@dsf.unica.it; Clemente, F. [Dipartimento di Fisica, Universita degli Studi di Cagliari and INMF UdR Cagliari, SP no8, Km 0700, 09042, Monserrato (Ca) (Italy); Corpino, R. [Dipartimento di Fisica, Universita degli Studi di Cagliari and INMF UdR Cagliari, SP no8, Km 0700, 09042, Monserrato (Ca) (Italy); Ricci, P.C. [Dipartimento di Fisica, Universita degli Studi di Cagliari and INMF UdR Cagliari, SP no8, Km 0700, 09042, Monserrato (Ca) (Italy); Rossini, S. [Dipartimento di Fisica, Universita degli Studi di Cagliari and INMF UdR Cagliari, SP no8, Km 0700, 09042, Monserrato (Ca) (Italy)

    2005-12-15

    The optical properties of rhodamine 6G dye confined in porous silica are reported. Photoluminescence properties of embedded chromophores in mesoporous hosts can be affected by the surrounding matrices: shifts in emission spectra and variations of photoluminescence quantum yield are found as compared to dye solutions. Host-guest interactions are studied here by varying both SiO{sub 2} xerogels porosity and the dye concentration. Comparing samples obtained by impregnating matrices with 5.4 and 18.2 nm pores with solutions having concentrations in the rhodamine 6G high laser gain, matrices with 5.4 nm pores impregnated with a dye concentration of 5 x 10{sup -4} M are found to be the most stable and efficient in the examined range.

  16. Silver impregnation in situ: an aid to radiographic interpretation

    International Nuclear Information System (INIS)

    Boyd, J.; Rantanen, N.W.

    1984-01-01

    In evaluating radiographs of the limb joints and head, students encounter difficulty where superimposition occurs. By replacing calcium with silver salts in the bone, enhanced radiopacity can be produced. In this study, silver impregnation was used to increase the radiopacity of individual carpal and tarsal bones, selected bones of the skull and the sinuses, and guttural pouch of the horse. This provides an interpretation aid for teaching radiographic anatomy of these regions

  17. Surrogate nits impregnated with white piedra--a case report.

    Science.gov (United States)

    Ghorpade, A

    2004-07-01

    White piedral spores packed inside empty pedicular nits were accidentally found on microscopic examination in a 42-year-old Indian woman who presented with hair loss. The diagnosis of piedra was confirmed on culture. She responded to topical 2% miconazole nitrate solution and manual removal of the nits. This is the first case report of pedicular nits found to be impregnated with spores of white piedra.

  18. Estimation of tribological anticorrosion properties of impregnated nitriding layers

    International Nuclear Information System (INIS)

    Iwanow, J.; Senatorski, J.; Tacikowski, J.

    1999-01-01

    In this paper is described aim, experimental and test result of tribological anticorrosion properties of thin nitriding layer (12.5 μm) obtained on 45 steel grade in controlled gas-nitriding process (570 o C, 4 h) impregnated with oil-based formulations, containing corrosion inhibitor BS-43, modified with tribological additives based on ashen organometallic compounds as well as ash-free organic compounds. It was stated, that tribological additives does not influence, in fact, on behaviour of corrosion resistance of nitriding layers impregnated with oil-base formulations mainly connected with inhibitor BS-43. Synergy of tribological additive and corrosion inhibitor is however more visible in modelling of wear resistance of nitriding layer. The influence nature of tribological additives in combination with corrosion inhibitor BS-43 is dependent on their kind and as result improves or worsens the wear resistance by friction. Hence in choice of impregnated formulation, which is enable to accomplish of tribological anticorrosion requirements, determined, above all, tribological additive. (author)

  19. Mercury adsorption properties of sulfur-impregnated adsorbents

    Science.gov (United States)

    Hsi, N.-C.; Rood, M.J.; Rostam-Abadi, M.; Chen, S.; Chang, R.

    2002-01-01

    Carbonaceous and noncarbonaceous adsorbents were impregnated with elemental sulfur to evaluate the chemical and physical properties of the adsorbents and their equilibrium mercury adsorption capacities. Simulated coal combustion flue gas conditions were used to determine the equilibrium adsorption capacities for Hg0 and HgCl2 gases to better understand how to remove mercury from gas streams generated by coal-fired utility power plants. Sulfur was deposited onto the adsorbents by monolayer surface deposition or volume pore filling. Sulfur impregnation increased the total sulfur content and decreased the total and micropore surface areas and pore volumes for all of the adsorbents tested. Adsorbents with sufficient amounts of active adsorption sites and sufficient microporous structure had mercury adsorption capacities up to 4,509 ??g Hg/g adsorbent. Elemental sulfur, organic sulfur, and sulfate were formed on the adsorbents during sulfur impregnation. Correlations were established with R2>0.92 between the equilibrium Hg0/HgCl2 adsorption capacities and the mass concentrations of elemental and organic sulfur. This result indicates that elemental and organic sulfur are important active adsorption sites for Hg0 and HgCl2.

  20. Decrease of insecticide resistance over generations without exposure to insecticides in Nilaparvata lugens (Hemipteran: Delphacidae).

    Science.gov (United States)

    Yang, Yajun; Dong, Biqin; Xu, Hongxing; Zheng, Xusong; Tian, Junce; Heong, Kongleun; Lu, Zhongxian

    2014-08-01

    The brown planthopper, Nilaparvata lugens (Stål), is one of the most important insect pests on paddy rice in tropical and temperate Asia. Overuse and misuse of insecticides have resulted in the development of high resistance to many different insecticides in this pest. Studies were conducted to evaluate the change of resistance level to four insecticides over 15 generations without any exposure to insecticides in brown planthopper. After 15 generations' rearing without exposure to insecticide, brown planthopper could reverse the resistance to imidacloprid, chlorpyrifos, fipronil, and fenobucarb. The range and style of resistance reversal of brown planthopper differed when treated with four different insecticides. To monitor potential changes in insect physiological responses, we measured the activity of each of the three selected enzymes, including acetylcholinesterases (AChE), general esterases (EST), and glutathione S-transferases. After multiple generations' rearing without exposure to insecticide, AChE and EST activities of brown planthopper declined with the increased generations, suggesting that the brown planthopper population adjusted activities of EST and AChE to adapt to the non-insecticide environment. These findings suggest that the reducing, temporary stop, or rotation of insecticide application could be incorporated into the brown planthopper management.

  1. Curtain color and lighting program in broiler production: III - thermal comfort

    Directory of Open Access Journals (Sweden)

    Paulo Giovanni de Abreu

    2011-09-01

    Full Text Available The objective of this study was to evaluate the thermal comfort of broilers reared under two lighting programs (almost continuous and intermittent in broiler houses with yellow or blue lateral curtains. The experiment was carried out from June 24, 2004 until May 12, 2005. Six consecutive flocks were housed in four 12 × 10 m broilers houses internally divided into four pens of 200 birds each. Six flocks were raised on the same litter. The registration of data was accomplished at 3-hour intervals, for 24 hours twice a week. In the center of each pen and outside the house, dry and wet bulb temperatures, black globe temperature, and air velocity were collected. Based on the data collected at each time, air temperature (AT (ºC, black globe humidity temperature index (BGHTI, radiant thermal load (RTL (W/m², and relative air humidity (RH were determined. Harmonic analysis was used to estimate m, R, and f parameters. In general, the best results in terms of thermal comfort for the birds were found when near-continuous lighting program and yellow curtain were used.

  2. On radiative transfer in water spray curtains using the discrete ordinates method

    Energy Technology Data Exchange (ETDEWEB)

    Collin, A. [Laboratoire d' Energetique et de Mecanique Theorique and Appliquee (LEMTA), CNRS UMR 7563, Faculte des Sciences et Techniques BP 239 - 54506 VANDOEUVRE Cedex (France); Boulet, P. [Laboratoire d' Energetique et de Mecanique Theorique and Appliquee (LEMTA), CNRS UMR 7563, Faculte des Sciences et Techniques BP 239 - 54506 VANDOEUVRE Cedex (France)]. E-mail: Pascal.Boulet@lemta.uhp-nancy.fr; Lacroix, D. [Laboratoire d' Energetique et de Mecanique Theorique and Appliquee (LEMTA), CNRS UMR 7563, Faculte des Sciences et Techniques BP 239 - 54506 VANDOEUVRE Cedex (France); Jeandel, G. [Laboratoire d' Energetique et de Mecanique Theorique and Appliquee (LEMTA), CNRS UMR 7563, Faculte des Sciences et Techniques BP 239 - 54506 VANDOEUVRE Cedex (France)

    2005-04-15

    Radiative transfer through water spray curtains has been presently addressed in conditions similar to devices used in fire protection systems. The radiation propagation from the heat source through the medium is simulated using a 2D Discrete Ordinates Method. The curtain is treated as an absorbing and anisotropically scattering medium, made of droplets injected in a mixing of air, water vapor and carbon dioxide. Such a participating medium requires a careful treatment of its spectral response in order to model the radiative transfer accurately. This particular problem is dealt with using a correlated-K method. Radiative properties for the droplets are calculated applying the Mie theory. Transmissivities under realistic conditions are then simulated after a validation thanks to comparisons with some experimental data available in the literature. Owing to promising results which are already observed in this case of uncoupled radiative problem, next step will be to combine the present study with a companion work dedicated to the careful treatment of the spray dynamics and of the induced heat transfer phenomena.

  3. On the use of infrared thermography in studies with air curtain devices

    Energy Technology Data Exchange (ETDEWEB)

    Neto, L. P. C. [Departamento de Engenharia Industrial, Escola Superior de Tecnologia, Instituto Politecnico de Castelo Branco, Castelo Branco (Portugal); Silva, M. C. G.; Costa, J. J. [Departamento de Engenharia Mecanica, Faculdade de Ciencias e Tecnologia da Universidade de Coimbra, Polo II, Coimbra (Portugal)

    2006-07-01

    Among the different existing methods to characterise the aerodynamic sealing effect provided by an air curtain device placed over the opening between two contiguous compartments, infrared thermography has revealed to be a very useful tool. Besides allowing the capture, in an expedite way, of instantaneous images of the temperature field in the neighbourhood of the door, the technique hereon described has other advantages, in terms of quick and easy setup, low intrusive character and liability of obtained results. To apply this method, a large sheet of paper was stretched in the direction perpendicular to the opening where the air curtain device has placed to allow the registration of pictures or video sequences with an infrared camera setup in its maximum sensitivity. Good concordance between the thermographs obtained with this technique and the temperature fields measured for the same plane with a rack of 16 low velocity omni-directional thermal anemometer probes allowed its validation. Various elucidative examples of the use of this technique as a complementary tool for analysis and visualization of the complex physical phenomena occurring for the studied flow are presented in this article. (author)

  4. Transformation of the insecticide teflubenzuron by microorganisms

    NARCIS (Netherlands)

    Finkelstein, Z.I.; Baskunov, B.P.; Rietjens, I.M.C.M.; Boersma, M.G.; Vervoort, J.; Golovleva, L.A.

    2001-01-01

    Transformation of teflubenzuron, the active component in the insecticide commercialized as Nomolt, by soil microorganisms was studied. It was shown that microorganisms, belonging to Bacillus, Alcaligenes, Pseudomonas and Acinetobacter genera are capable to perform the hydrolytic cleavage of the

  5. Effect of permethrin-impregnated underwear on body lice in sheltered homeless persons: a randomized controlled trial.

    Science.gov (United States)

    Benkouiten, Samir; Drali, Rezak; Badiaga, Sékéné; Veracx, Aurélie; Giorgi, Roch; Raoult, Didier; Brouqui, Philippe

    2014-03-01

    The control of body lice in homeless persons remains a challenge. To determine whether the use of long-lasting insecticide-treated underwear provides effective long-term protection against body lice in homeless persons. A randomized, double-blind, placebo-controlled trial was conducted in February and December 2011 in 2 homeless shelters (Madrague Ville and Forbin) in Marseille, France. Of the 125 homeless persons screened for eligibility, 73 body lice-infested homeless persons, 18 years or older, were enrolled. Body lice-infested homeless persons were randomly assigned to receive 0.4% permethrin-impregnated underwear or an identical-appearing placebo for 45 days, in a 1:1 ratio, with a permuted block size of 10. Visits were scheduled at days 14 and 45. Data regarding the presence or absence of live body lice were collected. The primary and secondary end points were the proportions of homeless persons free of body lice on days 14 and 45, respectively. Mutations associated with permethrin resistance in the body lice were also identified. Significantly more homeless persons receiving permethrin-impregnated underwear than homeless persons receiving the placebo were free of body lice on day 14 in the intent-to-treat population (28% vs 9%; P = .04), with a between-group difference of 18.4 percentage points (95% CI, 1.4-35.4), and in the per-protocol population (34% vs 11%; P = .03), with a between-group difference of 23.7 percentage points (95% CI, 3.6-43.7). This difference was not sustained on day 45. At baseline, the prevalence of the permethrin-resistant haplotype was 51% in the permethrin group and 44% in the placebo group. On day 45, the permethrin-resistant haplotype was significantly more frequent in the permethrin group than in the placebo group (73% vs 45%, P < .001). Permethrin-impregnated underwear is more efficient than placebo at eliminating body louse infestations by day 14; however, this difference was not sustained on day 45. The use of permethrin

  6. Replacement of hazardous chromium impregnating agent from silver/copper/chromium-impregnated active carbon using triethylenediamine to remove hydrogen sulfide, trichloromethane, ammonia, and sulfur dioxide.

    Science.gov (United States)

    Wu, Li-Chun; Chung, Ying-Chien

    2009-03-01

    Activated carbon (AC) is widely used as an effective adsorbent in many applications, including industrial-scale air purification systems and air filter systems in gas masks. In general, ACs without chemical impregnation are good adsorbents of organic vapors but poor adsorbents of low-molecular-weight or polar gases such as chlorine, sulfur dioxide (SO2), formaldehyde, and ammonia (NH3). Impregnated ACs modified with metallic impregnating agents (ASC-carbons; e.g., copper, chromium, and silver) enhance the adsorbing properties of the ACs for simultaneously removing specific poisonous gases, but disposal of the chromium metal salt used to impregnate the ACs has the potential to result in situations that are toxic to both humans and the environment, thereby necessitating the search for replaceable organic impregnating agents that represent a much lower risk. The aim of this study was to assess the gas removal efficiency of an AC in which the organic impregnating agent triethylenediamine (TEDA) largely replaced the metallic impregnating agent chromium. We assessed batch and continuous adsorption capacities in situ for removing simulated hydrogen sulfide (H2S), trichloromethane (CHCl3), NH3, and SO2 gases. Brunauer-Emmet-Teller measurements and scanning electron microscopy analyses identified the removal mechanism by which TEDA-impregnated AS-carbon (dechromium ASC-carbon) adsorbs gases and determined the removal capacity for H2S, CHCl3, NH3, and SO2 to be 311, 258, 272, and 223 mg/g-C, respectively. These results demonstrate that TEDA-impregnated AS-carbon is significantly more efficient than ASC-carbon in adsorbing these four gases. Organic TEDA-impregnating agents have also been proven to be a reliable and environmental friendly agent and therefore a safe replacement of the hazardous chromium found in conventional ASC-carbon used in removing toxic gases from the airstream.

  7. PHITS simulations of the Protective curtain experiment onboard the Service module of ISS: Comparison with absorbed doses measured with TLDs

    Czech Academy of Sciences Publication Activity Database

    Ploc, Ondřej; Sihver, L.; Kartashov, D.; Shurshakov, V.; Tolochek, R. V.

    2013-01-01

    Roč. 52, č. 11 (2013), s. 1911-1918 ISSN 0273-1177 Institutional support: RVO:61389005 Keywords : protective curtain experiment * shielding of cosmic radiation * PHITS simulations * ISS Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.238, year: 2013

  8. Modeling global distribution of agricultural insecticides in surface waters.

    Science.gov (United States)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J; Schäfer, Ralf B; Fornaroli, Riccardo; Liess, Matthias

    2015-03-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. Evaluation of the effectiveness of grouting curtain on the basis of the analysis of groundwater temperature fluctuations behind the dam

    Directory of Open Access Journals (Sweden)

    Orekhov Vyacheslav Valentinovich

    2015-04-01

    Full Text Available In the article the authors considered the technique of evaluating the performance of a grouting curtain basing on the analysis of mathematical forecasting and regular measurements of water temperature in the reservoir and in the rock mass behind the dam. The initial data for the solution of heat transfer problem are the rate of filtration, obtained from the solution of the stationary problem of filtration, and the experimental factor, generalizing thermophysical properties of rocks. For calculating the period of time from to the change of the water temperature in the reservoir till the change of water temperature at the reference point of the rock mass a computer program was designed, which allows defining the path and time of filtration from the reservoir to the reference point in the rock mass with the help of the reverse conversion on flow lines. The calculation was carried out from the point in question in the rock mass till the crossing paths of filtration with the bottom boundary of the reservoir. As an example, we present the results of computational studies of filtration and temperature regimes in the rock foundation of a concrete dam at the design work of the grouting curtain and in case of the presence of pervious area. The calculations were performed with a time step dt = 2 days. At each time step, with account of water motion along the lines of the current through the rock mass, the previous position of the reference points in space has been determined, for which the value of the velocity vector of filtration field was corrected. In the first case, the motion of water from the reservoir was carried out in the circumvention of the grouting curtain. In the second case, the motion of water took place from the reservoir through the permeable portion of the grouting curtain. The change of the water temperature during its seepage from the water reservoir through permeable area of grouting curtain because of conductive heat transmission in

  10. Evaluation and control of poisoning of impregnated carbons used for organic iodide removal

    International Nuclear Information System (INIS)

    Kovach, J.L.; Rankovic, L.

    1979-01-01

    By the evaluation of the chemical reactions which have taken place on impregnated activated carbon surfaces exposed to nuclear reactor atmospheric environments, the role of various impregnants has been studied. The evaluation shows several different paths for the aging and posioning to take place. The four major causes were found to be: organic solvent contamination; inorganic acid gas contamination; formation of organic acids on carbon surface; and, formation of SO 2 from carbon sulfur content. Prevention of poisoning by the first two paths can be accomplished only by procedural changes within the facility. However the last three poisoning paths can be controlled to some extent by the selection of carbon pretreatment techniques and the type of impregnant used. Results were generated by evaluating used carbons from 14 nuclear power plants and by artificial poisoning of laboratory impregnated carbons. Impregnants which have antioxidant properties, besides reaction with organic iodides, can increase the life of the impregnated activated carbons

  11. Design and operation problems related to water curtain system for underground water-sealed oil storage caverns

    Directory of Open Access Journals (Sweden)

    Zhongkui Li

    2016-10-01

    Full Text Available The underground water-sealed storage technique is critically important and generally accepted for the national energy strategy in China. Although several small underground water-sealed oil storage caverns have been built in China since the 1970s, there is still a lack of experience for large-volume underground storage in complicated geological conditions. The current design concept of water curtain system and the technical instruction for system operation have limitations in maintaining the stability of surrounding rock mass during the construction of the main storage caverns, as well as the long-term stability. Although several large-scale underground oil storage projects are under construction at present in China, the design concepts and construction methods, especially for the water curtain system, are mainly based on the ideal porosity medium flow theory and the experiences gained from the similar projects overseas. The storage projects currently constructed in China have the specific features such as huge scale, large depth, multiple-level arrangement, high seepage pressure, complicated geological conditions, and high in situ stresses, which are the challenging issues for the stability of the storage caverns. Based on years' experiences obtained from the first large-scale (millions of cubic meters underground water-sealed oil storage project in China, some design and operation problems related to water curtain system during project construction are discussed. The drawbacks and merits of the water curtain system are also presented. As an example, the conventional concept of “filling joints with water” is widely used in many cases, as a basic concept for the design of the water curtain system, but it is immature. In this paper, the advantages and disadvantages of the conventional concept are pointed out, with respect to the long-term stability as well as the safety of construction of storage caverns. Finally, new concepts and principles

  12. Malaria Vector Control Still Matters despite Insecticide Resistance.

    Science.gov (United States)

    Alout, Haoues; Labbé, Pierrick; Chandre, Fabrice; Cohuet, Anna

    2017-08-01

    Mosquito vectors' resistance to insecticides is usually considered a major threat to the recent progresses in malaria control. However, studies measuring the impact of interventions and insecticide resistance reveal inconsistencies when using entomological versus epidemiological indices. First, evaluation tests that do not reflect the susceptibility of mosquitoes when they are infectious may underestimate insecticide efficacy. Moreover, interactions between insecticide resistance and vectorial capacity reveal nonintuitive outcomes of interventions. Therefore, considering ecological interactions between vector, parasite, and environment highlights that the impact of insecticide resistance on the malaria burden is not straightforward and we suggest that vector control still matters despite insecticide resistance. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Optical study of planar waveguides based on oxidized porous silicon impregnated with laser dyes

    Energy Technology Data Exchange (ETDEWEB)

    Chouket, A. [Unite de recherche de Spectroscopie Raman, Departement de Physique, Faculte des Sciences de Tunis, Elmanar 2092, Tunis (Tunisia); Charrier, J. [Laboratoire d' Optronique CNRS-UMR FOTON 6082, Universite de Rennes 1, ENSSAT-6 rue de Kerampont, BP 80518, 22305 Lannion Cedex (France); Elhouichet, H. [Unite de recherche de Spectroscopie Raman, Departement de Physique, Faculte des Sciences de Tunis, Elmanar 2092, Tunis (Tunisia)], E-mail: habib.elhouichet@fst.rnu.tn; Oueslati, M. [Unite de recherche de Spectroscopie Raman, Departement de Physique, Faculte des Sciences de Tunis, Elmanar 2092, Tunis (Tunisia)

    2009-05-15

    Oxidized porous silicon optical planar waveguides were elaborated and impregnated with rhodamine B and rhodamine 6G. The waveguiding, absorption, and photoluminescence properties of these impregnated waveguides were studied. Successful impregnation of the structure with laser dyes is shown from photoluminescence and reflectivity measurements. Furthermore, the reflectivity spectra prove the homogenous incorporation of both dye molecules inside the pores of the matrices. The refractive indices of waveguide layers were determined before and after dye impregnation to indicate the conservation of guiding conditions. The optical losses in the visible wavelengths are studied as a function of dye concentration. The dye absorption is the main reason for these losses.

  14. The effect of type and mixture of resin on the properties of impregnated paper

    Directory of Open Access Journals (Sweden)

    hossein Kermanian

    2017-05-01

    Full Text Available This study was carried out in order to investigate the effects of different types of resins and also their mixtures on the impregnated paper properties. In this regard, pure urea resin (100%, mixture of melamine and urea resins with various combinations (60/40 and 70/30 and 50/50, mixture of nano-fiber cellulose ratios of 1, 2 and 3 percent with urea resin and pure PVA (100% were used to impregnate of newsprint basic paper of Mazandaran wood and paper industries. Immersion of samples in the impregnation step were done in two time of 5 and 10 seconds. Next, melamine resin was used for surface coating and then absorption of resin in the impregnation and coating process measured. Results showed that in the impregnation step with pure urea (100%, in the respect of absorption rate and surface properties of melamine paper, the best time of impregnation was obtained 10 seconds. In the combined treatment, adding up to 30% melamine to urea resin, as impregnation step resin, offers better properties in terms of stain resistance, cigarette resistance, resistance to cracking and resistance to hot water steam for impregnatedmade paper. By adding nanocellulose up to 1% in impregnation resin, better properties is obtained for melamine paper. Also, PVA as impregnation resin, can be offer similar quality to pure urea in the resulting melamine papers.

  15. Porous solid backbone impregnation for electrochemical energy conversion systems

    KAUST Repository

    Boulfrad, Samir

    2013-09-19

    An apparatus and method for impregnating a porous solid backbone. The apparatus may include a platform for holding a porous solid backbone, an ink jet nozzle configured to dispense a liquid solution onto the porous solid backbone, a positioning mechanism configured to position the ink jet nozzle proximate to a plurality of locations of the porous solid backbone, and a control unit configured to control the positioning mechanism to position the ink jet nozzle proximate to the plurality of locations and cause the ink jet nozzle to dispense the liquid solution onto the porous solid backbone.

  16. Differences and commonalities impregnation of dry and wet sand

    Directory of Open Access Journals (Sweden)

    Maujuda МUZAFFAROVA

    2014-09-01

    Full Text Available The article is devoted to research new methods of physic-chemical methods of preventing deflation to protect railways and highways from such phenomena as exogenous sand drifts. In particular, first studied the possibility of using binders in sand wet state. Results can significantly extend the scope of the method, and identified with particular impregnation maintaining stability requirements protective cover reduces both the concentration previously recommended binders, and their costs, thereby securing implementation in practice of shifting sands resource-saving technology.

  17. Porous solid backbone impregnation for electrochemical energy conversion systems

    KAUST Repository

    Boulfrad, Samir; Jabbour, Ghassan

    2013-01-01

    An apparatus and method for impregnating a porous solid backbone. The apparatus may include a platform for holding a porous solid backbone, an ink jet nozzle configured to dispense a liquid solution onto the porous solid backbone, a positioning mechanism configured to position the ink jet nozzle proximate to a plurality of locations of the porous solid backbone, and a control unit configured to control the positioning mechanism to position the ink jet nozzle proximate to the plurality of locations and cause the ink jet nozzle to dispense the liquid solution onto the porous solid backbone.

  18. Mass impregnation plant speeds high voltage cable production

    Energy Technology Data Exchange (ETDEWEB)

    1965-05-07

    A mass impregnation and continuous sheath extrusion plant that will eliminate the long period of vacuum treatment usually required for high voltage oil-filled cables is among the latest techniques included in the new factory at Pirelli General's Eastleigh works. The new factory is said to be the first in Europe designed solely for the manufacture of the full range of oil-filled cables. Possible future increases of system voltages to about 750-kV ac or 1000-kV dc have been taken into account in the design of the works, so that only a small amount of modification and new plant will be involved.

  19. Evaluation of level of impregnation monomers in hydrotalcite

    International Nuclear Information System (INIS)

    Carmo, Danieli M. do; Machado, Jacson S.C.; Oliveira, Marcelo F.L.; Oliveira, Marcia G.; Soares, Bluma G.

    2011-01-01

    To evaluate the impregnation degree of 1,6-hexamethylene diisocyanate and 1,4-butanediol monomers in hydrotalcite clays it was prepared dispersions with mixing ratio 1:100 (clay/monomer), using the Ultraturrax and Ultrasound. Subsequently the samples were characterized by Fourier Transform Infrared Spectroscopy and X-ray Diffraction. Swelling tests and Tyndall effect were used to illustrate the different dispersions. The results indicated a strong interaction between the hydrotalcite with 1,6-hexamethylene diisocyanate, favoring the formation of intercalated structures. (author)

  20. Evidence of carbamate resistance in urban populations of Anopheles gambiae s.s. mosquitoes resistant to DDT and deltamethrin insecticides in Lagos, South-Western Nigeria

    Directory of Open Access Journals (Sweden)

    Oduola Adedayo O

    2012-06-01

    Full Text Available Abstract Background Resistance monitoring is essential in ensuring the success of insecticide based vector control programmes. This study was carried out to assess the susceptibility status of urban populations of Anopheles gambiae to carbamate insecticide being considered for vector control in mosquito populations previously reported to be resistant to DDT and permethrin. Methods Two – three day old adult female Anopheles mosquitoes reared from larval collections in 11 study sites from Local Government Areas of Lagos were exposed to test papers impregnated with DDT 4%, deltamethrin 0.05% and propoxur 0.1% insecticides. Additional tests were carried out to determine the susceptibility status of the Anopheles gambiae population to bendiocarb insecticide. Members of the A. gambiae complex, the molecular forms, were identified by PCR assays. The involvement of metabolic enzymes in carbamate resistance was assessed using Piperonyl butoxide (PBO synergist assays. The presence of kdr-w/e and ace-1R point mutations responsible for DDT-pyrethroid and carbamate resistance mechanisms was also investigated by PCR. Results Propoxur resistance was found in 10 out of the 11 study sites. Resistance to three classes of insecticides was observed in five urban localities. Mortality rates in mosquitoes exposed to deltamethrin and propoxur did not show any significant difference (P > 0.05 but was significantly higher (P A. gambiae s.s (M form. The kdr -w point mutation at allelic frequencies between 45%-77% was identified as one of the resistant mechanisms responsible for DDT and pyrethroid resistance. Ace-1R point mutation was absent in the carbamate resistant population. However, the possible involvement of metabolic resistance was confirmed by synergistic assays conducted. Conclusion Evidence of carbamate resistance in A. gambiae populations already harbouring resistance to DDT and permethrin is a clear indication that calls for the implementation of

  1. Semi-Field Evaluation of Metofluthrin-Impregnated Nets on Host-Seeking Aedes aegypti and Anopheles dirus.

    Science.gov (United States)

    Ponlawat, Alongkot; Kankaew, Prasan; Chanaimongkol, Somporn; Pongsiri, Arissara; Richardson, Jason H; Evans, Brian P

    2016-06-01

    The efficacy of a metofluthrin-impregnated net (MIN) known as the "Mushikonazu" on the house entry behavior of female Aedes aegypti and Anopheles dirus mosquitoes was evaluated using a semi-field 50-m tunnel setup. While the MIN is labeled for the control of chironomids and moth flies, this study determined the feasibility of using the device, given its current construction and metofluthrin formulation, as a spatial repellent against mosquitoes. Sentinel and cone bioassays were used to determine the insecticidal effect of the MIN. A spatial activity index (SAI) was calculated to evaluate responses of the mosquitoes. For the spatial repellent evaluation against Ae. aegypti, the overall mean of SAI was slightly less than 0 at wk 1 after the MIN application and then decreased for the last 4 wk showing a preference to treatment tent. For An. dirus, the mean SAI at wk 1 was positive, indicating a presumed repellent effect of the MIN against An. dirus. For the subsequent 4 wk, the SAI was negative, indicating a preference for the MIN. Results suggested that the MIN may not be a promising approach to repel Ae. aegypti and An. dirus under field conditions in Thailand. However, it remains probable that the MIN may be effective as a spatial repellent if modifications are made to the metofluthrin concentration or formulation and/or the construction of the device.

  2. Modeling global distribution of agricultural insecticides in surface waters

    International Nuclear Information System (INIS)

    Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J.; Schäfer, Ralf B.; Fornaroli, Riccardo; Liess, Matthias

    2015-01-01

    Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. - Highlights: • First global map on insecticide runoff through modelling. • Model predicts upper limit of insecticide exposure when compared to field data. • Water bodies in 40% of global land surface may be at risk of adverse effects. • Insecticide application rate, terrain slope and rainfall main drivers of exposure. - We provide the first global map on insecticide runoff to surface water predicting that water bodies in 40% of global land surface may be at risk of adverse effects

  3. Concept and construction process of the ceramic curtain of Vila-real Library

    Directory of Open Access Journals (Sweden)

    A. Peñín Llobell

    2016-12-01

    Full Text Available The construction of the Library of Vila-real, selected in 2012 in the VIII Latin American Biennial of Architecture and Urbanism, highlights the importance of collaboration with industry for the development and application of its outer membrane. The analysis of the construction process of the ceramic cylindrical curtain that defines it, performed by white glazed ceramic, 5 cm diameter and 7.5 m height, reveals this fact. The system builds an interstitial space, essential for its use and environmental integration. At the same time it links the building to both local industrial fabric, which aims to establish itself as one of its exponents, and to the Mediterranean culture of filters. The procedure followed is ascribed to the postartesanal and pragmatic perspective that beyond the modern heroes, introduced characters like Jean Prouvé and that today, we state, should find natural and legal channels for its development, on behalf of the progress of the construction sector.

  4. Determination of the stresses and displacements in the cut off curtain body executed by the > method

    International Nuclear Information System (INIS)

    Snisarenko, V.I.; Mel'nikov, A.I.

    1994-01-01

    Construction of the cut-off-curtain (COC) is analyzed as a possible variant to reduce the rate of radioactive horizontal migration. Such constructions can be executed by the > method. The theoretical analysis of the stress-strained state of the carried out using the methods of the theory of elasticity and of the limit equilibrium of the strewing medium. Theoretical dependences are obtained and formulas for practical calculations of the COC-body stress-strained state in the depth intervals which are of practical interest are suggested. The dependences obtained may be used to calculate the consolidation parameters and filtration coefficients, to choose materials for the COC body, geometrical size and film elements included

  5. Blow capacity of an air curtain; Hoe hard denkt u dat een luchtgrodijn moet blazen?

    Energy Technology Data Exchange (ETDEWEB)

    Cremers, B.E. [Biddle, Kootstertille (Netherlands)

    2003-03-01

    In winter, the heat capacity of a conventional air curtain can often be increased by adjusting the speed of its outlet velocity. This article demonstrates that for various reasons, it is better to adjust the width of the outlet if you need to boost the heat level rather than the outlet velocity. It also describes the benefits of this CA (Constant Air Velocity) Technology in the interests of energy conservation and comfort. [Dutch] In de winter wordt de warmtecapaciteit van een conventioneel luchtgordijn vaak verhoogd door de uitblaassnelheid aan te passen. Dit artikel toont aan dat het om meerdere redenen beter is om bij een hogere warmtebehoefte de uitblaasbreedte aan te passen in plaats van de uitblaassnelheid. Daarnaast beschrijft het de voordelen van deze CA-technologie (Constant Air velocity) wat betreft energieverbruik en comfort.

  6. Between East and West: polio vaccination across the Iron Curtain in Cold War Hungary.

    Science.gov (United States)

    Vargha, Dora

    2014-01-01

    In 1950s Hungary, with an economy and infrastructure still devastated from World War II and facing further hardships, thousands of children became permanently disabled and many died in the severe polio epidemic that shook the globe. The relatively new communist regime invested significantly in solving the public health crisis, initially importing a vaccine from the West and later turning to the East for a new solution. Through the history of polio vaccination in Hungary, this article shows how Cold War politics shaped vaccine evaluation and implementation in the 1950s. On the one hand, the threat of polio created a safe place for hitherto unprecedented, open cooperation among governments and scientific communities on the two sides of the Iron Curtain. On the other hand, Cold War rhetoric influenced scientific evaluation of vaccines, choices of disease prevention, and ultimately the eradication of polio.

  7. Neurobehavioral toxicology of pyrethroid insecticides

    International Nuclear Information System (INIS)

    Crofton, K.M.

    1986-01-01

    Pyrethroid insecticides are classified as either Type I or Type II based upon in vivo toxic signs, and neurophysiological and biochemical data. Both axonal sodium channels and the γ-aminobutyric acid (GABA) receptor complex have been proposed as the major site of action of the Type II pyrethroids. This investigation characterized the behavior and biochemical effects of low dosages of pyrethroids in rats. Type I and II pyrethroids were tested for effects on figure-eight maze activity and the acoustic startle response (ASR). All compounds decreased figure-eight maze activity. Interactions of Type I and II pyrethroids with the three major binding sites on the GABA complex were determined in vivo. Radioligand binding experiments assessed in vitro interactions of pyrethroids with the three major GABA-complex binding sites. None of the pyrethroids competed for [ 3 H]-muscimol or [ 3 H]-flunitrazepam binding. Only Type II pyrethroids inhibited binding of [ 35 S]-t-butylbicyclophosphorothionate (TBPS) in cortical synaptosome preparations with K/sub i/ values of 5 to 10 μM. The [ 35 S]-TBPS data implicate the TBPS/picrotoxinin binding site in the mechanism of Type II pyrethroid toxicity. The results of these experiments support the classification of pyrethroids into two classes, and demonstrate the utility of the figure-eight maze and the ASR in studies to elucidate neurotoxic mechanisms. The interaction of the Type II pyrethroids is probably restricted to the TBPS/picrotoxinin binding domain on the GABA complex as shown by both the in vivo and in vitro studies

  8. Assessment of the use of selected chemical and microbiological constituents as indicators of wastewater in curtain drains from home sewage-treatment systems in Medina County, Ohio

    Science.gov (United States)

    Dumouchelle, Denise H.

    2006-01-01

    Many home sewage-treatment systems (HSTS) in Ohio use curtain or perimeter drains to depress the level of the subsurface water in and around the systems. These drains could possibly intercept partially untreated wastewater and release potential pathogens to ground-water and surface-water bodies. The quality of water in curtain drains from two different HSTS designs in Medina County, Ohio, was investigated using several methods. Six evaporation-transpiration-absorption (ETA) and five leach-line (LL) systems were investigated by determining nutrient concentrations, chloride/bromide ratios (Cl/Br), Escherichia coli (E. coli ) concentrations, coliphage genotyping, and genetic fingerprinting of E. coli. Water samples were collected at 11 sites and included samples from curtain drains, septic tanks, and residential water wells. Nitrate concentrations in the curtain drains ranged from 0.03 to 3.53 mg/L (milligrams per liter), as N. Concentrations of chloride in 10 of the 11 curtain drains ranged from 5.5 to 21 mg/L; the chloride concentration in the eleventh curtain drain was 340 mg/L. Bromide concentrations in 11 curtain drains ranged from 0.01 to 0.22 mg/L. Cl/Br ratios ranged from 86 to 2,000. F-specific coliphage were not found in any curtain-drain samples. Concentrations of E. coli in the curtain drains ranged from 1 to 760 colonies per 100 milliliters. The curtain-drain water-quality data were evaluated to determine whether HSTS-derived water was present in the curtain drains. Nutrient concentrations were too low to be of use in the determination. The Cl/Br ratios appear promising. Coliphage was not detected in the curtain drains, so genotyping could not be attempted. E. coli concentrations in the curtain drains were all less than those from the corresponding HSTS; only one sample exceeded the Ohio secondary-contact water-quality standard. The genetic fingerprinting data were inconclusive because multiple links between unrelated sites were found. Although the

  9. Monomers and Monomer Mixtures Used in Impregnation of Fibrous Materials

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1968-10-15

    Some important properties of monomers and polymers in relation to their use for reinforcement of fibrous materials are listed. Some monomers and their properties important in impregnation of fibrous materials are also listed. In general it is not advantageous to use a pure monomer for impregnation but rather a mixture of monomers or a mixture of a monomer and a low molecular weight polymer such as unsaturated polyester. Some of these mixtures which have been well studied in connection with WPC are listed together with some of their properties when used in WPC. Other monomer mixtures may well come in question and other monomers can probably be used. For instance, it is reported from Japan that the cheap monomer ethyleneoxide, which cannot be polymerized by gamma radiation as such, can be polymerized (in bulk) as a mixture with methylmethacrylate. Good results with WPC have generally been obtained without swelling agents but more is grafted if some swelling agent is used, and it is possible that a swelling agent might be useful in the case of fibre-boards. Solvents, plasticizers, crosslinkable natural resins, aromatic chlorinated hydrocarbons, and retardants can be added, and with their use the properties of WPC can be widely modified. For example, a chlorinated wax can act as retardant, can reduce the total dose of radiation and can increase the flame resistance simultaneously.

  10. Emissions and Char Quality of Flame-Curtain "Kon Tiki" Kilns for Farmer-Scale Charcoal/Biochar Production

    Science.gov (United States)

    Cornelissen, Gerard; Pandit, Naba Raj; Taylor, Paul; Pandit, Bishnu Hari; Sparrevik, Magnus; Schmidt, Hans Peter

    2016-01-01

    Flame Curtain Biochar Kilns Pyrolysis of organic waste or woody materials yields charcoal, a stable carbonaceous product that can be used for cooking or mixed into soil, in the latter case often termed "biochar". Traditional kiln technologies for charcoal production are slow and without treatment of the pyrolysis gases, resulting in emissions of gases (mainly methane and carbon monoxide) and aerosols that are both toxic and contribute to greenhouse gas emissions. In retort kilns pyrolysis gases are led back to a combustion chamber. This can reduce emissions substantially, but is costly and consumes a considerable amount of valuable ignition material such as wood during start-up. To overcome these problems, a novel type of technology, the Kon-Tiki flame curtain pyrolysis, is proposed. This technology combines the simplicity of the traditional kiln with the combustion of pyrolysis gases in the flame curtain (similar to retort kilns), also avoiding use of external fuel for start-up. Biochar Characteristics A field study in Nepal using various feedstocks showed char yields of 22 ± 5% on a dry weight basis and 40 ± 11% on a C basis. Biochars with high C contents (76 ± 9%; n = 57), average surface areas (11 to 215 m2 g-1), low EPA16—PAHs (2.3 to 6.6 mg kg-1) and high CECs (43 to 217 cmolc/kg)(average for all feedstocks, mainly woody shrubs) were obtained, in compliance with the European Biochar Certificate (EBC). Gas Emission Factors Mean emission factors for the flame curtain kilns were (g kg-1 biochar for all feedstocks); CO2 = 4300 ± 1700, CO = 54 ± 35, non-methane volatile organic compounds (NMVOC) = 6 ± 3, CH4 = 30 ± 60, aerosols (PM10) = 11 ± 15, total products of incomplete combustion (PIC) = 100 ± 83 and NOx = 0.4 ± 0.3. The flame curtain kilns emitted statistically significantly (p<0.05) lower amounts of CO, PIC and NOx than retort and traditional kilns, and higher amounts of CO2. Implications With benefits such as high quality biochar, low emission

  11. Insecticide susceptibility status of human biting mosquitoes in ...

    African Journals Online (AJOL)

    Background: There has been a rapid emergence in insecticide resistance among mosquito population to commonly used public health insecticides. This situation presents a challenge to chemicals that are currently used to control mosquitoes in sub-Saharan African. Furthermore, there is limited information on insecticide ...

  12. Microbes as interesting source of novel insecticides: A review ...

    African Journals Online (AJOL)

    ... strains with good insecticidal properties can be identified, evaluated and utilized for pest control. This paper reviews the insecticidal properties of microbes and their potential utility in pest management. Keywords: Microbes, insecticides, metabolites, pest management. African Journal of Biotechnology, Vol 13(26) 2582- ...

  13. Metabolic control of the insecticides safety use

    Directory of Open Access Journals (Sweden)

    L.I. Solomenko

    2016-06-01

    Full Text Available The results of the conducted research affirm that the phosphororganic insecticides utilization can lead to the break in the nitrogen metabolism, breaking the protein formation, reducing the protein molecules renewal, causing the amino acid and amides accumulation in the active state. It has been revealed that the translocation and transformation of the insecticides under consideration are more closely connected with the changes of insoluble protein fraction. The stagnation point of the Phosphamide and Kaunter impact on the plant has been determined. And only the use of the preparation in optimal norms can influence stimulatingly the course of the process under consideration.

  14. Conservation of mining and metallurgic arachaeologic wooden objects by impregnation and radiation curing

    International Nuclear Information System (INIS)

    Schaudy, R.; Slais, E.; Eibner, C.

    1983-05-01

    The conservation of mining and metallurgic archaeologic wooden objects of different grade of destruction by impregnation with radiation-curable impregnating agents followed by in-situ-curing with gamma rays is described. Dry objects have been consolidated after cautious cleaning, whereas wet findings had to be freezedried first. The results are discussed. (Author) [de

  15. 21 CFR 529.1003 - Flurogestone acetate-impregnated vaginal sponge.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Flurogestone acetate-impregnated vaginal sponge... § 529.1003 Flurogestone acetate-impregnated vaginal sponge. (a) Specifications. Each vaginal sponge... ewes during their normal breeding season. (2) Limitations. Using applicator provided, insert sponge...

  16. Impacts of impregnation with boric acid and borax on the red colour ...

    African Journals Online (AJOL)

    Impacts of impregnation with boric acid and borax on the red colour tone of some hardwoods and varnishes. H Keskin, M Atar, A Ketizmen. Abstract. This study was performed to determine the impacts of impregnation with boric acid and borax on the red colour tone of some hardwoods and varnishes. For this purpose, the ...

  17. Apple snack enriched with L-arginine using vacuum impregnation/ohmic heating technology.

    Science.gov (United States)

    Moreno, Jorge; Echeverria, Julian; Silva, Andrea; Escudero, Andrea; Petzold, Guillermo; Mella, Karla; Escudero, Carlos

    2017-07-01

    Modern life has created a high demand for functional food, and in this context, emerging technologies such as vacuum impregnation and ohmic heating have been applied to generate functional foods. The aim of this research was to enrich the content of the semi-essential amino acid L-arginine in apple cubes using vacuum impregnation, conventional heating, and ohmic heating. Additionally, combined vacuum impregnation/conventional heating and vacuum impregnation/ohmic heating treatments were evaluated. The above treatments were applied at 30, 40 and 50  ℃ and combined with air-drying at 40 ℃ in order to obtain an apple snack rich in L-arginine. Both the impregnation kinetics of L-arginine and sample color were evaluated. The impregnated samples created using vacuum impregnation/ohmic heating at 50 ℃ presented a high content of L-arginine, an effect attributed primarily to electropermeabilization. Overall, vacuum impregnation/ohmic heating treatment at 50 ℃, followed by drying at 40 ℃, was the best process for obtaining an apple snack rich in L-arginine.

  18. Impregnation of bio-oil from small diameter pine into wood for moisture resistance

    Science.gov (United States)

    Thomas J. Robinson; Brian K. Via; Oladiran Fasina; Sushil Adhikari; Emily Carter

    2011-01-01

    Wood pyrolysis oil consists of hundreds of complex compounds, many of which are phenolic-based and exhibit hydrophobic properties. Southern yellow pine was impregnated with a pyrolysis oil-based penetrant using both a high pressure and vacuum impregnation systems, with no significant differences in retention levels. Penetrant concentrations ranging from 5-50% pyrolysis...

  19. The sampling of sulfur dioxide in air with impregnated filter paper

    NARCIS (Netherlands)

    Huygen, C.

    1963-01-01

    A method is suggested for the sampling of sulfur dioxide in air with impregnated filter paper instead of bubblers. The best aqueous impregnating solution contained potassium hydroxide with glycerol or triethanolamine. The possibilities and limitations of the method are discussed. High collection

  20. The sampling of hydrogen sulfide in air with impregnated filter paper

    NARCIS (Netherlands)

    Huygen, C.

    1964-01-01

    A method is proposed for the quantitative collection of hydrogen sulfide in air on impregnated filter paper. An aqueous solution of potassium hydroxide, potassium zincate and glycerol is used as impregnating fluid. The stability of the collected sulfide and the efficiency of collection at different

  1. Conservation experiments applying radiation-curable impregnating agents to intact and artifically decayed wood samples

    International Nuclear Information System (INIS)

    Schaudy, R.; Slais, E.

    1983-02-01

    Conservation experiments have been performed applying 10 selected impregnating agents to intact and chemically as well as biologically decayed wood samples. The quality of the radiation-curable impregnating agents could be valued by determination of the monomer uptake, the alteration of dimensions and volume and the deformation of the samples. The results are to be discussed. (Author) [de

  2. An in vitro Method for Predicting Inhalation Toxicity of Impregnation Spray Products

    DEFF Research Database (Denmark)

    Sørli, Jorid B.; Hansen, Jitka S.; Nørgaard, Asger Wisti

    2015-01-01

    Impregnation spray products are used for making surfaces water and dirt repellent. The products are composed of one or more active film-forming components dissolved or suspended in an appropriate solvent mixture. Exposure to impregnation spray products may cause respiratory distress and new cases...

  3. Impregnation of mesoporous silica for catalyst preparation studied with differential scanning calorimetry

    NARCIS (Netherlands)

    Eggenhuisen, T.M.; van Steenbergen, M.J.; Talsma, H.; de Jongh, P.E.; de Jong, K.P.

    2009-01-01

    Aqueous impregnation of mesoporous silica as a first step in catalyst preparation was studied to investigate the distribution of the metal-precursor solution over the support. The degree of pore-filling after impregnation was determined using the freezing point depression of confined liquids. A

  4. Removal of hydrogen sulfide and sulfur dioxide by carbons impregnated with triethylenediamine.

    Science.gov (United States)

    Wu, Li-Chun; Chang, Tsu-Hua; Chung, Ying-Chien

    2007-12-01

    Activated carbon (AC) adsorption has long been considered to be a readily available technology for providing protection against exposure to acutely toxic gases. However, ACs without chemical impregnation have proven to be much less efficient than impregnated ACs in terms of gas removal. The impregnated ACs in current use are usually modified with metalloid impregnation agents (ASC-carbons; copper, chromium, or silver) to simultaneously enhance the chemical and physical properties of the ACs in removing specific poisonous gases. These metalloid agents, however, can cause acute poisoning to both humans and the environment, thereby necessitating the search for organic impregnation agents that present a much lower risk. The aim of the study reported here was to assess AC or ASC-carbon impregnated with triethylenediamine (TEDA) in terms of its adsorption capability for simulated hydrogen sulfide (H2S) and sulfur dioxide (SO2) gases. The investigation was undergone in a properly designed laboratory-scale and industrial fume hood evaluation. Using the system reported here, we obtained a significant adsorption: the removal capability for H2S and SO2 was 375 and 229 mg/g-C, respectively. BET measurements, element analysis, scanning electron microscopy, and energy dispersive spectrometry identified the removal mechanism for TEDA-impregnated AC to be both chemical and physical adsorption. Chemical adsorption and oxidation were the primary means by which TEDA-impregnated ASC-carbons removed the simulated gases.

  5. The impact of insecticide-treated school uniforms on dengue infections in school-aged children: study protocol for a randomised controlled trial in Thailand

    Directory of Open Access Journals (Sweden)

    Wilder-Smith Annelies

    2012-11-01

    Full Text Available Abstract Background There is an urgent need to protect children against dengue since this age group is particularly sensitive to the disease. Since dengue vectors are active mainly during the day, a potential target for control should be schools where children spend a considerable amount of their day. School uniforms are the cultural norm in most developing countries, worn throughout the day. We hypothesise that insecticide-treated school uniforms will reduce the incidence of dengue infection in school-aged children. Our objective is to determine the impact of impregnated school uniforms on dengue incidence. Methods A randomised controlled trial will be conducted in eastern Thailand in a group of schools with approximately 2,000 students aged 7–18 years. Pre-fabricated school uniforms will be commercially treated to ensure consistent, high-quality insecticide impregnation with permethrin. A double-blind, randomised, crossover trial at the school level will cover two dengue transmission seasons. Discussion Practical issues and plans concerning intervention implementation, evaluation, analysing and interpreting the data, and possible policy implications arising from the trial are discussed. Trial registration clinicaltrial.gov. Registration number: NCT01563640

  6. The impact of insecticide-treated school uniforms on dengue infections in school-aged children: study protocol for a randomised controlled trial in Thailand.

    Science.gov (United States)

    Wilder-Smith, Annelies; Byass, Peter; Olanratmanee, Phanthip; Maskhao, Pongsri; Sringernyuang, Luechai; Logan, James G; Lindsay, Steve W; Banks, Sarah; Gubler, Duane; Louis, Valérie R; Tozan, Yesim; Kittayapong, Pattamaporn

    2012-11-15

    There is an urgent need to protect children against dengue since this age group is particularly sensitive to the disease. Since dengue vectors are active mainly during the day, a potential target for control should be schools where children spend a considerable amount of their day. School uniforms are the cultural norm in most developing countries, worn throughout the day. We hypothesise that insecticide-treated school uniforms will reduce the incidence of dengue infection in school-aged children. Our objective is to determine the impact of impregnated school uniforms on dengue incidence. A randomised controlled trial will be conducted in eastern Thailand in a group of schools with approximately 2,000 students aged 7-18 years. Pre-fabricated school uniforms will be commercially treated to ensure consistent, high-quality insecticide impregnation with permethrin. A double-blind, randomised, crossover trial at the school level will cover two dengue transmission seasons. Practical issues and plans concerning intervention implementation, evaluation, analysing and interpreting the data, and possible policy implications arising from the trial are discussed. clinicaltrial.gov. NCT01563640.

  7. Characteristics of scandate-impregnated cathodes with sub-micron scandia-doped matrices

    International Nuclear Information System (INIS)

    Yuan Haiqing; Gu Xin; Pan Kexin; Wang Yiman; Liu Wei; Zhang Ke; Wang Jinshu; Zhou Meiling; Li Ji

    2005-01-01

    We describe in this paper scandate-impregnated cathodes with sub-micron scandia-doped tungsten matrices having an improved uniformity of the Sc distribution. The scandia-doped tungsten powders were made by both liquid-solid doping and liquid-liquid doping methods on the basis of previous research. By improving pressing, sintering and impregnating procedures, we have obtained scandate-impregnated cathodes with a good uniformity of the Sc 2 O 3 - distribution. The porosity of the sub-micron structure matrix and content of impregnants inside the matrix are similar to those of conventionally impregnated cathodes. Space charge limited current densities of more than 30 A/cm 2 at 850 deg. C b have been obtained in a reproducible way. The current density continuously increases during the first 2000 h life test at 950 deg. C b with a dc load of 2 A/cm 2 and are stable for at least 3000 h

  8. Mapping insecticide resistance and characterization of resistance mechanisms in Anopheles arabiensis (Diptera: Culicidae) in Ethiopia.

    Science.gov (United States)

    Alemayehu, Eba; Asale, Abebe; Eba, Kasahun; Getahun, Kefelegn; Tushune, Kora; Bryon, Astrid; Morou, Evangelia; Vontas, John; Van Leeuwen, Thomas; Duchateau, Luc; Yewhalaw, Delenasaw

    2017-09-02

    The emergence and spread of insecticide resistance in the major African malaria vectors Anopheles gambiae (s.s.) and An. arabiensis may compromise the current vector control interventions and threatens the global malaria control and elimination efforts. Insecticide resistance was monitored in several study sites in Ethiopia from 2013 to 2015 using papers impregnated with discriminating concentrations of DDT, deltamethrin, bendiocarb, propoxur, malathion, fenitrothion and pirimiphos-methyl, following the WHO insecticide susceptibility test procedure. Mosquitoes sampled from different localities for WHO bioassay were morphologically identified as An. gambiae (s.l.) using standard taxonomic keys. Samples were identified to species using species-specific polymerase chain reaction (PCR) and screened for the presence of target site mutations L1014F, L1014S and N1575Y in the voltage gated sodium channel (VGSC) gene and G119S in the acethylcholinesterase (AChE) gene using allele-specific PCR. Biochemical assays were performed to assess elevated levels of acetylcholinesterases, carboxylcholinesterases, glutathione-S-transferases (GSTs) and cytochrome P450s monooxygenases in wild populations of An. arabiensis, compared to the fully susceptible Sekoru An. arabiensis laboratory strain. Populations of An. arabiensis were resistant to DDT and deltamethrin but were susceptible to fenitrothion in all the study sites. Reduced susceptibility to malathion, pirimiphos-methyl, propoxur and bendiocarb was observed in some of the study sites. Knockdown resistance (kdr L1014F) was detected in all mosquito populations with allele frequency ranging from 42 to 91%. Elevated levels of glutathione-S-transferases (GSTs) were detected in some of the mosquito populations. However, no elevated levels of monooxygenases and esterases were detected in any of the populations assessed. Anopheles arabiensis populations from all surveyed sites in Ethiopia exhibited resistance against DDT and pyrethroids

  9. Effect of selected insecticides on SF9 insect cell line

    International Nuclear Information System (INIS)

    Saleh, M.; Rahmo, A.; Hajjar, J.

    2013-01-01

    The toxic effect of three insecticides: dimethoate (organophosphate insecticide), acetamiprid (neonicotinoid insecticide) and deltamethrin (pyrethroid insecticide) were evaluated in vitro on cultured Sf9 cell line. Cell growth inhibition was measured by the 3- (4,5- dimethylthiazol - 2-yl) - 2,5 - diphenyl tetrazolium bromide (MTT) assay. Regression Analysis was used to estimate the 20% inhibition of cells growth (IC 20). The IC 20 values obtained for deltamethrin, acetamipridand dimethoate were: 46.8, 61.6 and 68.9 μM, respectively. The proportion of phagocytic cells was positively correlated with the applied concentrations of the insecticides. (author)

  10. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:MŠk(CZ) 2B08049 Institutional support: RVO:67985858 Keywords : botanical insecticides * plant extracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  11. Possibilities of Botanical Insecticides in Plant Protection

    Czech Academy of Sciences Publication Activity Database

    Pavela, R.; Sajfrtová, Marie; Sovová, Helena; Bárnet, M.

    2008-01-01

    Roč. 2, č. 1 (2008), s. 16-23 ISSN 1313-2563 Grant - others:GA MŠMT(CZ) 2B08049 Institutional research plan: CEZ:AV0Z40720504 Keywords : botanical insecticides * plant exctracts * supercritical fluid extraction Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection

  12. Insecticidal and fungicidal compounds from Isatis tinctoria.

    Science.gov (United States)

    Seifert, K; Unger, W

    1994-01-01

    Tryptanthrin (1), indole-3-acetonitrile (2) and p-coumaric acid methylester (3) were isolated from the aerial parts of Isatis tinctoria L. The compounds show insecticidal and anti-feedant activity against termites (Reticulitermis santonensis), insect preventive and control activity against larvae of the house longhorn beetle (Hylotrupes bajulus) and fungicidal activity against the brown-rot fungus (Coniophora puteana).

  13. Antibiotic impregnated total femur spacers: a technical tip

    Directory of Open Access Journals (Sweden)

    Colin D. Canham, MD

    2018-03-01

    Full Text Available Simultaneous prosthetic joint infection of ipsilateral hip and knee arthroplasties is often accompanied by significant bone loss and presents a challenging reconstructive problem. Two-stage reconstruction is favored and requires the placement of a total femur spacer, which is not a commercially available device. We describe a surgical technique, reporting on 2 cases in which a customized total femur antibiotic impregnated spacer was created by combining an articulating knee spacer and an articulating hip spacer with a reinforced cement dowel construct connecting the 2 spacers. Custom total femoral spacers are useful in the management of infected femoral megaprostheses and cases with ipsilateral injected hip and knee arthroplasties and severe femoral bone loss. Keywords: total femur spacer, revision arthroplasty, total hip arthroplasty, total knee arthroplasty, prosthetic joint infection

  14. Preparation of Highly Conductive Yarns by an Optimized Impregnation Process

    Science.gov (United States)

    Amba Sankar, K. N.; Mohanta, Kallol

    2018-03-01

    We report the development of the electrical conductivity in textile yarns through impregnation and post-treatment of poly(3,4-ethylenedioxythiophene) polystyrene sulfonate (PEDOT:PSS). The conductive polymer is deposited on fibers, which fills the gap space within the hierarchical structure of the yarns. Organic nonpolar solvents act as reducing agent to increase the density of PEDOT moieties on the yarns, galvanizing increment in conductivity values. Post-treatment by ethylene glycol transforms the resonance configuration of the conductive moieties of conjugated polymer, which helps in further enhancement of electrical conductivity of the yarns. We have optimized the method in terms of loading and conformal change of the polymer to have a lesser resistance of the coated conductive yarns. The minimum resistance achieved has a value of 77 Ωcm-1. This technique of developing conductivity in conventional yarns enables retaining the flexibility of yarns and feeling of softness which would find suitable␣applications for wearable electronics.

  15. Is Apis mellifera more sensitive to insecticides than other insects?

    Science.gov (United States)

    Hardstone, Melissa C; Scott, Jeffrey G

    2010-11-01

    Honey bees (Apis mellifera L.) are among the most important pollinators in natural and agricultural settings. They commonly encounter insecticides, and the effects of insecticides on honey bees have been frequently noted. It has been suggested that honey bees may be (as a species) uniquely sensitive to insecticides, although no comparative toxicology study has been undertaken to examine this claim. An extensive literature review was conducted, using data in which adult insects were topically treated with insecticides. The goal of this review was to summarize insecticide toxicity data between A. mellifera and other insects to determine the relative sensitivity of honey bees to insecticides. It was found that, in general, honey bees were no more sensitive than other insect species across the 62 insecticides examined. In addition, honey bees were not more sensitive to any of the six classes of insecticides (carbamates, nicotinoids, organochlorines, organophosphates, pyrethroids and miscellaneous) examined. While honey bees can be sensitive to individual insecticides, they are not a highly sensitive species to insecticides overall, or even to specific classes of insecticides. However, all pesticides should be used in a way that minimizes honey bee exposure, so as to minimize possible declines in the number of bees and/or honey contamination. Copyright © 2010 Society of Chemical Industry.

  16. Preparation and Properties of Moisture-absorbing Film Impregnated with Polyacrylic Acid Partial Sodium Salt Material

    International Nuclear Information System (INIS)

    Lee, Youn Suk; Park, Insik; Choi, Hong Yeol

    2014-01-01

    Moisture is a major factor causing the deteriorative physical change, microbial growth, and chemical reaction of the products. In this study, the moisture absorbing composite films have been prepared with moisture absorbing material of polyacrylic acid partial sodium salt (PAPSS) impregnated on LLDPE polymer for the functional packaging applications. The results showed that PAPSS impregnated film illustrated uniformly dispersed PAPSS particles in the LLDPE polymer matrix. The transparency of the PAPSS impregnated film decreased slightly at higher PAPSS concentrations. An increase in the PAPSS content for moisture-absorbing films showed a similar decrease in tensile strength, percent elongation at break, and tear strength. Their values of films impregnated with PAPSS of 0.5, 1, and 2% showed no significant difference. Meanwhile, 4% PAPSS films significantly decreased the values of mechanical properties compared to the films impregnated with different PAPSS levels. Values of the oxygen permeability and water vapor permeability for PAPSS impregnated films decreased significantly with greater PAPSS. The results indicate that 4% PAPSS impregnated in LLDPE films had high affinity of moisture absorbencies compared to the other films. The mathematical equation that best described the moisture sorption isotherm of each film sample was the GAB equation at 25 .deg. C. The crystallization and melting temperatures of PAPSS films were influenced by the addition of PAPSS material, but showed good thermal stability

  17. Preparation of iron-impregnated granular activated carbon for arsenic removal from drinking water

    International Nuclear Information System (INIS)

    Chang Qigang; Lin Wei; Ying Weichi

    2010-01-01

    Granular activated carbon (GAC) was impregnated with iron through a new multi-step procedure using ferrous chloride as the precursor for removing arsenic from drinking water. Scanning electron microscopy (SEM) and energy dispersive X-ray spectroscopy (EDS) analysis demonstrated that the impregnated iron was distributed evenly on the internal surface of the GAC. Impregnated iron formed nano-size particles, and existed in both crystalline (akaganeite) and amorphous iron forms. Iron-impregnated GACs (Fe-GACs) were treated with sodium hydroxide to stabilize iron in GAC and impregnated iron was found very stable at the common pH range in water treatments. Synthetic arsenate-contaminated drinking water was used in isotherm tests to evaluate arsenic adsorption capacities and iron use efficiencies of Fe-GACs with iron contents ranging from 1.64% to 12.13% (by weight). Nonlinear regression was used to obtain unbiased estimates of Langmuir model parameters. The arsenic adsorption capacity of Fe-GAC increased significantly with impregnated iron up to 4.22% and then decreased with more impregnated iron. Fe-GACs synthesized in this study exhibited higher affinity for arsenate as compared with references in literature and shows great potential for real implementations.

  18. Preparation of Palladium-Impregnated Ceria by Metal Complex Decomposition for Methane Steam Reforming Catalysis

    Directory of Open Access Journals (Sweden)

    Worawat Wattanathana

    2017-01-01

    Full Text Available Palladium-impregnated ceria materials were successfully prepared via an integrated procedure between a metal complex decomposition method and a microwave-assisted wetness impregnation. Firstly, ceria (CeO2 powders were synthesized by thermal decomposition of cerium(III complexes prepared by using cerium(III nitrate or cerium(III chloride as a metal source to form a metal complex precursor with triethanolamine or benzoxazine dimer as an organic ligand. Palladium(II nitrate was consequently introduced to the preformed ceria materials using wetness impregnation while applying microwave irradiation to assist dispersion of the dopant. The palladium-impregnated ceria materials were obtained by calcination under reduced atmosphere of 10% H2 in He stream at 700°C for 2 h. Characterization of the palladium-impregnated ceria materials reveals the influences of the metal complex precursors on the properties of the obtained materials. Interestingly, the palladium-impregnated ceria prepared from the cerium(III-benzoxazine dimer complex revealed significantly higher BET specific surface area and higher content of the more active Pdδ+ (δ > 2 species than the materials prepared from cerium(III-triethanolamine complexes. Consequently, it exhibited the most efficient catalytic activity in the methane steam reforming reaction. By optimization of the metal complex precursors, characteristics of the obtained palladium-impregnated ceria catalysts can be modified and hence influence the catalytic activity.

  19. Preparation and Properties of Moisture-absorbing Film Impregnated with Polyacrylic Acid Partial Sodium Salt Material

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Youn Suk; Park, Insik [Yonsei University, Wonju (Korea, Republic of); Choi, Hong Yeol [CJ Cheiljedang, Seoul (Korea, Republic of)

    2014-08-15

    Moisture is a major factor causing the deteriorative physical change, microbial growth, and chemical reaction of the products. In this study, the moisture absorbing composite films have been prepared with moisture absorbing material of polyacrylic acid partial sodium salt (PAPSS) impregnated on LLDPE polymer for the functional packaging applications. The results showed that PAPSS impregnated film illustrated uniformly dispersed PAPSS particles in the LLDPE polymer matrix. The transparency of the PAPSS impregnated film decreased slightly at higher PAPSS concentrations. An increase in the PAPSS content for moisture-absorbing films showed a similar decrease in tensile strength, percent elongation at break, and tear strength. Their values of films impregnated with PAPSS of 0.5, 1, and 2% showed no significant difference. Meanwhile, 4% PAPSS films significantly decreased the values of mechanical properties compared to the films impregnated with different PAPSS levels. Values of the oxygen permeability and water vapor permeability for PAPSS impregnated films decreased significantly with greater PAPSS. The results indicate that 4% PAPSS impregnated in LLDPE films had high affinity of moisture absorbencies compared to the other films. The mathematical equation that best described the moisture sorption isotherm of each film sample was the GAB equation at 25 .deg. C. The crystallization and melting temperatures of PAPSS films were influenced by the addition of PAPSS material, but showed good thermal stability.

  20. Density-dependent clustering: I. Pulling back the curtains on motions of the BAO peak

    Science.gov (United States)

    Neyrinck, Mark C.; Szapudi, István; McCullagh, Nuala; Szalay, Alexander S.; Falck, Bridget; Wang, Jie

    2018-05-01

    The most common statistic used to analyze large-scale structure surveys is the correlation function, or power spectrum. Here, we show how `slicing' the correlation function on local density brings sensitivity to interesting non-Gaussian features in the large-scale structure, such as the expansion or contraction of baryon acoustic oscillations (BAO) according to the local density. The sliced correlation function measures the large-scale flows that smear out the BAO, instead of just correcting them as reconstruction algorithms do. Thus, we expect the sliced correlation function to be useful in constraining the growth factor, and modified gravity theories that involve the local density. Out of the studied cases, we find that the run of the BAO peak location with density is best revealed when slicing on a ˜40 h-1 Mpc filtered density. But slicing on a ˜100 h-1 Mpc filtered density may be most useful in distinguishing between underdense and overdense regions, whose BAO peaks are separated by a substantial ˜5 h-1 Mpc at z = 0. We also introduce `curtain plots' showing how local densities drive particle motions toward or away from each other over the course of an N-body simulation.

  1. Study of adsorption properties of impregnated charcoal for airborne iodine and methyl iodide

    International Nuclear Information System (INIS)

    Qi-dong, L.; Sui-yuang, H.

    1985-01-01

    The adsorption characteristics of airborne radioiodine and methyl iodide on impregnated charcoal were investigated. The activated charcoal tested was made from home-made oil-palm shells, and KI and TEDA were used as impregnants. A new technique was used to plot the dynamic partial adsorption isotherm at challenge concentrations (concentration range of iodine: 1-20 ppm v/v). Some adsorption properties of the impregnated charcoal were estimated with the dynamic partial adsorption isotherm. The dependences of the adsorption capacity and penetration behavior for airborne iodine and methyl iodide on the ambient conditions (temperature, relative humidity, and superficial velocity) were studied

  2. Polymer-filled microcontainers for oral delivery loaded using supercritical impregnation

    DEFF Research Database (Denmark)

    Marizza, Paolo; Keller, Stephan Sylvest; Müllertz, Anette

    2014-01-01

    with a quasi-no-waste performance. Then ketoprofen is impregnated in the polymer matrix by using supercritical carbon dioxide (scCO2) as loading medium. The amount of polymer is controlled by the volume and the number of droplets of dispensed polymer and drug loading is tuned by varying the impregnation...... procedures. This work proposes an effective loading technique for a poorly soluble model drug in microcontainers, by combining inkjet printing and supercritical fluid impregnation. Well defined quantities of poly(vinyl pyrrolidone) (PVP) solutions are dispensed into microcontainers by inkjet printing...

  3. Exploration of Novel Botanical Insecticide Leads: Synthesis and Insecticidal Activity of β-Dihydroagarofuran Derivatives.

    Science.gov (United States)

    Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen

    2016-02-24

    The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.

  4. IMPREGNATED FIBROUS CHEMOSORBENTS OF ACID GASES FOR RESPIRATORY PURPOSE

    Directory of Open Access Journals (Sweden)

    A. A. Ennan

    2017-11-01

    Full Text Available The present review is dedicated to the analysis of scientific works carried out in Physico- Chemical Institute of Environment and Human Protection (Odessa, Ukrainie and directed to the development of import-substituting sorption-filtering materials for respiratory purposes – impregnated fibrous chemisorbents (IFCS of acid gases, which are manufactured using standard equipment, as well as affordable and inexpensive chemical reagents and carriers of domestic origin. The process of chemisorption of sulphur dioxide by hexamethylenetetramine (HMTA modified nonwoven fibrous material resulted acid-catalyzed hydrolysis of HMTA to form aminomethanesulfonic acid and toxic formaldehyde. The IFCS with HMTA carried was recommended to use for air purification only from SiF4, HF, HCl and Cl2. Chemisorption of sulphur dioxide by fibrous materials impregnated by ethanolamines (monoethanolamine, diethanomamine, triethanomamine and N-methylethanolamine and polyethylenepolyamine (PEPA occurs only in the presence of “free” water with formation of “onium” sulphites, hydrosulphites and pyrosulphites. IFCS-PEPA (dynamic activity is 1,38 mmol(SO2/g are not inferior to the protective characteristics of IFCS with Na2CO3, HMTA, ethanolamines and the best foreign ionexchange fibrous chemisorbents brand VION and FIBAN (dynamic activity is 0,263 ÷0,422 mmol(SO2/g under conditions of respirators actual use (jAGM = 60 ÷ 90 %, TAGM = 297 K, VAGM = 2,0 sm/s, СSO2 = 20 ÷ 1000 mg/g3, QPEPA = 3,45 mmol/g. It is recommended to use the condensation products of primary alkylamines with formaldehyde (with large molar masses than the bases, complex compounds of amines with 3d-metals (Ni(II and Cu(II, salts of amine with aminoacids (glycine and polybasic acids (orthophosphoric acid (pKa1 = 2,12 and citric acid (pKa1 = 3,13 for manufacturing of IFCS of acid gases The IFCS with indication of dynamic absorptive capacity “wearing” (IVKS-I was developed.

  5. Construction Technology and Management of Stone Curtain Wall%石材幕墙的施工工艺及施工管理

    Institute of Scientific and Technical Information of China (English)

    黄博杰

    2015-01-01

    由于石材幕墙整体效果美观,颜色均匀一致,具有较好的耐久性且不会造成玻璃幕墙所导致的光污染,目前越来越多的住宅、酒店、写字楼的外墙用石材来进行装饰。随着其广泛地运用,对石材幕墙的施工进行管理显得日益重要。该文将从石材幕墙的施工工艺及施工管理的质量、安全、进度三方面来进行分析。%Due to stone curtain wall’s merits of the overall satisfactory effect,consistent color,good durability and no light pollution generally caused by glass curtain wall,stone is increasingly widely used for the exterior wall decora-tion of residential houses,hotels and office buildings.With the wide application of stone curtain wall,the importance of the construction management of stone curtain wall is increasingly obvious.This paper briefly studies the stone cur-tain wall from aspects of the quality,safety and process of construction technology and construction management.

  6. Ion channels: molecular targets of neuroactive insecticides.

    Science.gov (United States)

    Raymond-Delpech, Valérie; Matsuda, Kazuhiko; Sattelle, Benedict M; Rauh, James J; Sattelle, David B

    2005-11-01

    Many of the insecticides in current use act on molecular targets in the insect nervous system. Recently, our understanding of these targets has improved as a result of the complete sequencing of an insect genome, i.e., Drosophila melanogaster. Here we examine the recent work, drawing on genetics, genomics and physiology, which has provided evidence that specific receptors and ion channels are targeted by distinct chemical classes of insect control agents. The examples discussed include, sodium channels (pyrethroids, p,p'-dichlorodiphenyl-trichloroethane (DDT), dihydropyrazoles and oxadiazines); nicotinic acetylcholine receptors (cartap, spinosad, imidacloprid and related nitromethylenes/nitroguanidines); gamma-aminobutyric acid (GABA) receptors (cyclodienes, gamma-BHC and fipronil) and L-glutamate receptors (avermectins). Finally, we have examined the molecular basis of resistance to these molecules, which in some cases involves mutations in the molecular target, and we also consider the future impact of molecular genetic technologies in our understanding of the actions of neuroactive insecticides.

  7. Multicentre studies of insecticide-treated durable wall lining in Africa and South-East Asia: entomological efficacy and household acceptability during one year of field use

    Directory of Open Access Journals (Sweden)

    Messenger Louisa A

    2012-10-01

    Full Text Available Abstract Background Indoor residual spraying (IRS is a primary method of malaria vector control, but its potential impact is constrained by several inherent limitations: spraying must be repeated when insecticide residues decay, householders can tire of the annual imposition and campaign costs are recurrent. Durable lining (DL can be considered an advanced form of long-lasting IRS where insecticide is gradually released from an aesthetically attractive wall lining material to provide vector control for several years. A multicentre trial was carried out in Equatorial Guinea, Ghana, Mali, South Africa and Vietnam to assess the feasibility, durability, bioefficacy and household acceptability of DL, compared to conventional IRS or insecticide-treated curtains (LLITCs, in a variety of operational settings. Methods This study was conducted in 220 households in traditional rural villages over 12-15 months. In all sites, rolls of DL were cut to fit house dimensions and fixed to interior wall surfaces (usually with nails and caps by trained teams. Acceptability was assessed using a standardized questionnaire covering such topics as installation, exposure reactions, entomology, indoor environment, aesthetics and durability. Bioefficacy of interventions was evaluated using WHO cone bioassay tests at regular intervals throughout the year. Results The deltamethrin DL demonstrated little to no decline in bioefficacy over 12-15 months, supported by minimal loss of insecticide content. By contrast, IRS displayed a significant decrease in bioactivity by 6 months and full loss after 12 months. The majority of participants in DL households perceived reductions in mosquito density (93% and biting (82%, but no changes in indoor temperature (83%. Among those households that wanted to retain the DL, 73% cited protective reasons, 20% expressed a desire to keep theirs for decoration and 7% valued both qualities equally. In Equatorial Guinea, when offered a choice of

  8. A Mathematical Model of Repeated Impregnation of Porous Bodies with Solutions of Polymers

    Directory of Open Access Journals (Sweden)

    I. V. Glebov

    2015-01-01

    Full Text Available The paper describes basic methods of impregnating porous bodies with solutions of polymers and their use to manufacture prepregs. It also describes the existing methods of manufacturing multilayer prepregs to produce aerospace coating of the spacecraft "Soyuz". It is shown that these prepregs have to meet high requirements for the content of the polymer, as compared with other composite materials, about 35 - 40% of the mass. Methods used for their manufacturing are long-term and non-controllable. The assumption is made that using the vacuum impregnation technology of a woven material will allow to accelerate the manufacturing process of these prepregs and improve their quality.In reviewing the technical literature have been found works on modeling the processes of impregnation, but they are aimed only at studying the speed of the woven material impregnation by various fluids and determining the time of impregnation. There were no models found to define prepreg parameters during the process of multiple impregnations. The aim of this work is to develop the simple mathematical model, which enables us to predict the polymer content of volatile products in the prepreg after each cycle of multiple impregnation of woven material with a solution of the polymer.To consider the vacuum impregnation method are used the prepregs based on silica and silica-nylon stitch-bonding fabric and bakelite varnish LBS-4 containing 50 - 60% of phenol resin and the solvent with minor impurities of pure phenol and water, as an example. To describe the process of vacuum impregnation of the porous work-piece is developed a mathematical description of the process of filling the porous space of the material with a varnish. It is assumed that the varnish components fill the porous space of the material in the same proportion as they are contained in the varnish.It is shown that a single impregnation cannot ensure the content of phenol resin in the prepreg over 32%, which does

  9. Oxidative dehydration of glycerol to acrylic acid over vanadium-impregnated zeolite beta

    Energy Technology Data Exchange (ETDEWEB)

    Pestana, Carolina F.M.; Guerra, Antonio C.O.; Turci, Cassia C. [Universidade Federal do Rio de Janeiro, RJ (Brazil). Inst. de Quimica; Ferreira, Glaucio B. [Universidade Federal Fluminense, Niteroi, RJ (Brazil). Inst. de Quimica; Mota, Claudio J.A., E-mail: cmota@iq.ufrj.br [INCT Energia e Ambiente, Universidade Federal do Rio de Janeiro, RJ (Brazil)

    2013-01-15

    The oxidative dehydration of glycerol to acrylic acid was studied over vanadium-impregnated zeolite Beta. Catalysts were prepared by wet impregnation of ammonium metavanadate over ammonium-exchanged zeolite Beta, followed by air calcination at 823 K. Impregnation reduced the specific surface area, but did not significantly affected the acidity (Bronsted and Lewis) of the zeolites. The catalytic evaluation was carried out in a fixed bed flow reactor using air as the carrier and injecting glycerol by means of a syringe pump. Acrolein was the main product, with acetaldehyde and hydroxy-acetone (acetol) being also formed. Acrylic acid was formed with approximately 25% selectivity at 548 K over the impregnated zeolites. The result can be explained by XPS (X-ray photoelectron spectroscopy) measurements, which indicated a good dispersion of the vanadium inside the pores. (author)

  10. Effects of radiation induced polymerisation on the mechanical properties of polymer impregnated concrete

    International Nuclear Information System (INIS)

    Ohgishi, S.; Ono, H.; Kasahara, Y.

    1980-01-01

    In this programme, effects of electron irradiation energy on mechanical properties of polymer impregnated concrete (PIC) were examined with regard to the density of the base cement mortar, the total exposure dose, the radiation source and other factors. (author)

  11. Inkjet Impregnation for Tailoring Air Electrode Microstructure to Improve Solid Oxide Cells Performance

    KAUST Repository

    Da’ as, Eman H.

    2015-01-01

    The urge to lower the operating temperature of solid oxide cells (SOCs) to the intermediate ranges between 500-700°C motivated the research into impregnation processes, which offer highly efficient SOC air electrodes at low operating temperatures

  12. Advanced Examination Techniques Applied to the Assessment of Vacuum Pressure Impregnation (VPI) of ITER Correction Coils

    CERN Document Server

    Sgobba, Stefano; Samain, Valerie; Libeyre, Paul; Cecillon, Alexandre; Dawid, J

    2014-01-01

    The ITER Magnet System includes a set of 18 superconducting correction coils (CC) which are used to compensate the error field modes arising from geometrical deviations caused by manufacturing and assembly tolerances. The turn and ground insulation are electrically insulated with a multi-layer fiberglass polyimide interleaved composite, impregnated with epoxy resin using vacuum pressure impregnation (VPI). Adequate high voltage insulation (5 kV), mechanical strength and rigidity of the winding pack should be achieved after impregnation and curing of the insulation system. VPI is an effective process to avoid defects such dry spots and incomplete wet out. This insulation technology has also been developed since several years for application to large superconducting coils and more recently to ITER CC. It allows the coils to be impregnated without impacting on their functional characteristics. One of the critical challenges associated with the construction of the CC is the qualification of the VPI insulation. Se...

  13. Oxidative dehydration of glycerol to acrylic acid over vanadium-impregnated zeolite beta

    International Nuclear Information System (INIS)

    Pestana, Carolina F.M.; Guerra, Antonio C.O.; Turci, Cassia C.

    2013-01-01

    The oxidative dehydration of glycerol to acrylic acid was studied over vanadium-impregnated zeolite Beta. Catalysts were prepared by wet impregnation of ammonium metavanadate over ammonium-exchanged zeolite Beta, followed by air calcination at 823 K. Impregnation reduced the specific surface area, but did not significantly affected the acidity (Bronsted and Lewis) of the zeolites. The catalytic evaluation was carried out in a fixed bed flow reactor using air as the carrier and injecting glycerol by means of a syringe pump. Acrolein was the main product, with acetaldehyde and hydroxy-acetone (acetol) being also formed. Acrylic acid was formed with approximately 25% selectivity at 548 K over the impregnated zeolites. The result can be explained by XPS (X-ray photoelectron spectroscopy) measurements, which indicated a good dispersion of the vanadium inside the pores. (author)

  14. Catalytic flash pyrolysis of oil-impregnated-wood and jatropha cake using sodium based catalysts

    KAUST Repository

    Imran, Ali; Bramer, Eddy A.; Seshan, Kulathuiyer; Brem, Gerrit

    2015-01-01

    Catalytic pyrolysis of wood with impregnated vegetable oil was investigated and compared with catalytic pyrolysis of jatropha cake making use of sodium based catalysts to produce a high quality bio-oil. The catalytic pyrolysis was carried out in two

  15. Polymerization of impregnated monomer in wood by microwave irradiation

    International Nuclear Information System (INIS)

    Kawase, Kaoru; Hayakawa, Kiyoshi

    1976-01-01

    The manufacturing of a wood-plastic combination (WPC) by irradiation of microwave (2,450 and 915 +- 50 MHz) or gamma-ray was carried out. After the impregnation of dry woods (Hinoki: Chamaecyparis obtusa Endl., Buna: Acer mono Maxim., and Kaede: Fagus crenata Blume) with the mixture of the vinyl monomers and chemical reagents, the monomer in wood was polymerized by irradiation. In case of polymerization with microwave (2,450 MHz) the effect of oxygen was not recognized, but in the case of gamma-ray the rate of polymerization remarkably decreased in the presence of oxygen. The polymerization of various monomers was carried out also in the air, and the conversions of styrene, methyl-, ethyl-, n-propyl-, and n-butyl-methacrylate were 51.8 -- 89.1%, but that of vinyl acetate was lower (4.3 -- 8.2%). The conversion of monomers with irradiation of 915 MHz microwave was very low (2.6 -- 33.5%). The conversion of monomers increased when toluylene diisocyanate was added in the monomers. The percentage of extraction with hot benzene of WPC (chip) decreased by the addition of toluylene diisocyanate. It was concluded from C.H.N. analyses that the reaction took place among the wood, toluylene diisocyanate and methyl methacrylate. (auth.)

  16. Carbonization of heavy metal impregnated sewage sludge oriented towards potential co-disposal

    International Nuclear Information System (INIS)

    Dou, Xiaomin; Chen, Dezhen; Hu, Yuyan; Feng, Yuheng; Dai, Xiaohu

    2017-01-01

    Highlights: • The carbonization of SS with externally impregnated heavy metals was investigated. • Externally impregnated heavy metals can be immobilized in the SSC. • Higher carbonization temperature help produce non-hazardous SSC. • Incineration FA can be kneaded into SS for co-disposal through co-carbonization. - Abstract: Sewage sludge (SS) is adopted as a stabilizer to immobilize externally impregnated heavy metals through carbonization oriented towards the co-disposal of SS and some hazardous wastes. Firstly Cu and Pb were impregnated into SS to ascertain the impregnating capacity and leaching behaviours of heavy metals in the resulting sewage sludge char (SSC). Meanwhile, scanning electron microscopy (SEM) and X-ray diffraction (XRD) were employed to detect the heavy metal phase in the SSC. The results showed that within 400–800 °C and an impregnating concentration ≨0.5 wt%, more than 90% of the externally impregnated Cu and Pb were remained in the SSC and immobilized. And higher temperatures helped produce non-hazardous SSC. In addition, SEM and XRD analyses revealed that externally impregnated heavy metals could be converted into stable forms and evenly distributed throughout the SSC. In the second step municipal solid waste incineration fly ash (FA) was kneaded into SS and subjected to carbonization; it has been proved that the heavy metals in FA can be well immobilized in the resulting char when FA: SS mass ratio is 1:5. Those results show that sewage sludge can be co-carbonized with wastes contaminated with heavy metals to achieve co-disposal.

  17. Conservation of diverse old wooden objects by impregnation and radiation curing

    International Nuclear Information System (INIS)

    Schaudy, R.; Slais, E.; Eibner, C.

    1983-12-01

    The conservation by impregnation with radiation-curable impregnating agents and subsequent curing with gamma radiation of an medieval wooden window-frame, several gold-coated frame fragments, a primitive flail and a poppy mallet as well as fragments of a painted mail-box and of a border is described and the results are discussed. The process is especially suited for the consolidation of heavily decayed porous objects, e.g. archaeologic findings. (Author) [de

  18. Partial-impregnation techniques in the production of wood-polymer composites through gamma irradiation

    International Nuclear Information System (INIS)

    Du Plessis, T.A.; Du Toit, G.S.; Jurriaanse, A.

    1977-04-01

    Radiation-processed wood-polymer composites produced from various partially impregnated Pinus species grown in South Africa were investigated and compared to a number of locally available noble hardwoods in respect of dimensional stability, hardness, homogeneity and weathering properties. This investigation clearly demonstrates that, through partial-impregnation techniques, wood-polymer composites can be formed from the locally grown Pinus species with a considerable saving in monomer costs without sacrificing most of the important physical properties of these materials [af

  19. Carbonization of heavy metal impregnated sewage sludge oriented towards potential co-disposal

    Energy Technology Data Exchange (ETDEWEB)

    Dou, Xiaomin [Thermal & Environmental Engineering Institute, Tongji University, Shanghai 201804 (China); Chen, Dezhen, E-mail: chendezhen@tongji.edu.cn [Thermal & Environmental Engineering Institute, Tongji University, Shanghai 201804 (China); Hu, Yuyan; Feng, Yuheng [Thermal & Environmental Engineering Institute, Tongji University, Shanghai 201804 (China); Dai, Xiaohu [National Engineering Research Centre for Urban Pollution Control, Tongji University, Shanghai 200092 (China); College of Environmental Science and Engineering, Tongji University, Shanghai 200092 (China)

    2017-01-05

    Highlights: • The carbonization of SS with externally impregnated heavy metals was investigated. • Externally impregnated heavy metals can be immobilized in the SSC. • Higher carbonization temperature help produce non-hazardous SSC. • Incineration FA can be kneaded into SS for co-disposal through co-carbonization. - Abstract: Sewage sludge (SS) is adopted as a stabilizer to immobilize externally impregnated heavy metals through carbonization oriented towards the co-disposal of SS and some hazardous wastes. Firstly Cu and Pb were impregnated into SS to ascertain the impregnating capacity and leaching behaviours of heavy metals in the resulting sewage sludge char (SSC). Meanwhile, scanning electron microscopy (SEM) and X-ray diffraction (XRD) were employed to detect the heavy metal phase in the SSC. The results showed that within 400–800 °C and an impregnating concentration ≨0.5 wt%, more than 90% of the externally impregnated Cu and Pb were remained in the SSC and immobilized. And higher temperatures helped produce non-hazardous SSC. In addition, SEM and XRD analyses revealed that externally impregnated heavy metals could be converted into stable forms and evenly distributed throughout the SSC. In the second step municipal solid waste incineration fly ash (FA) was kneaded into SS and subjected to carbonization; it has been proved that the heavy metals in FA can be well immobilized in the resulting char when FA: SS mass ratio is 1:5. Those results show that sewage sludge can be co-carbonized with wastes contaminated with heavy metals to achieve co-disposal.

  20. Thin layer chromatography of glucose and sorbitol on Cu(II)-impregnated silica gel plates

    Energy Technology Data Exchange (ETDEWEB)

    Hadzija, O. (Ruder Boskovic Inst., Zagreb (Croatia)); Spoljar, B. (Ruder Boskovic Inst., Zagreb (Croatia)); Sesartic, L. (Inst. of Immunology, Zagreb (Croatia))

    1994-04-01

    A thin-layer chromatographic (TLC) separation of glucose and sorbitol on CU(II)-impregnated silica gel plates with n-propanol: Water (4:1) v/v as developer and potassium permanganate as detecting reagent has been worked out. The new impregnant is completely insoluble in water and thus enables the use of an aqueous developer. The R[sub f]-values are 55 and 10 for glucose and sorbitol, respectively. (orig.)

  1. The Effect of Water Repellent Surface Impregnation on Durability of Cement-Based Materials

    Directory of Open Access Journals (Sweden)

    Peng Zhang

    2017-01-01

    Full Text Available In many cases, service life of reinforced concrete structures is severely limited by chloride penetration until the steel reinforcement or by carbonation of the covercrete. Water repellent treatment on the surfaces of cement-based materials has often been considered to protect concrete from these deteriorations. In this paper, three types of water repellent agents have been applied on the surface of concrete specimens. Penetration profiles of silicon resin in treated concrete have been determined by FT-IR spectroscopy. Water capillary suction, chloride penetration, carbonation, and reinforcement corrosion in both surface impregnated and untreated specimens have been measured. Results indicate that surface impregnation reduced the coefficient of capillary suction of concrete substantially. An efficient chloride barrier can be established by deep impregnation. Water repellent surface impregnation by silanes also can make the process of carbonation action slow. In addition, it also has been concluded that surface impregnation can provide effective corrosion protection to reinforcing steel in concrete with migrating chloride. The improvement of durability and extension of service life for reinforced concrete structures, therefore, can be expected through the applications of appropriate water repellent surface impregnation.

  2. Thermal Effect on the phosphoric Acid Impregnated Activated Carbon Fiber and Adsorption Properties Toward Isoprene

    Energy Technology Data Exchange (ETDEWEB)

    Hwang, Taek Sung; Lee, Jin Hyok; Kang, Kyung suk [Department of Chemical Engineering, College of Engineering, Chungnam National University, Taejon (Korea); Kim, Kwang Young [Ace Lab. Co. Ltd. Taejon (Korea); Rhee, Moon Soo [Korea Ginseng and Tobacoo Research Institute, Taejon (Korea)

    2001-05-01

    To introduce chemisorption property and improve adsorption capacities for isoprene, ACF (Activated Carbon Fiber) was impregnated by phosphoric acid. As the impregnated ACF was dried by programmed temperature from 300 degree C to 500 degree C, degree of impregnation, surface area, thermal stability and adsorption properties for isoprene were observed. The degree of impregnation of the ACF, dried at the 400 degree C, was 12.7 w/w% and surface area was 1148 m{sup 2}/g. Over the temperature range of 450 degree C to 700 degree C, there was one-step thermal degradation by the thermal decomposition of phosphonyl group. The adsorption rate of phosphoric acid on the impregnated ACF, which was dried at 400 degree C, was the fastest. The breakthrough time of ACF that was dried at 400 degree C was 18 min., and its adsorption capacity improved roughly 7.2 times in comparison to the pure ACF. In addition, it was observed the adsorption properties persisted even after the regeneration. The adsorption efficiency of regenerated ACF was 66 percent compared to the unused impregnated ACF. 21 refs., 7 figs., 3 tabs.

  3. Laser incising of wood: Impregnation of columns with water-soluble dye

    International Nuclear Information System (INIS)

    Hattori, N.; Ando, K.; Kitayama, S.; Nakamura, Y.

    1994-01-01

    To know whether or not laser incising is a useful pre-treatment technique in impregnating a chemical fluid into lumber, pin holes were made in columns of hinoki (Chamaecyparis obtusa Endl.), sugi (Cryptomeria japonica D. Don), karamatsu (Larix leptolepis Gordon) and douglas-fir (Pseudo-tsuga menziesii Franco) with 1.7 kW CO2 laser, and a water-soluble dye was impregnated into these columns with a local pressure impregnation device. Retentions, and lengths and widths of penetrations from each hole were measured quantitatively. Referring to the results of the preparatory experiment mentioned above, incising patterns for sugi and douglas-fir were designed, and the same water-soluble dye was impregnated into the laser-incised columns as well as into non-incised ones with the vacuum-pressure method to obtain penetrated layers with the target depths completely. As a result, a retention of 200 kg/m3 of dye could be achieved for a column of douglas-fir even if it is a species difficult to impregnate. The penetrated layer also could be formed completely at the depth of the laser incision. Therefore, it is concluded that laser incising can be used for the pre-treatment before impregnation of wood columns. (author)

  4. Carbonization of heavy metal impregnated sewage sludge oriented towards potential co-disposal.

    Science.gov (United States)

    Dou, Xiaomin; Chen, Dezhen; Hu, Yuyan; Feng, Yuheng; Dai, Xiaohu

    2017-01-05

    Sewage sludge (SS) is adopted as a stabilizer to immobilize externally impregnated heavy metals through carbonization oriented towards the co-disposal of SS and some hazardous wastes. Firstly Cu and Pb were impregnated into SS to ascertain the impregnating capacity and leaching behaviours of heavy metals in the resulting sewage sludge char (SSC). Meanwhile, scanning electron microscopy (SEM) and X-ray diffraction (XRD) were employed to detect the heavy metal phase in the SSC. The results showed that within 400-800°C and an impregnating concentration ≨0.5wt%, more than 90% of the externally impregnated Cu and Pb were remained in the SSC and immobilized. And higher temperatures helped produce non-hazardous SSC. In addition, SEM and XRD analyses revealed that externally impregnated heavy metals could be converted into stable forms and evenly distributed throughout the SSC. In the second step municipal solid waste incineration fly ash (FA) was kneaded into SS and subjected to carbonization; it has been proved that the heavy metals in FA can be well immobilized in the resulting char when FA: SS mass ratio is 1:5. Those results show that sewage sludge can be co-carbonized with wastes contaminated with heavy metals to achieve co-disposal. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Research and development of lithium isotope separation using an ionic-liquid impregnated organic membrane

    International Nuclear Information System (INIS)

    Hoshino, Tsuyoshi

    2013-01-01

    The tritium needed as a fuel for fusion reactors is produced by the neutron capture reaction of lithium-6 ( 6 Li) in tritium breeding materials. However, natural Li contains only about 7.6 at.% 6 Li. In Japan, new lithium isotope separation technique using ionic-liquid impregnated organic membranes have been developed. The improvement in the durability of the ionic-liquid impregnated organic membrane is one of the main issues for stable, long-term operation of electrodialysis cells while maintaining good performance. Therefore, we developed highly-durable ionic-liquid impregnated organic membrane. Both ends of the ionic-liquid impregnated organic membrane were covered by a nafion 324 overcoat to prevent the outflow of the ionic liquid. The transmission of Lithium aqueous solution after 10 hours under the highly-durable ionic-liquid impregnated organic membrane is almost 13%. So this highly-durable ionic-liquid impregnated organic membrane for long operating of electrodialysis cells has been developed through successful prevention of ion liquid dissolution. (J.P.N.)

  6. Effects of impregnation methods and drying conditions on quinoline hydrodenitrogenation over Ni-W based catalysts

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Fang; Qiu, Zegang; Zhao, Liangfu; Xiang, Hongwei [Institute of Coal Chemistry, Chinese Academy of Sciences (China); Guo, Shaoqing [Taiyuan University of Science and Technology (China)

    2014-04-15

    The effects of impregnation methods (co-impregnation and sequential impregnation) and drying conditions (air and vacuum) on the structure and catalytic behavior of MCM-41 supported Ni-W catalysts were investigated. The catalysts were characterized by powder X-ray diffraction (XRD) analysis, Fourier-transform infrared spectroscopy (FT-IR), diffuse reflectance UV-Vis absorbance spectroscopy (DRS), Raman spectroscopy, X-ray photoelectron spectroscopy (XPS) and pyridine adsorbed infrared spectroscopy (Py-IR) techniques. They were tested for hydrodenitrogenation (HDN) of quinoline at temperatures of 300-400 deg C. The HDN results showed that the catalysts prepared by co-impregnation were more active than the catalysts prepared by sequential impregnation and the catalysts prepared by drying under vacuum were more active than the catalysts dried in air. Characterization revealed that the co-impregnation method and drying under vacuum promoted the dispersion of W, the formation of the active phases, and the formation of acidic sites on the catalysts. (author)

  7. Emissions from the burning of vegetative debris in air curtain destructors.

    Science.gov (United States)

    Miller, C Andrew; Lemieux, Paul M

    2007-08-01

    Although air curtain destructors (ACDs) have been used for quite some time to dispose of vegetative debris, relatively little in-depth testing has been conducted to quantify emissions of pollutants other than CO and particulate matter. As part of an effort to prepare for possible use of ACDs to dispose of the enormous volumes of debris generated by Hurricanes Katrina and Rita, the literature on ACD emissions was reviewed to identify potential environmental issues associated with ACD disposal of construction and demolition (C&D) debris. Although no data have been published on emissions from C&D debris combustion in an ACD, a few studies provided information on emissions from the combustion of vegetative debris. These studies are reviewed, and the results compared with studies of open burning of biomass. Combustion of vegetative debris in ACD units results in significantly lower emissions of particulate matter and CO per unit of mass of debris compared with open pile burning. The available data are not sufficient to make general estimates regarding emissions of organic or metal compounds. The highly transient nature of the ACD combustion process, a minimal degree of operational control, and significant variability in debris properties make accurate prediction of ACD emissions impossible in general. Results of scoping tests conducted in preparation for possible in-depth emissions tests demonstrate the challenges associated with sampling ACD emissions and highlight the transient nature of the process. The environmental impacts of widespread use of ACDs for disposal of vegetative debris and their potential use to reduce the volume of C&D debris in future disaster response scenarios remain a considerable gap in understanding the risks associated with debris disposal options.

  8. Integral Facade Construction. Towards a new product architecture for curtain walls

    Directory of Open Access Journals (Sweden)

    Tillmann Klein

    2013-06-01

    Full Text Available Curtain wall constructions are one of the most applied facade constructions today. Independently attached to the primary load bearing structure of the building they protect the building’s interior from external climate conditions and allow great design freedom. With continuously rising requirements in terms of energy savings the constructional principle has reached its limits and strategies for improvement are needed. Incrementally evolved over time it is closely related to the architectural design and building processes. Based on literature research and stakeholder interviews the dissertation maps out the traditional and craftsmanship related facade design and construction process currently employed. In a next step, future challenges for facade constructions to cope with a changing market environment are identified. A facade function tree is developed and the theory of product architecture is applied to create a comparative basis for analysing different historical and contemporary facade products and systems. The function tree as well as the analysis clearly show how the fragmented market structures has influenced contemporary facade construction and leads to extremely modular product architectures. Numerous case studies for a new approach are conducted and summarised in several matrices. The case studies show how different modular and integral constructional strategies can respond to the future challenges. The pros and cons of different facade solutions, their potential for innovation and robustness in terms of market conditions are investigated. The dissertation concludes that a greater diversity of fa.ade types with a more integral construction is needed to meet the sometimes conflicting future challenges. If this can be realised, a greater diversity of more integral design and construction processes will evolve simultaneously. The role of the different stakeholders will change and a new way of educating architects or facade specialists

  9. Insecticides suppress natural enemies and increase pest damage in cabbage.

    Science.gov (United States)

    Bommarco, Riccardo; Miranda, Freddy; Bylund, Helena; Björkman, Christer

    2011-06-01

    Intensive use of pesticides is common and increasing despite a growing and historically well documented awareness of the costs and hazards. The benefits from pesticides of increased yields from sufficient pest control may be outweighed by developed resistance in pests and killing of beneficial natural enemies. Other negative effects are human health problems and lower prices because of consumers' desire to buy organic products. Few studies have examined these trade-offs in the field. Here, we demonstrate that Nicaraguan cabbage (Brassica spp.) farmers may suffer economically by using insecticides as they get more damage by the main pest diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae), at the same time as they spend economic resources on insecticides. Replicated similarly sized cabbage fields cultivated in a standardized manner were either treated with insecticides according common practice or not treated with insecticides over two seasons. Fields treated with insecticides suffered, compared with nontreated fields, equal or, at least in some periods of the seasons, higher diamondback moth pest attacks. These fields also had increased leaf damage on the harvested cabbage heads. Weight and size of the heads were not affected. The farmers received the same price on the local market irrespective of insecticide use. Rates of parasitized diamondback moth were consistently lower in the treated fields. Negative effects of using insecticides against diamondback moth were found for the density of parasitoids and generalist predatory wasps, and tended to affect spiders negatively. The observed increased leaf damages in insecticide-treated fields may be a combined consequence of insecticide resistance in the pest, and of lower predation and parasitization rates from naturally occurring predators that are suppressed by the insecticide applications. The results indicate biological control as a viable and economic alternative pest management strategy

  10. Diagnostic Doses of Insecticides for Adult Aedes aegypti to Assess Insecticide Resistance in Cuba.

    Science.gov (United States)

    Rodríguez, María Magdalena; Crespo, Ariel; Hurtado, Daymi; Fuentes, Ilario; Rey, Jorge; Bisset, Juan Andrés

    2017-06-01

    The objective of this study was to determine diagnostic doses (DDs) of 5 insecticides for the Rockefeller susceptible strain of Aedes aegypti , using the Centers for Disease Control and Prevention (CDC) bottle bioassay as a tool for monitoring insecticide resistance in the Cuban vector control program. The 30-min DD values determined in this study were 13.5 μg/ml, 6.5 μg/ml, 6 μg/ml, 90.0 μg/ml, and 15.0 μg/ml for cypermethrin, deltamethrin, lambda-cyhalothrin, chlorpyrifos, and propoxur, respectively. To compare the reliability of CDC bottle bioassay with the World Health Organization susceptible test, 3 insecticide-resistant strains were evaluated for deltamethrin and lambda-cyhalothrin. Results showed that the bottles can be used effectively from 21 to 25 days after treatment and reused up to 4 times, depending on the storage time. The CDC bottle bioassay is an effective tool to assess insecticide resistance in field populations of Ae. aegypti in Cuba and can be incorporated into vector management programs using the diagnostic doses determined in this study.

  11. Emamectin benzoate: new insecticide against Helicoverpa armigera.

    Science.gov (United States)

    Fanigliulo, A; Sacchetti, M

    2008-01-01

    Emamectin benzoate is a new insecticide of Syngenta Crop Protection, with a new mechanism of action and a strong activity against Lepidoptera as well as with and a high selectivity on useful organisms. This molecule acts if swallowed and has some contact action. It penetrates leaf tissues (translaminar activity) and forms a reservoir within the leaf. The mechanism of action is unique in the panorama of insecticides. In facts, it inhibits muscle contraction, causing a continuous flow of chlorine ions in the GABA and H-Glutamate receptor sites. During 2006 and 2007, experimentation was performed by the Bioagritest test facility, according to EPPO guidelines and Principles of Good Experimental Practice (GEP), aiming at establishing the biological efficacy and the selectivity of Emamectin benzoate on industry tomato against Helicoverpa armigera (Lepidoptera: Noctuidoe). The study was performed in Tursi-Policoro (Matera), southern Italy. Experimental design consisted in random blocks, in 4 repetitions. A dosage of 1.5 Kg/ha of the formulate was compared with two commercial formulates: Spinosad 0.2 kg/ha (Laser, Dow Agrosciences Italia) and Indoxacarb 0.125 kg/ha (Steward EC insecticide, Dupont). Three foliage applications were applied every 8 days. The severity of damage induced by H. armigera was evaluated on fruits. Eventual phytotoxic effects were also evaluated. Climatic conditions were optimal for Lepidoptera development, so that the percentage of fruits attacked in 2007 at the first scouting was 68.28%. Emamectin benzoate has shown, in two years of testing, a high control of H. armigera if compared with the standards Indoxacarb and Spinosad. No effect of phytotoxicity was noticed on fruits.

  12. BACILLUS THURINGIENSIS ELASTASES WITH INSECTICIDE ACTIVITY

    Directory of Open Access Journals (Sweden)

    E. V. Matseliukh

    2015-10-01

    Full Text Available The purpose of the research was a screening of proteases with elastase activity among Bacillus thuringiensis strains, their isolation, partially purification, study of physicochemical properties and insecticide activity in relation to the larvae of the Colorado beetle. The objects of the investigation were 18 strains of B. thuringiensis, isolated from different sources: sea water, dry biological product "Bitoksibatsillin" and also from natural populations of Colorado beetles of the Crimea, Kherson, Odesa, Mykolaiv and Zaporizhiia regions of Ukraine. Purification of enzymes with elastase activity isolated from above mentioned strains was performed by gel-chromatography and insecticide activity was studied on the 3–4 larvae instar of Colorado beetle. The ability of a number of B. thuringiensis strains to synthesize the proteases with elastase activity has been established. The most active were enzymes obtained from strains IMV B-7465, IMV B-7324 isolated from sea water, and strains 9, 902, Bt-H and 0-239 isolated from Colorado beetles. The study of the physicochemical properties of the partially purified proteases of these strains showed that they belonged to enzymes of the serine type. Peptidases of a number of B. thuringiensis strains (IMV B-7324, IMV B-7465, 902, 0-239, 9 are metal-dependent enzymes. Optimal conditions of action of all tested enzymes are the neutral and alkaline рН values and the temperatures of 30–40 °С. The studies of influence of the complex enzyme preparations and partially purified ones of B. thuringiensis strains on the larvae instar of Colorado beetles indicated that enzymes with elastase activity could be responsible for insecticide action of the tested strains.

  13. Bacterial adhesion forces to Ag-impregnated contact lens cases and transmission to contact lenses.

    Science.gov (United States)

    Qu, Wenwen; Busscher, Henk J; van der Mei, Henny C; Hooymans, Johanna M M

    2013-03-01

    To measure adhesion forces of Pseudomonas aeruginosa, Staphylococcus aureus, and Serratia marcescens to a rigid contact lens (CL), standard polypropylene, and Ag-impregnated lens cases using atomic force microscopy and determine bacterial transmission from lens case to CL. Adhesion forces of bacterial strains to Ag-impregnated and polypropylene lens cases and a rigid CL were measured using atomic force microscopy. Adhesion forces were used to calculate Weibull distributions, from which transmission probabilities from lens case to CL were derived. Transmission probabilities were compared with actual transmission of viable bacteria from a lens case to the CL in 0.9% NaCl and in an antimicrobial lens care solution. Bacterial transmission probabilities from polypropylene lens cases based on force analysis coincided well for all strains with actual transmission in 0.9% NaCl. Bacterial adhesion forces on Ag-impregnated lens cases were much smaller than that on polypropylene and CLs, yielding a high probability of transmission. Comparison with actual bacterial transmission indicated bacterial killing due to Ag ions during colony-forming unit transmission from an Ag-impregnated lens case, especially for P. aeruginosa. Transmission of viable bacteria from Ag-impregnated lens cases could be further decreased by use of an antimicrobial lens care solution instead of 0.9% NaCl. Bacterial transmission probabilities are higher from Ag-impregnated lens cases than from polypropylene lens cases because of small adhesion forces, but this is compensated for by enhanced bacterial killing due to Ag impregnation, especially when in combination with an antimicrobial lens care solution. This calls for a balanced combination of antimicrobial lens care solutions and surface properties of a lens case and CL.

  14. Comparison of the laboratory standard washing using CIPAC washing agent and the domestic washing on three recommended types of long-lasting insecticidal mosquito nets.

    Science.gov (United States)

    Ouattara, Jean Pierre Nabléni; Louwagie, Johanna; Pigeon, Olivier; Spanoghe, Pieter

    2013-01-01

    One of the best ways to prevent malaria is the use of insecticide-treated bed nets. Manufacturers pursue easier, safer and more efficient nets. Hence, many studies on the efficacy and wash resistance using World Health Organization standards have been reported. The commonly used detergent is "Savon de Marseille", because it closely resembles actually used soaps. At the 54(th) Collaborative International Pesticides Analytical Council (CIPAC) Technical Meeting in 2010, it was suggested to replace it by a standardized "CIPAC washing agent". The aim of this study was to investigate the difference between a laboratory hand washing simulation using the CIPAC washing agent (method-1) and a domestic washing (method-2) on different bed nets, as well as the effect of the drying process on the release of active ingredient. Interceptor®, Permanet®2.0 and Netprotect® nets were used in three treatments, each repeated 20 times. The first treatment included method-1 washing and indoor drying. The second treatment included method-2 washing and indoor drying. The third treatment used method-2 washing and UV-drying. The residual insecticide contents were determined using gas chromatography. The washing procedure and the number of washes have a significant effect on the release of active ingredient. Statistically, the two washing methods have the same effect on removing the active ingredient from the Interceptor® and Permanet®2.0 net, but a significantly different influence on the Netprotect® nets. The drying process has no significant effect on the insecticide. Both washing procedures affected the amount of insecticide remaining on nets independently of the impregnation technology. The active ingredient decreases with the number of washing cycles following an exponential or logarithmic model for coated nets. The laboratory hand washing simulation had more impact on the decrease of active ingredient content of the Netprotect® nets. All net types seemed to be effectively

  15. Comparison of the laboratory standard washing using CIPAC washing agent and the domestic washing on three recommended types of long-lasting insecticidal mosquito nets.

    Directory of Open Access Journals (Sweden)

    Jean Pierre Nabléni Ouattara

    Full Text Available One of the best ways to prevent malaria is the use of insecticide-treated bed nets. Manufacturers pursue easier, safer and more efficient nets. Hence, many studies on the efficacy and wash resistance using World Health Organization standards have been reported. The commonly used detergent is "Savon de Marseille", because it closely resembles actually used soaps. At the 54(th Collaborative International Pesticides Analytical Council (CIPAC Technical Meeting in 2010, it was suggested to replace it by a standardized "CIPAC washing agent". The aim of this study was to investigate the difference between a laboratory hand washing simulation using the CIPAC washing agent (method-1 and a domestic washing (method-2 on different bed nets, as well as the effect of the drying process on the release of active ingredient.Interceptor®, Permanet®2.0 and Netprotect® nets were used in three treatments, each repeated 20 times. The first treatment included method-1 washing and indoor drying. The second treatment included method-2 washing and indoor drying. The third treatment used method-2 washing and UV-drying. The residual insecticide contents were determined using gas chromatography.The washing procedure and the number of washes have a significant effect on the release of active ingredient. Statistically, the two washing methods have the same effect on removing the active ingredient from the Interceptor® and Permanet®2.0 net, but a significantly different influence on the Netprotect® nets. The drying process has no significant effect on the insecticide.Both washing procedures affected the amount of insecticide remaining on nets independently of the impregnation technology. The active ingredient decreases with the number of washing cycles following an exponential or logarithmic model for coated nets. The laboratory hand washing simulation had more impact on the decrease of active ingredient content of the Netprotect® nets. All net types seemed to be

  16. The combination of the entomopathogenic fungus Metarhizium anisopliae with the insecticide Imidacloprid increases virulence against the dengue vector Aedes aegypti (Diptera: Culicidae

    Directory of Open Access Journals (Sweden)

    Samuels Richard I

    2011-01-01

    Full Text Available Abstract Background Dengue fever transmitted by the mosquito Aedes aegypti, is one of the most rapidly spreading insect borne diseases, stimulating the search for alternatives to current control measures. The dengue vector A. aegypti has received less attention than anophelene species, although more than 2.5 billion people are at risk of infection worldwide. Entomopathogenic fungi are emerging as potential candidates for the control of mosquitoes. Here we continue our studies on the pathogenicity of the entomopathogenic fungus Metarhizium anisopliae against adult A. aegypti females. With the aim of further reducing mean survival times of A. aegypti exposed to fungus impregnated surfaces, a sub-lethal concentration of the neonicotinoid insecticide Imidacloprid (IMI was added to fungal suspensions. Results A sub-lethal concentration of IMI that did not significantly alter the daily survival rates or mean survival percentages of mosquitoes was identified to be 0.1 ppm. This sub-lethal concentration was combined with M. anisopliae conidia (1 × 109 conidia mL-1. Both the combined treatment and the conidia alone were able to reduce the survival of A. aegypti compared with untreated or IMI treated mosquitoes. Importantly, mosquito survival following exposure to the combined treatment for 6 and 12 hrs was significantly reduced when compared with mosquitoes exposed to conidia alone. Conclusions This is the first time that a combination of an insecticide and an entomopathogenic fungus has been tested against A. aegypti. Firstly, the study showed the potential of IMI as an alternative to the currently employed pyrethroid adulticides. Secondly, as an alternative to applications of high concentrations of chemical insecticides, we suggest that adult A. aegypti could be controlled by surface application of entomopathogenic fungi and that the efficiency of these fungi could be increased by combining the fungi with ultra-low concentrations of insecticides

  17. The combination of the entomopathogenic fungus Metarhizium anisopliae with the insecticide Imidacloprid increases virulence against the dengue vector Aedes aegypti (Diptera: Culicidae).

    Science.gov (United States)

    Paula, Adriano R; Carolino, Aline T; Paula, Cátia O; Samuels, Richard I

    2011-01-25

    Dengue fever transmitted by the mosquito Aedes aegypti, is one of the most rapidly spreading insect borne diseases, stimulating the search for alternatives to current control measures. The dengue vector A. aegypti has received less attention than anophelene species, although more than 2.5 billion people are at risk of infection worldwide. Entomopathogenic fungi are emerging as potential candidates for the control of mosquitoes. Here we continue our studies on the pathogenicity of the entomopathogenic fungus Metarhizium anisopliae against adult A. aegypti females. With the aim of further reducing mean survival times of A. aegypti exposed to fungus impregnated surfaces, a sub-lethal concentration of the neonicotinoid insecticide Imidacloprid (IMI) was added to fungal suspensions. A sub-lethal concentration of IMI that did not significantly alter the daily survival rates or mean survival percentages of mosquitoes was identified to be 0.1 ppm. This sub-lethal concentration was combined with M. anisopliae conidia (1 × 10(9) conidia mL(-1)). Both the combined treatment and the conidia alone were able to reduce the survival of A. aegypti compared with untreated or IMI treated mosquitoes. Importantly, mosquito survival following exposure to the combined treatment for 6 and 12 hrs was significantly reduced when compared with mosquitoes exposed to conidia alone. This is the first time that a combination of an insecticide and an entomopathogenic fungus has been tested against A. aegypti. Firstly, the study showed the potential of IMI as an alternative to the currently employed pyrethroid adulticides. Secondly, as an alternative to applications of high concentrations of chemical insecticides, we suggest that adult A. aegypti could be controlled by surface application of entomopathogenic fungi and that the efficiency of these fungi could be increased by combining the fungi with ultra-low concentrations of insecticides, resulting in higher mortality following relatively short

  18. Effectiveness and profitability of insecticide formulations used for ...

    African Journals Online (AJOL)

    To identify optimal pest control with lower economic risks to farmers, we investigated the effectiveness and profitability of different insecticides and insecticide formulations against bean fly (Ophiomyia spp.) and bean flower thrips (Megalurothrips sjostedtii). Two separate experiments were conducted during 2009 to 2012.

  19. Effects of insecticide spray application on insect pest infestation and ...

    African Journals Online (AJOL)

    USER

    2010-03-15

    Mar 15, 2010 ... This study provides information on the incidence of major insect pests of cowpea as well as the minimum insecticide control intervention necessary for effectively reducing cowpea yield losses on the field. Two insecticide spray regimes (once at flowering and podding) significantly reduced insect population ...

  20. Effects of insecticide spray application on insect pest infestation and ...

    African Journals Online (AJOL)

    Field studies were conducted during the 2008 - 2009 cropping season to determine the minimal insecticide application which can reduce cowpea yield losses on the field due to insect pest infestations in the Transkei region of South Africa. Treatments consisted of five cowpea varieties and four regimes of insecticide spray ...

  1. Design, Synthesis and Insecticidal Activities of Novel Phenyl Substituted Isoxazolecarboxamides

    Institute of Scientific and Technical Information of China (English)

    LIU Peng-fei; ZHANG Ji-feng; YAN Tao; XIONG Li-xia; LI Zheng-ming

    2012-01-01

    Thirteen novel phenyl substituted isoxazolecarboxamides were synthesized,and their structures were characterized by 1H NMR,elementary analysis and high-resolution mass spectrometry(HRMS) techniques.Their evaluated insecticidal activities against oriental armyworm(Mythimna separata) indicate that the phcnyl substituted isoxazolecarboxamides exhibited moderate insecticidal activities,among which compounds 9c and 9k showed comparatively higher activities.

  2. Mechanistic modeling of insecticide risks to breeding birds in ...

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of the insecticide and the risk the insecticide poses to the environment and non-target wildlife. At the present time, current USEPA risk assessments do not include population-level endpoints. In this paper, we present a new mechanistic model, which allows risk assessors to estimate the effects of insecticide exposure on the survival and seasonal productivity of birds known to use agricultural fields during their breeding season. The new model was created from two existing USEPA avian risk assessment models, the Terrestrial Investigation Model (TIM v.3.0) and the Markov Chain Nest Productivity model (MCnest). The integrated TIM/MCnest model has been applied to assess the relative risk of 12 insecticides used to control corn pests on a suite of 31 avian species known to use cornfields in midwestern agroecosystems. The 12 insecticides that were assessed in this study are all used to treat major pests of corn (corn root worm borer, cutworm, and armyworm). After running the integrated TIM/MCnest model, we found extensive differences in risk to birds among insecticides, with chlorpyrifos and malathion (organophosphates) generally posing the greatest risk, and bifenthrin and ë-cyhalothrin (

  3. Expression of melanin and insecticidal protein from Rhodotorula ...

    African Journals Online (AJOL)

    Both the salmon/red melanin and the insecticidal producing genes of Rhodotorula glutinis was successfully expressed in Escherichia coli using plasmid pZErO-1. This work suggests that in Rhodotorula species melanin and insecticidal toxin are co-expressed and therefore possibly co-evolved. Keywords: Rhodotorula ...

  4. Guide to testing insecticides on coniferous forest defoliators

    Science.gov (United States)

    Carroll B Jr. Williams; David A. Sharpnack; Liz Maxwell; Patrick J. Shea; Mark D. McGregor

    1985-01-01

    This report provides a guide to techniques for designing field tests of candidate insecticides, and for carrying out pilot tests and control projects. It describes experimental designs for testing hypotheses, and for sampling trees to estimate insect population densities and percent reduction after treatments. Directions for applying insecticides by aircraft and for...

  5. Biological efficacy of the ecotoxically favourable insecticides and ...

    African Journals Online (AJOL)

    Administrator

    2011-05-30

    May 30, 2011 ... different, studies done in natural conditions should be favored. Key words: Insecticides ... insecticide was applied on synthetic or natural food of the target insect ..... Pozsgay M, Fast P, Kaplan H, Carey PR (1987). The effect of ...

  6. Ecdysone Agonist: New Insecticides with Novel Mode of Action

    Directory of Open Access Journals (Sweden)

    Y. Andi Trisyono

    2002-12-01

    Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists

  7. Identification and cloning of two insecticidal protein genes from ...

    African Journals Online (AJOL)

    Bacillus thuringiensis (Bt) is the most widely applied type of microbial pesticide due to its high specificity and environmental safety. The activity of Bt is largely attributed to the insecticidal crystal protein encoded by the cry genes. Different insecticidal crystal proteins of Bt have different bioactivity against distinct agricultural ...

  8. Interactions of transgenic Bacillus thuringiensis insecticidal crops with spiders (Araneae)

    Science.gov (United States)

    Genetically modified crops expressing insecticidal proteins from Bacillus thuringiensis (Bt) have dramatically increased in acreage since their introduction in the mid-1990’s. Although the insecticidal mechanisms of Bt target specific pests, concerns persist regarding direct and indirect effects on...

  9. Conifer flavonoid compounds inhibit detoxification enzymes and synergize insecticides.

    Science.gov (United States)

    Wang, Zhiling; Zhao, Zhong; Cheng, Xiaofei; Liu, Suqi; Wei, Qin; Scott, Ian M

    2016-02-01

    Detoxification by glutathione S-transferases (GSTs) and esterases are important mechanisms associated with insecticide resistance. Discovery of novel GST and esterase inhibitors from phytochemicals could provide potential new insecticide synergists. Conifer tree species contain flavonoids, such as taxifolin, that inhibit in vitro GST activity. The objectives were to test the relative effectiveness of taxifolin as an enzyme inhibitor and as an insecticide synergist in combination with the organophosphorous insecticide, Guthion (50% azinphos-methyl), and the botanical insecticide, pyrethrum, using an insecticide-resistant Colorado potato beetle (CPB) Leptinotarsa decemlineata (Say) strain. Both taxifolin and its isomer, quercetin, increased the mortality of 1(st) instar CPB larvae after 48h when combined with Guthion, but not pyrethrum. Taxifolin had greater in vitro esterase inhibition compared with the commonly used esterase inhibitor, S, S, S-tributyl phosphorotrithioate (DEF). An in vivo esterase and GST inhibition effect after ingestion of taxifolin was measured, however DEF caused a greater suppression of esterase activity. This study demonstrated that flavonoid compounds have both in vitro and in vivo esterase inhibition, which is likely responsible for the insecticide synergism observed in insecticide-resistant CPB. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.

  10. Sunlight-driven eco-friendly smart curtain based on infrared responsive graphene oxide-polymer photoactuators.

    Science.gov (United States)

    Leeladhar; Raturi, Parul; Singh, J P

    2018-02-27

    Photomechanical actuation is the conversion of light energy into mechanical energy through some smart materials. Infrared-responsive smart materials have become an emerging field of research due to easy availability and eco-friendly nature of their stimulus in the form of sunlight, which contains about 50% of near-infrared(nIR) making these materials useful at macro-scale photoactuator applications. Here, we demonstrate fabrication of highly versatile nIR triggered photoactuators based on graphene oxide/polycarbonate bilayers that offers fast, low-cost fabrication, large deflection, reversible actuation and wavelength-selective response. The photoactuators are realized by vacuum filtration of graphene oxide/water dispersion through polycarbonate membrane resulting graphene oxide/polymer bilayer structure. The photoactuation response was measured in the form of deflection from equilibrium position as a result of infrared-irradiation. The deflection is caused by the generated thermal stress at the interface of bilayers due to mismatch of thermal expansion coefficient as a results of nIR absorption by graphene oxide and subsequent temperature rise. A maximum deflection of 12 mm (circular-shaped structure with diameter 28 mm) with corresponding bending curvature of 0.33 cm -1 was shown by this photoactuator for illumination intensity of 106 mW/cm 2 . Few applications of these photoactuators such as sunlight-driven smart curtain, infrared actuated curtain and self-folding box are also demonstrated.

  11. Influence of PVA and CMC on the Properties of Pigment Coating Colors and their Effects on Curtain Stability

    Directory of Open Access Journals (Sweden)

    Eun Heui Choi

    2015-09-01

    Full Text Available The influence of polyvinyl alcohol (PVA and carboxymethyl cellulose (CMC on the properties of ground calcium carbonate (GCC and clay coating colors, as well as its effect on curtain stability during the coating process was investigated. Based on the experimental results of the zeta potential, sediment porosity, rheological measurements, the floc formation mechanisms of the cobinders were proposed. The zeta potential decreased with an increase in the amount of added PVA, while it barely changed when CMC was added. This was attributed to the adsorption of PVA onto the pigment surface, while the adsorption of CMC was hindered by electrostatic repulsion. CMC cobinder increased the low-shear viscosity, but it resulted in relatively low viscosity under high-shear conditions, indicating the disruption of the formed flocs under high shear. The destabilization mechanism of the curtain coating differed depending on the type of cobinder. The PVA cobinder flocculates the coating color via a gelling mechanism, while the CMC cobinder flocculates the colors via a depletion flocculation mechanism.

  12. Spatial repellency of metofluthrin-impregnated multilayer paper strip against Aedes albopictus under outdoor conditions, Nagasaki, Japan

    OpenAIRE

    Argueta, Tamara Belzabel Obispo; Kawada, Hitoshi; Takagi, Masahiro

    2004-01-01

    Spatial repellency of a new device in which metofluthrin, a newly synthesized pyrethroid, is impregnated into a multilayer paper strip, against Aedes albopictus was evaluated under outdoor conditions. High spatial repellency (>80%) with the metofluthrin-impregnated (200 mg) device lasted for more than 6 weeks, while the repellency with the same device impregnated with the same amount of transfluthrin declined within 5 weeks after treatment.

  13. Botanical insecticides inspired by plant-herbivore chemical interactions.

    Science.gov (United States)

    Miresmailli, Saber; Isman, Murray B

    2014-01-01

    Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. Ecotoxicological study of insecticide effects on arthropods in common bean.

    Science.gov (United States)

    de Barros, Emerson Cristi; Ventura, Hudson Vaner; Gontijo, Pablo Costa; Pereira, Renata Ramos; Picanço, Marcelo Coutinho

    2015-01-01

    Arthropods are an important group of macroorganisms that work to maintain ecosystem health. Despite the agricultural benefits of chemical control against arthropod pests, insecticides can cause environmental damage. We examined the effects of one and two applications of the insecticides chlorfenapyr (0.18 liters a.i. ha-1) and methamidophos (0.45 liters a.i. ha-1), both independently and in combination, on arthropods in plots of common bean. The experiment was repeated for two growing seasons. Principal response curve, richness estimator, and Shannon-Wiener diversity index analyses were performed. The insecticides generally affected the frequency, richness, diversity, and relative abundance of the arthropods. In addition, the arthropods did not experience recovery after the insecticide applications. The results suggest that the insecticide impacts were sufficiently drastic to eliminate many taxa from the studied common bean plots. © The Author 2015. Published by Oxford University Press on behalf of the Entomological Society of America.

  15. An Operational Framework for Insecticide Resistance Management Planning.

    Science.gov (United States)

    Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael

    2016-05-01

    Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.

  16. Physicochemical properties of vanadium impregnated Al-PILCs: Effect of vanadium source

    Energy Technology Data Exchange (ETDEWEB)

    Balci, Suna, E-mail: sunabalci@gazi.edu.tr; Tecimer, Aylin

    2015-03-01

    Graphical abstract: - Highlights: • Vanadium was incorporated into Al-PILC using NaVO{sub 3} or VOSO{sub 4}·3H{sub 2}O precursors by wet impregnation, washing after wet impregnation and impregnation from solution methods. • The layered structure of the supports was retained after the vanadium incorporation. • Incorporation took place both by settling and ion exchange mechanism with the treatment VOSO{sub 4}·3H{sub 2}O precursor while settling was dominant in the use of NaVO{sub 3} precursor. • Treatment with VOSO{sub 4}·3H{sub 2}O which was acidic in solution resulted in more structural deformation. • V{sub 2}O{sub 5} and VO{sub 2} were found as the major oxide forms on the impregnated samples. Loading of vanadyl sulfate hydrate (VOSO{sub 4}·H{sub 2}O) resulted in higher V/Si ratio. Most of the vanadium was bonded in +5 oxide form. • Changes in the FTIR signals after vanadium incorporation caused by Brønsted and Lewis sites, silanol, water and vanadium vibrations were occured. • Dehydroxylation of the structure took place around 300 °C. Samples obtained by impregnation and washing after wet impregnation methods resulted in similar mass losses and the wet impregnated sample showed the highest mass loss among the impregnated samples. - Summary: Clay from the Middle Anatolian previously pillared by Al{sub 13}-Keggin ions and then calcined at 300 °C (Al-PILC) was impregnated with aqueous solutions of vanadium precursors by impregnation from solution (I), wet impregnation (WI) and washing after wet impregnation (WWI) methods. The crystal and textural properties were evaluated by X-ray powder diffraction (XRD), nitrogen sorption and transmission electron microscopy (TEM) images. Vanadium incorporation into the Al-PILC resulted decreases in the basal spacing from 1.75 nm to 1.35 nm with the preserved typical layered structure. The use of sodium metavanadate (NaVO{sub 3}) as the source and the impregnation from solution as the incorporation method

  17. Incorporation of Hyperbranched Supramolecules into Nafion Ionic Domains via Impregnation and In-Situ Photopolymerization

    Directory of Open Access Journals (Sweden)

    Hiruto Kudo

    2011-11-01

    Full Text Available Nafion membranes were impregnated with photocurable supramolecules, viz., hyperbranched polyester having pendant functional carboxylic acid groups (HBPEAc-COOH by swelling in methanol and subsequently photocured in-situ after drying. Structure-property relationships of the HBPEAc-COOH impregnated Nafion membranes were analyzed on the basis of Fourier transform infrared (FTIR spectroscopy, solid-state nuclear magnetic resonance (SSNMR and dynamic mechanical analysis (DMA. FTIR and SSNMR investigations revealed that about 7 wt % of HBPEAc-COOH was actually incorporated into the ionic domains of Nafion. The FTIR study suggests possible complexation via inter-species hydrogen bonding between the carboxylic groups of HBPEAc-COOH and the sulfonate groups of Nafion. The α-relaxation peak corresponding to the glass transition temperature of the ionic domains of the neat Nafion-acid form was found to increase from ~100 to ~130 °C upon impregnation with enhanced modulus afforded by the cured polyester network within the ionic domains. The AC impedance fuel cell measurement of the impregnated membrane exhibited an increasing trend of proton conductivity with increasing temperature, which eventually surpassed that of neat Nafion above 100 °C. Of particular importance is that the present paper is the first to successfully incorporate polymer molecules/networks into the Nafion ionic domains by means of impregnation with hyperbranched supramolecules followed by in-situ photopolymerization.

  18. Different Types of Waste Melamine Impregnated Paper (MIP in Particleboard Manufacturing

    Directory of Open Access Journals (Sweden)

    Ibrahim Halil BASBOGA

    2017-03-01

    Full Text Available Two different types of waste melamine impregnated paper (WMIP were generated in the manufactured coated board product plants. First one is obtained when the neat décor papers were impregnated (in the impregnation line with melamine urea formaldehyde and other chemicals (WMIP1. The second one is generated during the coating of the melamine impregnated papers on the board surfaces (WMIP2. In this study, the utilization of both WMIPs in the production of particleboard as an adhesivereplacement was investigated. First, waste melamine impregnated papers (WMIPs granulated into flour form using Pulverizator with cooling capabilities. Then, they were dry-mixed with surface and core layer particles at 10% or 15% loadings. Three different WMIPs (WMIP1, WMIP2 or their mixtures - 70% WMIP1+30% WMIP2 were used as adhesive-replacement. Mechanical properties including bending strength, modulus of elasticity, internal bond strength and surface stability of the samples were determined according to EN 310, EN 319 and EN 317 standards, respectively. Based on the results, the type of WMIP had significant effect on all mechanical properties investigated. Particleboards produced with both 10% and 15% of WMIP1 loading provided adequate results for the related standards. The best result was obtained when 15% of WMIP1 was used. It is concluded that WMIP1 might be used as an adhesive-replacement in particleboard manufacturing and may provide economic and environmental benefits.

  19. Supercritical impregnation of cinnamaldehyde into polylactic acid as a route to develop antibacterial food packaging materials.

    Science.gov (United States)

    Villegas, Carolina; Torres, Alejandra; Rios, Mauricio; Rojas, Adrián; Romero, Julio; de Dicastillo, Carol López; Valenzuela, Ximena; Galotto, María José; Guarda, Abel

    2017-09-01

    Supercritical impregnation was used to incorporate a natural compound with antibacterial activity into biopolymer-based films to develop active food packaging materials. Impregnation tests were carried out under two pressure conditions (9 and 12MPa), and three depressurization rates (0.1, 1 and 10MPamin -1 ) in a high-pressure cell at a constant temperature equal to 40°C. Cinnamaldehyde (Ci), a natural compound with proven antimicrobial activity, was successfully incorporated into poly(lactic acid) films (PLA) using supercritical carbon dioxide (scCO 2 ), with impregnation yields ranging from 8 to 13% w/w. Higher pressure and slower depressurization rate seem to favor the Ci impregnation. The incorporation of Ci improved thermal, structural and mechanical properties of the PLA films. Impregnated films were more flexible, less brittle and more resistant materials than neat PLA films. The tested samples showed strong antibacterial activity against the selected microorganisms. In summary, this study provides an innovative route to the development of antibacterial biodegradable materials, which could be used in a wide range of applications of active food packaging. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Processing effects in production of composite prepreg by hot melt impregnation

    Science.gov (United States)

    Chmielewski, C.; Jayaraman, K.; Petty, C. A.

    1993-06-01

    The hot melt impregnation process for producing composite prepreg has been studied. The role of the exit die is highlighted by operating without impregnation bars. Experimental results show that when a fiber tow is pulled through a resin bath and then through a wedge shaped die, the total resin mass fraction and the extent of resin impregnation in the tow increase with the processing viscosity. The penetration of resin into a fiber bundle is greater when the resin viscosity is higher. This trend is unchanged over a range of tow speeds up to the breaking point. A theoretical model is developed to describe the effect of processing conditions and die geometry on the degree of impregnation. Calculations with this model indicate that for a given die geometry, the degree of impregnation increases from 58 percent to 90 percent as the ratio of the clearance between the tow and the die wall, to the total die gap is decreased from 0.15 to 0.05. Physical arguments related to the effective viscosity of the prepreg show that the clearance ratio is independent of the tow speed, but decreases as the ratio of the effective shear viscosity of the prepreg to the resin viscosity increases. This provides a connection between the experimental results obtained with varying resin viscosity and the computational results obtained with varying clearance values at the die inlet.

  1. The results of air treatment process modeling at the location of the air curtain in the air suppliers and ventilation shafts

    Directory of Open Access Journals (Sweden)

    Nikolaev Aleksandr

    2017-01-01

    Full Text Available In the existing shaft air heater installations (AHI, that heat the air for air suppliers in cold seasons, a heater channel is used. Some parts of the air from the heater go to the channel, other parts are sucked through a pithead by the general shaft pressure drawdown formed by the main ventilation installation (MVI. When this happens, a mix of two air flows leads to a shaft heat regime violation that can break pressurization of intertubular sealers. The problem of energy saving while airing underground mining enterprises is also very important. The proposed solution of both tasks due to the application of an air curtain is described in the article. In cold seasons the air treatment process should be used and it is offered to place an air curtain in the air suppliers shaft above the place of interface of the calorifer channel to a trunk in order to avoid an infiltration (suction of air through the pithead. It’s recommended to use an air curtain in a ventilation shaft because it reduces external air leaks thereby improving energy efficiency of the MVI work. During the mathematical modeling of ventilation and air preparation process (in SolidWorks Flowsimulation software package it was found out that the use of the air curtain in the air supply shaft can increase the efficiency of the AHI, and reduce the electricity consumption for ventilation in the ventilation shaft.

  2. 石材幕墙安装技术要点控制%The Control Points of Stone Curtain Wall Installation Technology

    Institute of Scientific and Technical Information of China (English)

    陈慧

    2013-01-01

      随着经济的发展,城市建筑外墙结构采用天然石材幕墙的不断增多。石材幕墙具有独特的艺术风格、高雅的外在造型,能使城市景观得到进一步的提升。石材幕墙的施工方法分为干挂法和湿挂法。本文着重针对干挂法石材幕墙安装的技术要点与质量控制进行探讨。%With the development of economy, exterior wal st-ructure of urban architecture using the natural stone curtain wal structure is increasing. The external appearance of stone curtain wal has a unique artistic style, elegant, can make the city landscape has been further improved. Construction metho-d for stone curtain wal is divided into dry hanging method and wet hanging method. This paper discusses focused on the law of dry hanging stone curtain wal technology points and the quality control of instal ation.

  3. Rice Production without Insecticide in Smallholder Farmer's Field

    Directory of Open Access Journals (Sweden)

    M. P. Ali

    2017-05-01

    Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even

  4. In situ treatment of concrete surfaces by organic impregnation and polymerization

    International Nuclear Information System (INIS)

    Ursella, P.; Moretti, G.; Pellecchia, V.

    1990-01-01

    The impregnation by resins of concrete structures is a process well known at PIC (Polymer Impregnated Concrete). This process improves the physical-chemical features of concrete matrixes in order to extend their durability when severe environmental conditions may occur. The main objective of this research contract has been the verification of a proper impregnation 'in situ' of existing concrete surfaces, of any laying in the space, by means of a prototype machine, expressly designed and implemented, and verification of the increase of mechanical resistance, leach resistance, durability of treated material. In a nuclear facility this goal is very important in relation to the long term integrity of concrete structures during operating lifetime and, in particular, after final shutdown. (author)

  5. Controllable Impregnation Via Inkjet Printing for the Fabrication of Solid Oxide Cell Air Electrodes

    KAUST Repository

    Da'as, E. H.; Irvine, J. T. S.; Traversa, Enrico; Boulfrad, S.

    2013-01-01

    The impregnation method has been considered as one of the most successful techniques for the fabrication of highly efficient electrodes for solid oxide fuel and electrolysis cells (SOCs) at the lab scale. However, because the impregnation is usually performed manually, its irreproducibility remains a major problem that can be solved by using controllable techniques, such as inkjet printing. In this paper, lanthanum strontium manganite (LSM)/yttria stabilized zirconia (YSZ) air electrodes were prepared by infiltrating YSZ porous bodies with LSM precursor solution using inkjet printing, followed by annealing at 800°C for 2 hours. XRD analysis confirmed the formation of the LSM phase, which was in the form of nanoparticles with size in the 50-70 nm range on the YSZ walls, as revealed by FEG-SEM observations. The effect of printing parameters on the distribution of the impregnated phase was investigated and discussed.

  6. Surface studies of thermionic cathodes and the mechanism of operation of an impregnated tungsten cathode

    International Nuclear Information System (INIS)

    Forman, R.

    1976-09-01

    The surface properties of conventional impregnated cathodes were investigated by the use of Auger spectroscopy and work function measurements, and these were compared with a synthesized barium- or barium oxide coated tungsten surface. The barium- and barium oxide coated surfaces were prepared by evaporating barium onto a tungsten surface that can be heated to elevated temperatures. Multilayer or monolayer coverages can be investigated using this technique. The results of this study show that the surface of an impregnated tungsten cathode is identical to that observed for a synthesized monolayer or partial monolayer of barium on partially oxidized tungsten, using the criteria of identical Auger patterns and work functions. Desorption measurements of barium from a tungsten surface were also made. These results in conjunction with Auger and work function data were interpreted to show that throughout most of its life an impregnated cathode operating in the range of 1100 C has a partial monolayer rather than a monolayer of barium on its surface

  7. Recent progress and tests of radiation resistant impregnation materials for Nb3Sn coils

    Science.gov (United States)

    Bossert, R.; Krave, S.; Ambrosio, G.; Andreev, N.; Chlachidze, G.; Nobrega, A.; Novitski, I.; Yu, M.; Zlobin, A. V.

    2014-01-01

    Fermilab is collaborating with Lawrence Berkeley National Laboratory (LBNL) and Brookhaven National Laboratory (BNL) (US-LARP collaboration) to develop a large-aperture Nb3Sn superconducting quadrupole for the Large Hadron Collider (LHC) luminosity upgrade. An important component of this work is the development of materials that are sufficiently radiation resistant for use in critical areas of the upgrade. This paper describes recent progress in characterization of materials, including the baseline CTD101K epoxy, cyanate ester blends, and Matrimid 5292, a bismaleimide-based system. Structural properties of "ten stacks" of cable impregnated with these materials are tested at room and cryogenic temperatures and compared to the baseline CT-101K. Experience with potting 1 and 2 meter long coils with Matrimid 5292 are described. Test results of a single 1-m coil impregnated with Matrimid 5292 are reported and compared to similar coils impregnated with the traditional epoxy.

  8. Controllable Impregnation Via Inkjet Printing for the Fabrication of Solid Oxide Cell Air Electrodes

    KAUST Repository

    Da'as, E. H.

    2013-10-07

    The impregnation method has been considered as one of the most successful techniques for the fabrication of highly efficient electrodes for solid oxide fuel and electrolysis cells (SOCs) at the lab scale. However, because the impregnation is usually performed manually, its irreproducibility remains a major problem that can be solved by using controllable techniques, such as inkjet printing. In this paper, lanthanum strontium manganite (LSM)/yttria stabilized zirconia (YSZ) air electrodes were prepared by infiltrating YSZ porous bodies with LSM precursor solution using inkjet printing, followed by annealing at 800°C for 2 hours. XRD analysis confirmed the formation of the LSM phase, which was in the form of nanoparticles with size in the 50-70 nm range on the YSZ walls, as revealed by FEG-SEM observations. The effect of printing parameters on the distribution of the impregnated phase was investigated and discussed.

  9. Impregnated cathode coated with tungsten thin film containing Sc2O3

    International Nuclear Information System (INIS)

    Yamamoto, S.; Taguchi, S.; Watanabe, I.; Kawase, S.

    1987-01-01

    An impregnated cathode of a novel structure is proposed, fabricated, and evaluated. A thin tungsten film 100--400 nm in thickness containing various amounts of Sc 2 O 3 is coated on a standard impregnated cathode composed of a porous tungsten body in which electron emissive materials are impregnated. The electron emission property measured with a diode configuration is found to be dependent on Sc 2 O 3 content and surface atom distribution. Surface atom distribution is depicted by means of Auger electron spectroscopy. For high electron emission enhancement it is necessary for Sc 2 O 3 content to be 2.5--6.5 wt. % and for a layer of the order of a monolayer in thickness composed of Ba, Sc, and O to develop on the cathode surface

  10. Characteristic of Polymer-Impregnated Cement Mortar: Composites: Bulk Density and Microstructure

    International Nuclear Information System (INIS)

    Younes, M.M.; Abo-El-Enein, S.A.; El-Saft, M.M.; Sadek, M.A.; Zohdy, K.M.

    2010-01-01

    The effect of radiation initiated polymerization of some monomers on the physical properties of polymer-incorporated mortar was studied. The monomers used were: castor oil (C.O.), 4, 4'-diphenylmethane diisocyanate (MDI) and methyl methacrylate (MMA). Polymerization was carried out by subjecting the monomer-impregnated mortar specimens to different doses of gamma radiation. Where polyurethane (pu) and polyurethane -methyl methacrylate copolymers were formed within the pore system. The influence of polymer impregnation on the various physico-mechanical characteristics of the resulting composites was studied with respect to bulk density and polymer loading. Scanning electron microscopy (SEM) was employed to study the micro-structural characteristics of the neat hardened Ordinary Portland Cement (OPC) mortar pastes and their polymer-impregnated composites

  11. Recent progress and tests of radiation resistant impregnation materials for Nb3Sn coils

    International Nuclear Information System (INIS)

    Bossert, R.; Krave, S.; Ambrosio, G.; Andreev, N.; Chlachidze, G.; Nobrega, A.; Novitski, I.; Yu, M.; Zlobin, A. V.

    2014-01-01

    Fermilab is collaborating with Lawrence Berkeley National Laboratory (LBNL) and Brookhaven National Laboratory (BNL) (US-LARP collaboration) to develop a large-aperture Nb 3 Sn superconducting quadrupole for the Large Hadron Collider (LHC) luminosity upgrade. An important component of this work is the development of materials that are sufficiently radiation resistant for use in critical areas of the upgrade. This paper describes recent progress in characterization of materials, including the baseline CTD101K epoxy, cyanate ester blends, and Matrimid 5292, a bismaleimide-based system. Structural properties of “ten stacks” of cable impregnated with these materials are tested at room and cryogenic temperatures and compared to the baseline CT-101K. Experience with potting 1 and 2 meter long coils with Matrimid 5292 are described. Test results of a single 1-m coil impregnated with Matrimid 5292 are reported and compared to similar coils impregnated with the traditional epoxy

  12. Antibiotic-Impregnated Bone Grafts in Orthopaedic and Trauma Surgery: A Systematic Review of the Literature

    Directory of Open Access Journals (Sweden)

    Konstantinos Anagnostakos

    2012-01-01

    Full Text Available There exist several options for local antibiotic therapy in orthopaedic and trauma surgery. Over the past years, the use of antibiotic-impregnated bone grafts (AIBGs has become a popular procedure in the treatment of bone and joint infections. A major advantage of AIBGs involves the possibility of impregnation of various antibiotics depending on the sensitivity profile of the causative organism, whereas an additional surgery with removal of the antibiotic carrier is not necessary, as in the use of antibiotic-loaded bone cement. However, generalized conclusions cannot be clearly drawn from the existing literature due to differences of bone used, impregnation method, antibiotics, their doses, laboratory circumstances, or clinical indications. The present work reviews the literature regarding this topic and sheds some light onto the choice of bone and antibiotics, manufacturing details, and clinical experience.

  13. Removal efficiency of radioactive methyl iodide on TEDA-impregnated activated carbons

    International Nuclear Information System (INIS)

    Gonzalez-Garcia, C.M.; Gonzalez, J.F.; Roman, S.

    2011-01-01

    Activated carbons were prepared by different series of carbon dioxide and steam activation from walnut shells for their optimal use as radioactive methyl iodide adsorbents in Nuclear Plants. The knowledge of the most favourable textural characteristics of the activated carbons was possible by the previous study of the commercial activated carbon currently used for this purpose. In order to increase their methyl iodide affinity, the effect of triethylenediamine impregnation was studied at 5 and 10 wt.%. The results obtained indicated that in both cases the adsorption efficiency is markedly improved by the addition of impregnant, which allows the adsorbate uptake to occur not only by physical adsorption, via non-specific interactions (as in non-impregnated carbons) but also by the specific interaction of triethylenediamine with radioactive methyl iodide. Methyl iodide retention efficiencies up to 98.1% were achieved. (author)

  14. Dielectric properties of transformer paper impregnated by mineral oil based magnetic fluid

    International Nuclear Information System (INIS)

    Timko, M; Marton, K; Tomco, L; Kopcansky, P; Koneracka, M

    2010-01-01

    The influence of combined magnetic and electric field on permittivity of transformer paper used in power transformers was observed. Transformer paper was impregnated by pure transformer oil ITO 100 and magnetic fluids based on transformer oil ITO 100 with different concentrations of magnetite nanoparticles. The measurements were carried out with help of high precision capacitance bridge. The electric intensity between circular planar electrodes was in the region of weak electric field (E > 10 6 V/m). The increase of electric permittivity of transformer paper impregnated by magnetic fluid opposite pure transformer paper was observed. The experiments showed that permittivity of insulator system consisting of pure transformer paper and impregnated transformer paper naturally depends on number of paper layers. The magnetodielectric effect was found to be dependent on magnetite nanoparticles concentration in magnetic fluids.

  15. Thick-target Pixe analysis of chromium, copper and arsenic impregnated lumber

    International Nuclear Information System (INIS)

    Saarela, K-E.; Harju, L.; Lill, J-O.; Rajander, J.; Lindroos, A.; Heselius, S-J.

    1999-01-01

    Chromium, copper and arsenic (CCA) have for decades been used for wood preservation. Of these elements especially arsenic is very toxic. As CCA impregnated wood is still today used for many construction purposes, a monitoring of these metal ions is of great environmental importance. Thick-target PIXE is a powerful method for the determination of trace metals in wood. The TTPIXE method enabled study of variations of the elemental concentrations in lumber treated with CCA impregnation solution. Distribution patterns were obtained for both naturally occurring elements and elements introduced in the treatment process. During the impregnation process a desorption of e.g. alkali metal ions takes place from the wood. The sensitivity of the method is improved by dry ashing of the samples prior to PIXE analysis. The TTPIXE method was calibrated and validated using international certified reference materials (CRM) based on wood material

  16. Pore structure, mechanical properties and polymer characteristics of porous materials impregnated with methylmethacrylate

    International Nuclear Information System (INIS)

    Hastrup, K.

    1976-05-01

    The pore structure of porous materials plays a decisive role with regard to many properties of the materials. One therefore expects property improvement due to impregnation to be mostly brought about as a result of pore structure modification. This supposition formed the basis for the project here presented, which had the main aim of investigating polymer impregnation in relation to pore structure. Objectives were: 1) to examine the pore structure of hardened cement paste, beech wood and porous glass before and after gas-phase impregnation with methyl-methacrylate monomer and in situ polymerization, 2) to investigate the influence of the pore structure on the molecular weight of the polymer, 3) to investigate the influence of the degree of pore filling on the elastic modulus, damping coefficient and bending strength. (author)

  17. Solvent impregnated resin for isolation of U(VI) from industrial wastes

    International Nuclear Information System (INIS)

    Karve, M.; Rajgor, R.V.

    2008-01-01

    A solid-phase extraction method based upon impregnation of Cyanex 302 (bis(2,4,4- trimethylpentyl)mono-thio-phosphinic acid) on Amberlite XAD-2 resin is proposed for isolation of U(VI) from uranmicrolite ore tailing samples and industrial effluent samples. U(VI) was sorbed from nitric acid media on the solvent-impregnated resin (SIR) and was recovered completely with 1.0 M HCl. Based upon sorption behavior of U(VI) with Cyanex 302, it was quantitatively sorbed on the SIR in a dynamic method, while the other metal ions were not sorbed by the modified resin. The preparation of impregnated resin is simple, based upon physical interaction of the extractant and solid support, has good sorption capacity for U(VI), and is also reliable for detection of traces of U(VI). (authors)

  18. Dielectric microwave absorbing material processed by impregnation of carbon fiber fabric with polyaniline

    Directory of Open Access Journals (Sweden)

    Luiza de Castro Folgueras

    2007-03-01

    Full Text Available It is a known fact that the adequate combination of components and experimental conditions may produce materials with specific requirements. This study presents the effect of carbon fiber fabric impregnation with polyaniline conducting polymer aiming at the radar absorbing material processing. The experiments consider the sample preparation with one and two impregnations. The prepared samples were evaluated by reflectivity measurements, in the frequency range of 8-12 GHz and scanning electron microscopy analyses. The correlation of the results shows that the quantity of impregnated material influences the performance of the processed microwave absorber. This study shows that the proposed experimental route provides flexible absorbers with absorption values of the incident radiation close to 87%.

  19. Insecticide-induced hormesis and arthropod pest management.

    Science.gov (United States)

    Guedes, Raul Narciso C; Cutler, G Christopher

    2014-05-01

    Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas. © 2013 Society of Chemical Industry.

  20. Radiation-curable impregnating agents for the conservation of archaeologic wooden objects. Part 2

    International Nuclear Information System (INIS)

    Schaudy, R.; Wendrinsky, J.; Kalteis, H.; Grienauer, W.

    1982-12-01

    As a continuation of the work described in OEFZS Ber. No. 4165, impregnating agents curable by ionizing radiation, such as free radical polymerizable monomers or artificial resins, have been investigated. Specific weight and viscosity of the liquid mixtures have been as well determined as the specific weight and gel content of the gamma radiation-cured samples. Hardness and elastic behaviour have been estimated only. The shrinkage during hardening was found to be 5 to 12 % for low viscous mixtures (up to 600 mPa.s) and 3 to 8 % for higher viscous impregnating agents. The results are to be discussed. (Author) [de

  1. Xe-133 recuperation by adsorption in active carbon impregnated with PF5

    International Nuclear Information System (INIS)

    Mondino, A.V.; Marques, R.O.

    1990-01-01

    Since the Mo-99 Fission Project has the aim to produce Xe-133 from gases generated in the alkaline dissolution of Al-U plates irradiated with thermal neutrons and, considering the importance of this radioisotope from the nuclear medicine point of view, studies to improve and optimize the Xe-133 recuperation were continued. Experiences were made on 'static' equilibrium employing high purity xenon and for the 'dynamic' case, Xe-133 mixed with a carrier and nitrogen as gas carrier; in this case, a 44% and a 34% increase in the capacity of xenon adsorption relaxed with activated carbon without being impregnated and impregnated with AgF, were respectively achieved. (Author) [es

  2. Conservation of waterlogged wood by freeze-drying and optional resin impregnation

    International Nuclear Information System (INIS)

    Schaudy, R.

    1987-09-01

    As a contribution to the 'International Comparative Study on Waterlogged Wood' (Grattan-Schweingruber-Project) of the ICOM Working Group on Waterlogged Organic Materials seven archaeological wood samples from sites in Canada, England, the Netherlands, Japan, Norway and Western Australia have been treated. The conservation process consisted of freeze-drying following a polyethylene glycol (PEG 400) treatment and - for fragile objects - of a resin impregnation using a radiation-curable impregnant and gamma radiation for curing. The results are discussed, however without paying regard to the other contributions to this international study. 20 refs., 3 tabs., 30 figs. (Author)

  3. A Binder Viscosity Effect on the Wet-Wounded Composite Porosity in the Impregnating Bath

    Directory of Open Access Journals (Sweden)

    M. A. Komkov

    2014-01-01

    Full Text Available The aim of this work is to define experimentally an impregnation rate of VM-1 glass fibers and CBM aramid bundles with the epoxy binder EDB-10 using wet method of winding. During the impregnation process of the fibrous fillers by the liquid binder, air is displaced from the interfiber space of fiber and bundle. With the composite product winding a fiber impregnation process is short. That is why gas inclusions or pores are formed in the polymer-fiber compositeThe impregnation rate or porosity of wound material will depend directly on the binder viscosity. To reduce an epoxy binder viscosity temporarily is possible by two ways. The first is to heat a liquid epoxy composition EDB-10 to the maximum possible temperature during the winding process of the product. The second method is to dilute the binder by a solvent, such as acetone or alcohol. However, the solvent reduces its strength.The paper presents experimental data to show the volumetric content of pores in the wound composite affected only by the viscosity of the epoxy binder. Heating a binder allowed us to regulate a changing conditional viscosity of the binder in the impregnating bath for the normal conditions of impregnation. Other impacts on the impregnation and filament-winding processes, such as filler kinks, squeeze, vacuuming binder, highly tensioned winding, and others were not used.Experimentally obtained dependences of the porosity value of wound composite on the conditional viscosity of binder are nonlinear and can be used to design heaters for impregnating devices of winders. The research technique and results can be used in development of technological processes to manufacture composite structures by winding from the other reinforcing fibrous fillers and thermo-active binders.The results show that the volumetric content of pores can significantly vary within 8 - 14 % of material volume. Therefore, to reduce the number of pores in the wound composite to 1-2 %, auxiliary

  4. Characterization of impregnated GDC nano structures and their functionality in LSM based cathodes

    DEFF Research Database (Denmark)

    Klemensø, Trine; Chatzichristodoulou, Christodoulos; Nielsen, Jimmi

    2012-01-01

    Porous composite cathodes of LSM–YSZ (lanthanum strontium manganite and yttria stabilized zirconia) were impregnated with GDC (gadolinia doped ceria) nano particles. The impregnation process was varied using none or different surfactants (Triton X-45, Triton X-100, P123), and the quantity...... on the LSM phase and the LSM grain boundaries. The observations suggest that the improved performance associated with GDC nano particles is related to the particles placed near the TPB (triple phase boundary) zone. The GDC extends the TPB by creating an ionic conducting network on top of the LSM particles...

  5. Comment on the mechanism of operation of the impregnated tungsten cathode

    Science.gov (United States)

    Forman, R.

    1979-01-01

    Recent life-test measurements, over 20,000-30,000 h, on impregnated tungsten cathodes in tubes employing an open-type electron-gun structure, show emission current degradation with time. This is in contrast to those recently published by Rittner on B-type cathodes, run in close-spaced diodes, taken some years ago. These more recent life-test results are consistent with the model suggested by Forman and disputed by Rittner that the barium coverage on an impregnated cathode is less than a monolayer for most of its life and decreases with time.

  6. A Combined Electro-Thermal Breakdown Model for Oil-Impregnated Paper

    Directory of Open Access Journals (Sweden)

    Meng Huang

    2017-12-01

    Full Text Available The breakdown property of oil-impregnated paper is a key factor for converter transformer design and operation, but it is not well understood. In this paper, breakdown voltages of oil-impregnated paper were measured at different temperatures. The results showed that with the increase of temperature, electrical, electro-thermal and thermal breakdown occurred successively. An electro-thermal breakdown model was proposed based on the heat equilibrium and space charge transport, and negative differential mobility was introduced to the model. It was shown that carrier mobility determined whether it was electrical or thermal breakdown, and the model can effectively explain the temperature-dependent breakdown.

  7. Electrochemical in-situ impregnation of wood using a copper nail as source for copper

    DEFF Research Database (Denmark)

    Ottosen, Lisbeth M.; Block, Thomas; Nymark, Morten

    2011-01-01

    A new method for copper impregnation of wood in structures was suggested and tested in laboratory scale with specimen of new pine sapwood. A copper nail and a steel screw were placed in the wood, and an electric direct current field was applied, so the copper nail was anode and the screw...... was cathode. At the anode, copper ions were generated. The copper ions were transported into the wood by electromigration (movement of ions in an applied electric field) towards the cathode, and a volume between the two electrodes was thereby impregnated. Copper also moved to a lesser degree in the opposite...

  8. Influence of impregnation by inorganic substances on the yield of pyrolysis products

    Energy Technology Data Exchange (ETDEWEB)

    Shevkoplyas, V N; Saranchuk, V I [AN Ukrainskoj SSR, Donetsk (Ukraine). Inst. Fiziko-Organicheskoj Khimii i Uglekhimii

    1998-09-01

    In papers was shown that fossil coals impregnation by aqueous solution of inorganic substances with a subsequent pyrolysis leads to the rise of the rate and depth of its organic mass destruction into liquid and gaseous products. This is, apperently, conditioned by changes in coals structure already on the stage of treatment. But, there are few papers that study an activating effect of inorganic reactants upon natural coals structure and their behaviour at pyrolysis. One of the methods which allows to judge structural transformation in coals at their impregnation by inorganic substances is an X-ray analysis. (orig.)

  9. Induced tolerance from a sublethal insecticide leads to cross-tolerance to other insecticides.

    Science.gov (United States)

    Hua, Jessica; Jones, Devin K; Relyea, Rick A

    2014-04-01

    As global pesticide use increases, the ability to rapidly respond to pesticides by increasing tolerance has important implications for the persistence of nontarget organisms. A recent study of larval amphibians discovered that increased tolerance can be induced by an early exposure to low concentrations of a pesticide. Since natural systems are often exposed to a variety of pesticides that vary in mode of action, we need to know whether the induction of increased tolerance to one pesticide confers increased tolerance to other pesticides. Using larval wood frogs (Lithobates sylvaticus), we investigated whether induction of increased tolerance to the insecticide carbaryl (AChE-inhibitor) can induce increased tolerance to other insecticides that have the same mode of action (chlorpyrifos, malathion) or a different mode of action (Na(+)channel-interfering insecticides; permethrin, cypermethrin). We found that embryonic exposure to sublethal concentrations of carbaryl induced higher tolerance to carbaryl and increased cross-tolerance to malathion and cypermethrin but not to chlorpyrifos or permethrin. In one case, the embryonic exposure to carbaryl induced tolerance in a nonlinear pattern (hormesis). These results demonstrate that that the newly discovered phenomenon of induced tolerance also provides induced cross-tolerance that is not restricted to pesticides with the same mode of action.

  10. Quantitative structure-activity relationship (QSAR) for insecticides: development of predictive in vivo insecticide activity models.

    Science.gov (United States)

    Naik, P K; Singh, T; Singh, H

    2009-07-01

    Quantitative structure-activity relationship (QSAR) analyses were performed independently on data sets belonging to two groups of insecticides, namely the organophosphates and carbamates. Several types of descriptors including topological, spatial, thermodynamic, information content, lead likeness and E-state indices were used to derive quantitative relationships between insecticide activities and structural properties of chemicals. A systematic search approach based on missing value, zero value, simple correlation and multi-collinearity tests as well as the use of a genetic algorithm allowed the optimal selection of the descriptors used to generate the models. The QSAR models developed for both organophosphate and carbamate groups revealed good predictability with r(2) values of 0.949 and 0.838 as well as [image omitted] values of 0.890 and 0.765, respectively. In addition, a linear correlation was observed between the predicted and experimental LD(50) values for the test set data with r(2) of 0.871 and 0.788 for both the organophosphate and carbamate groups, indicating that the prediction accuracy of the QSAR models was acceptable. The models were also tested successfully from external validation criteria. QSAR models developed in this study should help further design of novel potent insecticides.

  11. Efficacy, Safety and Cost of Insecticide Treated Wall Lining, Insecticide Treated Bed Nets and Indoor Wall Wash with Lime for Visceral Leishmaniasis Vector Control in the Indian Sub-continent: A Multi-country Cluster Randomized Controlled Trial

    Science.gov (United States)

    Das, Pradeep; Ghosh, Debashis; Priyanka, Jyoti; Matlashewski, Greg; Kroeger, Axel; Upfill-Brown, Alexander

    2016-01-01

    Background We investigated the efficacy, safety and cost of lime wash of household walls plus treatment of sand fly breeding places with bleach (i.e. environmental management or EM), insecticide impregnated durable wall lining (DWL), and bed net impregnation with slow release insecticide (ITN) for sand fly control in the Indian sub-continent. Methods This multi-country cluster randomized controlled trial had 24 clusters in each three sites with eight clusters per high, medium or low sand fly density stratum. Every cluster included 45–50 households. Five households from each cluster were randomly selected for entomological measurements including sand fly density and mortality at one, three, nine and twelve months post intervention. Household interviews were conducted for socioeconomic information and intervention acceptability assessment. Cost for each intervention was calculated. There was a control group without intervention. Findings Sand fly mortality [mean and 95%CI] ranged from 84% (81%-87%) at one month to 74% (71%-78%) at 12 months for DWL, 75% (71%-79%) at one month to 49% (43%-55%) at twelve months for ITN, and 44% (34%-53%) at one month to 22% (14%-29%) at twelve months for EM. Adjusted intervention effect on sand fly density measured by incidence rate ratio ranged from 0.28 (0.23–0.34) at one month to 0.62 (0.51–0.75) at 12 months for DWL; 0.72 (0.62–0.85) at one month to 1.02 (0.86–1.22) at 12 months for ITN; and 0.89 (0.76–1.03) at one months to 1.49 (1.26–1.74) at 12 months for EM. Household acceptance of EM was 74% compared to 94% for both DWL and ITN. Operational cost per household in USD was about 5, 8, and 2 for EM, DWL and ITN, respectively. Minimal adverse reactions were reported for EM and ITN while 36% of households with DWL reported transient itching. Interpretation DWL is the most effective, durable and acceptable control method followed by ITN. The Visceral Leishmaniasis (VL) Elimination Program in the Indian sub

  12. Insecticidal defenses of Piperaceae from the neotropics.

    Science.gov (United States)

    Bernard, C B; Krishanmurty, H G; Chauret, D; Durst, T; Philogène, B J; Sánchez-Vindas, P; Hasbun, C; Poveda, L; San Román, L; Arnason, J T

    1995-06-01

    Insecticidal and growth-reducing properties of extracts of 14 species of American neotropical Piperaceae were investigated by inclusion in diets of a polyphagous lepidopteran, the European corn borer,Ostrinia nubilalis. Nutritional indices suggested most extracts acted by postdigestive toxicity.Piper aduncum, P. tuberculatum, andP. decurrens were among the most active species and were subjected to bioassay-guided isolation of the active components. Dillapiol was isolated from the active fraction ofP. aduncum, piperlonguminine was isolated fromP. tuberculatum, and a novel neolignan fromP. decurrens. The results support other studies on Asian and AfricanPiper species, which suggest that lignans and isobutyl amides are the active defence compounds in this family.

  13. Insecticidal Constituents from Buddlej aalbiflora Hemsl.

    Science.gov (United States)

    Zhang, Xiu-Yun; Shen, Jing; Zhou, Yu; Wei, Zhi-Ping; Gao, Jin-Ming

    2017-06-01

    Eleven known compounds, deoxymikanolide (1), 1,3-dihydroxyxanthone (2), kumatakenin (3), apigenin (4), chrysin (5), kaempferol (6), Iso-kaempferol (7), luteolin (8), luteolin-3',4'-dimethylether-7-O-β-glucoside (9), luteolin-7-O-β-glucoside (10) and quercetin (11) were identified in MeOH extract of Buddleja albiflora Hemsl (Oleaceae). These compounds (each, 1, 0.5 and 0.25 mg mL -1 ) were tested for insecticidal activity against 3rd and 4th-instar larvae of Plutella xylostella, 3rd-instar larvae of Mythimna separata and 3rd-instar larvae of Macrosiphoniella sanborni. The lowest 50% anti-feedant concentration (AFC 50 ) against P. xylostella and 50% lethal concentration (LC 50 ) against P. xylostella and M. sanborni were observed as 0.0058, 0.0046 and 3.4048 mg L -1 , respectively.

  14. Insecticidal Activity of Cyanohydrin and Monoterpenoid Compounds

    Directory of Open Access Journals (Sweden)

    Joel R. Coats

    2000-04-01

    Full Text Available The insecticidal activities of several cyanohydrins, cyanohydrin esters and monoterpenoid esters (including three monoterpenoid esters of a cyanohydrin were evaluated. Topical toxicity to Musca domestica L. adults was examined, and testing of many compounds at 100 mg/fly resulted in 100% mortality. Topical LD50 values of four compounds for M. domestica were calculated. Testing of many of the reported compounds to brine shrimp (Artemia franciscana Kellog resulted in 100% mortality at 10 ppm, and two compounds caused 100% mortality at 1 ppm. Aquatic LC50 values were calculated for five compounds for larvae of the yellow fever mosquito (Aedes aegypti (L.. Monoterpenoid esters were among the most toxic compounds tested in topical and aquatic bioassays.

  15. Selective recovery of a pyridine derivative from an aqueous waste stream containing acetic acid and succinonitrile with solvent impregnated resins

    NARCIS (Netherlands)

    Bokhove, J.; Visser, T.J.; Schuur, Boelo; de Haan, A.B.

    2015-01-01

    Solvent impregnated resins (SIRs) were evaluated for the recovery of pyridine derivatives from an aqueous waste-stream containing also acetic acid and succinonitrile. For this purpose, a new solvent was developed, synthesized and impregnated in Amberlite XAD4. Sorption studies were used to determine

  16. The investigation of copper-based impregnated activated carbons prepared from water-soluble materials for broad spectrum respirator applications

    International Nuclear Information System (INIS)

    Smith, J.W.H.; Westreich, P.; Abdellatif, H.; Filbee-Dexter, P.; Smith, A.J.; Wood, T.E.; Croll, L.M.; Reynolds, J.H.; Dahn, J.R.

    2010-01-01

    The preparation of impregnated activated carbons (IACs) from aqueous, copper-containing solutions for broad spectrum gas filtration applications is studied here. Several samples were studied to determine the effect that impregnant loading, impregnant distribution and impregnant recipe had on the overall performance. Dynamic flow testing was used to determine the gas filtration capacity of the IAC samples versus a variety of challenge gases. X-ray diffraction (XRD), scanning electron microscopy (SEM) and energy dispersive X-ray analysis (EDX) were used to characterize the impregnant distribution on the carbon as a function of impregnant loading. Oven tests were performed to determine the thermal stability of the IAC samples exposed to elevated temperatures. The role impregnant distribution plays in gas filtration capacity and the overall performance of the IAC samples is discussed. The IAC samples prepared in this work were found to have gas filtration capacities as good as or better than broad spectrum respirator carbon samples prepared from the patent literature. IACs impregnated with an aqueous 2.4 M Cu(NO 3 ) 2 /0.04 M H 3 PO 4 .12MoO 3 /4 M HNO 3 solution that were heated to 200 deg. C under argon were found to have the best overall performance of the samples studied in this work.

  17. Determination of SO2 in the atmosphere using radioactive iodine kryptonate as impregnation medium of chromatographic paper

    International Nuclear Information System (INIS)

    Pruzinec, J.

    1975-01-01

    Chromatographic paper was impregnated with radioiodine kryptonate using the macrodiffusion technique. The decrease with time of the activity of the kryptonate-impregnated paper exposed to SO 2 -contaminated air was measured. From the decrease in chromatographic paper activity, the concentration of SO 2 was determined in the range 300 to 700 ppm. (A.K.)

  18. The investigation of copper-based impregnated activated carbons prepared from water-soluble materials for broad spectrum respirator applications

    Energy Technology Data Exchange (ETDEWEB)

    Smith, J.W.H.; Westreich, P.; Abdellatif, H.; Filbee-Dexter, P.; Smith, A.J. [Department of Physics and Atmospheric Science, Dalhousie University, Halifax, Nova Scotia, B3H 3J5 (Canada); Wood, T.E. [3M Company, St. Paul, MN, 55144 (United States); Croll, L.M.; Reynolds, J.H. [3M Canada Company, Brockville, Ontario, K6V 5V8 (Canada); Dahn, J.R., E-mail: jeff.dahn@dal.ca [Department of Physics and Atmospheric Science, Dalhousie University, Halifax, Nova Scotia, B3H 3J5 (Canada); Department of Chemistry, Dalhousie University, Halifax, Nova Scotia, B3H 4J3 (Canada)

    2010-08-15

    The preparation of impregnated activated carbons (IACs) from aqueous, copper-containing solutions for broad spectrum gas filtration applications is studied here. Several samples were studied to determine the effect that impregnant loading, impregnant distribution and impregnant recipe had on the overall performance. Dynamic flow testing was used to determine the gas filtration capacity of the IAC samples versus a variety of challenge gases. X-ray diffraction (XRD), scanning electron microscopy (SEM) and energy dispersive X-ray analysis (EDX) were used to characterize the impregnant distribution on the carbon as a function of impregnant loading. Oven tests were performed to determine the thermal stability of the IAC samples exposed to elevated temperatures. The role impregnant distribution plays in gas filtration capacity and the overall performance of the IAC samples is discussed. The IAC samples prepared in this work were found to have gas filtration capacities as good as or better than broad spectrum respirator carbon samples prepared from the patent literature. IACs impregnated with an aqueous 2.4 M Cu(NO{sub 3}){sub 2}/0.04 M H{sub 3}PO{sub 4}.12MoO{sub 3}/4 M HNO{sub 3} solution that were heated to 200 deg. C under argon were found to have the best overall performance of the samples studied in this work.

  19. Experimental data and boundary conditions for a Double-Skin Facade building in external air curtain mode

    DEFF Research Database (Denmark)

    Larsen, Olena Kalyanova; Heiselberg, Per; Jensen, Rasmus Lund

    Frequent discussions of double skin façade energy performance have started a dialogue about the methods, models and tools for simulation of double façade systems and reliability of their results. Their reliability will increase with empirical validation of the software. Detailed experimental work...... was carried out in a full scale test facility ‘The Cube’, in order to compile three sets of high quality experimental data for validation purposes. The data sets are available for preheating mode, external air curtain mode and transparent insulation mode. The objective of this article is to provide the reader......’. This covers such problem areas as measurements of naturally induced air flow, measurements of air temperature under direct solar radiation exposure, etc. Finally, in order to create a solid foundation for software validation, the uncertainty and limitations in the experimental results are discussed. In part...

  20. Experimental analysis of the thermal entrainment factor of air curtains in vertical open display cabinets for different ambient air conditions

    International Nuclear Information System (INIS)

    Gaspar, Pedro Dinis; Carrilho Goncalves, L.C.; Pitarma, R.A.

    2011-01-01

    The vertical open refrigerated display cabinets suffer alterations of their thermal performance and energy efficiency due to variations of ambient air conditions. The air curtain provides an aerothermodynamics insulation effect that can be evaluated by the thermal entrainment factor calculation as an engineering approximation or by the calculus of all sensible and latent thermal loads. This study presents the variation of heat transfer rate and thermal entrainment factor obtained through experimental tests carried out for different ambient air conditions, varying air temperature, relative humidity, velocity and its direction relatively to the display cabinet frontal opening. The thermal entrainment factor are analysed and compared with the total sensible and latent heats results for the experimental tests. From an engineering point of view, it is concluded that thermal entrainment factor cannot be used indiscriminately, although its use is suitable to design better cabinet under the same climate class condition.

  1. Impregnation of cinnamaldehyde into cassava starch biocomposite films using supercritical fluid technology for the development of food active packaging.

    Science.gov (United States)

    de Souza, Ana Cristina; Dias, Ana M A; Sousa, Hermínio C; Tadini, Carmen C

    2014-02-15

    In this work, supercritical solvent impregnation (SSI) has been tested for the incorporation of natural compounds into biocomposite materials for food packaging. Cinnamaldehyde, with proved antimicrobial activity against fungi commonly found in bread products, was successfully impregnated on biocomposite cassava starch based materials using supercritical carbon dioxide as solvent. Different process experimental conditions were tested (pressure, impregnation time and depressurization rate) at a fixed temperature (35 °C) in order to study their influence on the amount of impregnated cinnamaldehyde as well as on the morphology of the films. Results showed that all conditions permitted to impregnate antimicrobial active amounts superior to those previously obtained using conventional incorporation methods. Moreover, a significant decrease of the equilibrium water vapor sorption capacity and water vapor permeability of the films was observed after SSI processing which is a clear advantage of the process, considering the envisaged applications. Copyright © 2013 Elsevier Ltd. All rights reserved.

  2. Teenage organophosphate insecticide poisoning: An ugly trend in ...

    African Journals Online (AJOL)

    UNIBEN

    is worsened by uncontrolled sale of organophosphorus insecticides on the streets and in open markets. We report ..... Nicotinic activity results in autonomic nervous system .... optimize outcome.23 Oximes are cholinesterase re-activators used ...

  3. Gas Chromaotography-Mass Spectrometry Analysis of Insecticidal ...

    African Journals Online (AJOL)

    Insecticidal Essential Oil Derived from Chinese Ainsliaea fragrans Champ ex Benth ... Methods: The essential oil of A. fragrans aerial parts was obtained by hydrodistillation and analyzed by ..... toxicity than the crude oil. Caryophyllene showed.

  4. Scepticism towards insecticide treated mosquito nets for malaria ...

    African Journals Online (AJOL)

    Scepticism towards insecticide treated mosquito nets for malaria control in rural ... especially among under-five year children and pregnant women in poor rural ... through social marketing strategy for malaria control prior to the introduction of ...

  5. Design, Synthesis and Insecticidal Activity of Novel Phenylurea Derivatives

    Directory of Open Access Journals (Sweden)

    Jialong Sun

    2015-03-01

    Full Text Available A series of novel phenylurea derivatives were designed and synthesized according to the method of active groups linkage and the principle of aromatic groups bioisosterism in this study. The structures of the novel phenylurea derivatives were confirmed based on ESI-MS, IR and 1H-NMR spectral data. All of the compounds were evaluated for the insecticidal activity against the third instars larvae of Spodoptera exigua Hiibner, Plutella xyllostella Linnaeus, Helicoverpa armigera Hubner and Pieris rapae Linne respectively, at the concentration of 10 mg/L. The results showed that all of the derivatives displayed strong insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, chlorbenzuron and metaflumizone. Among the synthesized compounds, 3b, 3d, 3f, 4b and 4g displayed broad spectrum insecticidal activity.

  6. Neurotoxicological effects and the mode of action of pyrethroid insecticides

    NARCIS (Netherlands)

    Vijverberg, H.P.M.; Bercken, Joep van den

    1990-01-01

    Neuroexcitatory symptoms of acute poisoning of vertebrates by pyrethroids are related to the ability of these insecticides to modify electrical activity in various parts of the nervous system. Repetitive nerve activity, particularly in the sensory nervous system, membrane depolarization, and

  7. Effect of natural and chemical insecticides on Hyalopterus pruni and ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-06-17

    Jun 17, 2008 ... Anthmis pseudocotula and their mixtures with chemical insecticide (Malathion) on growth of ... ed the use of natural extracts of Fagonia arabica, Salix ..... Studies on the efficacy of neem products against the aphid Aphis.

  8. Process optimization and insecticidal activity of alkaloids from the ...

    African Journals Online (AJOL)

    Process optimization and insecticidal activity of alkaloids from the root bark of Catalpa ovata G. Don by response surface methodology. ... Tropical Journal of Pharmaceutical Research. Journal Home · ABOUT THIS JOURNAL · Advanced ...

  9. Insect P450 inhibitors and insecticides: challenges and opportunities.

    Science.gov (United States)

    Feyereisen, René

    2015-06-01

    P450 enzymes are encoded by a large number of genes in insects, often over a hundred. They play important roles in insecticide metabolism and resistance, and growing numbers of P450 enzymes are now known to catalyse important physiological reactions, such as hormone metabolism or cuticular hydrocarbon synthesis. Ways to inhibit P450 enzymes specifically or less specifically are well understood, as P450 inhibitors are found as drugs, as fungicides, as plant growth regulators and as insecticide synergists. Yet there are no P450 inhibitors as insecticides on the market. As new modes of action are constantly needed to support insecticide resistance management, P450 inhibitors should be considered because of their high potential for insect selectivity, their well-known mechanisms of action and the increasing ease of rational design and testing. © 2014 Society of Chemical Industry.

  10. Gas Chromatography-Mass Spectrometric Analysis and Insecticidal ...

    African Journals Online (AJOL)

    HP

    Original Research Article. Gas Chromatography-Mass Spectrometric Analysis and ... into a natural fumigant/insecticide for the control of stored product insects. Keywords: Mallotus ..... stability as well as reduce cost. ACKNOWLEDGEMENT.

  11. Gas Chromatography-Mass Spectrometric Analysis and Insecticidal ...

    African Journals Online (AJOL)

    Tropical Journal of Pharmaceutical Research ... apelta aerial parts was analyzed by gas chromatography/mass spectrometric (GC/MS) to determine its composition. ... into a natural fumigant/insecticide for the control of stored product insects.

  12. Federal Insecticide, Fungicide, and Rodenticide Act Section 18 Database

    Data.gov (United States)

    U.S. Environmental Protection Agency — Section 18 of Federal Insecticide, Fungicide, and Rodenticide Act (FIFRA) authorizes EPA to allow an unregistered use of a pesticide for a limited time if EPA...

  13. PRN 73-4: Residual Insecticides in Food Handling Establishments

    Science.gov (United States)

    This notice provides a copy of a Federal Register notice published July 6, 1973, regarding certain insecticides used in food-handling establishments. It establishes certain definitions and requirements related to approval for crack and crevice treatment.

  14. Log bioassay of residual effectiveness of insecticides against bark beetles

    Science.gov (United States)

    Richard H. Smith

    1982-01-01

    Residual effectiveness of nine insecticides applied to bark was tested against western, mountain, and Jeffrey pine beetles. Ponderosa and Jeffrey pine trees were treated and logs cut from them 2 to 13 months later, and bioassayed with the three beetles. The insecticides were sprayed at the rate of 1 gal (3.8 l) per 40- or 80-ft² (3.6 or 7.2 m²) bark surface at varying...

  15. The use of insecticides to control insect pests

    OpenAIRE

    M Wojciechowska; P Stepnowski; M Gołębiowski

    2016-01-01

    Pesticides are used as plants protection products. Among those, insecticides serve as agents to control insects. When incorrectly applied, however these substances may negatively affect people's health and natural environment. Administration routes of insecticides depend on many factors and vary from spraying to fertilizers. These different methods influence how insects prey and how pests develop. Additionally, too frequent use of the same chemicals can lead to development of resi...

  16. Insecticidal activity of Trichilia claussenii (Meliaceae) fruits against Spodoptera frugiperda

    International Nuclear Information System (INIS)

    Nebo, Liliane; Matos, Andrea Pereira; Vieira, Paulo Cezar; Fernandes, Joao Batista; Silva, Maria Fatima das Gracas Fernandes da; Rodrigues, Ricardo Ribeiro

    2010-01-01

    An evaluation of the insecticidal activity of the fruits extracts of Trichilia claussenii was carried out and the methanol extract revealed to have strong insecticidal activity. The fractionation of methanol extract of T. claussenii seeds bioassay-guided against Spodoptera frugiperda has led to the identification of the ω-phenylalkyl and alkenyl fatty acids as active compounds in this extract. The structures of the compounds were proposed by spectroscopic analysis and comparison with literature data. (author)

  17. Organochlorine insecticide poisoning in Golden Langurs Trachypithecus geei

    Directory of Open Access Journals (Sweden)

    D.C. Pathak

    2011-07-01

    Full Text Available Organochlorine insecticide poisoning was recorded in three Golden Langurs (Trachypithecus geei in Chakrashila Wildlife Sanctuary (CWS in Kokrajhar district of Assam during the month of December, 2008. The poisoning was due to prolonged ingestion of rubber plant leaves sprayed with the insecticide in a rubber plantation adjacent to the sanctuary. Though no specific gross lesions were observed, histopathologically, centilobular hepatic necrosis, mild renal degeneration, necrotic enteritis, pulmonary congestion and neuronal degeneration were recorded in all three animals.

  18. Plant compounds insecticide activity against Coleoptera pests of stored products

    OpenAIRE

    MOREIRA, M.D.; PICANÇO, M.C.; BARBOSA, L.C. de A.; GUEDES, R.N.C.; CAMPOS, M.R. de; SILVA, G.A.; MARTINS, J.C.

    2008-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed...

  19. The Effects of Natural Weathering on Color Stability of Impregnated and Varnished Wood Materials

    Directory of Open Access Journals (Sweden)

    Turkay Turkoglu

    2015-01-01

    Full Text Available The aim of this study was to investigate effects of natural weathering on color stability of Scots pine (Pinus sylvestris L. and Oriental beech (Fagus orientalis L. impregnated with some chemicals [tanalith-E (TN-E, adolit-KD5 (AD-KD5, and chromated copper arsenate (CCA] and then varnished [synthetic varnish (SV and polyurethane varnish (PV]. While applying varnish increased lightness, impregnation decreased lightness of the wood specimens before natural weathering. Natural weathering caused greenish, bluish, and dark color tones of the wood surface. Total color change was increased with increasing exposure times in natural weathering. Untreated (control wood specimens exhibited higher color changes than the other wood specimens in all the stages of natural weathering. The total color changes of untreated Oriental beech specimens were less than untreated Scots pine specimens. The color stability of impregnated and varnished wood specimens gave better results than untreated and solely varnished wood specimens after natural weathering. The best color stability was obtained from both Oriental beech and Scots pine wood impregnated with TN-E before PV coating.

  20. Phosphate adsorption on aluminum-impregnated mesoporous silicates : surface structure and behavior of adsorbents

    Science.gov (United States)

    Eun Woo Shin; James S. Han; Min Jang; Soo-Hong Min; Jae Kwang Park; Roger M. Rowell

    2004-01-01

    Phosphorus from excess fertilizers and detergents ends up washing into lakes, creeks, and rivers. This overabundance of phosphorus causes excessive aquatic plant and algae growth and depletes the dissolved oxygen supply in the water. In this study, aluminum-impregnated mesoporous adsorbents were tested for their ability to remove phosphate from water. The surface...

  1. 3D Imaging of Water-Drop Condensation on Hydrophobic and Hydrophilic Lubricant-Impregnated Surfaces

    Science.gov (United States)

    Kajiya, Tadashi; Schellenberger, Frank; Papadopoulos, Periklis; Vollmer, Doris; Butt, Hans-Jürgen

    2016-04-01

    Condensation of water from the atmosphere on a solid surface is an ubiquitous phenomenon in nature and has diverse technological applications, e.g. in heat and mass transfer. We investigated the condensation kinetics of water drops on a lubricant-impregnated surface, i.e., a micropillar array impregnated with a non-volatile ionic liquid. Growing and coalescing drops were imaged in 3D using a laser scanning confocal microscope equipped with a temperature and humidity control. Different stages of condensation can be discriminated. On a lubricant-impregnated hydrophobic micropillar array these are: (1) Nucleation on the lubricant surface. (2) Regular alignment of water drops between micropillars and formation of a three-phase contact line on a bottom of the substrate. (3) Deformation and bridging by coalescence which eventually leads to a detachment of the drops from the bottom substrate. The drop-substrate contact does not result in breakdown of the slippery behaviour. Contrary, on a lubricant-impregnated hydrophilic micropillar array, the condensed water drops replace the lubricant. Consequently, the surface loses its slippery property. Our results demonstrate that a Wenzel-like to Cassie transition, required to maintain the facile removal of condensed water drops, can be induced by well-chosen surface hydrophobicity.

  2. Field emission characteristics of SnO2/CNT composite prepared by microwave assisted wet impregnation

    CSIR Research Space (South Africa)

    Kesavan Pillai, Sreejarani

    2012-01-01

    Full Text Available SnO2/CNT composites were prepared by microwave assisted wet impregnation at 60 °C. The process was optimized by varying the microwave power and reaction time. Raman analysis showed the typical features of the rutile phase of as-synthesized SnO2...

  3. Investigation of the Acoustic Properties of Chemically Impregnated Kayu Malam Wood Used for Musical Instrument

    Directory of Open Access Journals (Sweden)

    Md. Faruk Hossen

    2018-01-01

    Full Text Available The chemical modification or impregnation through preparing the wood polymer composites (WPCs can effectively reduce the hygroscopicity as well as can improve the acoustic properties of wood. On the other hand, a small amount of nanoclay into the chemical mixture can further improve the different properties of the WPCs through the preparation of wood polymer nanocomposites (WPNCs. Kayu Malam wood species with styrene (St, vinyl acetate (VA, and montmorillonite (MMT nanoclay were used for the preparation of WPNCs. The acoustic properties such as specific dynamic Young’s modulus (Ed/γ, internal friction (Q−1, and acoustic conversion efficiency (ACE of wood were examined using free-free flexural vibration. It was observed that the chemically impregnated wood composite showed a higher value of Ed/γ than raw wood and the nanoclay-loaded wood nanocomposite showed the highest value. The reverse trend was observed in the case of Q−1. On the other hand, chemical impregnation has a minor effect on ACE of wood for musical instruments. The results suggested that the chemically impregnated Kayu Malam wood polymer nanocomposite (WPNC is suitable for making soundboards of violin and guitar instruments to be played longer without losing tone quality.

  4. Moisture effect on the dielectric response and space charge behaviour of mineral oil impregnated paper insulation

    International Nuclear Information System (INIS)

    Hao Jian; Liao Ruijin; Chen, George

    2011-01-01

    Dielectric response and space charge behaviour of oil-paper insulation sample with different moisture contents were investigated using the frequency dielectric spectroscopy (FDS) and the pulsed electroacoustic (PEA) technique, respectively. The influence of moisture on the dielectric response and space charge behaviour of oil impregnated paper insulation was analysed. Results show that the moisture has great effect on the FDS and space charge behaviour of oil impregnated paper insulation. In the frequency range of 10 -2 ∼10 6 Hz, the conductivity and the capacitance of oil impregnated paper increases with its moisture content. The space charge distribution of oil-paper sample with lower and higher moisture contents is very different from each other. The higher the moisture concentration of the oil impregnated paper, the easier the negative charge penetration into the insulation paper. There is a significant amount of positive charge accumulated at the paper-paper interface near to the cathode for oilpaper sample with lower moisture content. However, the positive charge appears in the middle layer paper for oil-paper sample with higher moisture content. Due to the high conductivity, the charge trapped in the oil-paper sample with higher moisture content disappears much faster than that in the oil-paper sample with lower moisture content after removing the voltage.

  5. Process for making 90 degree K. superconductors by impregnating cellulosic article with precursor solution

    International Nuclear Information System (INIS)

    Bolt, J.D.; Subramanian, M.A.

    1991-01-01

    This patent describes an improved process for preparing a shaped article of a superconducting composition having the formula MBa 2 Cu 3 O x wherein; M is selected from the group consisting of Y, Nd, Sm, Eu, Gd, Dy, Ho, Er, Tm, Yb and Lu; x is from about 6.5 to about 7.0; the composition having a superconducting transition temperature of about 90 K. It comprises: forming in acetic acid a mixture of M(C 2 H 3 O 2 ) 3 , barium acetate and copper acetate in an atomic ratio of M:Ba:Cu of about 1:2:3; heating the resulting mixture to boiling, and adding sufficient formic acid to dissolve any undissolved starting material while continuing to boil the solution; contacting an article of cellulose material with the solution thereby impregnating the article with the solution, the article having the shape desired; removing excess solution from the resulting impregnated article of cellulose material and drying the impregnated article; heating the impregnated article of cellulose material to a temperature from about 850 degree C to about 925 degree C in an oxygen-containing atmosphere for a time sufficient to form MBa 2 Cu 3 O y , where y is from about 6.0 to about 6.5, the heating effecting carbonization of the cellulose material and oxidization of carbon without ignition; and maintaining the resulting article in an oxygen-containing atmosphere while cooling for a time sufficient to obtained the desired product

  6. Conservation of a medieval climbing stem by freeze-drying and resin impregnation

    International Nuclear Information System (INIS)

    Schaudy, R.; Slais, E.; Eibner, C.

    1985-12-01

    The conservation of a climbing stem originating from a medieval mining adit is described. The fragile wet object was preserved by a combined process consisting of freeze-drying after a polyethylene glycol bath and consecutive resin impregnation with curing by gamma irradiation. The whole conservation process took 1 year. The result is discussed. (Author)

  7. Swelling kinetics and impregnation of PLA with thymol under supercritical CO2 conditions

    Directory of Open Access Journals (Sweden)

    Milovanović Stoja L.

    2016-01-01

    Full Text Available The present work was aimed to study swelling kinetics of polylactic acid (PLA and its impregnation with thymol in supercritical carbon dioxide (scCO2 medium. The influences of temperature and soaking time on the swelling kinetics and impregnation yield of PLA cylindrical disc and film were investigated. Swelling experiments were performed in a high pressure view cell at 10 MPa and temperatures of 40°C, 60°C and 75°C for 2 to 24 h. On the basis of swelling kinetics, pressure of 10 MPa and temperature of 40°C were chosen for supercritical solvent impregnation (SSI of the PLA samples during 2 to24 h. The highest swelling extent was observed for the PLA monolith after 24 h treatment with pure scCO2 (7.5% and scCO2 with thymol (118.3%. It was shown that sufficiently high amount of thymol can be loaded into both PLA monolith and film using SSI after only 2 h (10.0% and 6.6%, respectively. Monolith and film of PLA impregnated with thymol could be suitable for active food packaging and sterile medical disposables.

  8. Bacterial Adhesion Forces to Ag-Impregnated Contact Lens Cases and Transmission to Contact Lenses

    NARCIS (Netherlands)

    Qu, Wenwen; Busscher, Henk J.; van der Mei, Henny C.; Hooymans, Johanna M. M.

    Purpose: To measure adhesion forces of Pseudomonas aeruginosa, Staphylococcus aureus, and Serratia marcescens to a rigid contact lens (CL), standard polypropylene, and Ag-impregnated lens cases using atomic force microscopy and determine bacterial transmission from lens case to CL. Methods: Adhesion

  9. Fast, versatile x-ray fluorescence method for measuring tin in impregnated wood

    DEFF Research Database (Denmark)

    Drabæk, I.; Christensen, Leif Højslet

    1985-01-01

    The present paper describes an energy-dispersive x-ray fluorescence method for measuring tin in bis(tri-n-butyl)tin-oxide impregnated wood. The proposed method is of the backscatter/fundamental parameter type. Its versatility, precision, and accuracy is demonstrated by analyses of eleven samples...

  10. Anti-triatomine saliva immunoassays for the evaluation of impregnated netting trials against Chagas disease transmission

    Czech Academy of Sciences Publication Activity Database

    Schwarz, Alexandra; Juarez, J. A.; Richards, J.; Rath, B.; Machaca, V. Q.; Castro, Y. E.; Málaga, E. S.; Levy, K.; Gilman, R. H.; Bern, C.; Verastegui, M.; Levy, M. Z.

    2011-01-01

    Roč. 41, č. 6 (2011), s. 591-594 ISSN 0020-7519 R&D Projects: GA ČR GPP302/11/P798 Institutional research plan: CEZ:AV0Z60220518 Keywords : Triatoma infestans * Impregnated net * Sentinel guinea pig * Saliva * Antibody response Subject RIV: EC - Immunology Impact factor: 3.393, year: 2011

  11. Clinical evaluation of a PHMB-impregnated biocellulose dressing on paediatric lacerations

    NARCIS (Netherlands)

    Elzinga, G.; van Doorn, J.; Wiersema, A. M.; Klicks, R. J.; Andriessen, A.; Alblas, J. G.; Spits, H.; Post, A.; van Gent, M.

    2011-01-01

    Objective: To evaluate the clinical benefits, primarily tolerability and reduction in pain levels, associated with the use of a PHMB-impregnated biosynthetic cellulose dressing (Suprasorb X + PHMB) on paediatric heel lacerations. Method: These lacerations were caused when children, who were being

  12. Catalytic flash pyrolysis of oil-impregnated-wood and jatropha cake using sodium based catalysts

    NARCIS (Netherlands)

    Ali Imran, A.; Bramer, Eduard A.; Seshan, Kulathuiyer; Brem, Gerrit

    2016-01-01

    Catalytic pyrolysis of wood with impregnated vegetable oil was investigated and compared with catalytic pyrolysis of jatropha cake making use of sodium based catalysts to produce a high quality bio-oil. The catalytic pyrolysis was carried out in two modes: in-situ catalytic pyrolysis and post

  13. In situ processing of concrete surface by impregnation and polymerization of an organic resin

    International Nuclear Information System (INIS)

    Pellecchia, V.; Ursella, P.; Moretto, G.

    1990-01-01

    The impregnation by resins of concrete structures is widely known as PIC (Polymer Impregnated Concrete). This process is normally used to improve the physical-chemical features of prefabricated items in particular to raise their lifetime under severe environmental conditions. The main target of this research contract was the verification of the possibility of a proper impregnation of existing concrete surfaces, of any dimensions and position, by comparing the obtained characteristics with those of untreated original material to check the improvement of chemical-physical properties and durability. In a nuclear facility, this goal is very important with reference to the long-term integrity of concrete walls during plant operative lifetime and after the final shutdown and decommissioning of the plant, if its dismantling is deferred. The operative steps of the research were the design, manufacturing and implementation of a tailored prototype equipment, the setting-up of the machine, the project and erection of a walling unit made of different density sectors in nuclear grade concrete and optimisation of the PIC process phases (dehydration, degassing, monomer injection, thermal cycles) during the experimental campaign. The data collected from samples gathered from field application gave results very similar to laboratory impregnated samples, thus confirming the satisfactory running of the prototype unit. Particularly the resin penetration, in spite of low porosity of nuclear grade concrete matrix, reached depths well beyond 50 mm with a significant increase of mechanical features, leaching resistance to aggressive agents and an appreciable sealing of concrete porosity

  14. Impregnation of β-​tricalcium phosphate robocast scaffolds by in situ polymerization

    NARCIS (Netherlands)

    Martinez-Vazquez, F.J.; Perera, F.H.; Meulen, van der I.; Heise, A.; Pajares, A.; Miranda, P.

    2013-01-01

    Ring-¿opening polymn. of e-¿caprolactone (e-¿CL) and L-¿lactide (LLA) was performed to impregnate ß-¿tricalcium phosphate (ß-¿TCP) scaffolds fabricated by robocasting. Concd. colloidal inks prepd. from ß-¿TCP com. powders were used to fabricate porous structures consisting of a 3D mesh of

  15. Impregnated membranes for direct methanol fuel cells at high methanol concentrations

    NARCIS (Netherlands)

    Yildirim, M.H.; Schwarz, Alexander; Stamatialis, Dimitrios; Wessling, Matthias

    2009-01-01

    Sulfonated poly(phthalazinone ether ketone) (SPPEK) impregnated Solupor® microporous film (SPPEK–PE) and pure SPPEK membranes with two different ion-exchange capacities (IECs) were prepared and characterized for use in DMFC applications. Swelling, proton conductivity, diffusion and DMFC experiments

  16. Ecological risks of an old wood impregnation mill: application of the triad approach.

    NARCIS (Netherlands)

    Karjalainen, A.-M.; Kilpi-Koski, J.; Väisänen, A.O.; Penttinen, S.; van Gestel, C.A.M.; Penttinen, O.-P.

    2009-01-01

    Although many studies deal with the distribution and mobility of chromated copper arsenate (CCA) metals in soil, the ecotoxicity of CCA-contaminated soils is rarely studied. The Triad approach was applied to determine the ecological risks posed by a CCA mixture at a decommissioned wood impregnation

  17. Iron oxide impregnated filter paper (Pi test): a review of its development and methodological research

    NARCIS (Netherlands)

    Chardon, W.J.; Menon, R.G.; Chien, S.H.

    1996-01-01

    Iron oxide impregnated filter paper (FeO paper) has been used to study the availability of phosphorus (P) to plants and algae, P desorption kinetics and P dynamics in the field. Since its initial development a number of differences in the method of preparation of the paper and its application have

  18. Anti-biofilm and cytotoxicity activity of impregnated dressings with silver nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Velázquez-Velázquez, Jorge Luis [Laboratorio de Microbiología, Facultad de Ciencias Químicas, UASLP (Mexico); Santos-Flores, Andrés; Araujo-Meléndez, Javier [Servicio de Epidemiología del Hospital Central “Dr. Ignacio Morones Prieto”, San Luis Potosí (Mexico); Sánchez-Sánchez, Roberto; Velasquillo, Cristina [Laboratorio de Biotecnología, Instituto Nacional de Rehabilitación (Mexico); González, Carmen [Laboratorio de Fisiología Celular, Facultad de Ciencias Químicas, UASLP (Mexico); Martínez-Castañon, Gabriel [Maestría en Ciencias Odontológicas Facultad de Estomatología, UASLP (Mexico); Martinez-Gutierrez, Fidel, E-mail: fidel@uaslp.mx [Laboratorio de Microbiología, Facultad de Ciencias Químicas, UASLP (Mexico)

    2015-04-01

    Infections arising from bacterial adhesion and colonization on chronic wounds are a significant healthcare problem. Silver nanoparticles (AgNPs) impregnated in dressing have attracted a great deal of attention as a potential solution. The goal of the present study was to evaluate the anti-biofilm activities of AgNPs impregnated in commercial dressings against Pseudomonas aeruginosa, bacteria isolated of chronic wounds from a hospital patient. The antimicrobial activity of AgNPs was tested within biofilms generated under slow fluid shear conditions using a standard bioreactor. A 2-log reduction in the number of colony-forming units of P. aeruginosa was recorded in the reactor on exposure to dressing impregnated with 250 ppm of AgNPs, diameter 9.3 ± 1.1 nm, and also showed compatibility to mammalian cells (human fibroblasts). Our study suggests that the use of dressings with AgNPs may either prevent or reduce microbial growth in the wound environment, and reducing wound bioburden may improve wound-healing outcomes. - Highlights: • Biological activities of silver nanoparticles for wound-healing purposes • Characterization of the silver nanoparticles impregnated in dressings • Reduction in the P. aeruginosa biofilm formation was statistically significant. • Compatibility to human dermal fibroblasts as the main cell type involved in the reparation • AgNPs covering the surfaces would provide great potential for prevention and treatment.

  19. Anti-biofilm and cytotoxicity activity of impregnated dressings with silver nanoparticles

    International Nuclear Information System (INIS)

    Velázquez-Velázquez, Jorge Luis; Santos-Flores, Andrés; Araujo-Meléndez, Javier; Sánchez-Sánchez, Roberto; Velasquillo, Cristina; González, Carmen; Martínez-Castañon, Gabriel; Martinez-Gutierrez, Fidel

    2015-01-01

    Infections arising from bacterial adhesion and colonization on chronic wounds are a significant healthcare problem. Silver nanoparticles (AgNPs) impregnated in dressing have attracted a great deal of attention as a potential solution. The goal of the present study was to evaluate the anti-biofilm activities of AgNPs impregnated in commercial dressings against Pseudomonas aeruginosa, bacteria isolated of chronic wounds from a hospital patient. The antimicrobial activity of AgNPs was tested within biofilms generated under slow fluid shear conditions using a standard bioreactor. A 2-log reduction in the number of colony-forming units of P. aeruginosa was recorded in the reactor on exposure to dressing impregnated with 250 ppm of AgNPs, diameter 9.3 ± 1.1 nm, and also showed compatibility to mammalian cells (human fibroblasts). Our study suggests that the use of dressings with AgNPs may either prevent or reduce microbial growth in the wound environment, and reducing wound bioburden may improve wound-healing outcomes. - Highlights: • Biological activities of silver nanoparticles for wound-healing purposes • Characterization of the silver nanoparticles impregnated in dressings • Reduction in the P. aeruginosa biofilm formation was statistically significant. • Compatibility to human dermal fibroblasts as the main cell type involved in the reparation • AgNPs covering the surfaces would provide great potential for prevention and treatment

  20. Operating features of decorative polymer-impregnated concretes under severe operating conditions

    International Nuclear Information System (INIS)

    Kapustina, I.B.; Lobasenok, V.A.; Yakimtsiv, V.P.

    1991-01-01

    The study was carried out to investigate the possibility of a decorative polymer-impregnated concrete as a lining material in radiation-endangered rooms. Their extreme properties such as radiation resistance, decontamination ability, fire resistance and melting-freezing cycle resistance were studied. The material proposed shows substantially high resistance under severe operating conditions

  1. The sampling of hydrogen fluoride in air with impregnated filter paper

    NARCIS (Netherlands)

    Huygen, C.

    1963-01-01

    A method isproposed for the quantitative collection of hydrogen fluoride in air by drawing a known quantity of the air through filter paper impregnated with solutions of potassium hydroxide and glycerol or triethanolamine. Somu possibilities and limitations of the method are discussed.

  2. Moisture effect on the dielectric response and space charge behaviour of mineral oil impregnated paper insulation

    Energy Technology Data Exchange (ETDEWEB)

    Hao Jian; Liao Ruijin [State Key Laboratory of Power Transmission Equipment and System Security and New Technology, Chongqing University (China); Chen, George, E-mail: jh210v@ecs.soton.ac.uk [School of Electronics and Computer Science, University of Southampton (United Kingdom)

    2011-08-12

    Dielectric response and space charge behaviour of oil-paper insulation sample with different moisture contents were investigated using the frequency dielectric spectroscopy (FDS) and the pulsed electroacoustic (PEA) technique, respectively. The influence of moisture on the dielectric response and space charge behaviour of oil impregnated paper insulation was analysed. Results show that the moisture has great effect on the FDS and space charge behaviour of oil impregnated paper insulation. In the frequency range of 10{sup -2}{approx}10{sup 6}Hz, the conductivity and the capacitance of oil impregnated paper increases with its moisture content. The space charge distribution of oil-paper sample with lower and higher moisture contents is very different from each other. The higher the moisture concentration of the oil impregnated paper, the easier the negative charge penetration into the insulation paper. There is a significant amount of positive charge accumulated at the paper-paper interface near to the cathode for oilpaper sample with lower moisture content. However, the positive charge appears in the middle layer paper for oil-paper sample with higher moisture content. Due to the high conductivity, the charge trapped in the oil-paper sample with higher moisture content disappears much faster than that in the oil-paper sample with lower moisture content after removing the voltage.

  3. DTDGA impregnated XAD-16 beads for separation and recovery of palladium from acidic wastes

    International Nuclear Information System (INIS)

    Singh, Krishan Kant; Kanagare, Anant B.; Bairwa, K.K.; Manmohan Kumar; Bajaj, Parma N.; Ruhela, Ritesh; Singh, Ajoy K.; Hubli, Rajendra C.

    2014-01-01

    In the present study DTDGA extractant impregnated XAD16 polymeric beads (DTDGA- XAD16) were synthesized by wet chemical method and the beads were characterized by various techniques viz. FT-IR, Optical microscopy, SEM and TGA. The DTDGA-XAD 16 beads were evaluated for separation and recovery of palladium from high level waste solutions (HLW)

  4. Impact of some selected insecticides application on soil microbial respiration.

    Science.gov (United States)

    Latif, M A; Razzaque, M A; Rahman, M M

    2008-08-15

    The aim of present study was to investigate the impact of selected insecticides used for controlling brinjal shoot and fruit borer on soil microorganisms and to find out the insecticides or nontoxic to soil microorganism the impact of nine selected insecticides on soil microbial respiration was studied in the laboratory. After injection of different insecticides solutions, the soil was incubated in the laboratory at room temperature for 32 days. The amount of CO2 evolved due to soil microbial respiration was determined at 2, 4, 8, 16, 24 and 32 days of incubation. Flubendiamide, nimbicidine, lambda-cyhalothrin, abamectin and thiodicarb had stimulatory effect on microbial respiration during the initial period of incubation. Chlorpyriphos, cartap and carbosulfan had inhibitory effect on microbial respiration and cypermethrin had no remarkable effect during the early stage of incubation. The negative effect of chlorpyriphos, cartap and carbosulfan was temporary, which was disappeared after 4 days of insecticides application. No effect of the selected insecticides on soil microorganisms was observed after 24 or 32 days of incubation.

  5. Role of iron catalyst impregnated by solvent swelling method in pyrolytic removal of coal nitrogen

    Energy Technology Data Exchange (ETDEWEB)

    Hayashi, J.; Kusakabe, K.; Morooka, S.; Nielsen, M.; Furimsky, E. [Kyushu University, Fukuoka (Japan). Dept. of Chemical Science and Technology

    1995-11-01

    Organometallic iron precursors, ferrocene and ferric acetate, were impregnated into Illinois No. 6 (IL), Wyoming (WY) and Yallourn (YL) coals by solvent swelling technique in THF, ethanol, and a THF/ethanol binary solvent. Then iron-impregnated coals were pyrolyzed in a flow of helium at atmospheric pressure in a fixed bed and a thermobalance. Conversion of coal nitrogen to N{sub 2} was 20, 38 and 30% respectively, for original IL, WY, and YL coals. Iron formed from both precursors lowered the onset temperature of N{sub 2} evolution by 20-100{degree}C. When ferrocene was impregnated in coals at a concentration of 1.7-1.8 wt% as Fe, nitrogen conversion was increased to 52, 71 and 68% for IL, WY and YL coals, respectively. Ferric acetate impregnated into IL coal from THF/ethanol solution increased the nitrogen conversion much more than that from ethanol solution. The expansion of microporous coal structure by the swelling was essential for better dispersion of the catalyst precursor. The evolution of HCN as well as NH{sub 3} was effectively suppressed above 600{degree}C by the presence of iron but not influenced significantly by combinations of catalyst precursors and solvents. The increase in N{sub 2} yield was compensated by the decrease in nitrogen emitted as HCN and NH{sub 3} and in tar and char. The increase in CO evolution from the iron-impregnated IL coal at 600-800{degree}C was explained by catalytic rearrangement of aromatic structure of char, accompanying the removal of nitrogen as N{sub 2}. In a range of 600-750{degree}C, the evolution of CO as well as N{sub 2} from the other coals increased remarkably with a significant decrease in CO{sub 2} gasification in char microproes. 32 refs., 9 figs., 3 tabs.

  6. Modeling boron separation from water by activated carbon, impregnated and unimpregnated

    Energy Technology Data Exchange (ETDEWEB)

    Ristic, M.; Grbavcic, Z. [Belgrade Univ., Belgrade (BA). Faculty of Technology and Metallurgy; Marinovic, V. [Belgrade Univ., Belgrade (BA). Ist. of Technical Science of the Serbian Academy of Science and Arts

    2000-10-01

    The sorption of boron from boric acid water solution by impregnated activated carbon has been studied. Barium, calcium, mannitol, tartaric acid and citric acid were used as chemical active materials. All processes were performed in a chromatographic continuous system at 22{sup 0} C. Experimental results show that activated carbon impregnated with mannitol is effective in removing boron from water. The separation of boron from the wastewater from a factory for producing enameled dishes by activated carbon impregnated with mannitol was also performed. Two models have been applied to describe published and new data on boron sorption by impregnated activated carbon. Both of them are based on the analysis of boron concentration response to the step input function. This led to a mathematical model that quite successfully described impregnation effects on adsorption capacities. [Italian] E' stato studiato l'assorbimento del boro, mediante carbone attivo impregnato, da soluzioni acquose di acido borico. Quali materiali chimici attivi sono stati utilizzati: bario, calcio, mannitolo, acido tartarico ed acido citrico. Tutti i processi sono stati condotti in un sistema cromatografico continuo a 22{sup 0}C. I risultati sperimentali mostrano che il carbone attivo impregnato con mannitolo e' efficace nella rimozione del boro dall'acqua. E' anche stata effettuata la separazione del boro da acque di scarico di un'industria per la produzione di piatti smaltati mediante carbone attivo impregnato con mannitolo. Sono stati applicati due modelli per descrivere i risultati, pubblicati e nuovi, dell'assorbimento del boro mediante carbone attivo impregnato. Entrambi sono basati sull'analisi della risposta alla concentrazione di boro successivamente incrementata a stadi. Cio' porta ad un modello matematico che descrive abbastanza soddisfacentemente gli effetti dell'impregnazione sulla capacita' di assorbimento.

  7. Malaria transmission and insecticide resistance of Anopheles gambiae in Libreville and Port-Gentil, Gabon

    Directory of Open Access Journals (Sweden)

    Kombila Maryvonne

    2010-11-01

    Full Text Available Abstract Background Urban malaria is a major health priority for civilian and militaries populations. A preliminary entomologic study has been conducted in 2006-2007, in the French military camps of the two mains towns of Gabon: Libreville and Port-Gentil. The aim was to assess the malaria transmission risk for troops. Methods Mosquitoes sampled by human landing collection were identified morphologically and by molecular methods. The Plasmodium falciparum circumsporozoïte (CSP indexes were measured by ELISA, and the entomological inoculation rates (EIR were calculated for both areas. Molecular assessments of pyrethroid knock down (kdr resistance and of insensitive acetylcholinesterase resistance were conducted. Results In Libreville, Anopheles gambiae s.s. S form was the only specie of the An. gambiae complex present and was responsible of 9.4 bites per person per night. The circumsporozoïte index was 0.15% and the entomological inoculation rate estimated to be 1.23 infective bites during the four months period. In Port-Gentil, Anopheles melas (75.5% of catches and An. gambiae s.s. S form (24.5% were responsible of 58.7 bites per person per night. The CSP indexes were of 1.67% for An. gambiae s.s and 0.28% for An. melas and the EIRs were respectively of 1.8 infective bites per week and of 0.8 infective bites per week. Both kdr-w and kdr-e mutations in An. gambiae S form were found in Libreville and in Port-Gentil. Insensitive acetylcholinesterase has been detected for the first time in Gabon in Libreville. Conclusion Malaria transmission exists in both town, but with high difference in the level of risk. The co-occurrence of molecular resistances to the main families of insecticide has implications for the effectiveness of the current vector control programmes that are based on pyrethroid-impregnated bed nets.

  8. The development of insecticide-treated durable wall lining for malaria control: insights from rural and urban populations in Angola and Nigeria

    Directory of Open Access Journals (Sweden)

    Messenger Louisa A

    2012-09-01

    Full Text Available Abstract Background Durable lining (DL is a deltamethrin-impregnated polyethylene material, which is designed to cover domestic walls that would normally be sprayed with residual insecticide. The operational success of DL as a long-lasting insecticidal substrate will be dependent on a high level of user acceptability as households must maintain correctly installed linings on their walls for several years. Preliminary trials were undertaken to identify a material to develop into a marketable wall lining and to assess its level of acceptability among rural and urban populations. Methods In Angola (n=60, prototype DL and insecticide-treated plastic sheeting (ITPS were installed on urban house walls and ceilings, respectively, and acceptability was compared to indoor residual spraying (IRS (n=20 using a knowledge, attitude and practice (KAP questionnaire. In Nigeria (n=178, three materials (prototype DL, ITPS and insecticide-treated wall netting were distributed among rural and urban households. User opinions were gathered from focus group discussions, in-depth interviews and KAP questionnaires. Results In Angola, after two weeks, the majority of participants (98% expressed satisfaction with the products and identified the killing of insects as the materials’ principal benefits (73%. After one year, despite a loss of almost 50% of households to refugee repatriation, all 32 remaining households still asserted that they had liked the DL/ITPS in their homes and given the choice of intervention preferred DL/ITPS to IRS (94% or insecticide-treated nets (78%. In Nigeria, a dichotomy between rural and urban respondents emerged. Rural participants favoured wall adornments and accepted wall linings because of their perceived decorative value and entomological efficacy. By contrast, urban households preferred minimal wall decoration and rejected the materials based upon objections to their aesthetics and installation feasibility. Conclusions The high level

  9. The development of insecticide-treated durable wall lining for malaria control: insights from rural and urban populations in Angola and Nigeria

    Science.gov (United States)

    2012-01-01

    Background Durable lining (DL) is a deltamethrin-impregnated polyethylene material, which is designed to cover domestic walls that would normally be sprayed with residual insecticide. The operational success of DL as a long-lasting insecticidal substrate will be dependent on a high level of user acceptability as households must maintain correctly installed linings on their walls for several years. Preliminary trials were undertaken to identify a material to develop into a marketable wall lining and to assess its level of acceptability among rural and urban populations. Methods In Angola (n=60), prototype DL and insecticide-treated plastic sheeting (ITPS) were installed on urban house walls and ceilings, respectively, and acceptability was compared to indoor residual spraying (IRS) (n=20) using a knowledge, attitude and practice (KAP) questionnaire. In Nigeria (n=178), three materials (prototype DL, ITPS and insecticide-treated wall netting) were distributed among rural and urban households. User opinions were gathered from focus group discussions, in-depth interviews and KAP questionnaires. Results In Angola, after two weeks, the majority of participants (98%) expressed satisfaction with the products and identified the killing of insects as the materials’ principal benefits (73%). After one year, despite a loss of almost 50% of households to refugee repatriation, all 32 remaining households still asserted that they had liked the DL/ITPS in their homes and given the choice of intervention preferred DL/ITPS to IRS (94%) or insecticide-treated nets (78%). In Nigeria, a dichotomy between rural and urban respondents emerged. Rural participants favoured wall adornments and accepted wall linings because of their perceived decorative value and entomological efficacy. By contrast, urban households preferred minimal wall decoration and rejected the materials based upon objections to their aesthetics and installation feasibility. Conclusions The high level of acceptability

  10. Insecticide mixtures could enhance the toxicity of insecticides in a resistant dairy population of Musca domestica L [corrected].

    Directory of Open Access Journals (Sweden)

    Hafiz Azhar Ali Khan

    Full Text Available House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-"A" and LC50: LC50-"B" significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies.

  11. Insecticide Mixtures Could Enhance the Toxicity of Insecticides in a Resistant Dairy Population of Musca domestica L

    Science.gov (United States)

    Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin

    2013-01-01

    House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758

  12. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation

    Science.gov (United States)

    de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso

    2017-01-01

    The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907

  13. The gut microbiota of insecticide-resistant insects houses insecticide-degrading bacteria: A potential source for biotechnological exploitation.

    Directory of Open Access Journals (Sweden)

    Luis Gustavo de Almeida

    Full Text Available The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects.

  14. Kirjanduslikest kontaktidest läbi raudse eesriide / Literary contacts through the iron curtain

    Directory of Open Access Journals (Sweden)

    Marin Laak

    2016-09-01

    1968, paperback poetry books by young authors issued in Estonia; there was a need among young exile writers to respond to their contemporaries in the homeland. This revealing fact verifies that regardless of shadow of the iron curtain, good relationships existed between the two literary and artistic worlds, despite the absence of official relationships, and that from the literary historiographical perspective there are grounds for treating Estonian literature as a single process.

  15. 多向可调节柔性连接式石材幕墙施工技术%Multi Direction Adjustable Connection Stone Curtain Wall Construction Technology

    Institute of Scientific and Technical Information of China (English)

    杨军

    2016-01-01

    This paper introduces a new type of surface stone curtain wall construction technology, the technology used to adjust the flexible back bolt of the multi direction can be adjusted, improved the construction efficiency of special⁃shaped curved surface stone, irregular curved surface stone curtain wall facade effect can be better.%介绍了一种新的异形曲面石材幕墙施工技术,该技术运用多向可调节柔性背栓的多向可调节性,提高了异形曲面石材的施工效率,异形曲面石材幕墙的外立面效果得以更好呈现。

  16. Enzymes and Inhibitors in Neonicotinoid Insecticide Metabolism

    Science.gov (United States)

    Shi, Xueyan; Dick, Ryan A.; Ford, Kevin A.; Casida, John E.

    2009-01-01

    Neonicotinoid insecticide metabolism involves considerable substrate specificity and regioselectivity of the relevant CYP450, aldehyde oxidase, and phase II enzymes. Human CYP450 recombinant enzymes carry out the following conversions: CYP3A4, 2C19 and 2B6 for thiamethoxam (TMX) to clothianidin (CLO); 3A4, 2C19 and 2A6 for CLO to desmethyl-CLO; 2C19 for TMX to desmethyl-TMX. Human liver aldehyde oxidase reduces the nitro substituent of CLO to nitroso much more rapidly than that of TMX. Imidacloprid (IMI), CLO and several of their metabolites do not give detectable N-glucuronides but 5-hydroxy-IMI, 4,5-diol-IMI and 4-hydroxy-thiacloprid are converted to O-glucuronides in vitro with mouse liver microsomes and UDP-glucuronic acid or in vivo in mice. Mouse liver cytosol with S-adenosylmethionine converts desmethyl-CLO to CLO but not desmethyl-TMX to TMX. Two organophosphorus CYP450 inhibitors partially block IMI, thiacloprid and CLO metabolism in vivo in mice, elevating the brain and liver levels of the parent compounds while reducing amounts of the hydroxylated metabolites. PMID:19391582

  17. Azobenzene Modified Imidacloprid Derivatives as Photoswitchable Insecticides: Steering Molecular Activity in a Controllable Manner

    Science.gov (United States)

    Xu, Zhiping; Shi, Lina; Jiang, Danping; Cheng, Jiagao; Shao, Xusheng; Li, Zhong

    2015-10-01

    Incorporating the photoisomerizable azobenzene into imidacloprid produced a photoswitchable insecticidal molecule as the first neonicotinoid example of remote control insecticide performance with spatiotemporal resolution. The designed photoswitchable insecticides showed distinguishable activity against Musca both in vivo and in vitro upon irradiation. Molecular docking study further suggested the binding difference of the two photoisomers. The generation of these photomediated insecticides provides novel insight into the insecticidal activity facilitating further investigation on the functions of insect nicotinic acetylcholine receptors and opens a novel way to control and study insect behavior on insecticide poisoning using light.

  18. Field experiment and numerical simulation of coupling non-Darcy flow caused by curtain and pumping well in foundation pit dewatering

    Science.gov (United States)

    Wang, Jianxiu; Liu, Xiaotian; Wu, Yuanbin; Liu, Shaoli; Wu, Lingao; Lou, Rongxiang; Lu, Jiansheng; Yin, Yao

    2017-06-01

    High-velocity non-Darcy flow produced larger drawdown than Darcy flow under the same pumping rate. When the non-Darcy flow caused by curtain met non-Darcy flow caused by pumping wells, superposition and amplification effect occurred in the coupling area, the non-Darcy flow was defined as coupling non-Darcy flow. The coupling non-Darcy flow can be produced and controlled using different combination of curtain and pumping wells in foundation pit dewatering to obtain the maximum drawdown using the minimum pumping rate. The Qianjiang Century City Station foundation pit of Hangzhou subway, China, was selected as background. Field experiments were performed to observe the coupling non-Darcy flow in round gravel. A generalized conceptual model was established to study the coupling effect under different combination of curtain and pumping wells. Numerical simulations of the coupling non-Darcy flow in foundation pit dewatering were carried out based on the Forchheimer equation. The non-Darcy flow area and flow velocity were influenced by the coupling effect. Short filter tube, large pumping rate, small horizontal distance between filter tube and diaphragm wall, and small vertical distance between the filter tube and confined aquifer roof effectively strengthened the coupling effect and obtained a large drawdown. The pumping wells installed close to a curtain was an intentional choice designed to create coupling non-Darcy flow and obtain the maximize drawdown. It can be used in the dewatering of a long and narrow foundation pit, such as a subway foundation pit.

  19. Onboard cross-calibration of the Pille-ISS Detector System and measurement of radiation shielding effect of the water filled protective curtain in the ISS crew cabin

    International Nuclear Information System (INIS)

    Szántó, P.; Apáthy, I.; Deme, S.; Hirn, A.; Nikolaev, I.V.; Pázmándi, T.; Shurshakov, V.A.; Tolochek, R.V.; Yarmanova, E.N.

    2015-01-01

    As a preparation for long duration space missions it is important to determine and minimize the impact of space radiation on human health. One of the methods to diminish the radiation burden is using an additional local shielding in the places where the crewmembers can stay for longer time. To increase the crew cabin shielding a special protective curtain was designed and delivered to ISS in 2010 containing four layers of hygienic wipes and towels providing an additional shielding thickness of about 8 g/cm"2 water-equivalent matter. The radiation shielding effect of the protective curtain, in terms of absorbed dose, was measured with the thermoluminescent Pille-ISS Detector System. In order to verify the reliability of the Pille system an onboard cross-calibration was also performed. The measurement proved that potentially 25% reduction of the absorbed dose rate in the crew cabin can be achieved, that results in 8% (∼16 μGy/day) decrease of the total absorbed dose to the crew, assuming that they spend 8 h in the crew cabin a day. - Highlights: • The dose level in the ISS Zvezda crew quarters is higher than the average dose level in the module. • A shielding made of hygienic wipes and towels was set up onboard as additional protection. • Onboard cross calibration of the Pille-ISS space dosimeter (TL) system was performed. • The shielding effect of the protective curtain in terms of absorbed dose was measured with the onboard Pille system. • The shielding effect of the protective water curtain is approximately 24 ± 9% in absorbed dose.

  20. The nuclear waste disaster. A view behind the curtain of the presumably clean nuclear power; Das Atommuell-Desaster. Blicke hinter die Kulissen der angeblich sauberen Atomenergie

    Energy Technology Data Exchange (ETDEWEB)

    Schumacher, Julia; Simon, Armin; Stay, Jochen (comps.)

    2015-04-15

    The brochure on the nuclear waste disaster - a view behind the curtain of the presumably clean nuclear power discusses the following topics: Thuringia and Saxony - radiating landscapes, Gronau - 100.000 tons for eternity, Gundremmingen - nuclear waste records and castor shortage, Brunsbuettel - castor storage facility without licensing, Juelich the pebble bed drama, Karlsruhe - the hall is filled, Obrigheim - radioactive waste for cooking pots, Asse - the ticking bomb, final repositories - an illusion without solution, stop the waste production, Germany - endless nuclear waste.

  1. CHEMISORPtION OF SULFUR (IV OXIDeBY PoLYETHYLENEPOLYAMINE IMPREGNATED FIBROUS MATERIALS. 1. HYDROPHILIC POLYETHYLENEPOLYAMINE IMPREGNATED FIBROUS MATERIALS

    Directory of Open Access Journals (Sweden)

    A. A. Ennan

    2015-03-01

    Full Text Available The hydrophilicity of artificial and synthetic fibers and polyethylenepolyamine (PEPA impregnated fibrous materials based on them was investigated under static conditions using a vacuum sorption installation. Water vapor sorption isotherms were analyzed and monolayer capacitance values  and a water molecules adsorption in the first layer heats were determined in the framework of polymolecular adsorption Brunauer – Emmett – Teller. It has been found that the hydrophilicity of the fibers studied to change in the following sequence: viscose > VION AN-3 > VION KN-1 > nylon-polyester > nitrone > polyester > polypropylene; PEPA modified hydrophilic fibrous material does not depend essentially on the chemical nature of the carrier.

  2. Climate change, agricultural insecticide exposure, and risk for freshwater communities.

    Science.gov (United States)

    Kattwinkel, Mira; Kühne, Jan-Valentin; Foit, Kaarina; Liess, Matthias

    2011-09-01

    Climate change exerts direct effects on ecosystems but has additional indirect effects due to changes in agricultural practice. These include the increased use of pesticides, changes in the areas that are cultivated, and changes in the crops cultivated. It is well known that pesticides, and in particular insecticides, affect aquatic ecosystems adversely. To implement effective mitigation measures it is necessary to identify areas that are affected currently and those that will be affected in the future. As a consequence, we predicted potential exposure to insecticide (insecticide runoff potential, RP) under current conditions (1990) and under a model scenario of future climate and land use (2090) using a spatially explicit model on a continental scale, with a focus on Europe. Space-for-time substitution was used to predict future levels of insecticide application, intensity of agricultural land use, and cultivated crops. To assess the indirect effects of climate change, evaluation of the risk of insecticide exposure was based on a trait-based, climate-insensitive indicator system (SPEAR, SPEcies At Risk). To this end, RP and landscape characteristics that are relevant for the recovery of affected populations were combined to estimate the ecological risk (ER) of insecticides for freshwater communities. We predicted a strong increase in the application of, and aquatic exposure to, insecticides under the future scenario, especially in central and northern Europe. This, in turn, will result in a severe increase in ER in these regions. Hence, the proportion of stream sites adjacent to arable land that do not meet the requirements for good ecological status as defined by the EU Water Framework Directive will increase (from 33% to 39% for the EU-25 countries), in particular in the Scandinavian and Baltic countries (from 6% to 19%). Such spatially explicit mapping of risk enables the planning of adaptation and mitigation strategies including vegetated buffer strips and

  3. The effect of silanated and impregnated fiber on the tensile strength of E-glass fiber reinforced composite retainer

    Directory of Open Access Journals (Sweden)

    Niswati Fathmah Rosyida

    2015-12-01

    Full Text Available Background: Fiber reinforced composite (FRC is can be used in dentistry as an orthodontic retainer. FRC  still has a limitations because of to  a weak bonding between fibers and matrix. Purpose: This research was aimed to evaluate the effect of silane as coupling agent and fiber impregnation on the tensile strength of E-glass FRC. Methods: The samples of this research were classified into two groups each of which consisted of three subgroups, namely the impregnated fiber group (original, 1x addition of silane, 2x addition of silane and the non-impregnated fiber group (original, 1x addition of silane, 2x addition of silane. The tensile strength was measured by a universal testing machine. The averages of the tensile strength in all groups then were compared by using Kruskal Wallis and Mann Whitney post hoc tests. Results: The averages of the tensile strength (MPa in the impregnated fiber group can be known as follow; original impregnated fiber (26.60±0.51, 1x addition of silane (43.38±4.42, and 2x addition of silane (36.22±7.23. The averages of tensile strength (MPa in the non-impregnated fiber group can also be known as follow; original non-impregnated fiber (29.38±1.08, 1x addition of silane (29.38±1.08, 2x addition of silane (12.48±2.37. Kruskal Wallis test showed that there was a significant difference between the impregnated fiber group and the non-impregnated fiber group (p<0.05. Based on the results of post hoc test, it is also known that the addition of silane in the impregnated fiber group had a significant effect on the increasing of the tensile strength of E-glass FRC (p<0.05, while the addition of silane in the non-impregnated fiber group had a significant effect on the decreasing of the tensile strength of E-glass FRC. Conclusion: It can be concluded that the addition of silane in the non-silanated fiber group can increase the tensile strength of E-glass FRC, but the addition of silane in the silanated fiber group can

  4. Chemical composition and insecticidal properties of the essential oil ...

    African Journals Online (AJOL)

    Methods: The essential oil of B. frondosa was obtained by hydro-distillation and analyzed by gas chromatography (GC) and gas chromatography-mass spectrometry (GC-MS) with HP-5MS column. The active constituents were purified from the oil by bioactivity-guided fractionation. Contact (impregnated filter paper method) ...

  5. Curtain-Lifting Winds Allow Rare Glimpse into Massive Star Factory

    Science.gov (United States)

    2003-06-01

    the earliest ones (astronomers here refer to "protostars"), high-mass stars evolve much faster than low-mass stars. It is therefore more difficult to "catch" massive stars in the critical phases of early formation. And, what is even worse, due to this rapid development, young high-mass protostars are usually very deeply embedded in their natal clouds and therefore not detectable at optical wavelengths during the (short) phase before nuclear reactions start in their interior. There is simply not enough time for the cloud to disperse - when the curtain finally lifts, allowing a view of the new star, it is already past those earliest stages. Is there a way around these problems? "Yes", says Dieter Nürnberger of ESO-Santiago, "you just have to look in the right place and remember Bob Dylan...!". This is what he did. "The answer, my friend, is blowing by the wind..." Imagine that it would be possible to blow away most of the obscuring gas and dust around those high-mass protostars! Even the strongest desire of the astronomers cannot do it, but there are fortunately others who are better at it! Some high-mass stars form in the neighbourhood of clusters of hot stars, i.e., next to their elder brethren. Such already evolved hot stars are a rich source of energetic photons and produce powerful stellar winds of elementary particles (like the "solar wind" but many times stronger) which impact on the surrounding interstellar gas and dust clouds. This process may lead to partial evaporation and dispersion of those clouds, thereby "lifting the curtain" and letting us look directly at young stars in that region, also comparatively massive ones at a relatively early evolutionary stage. The NGC 3603 region ESO PR Photo 16a/03 ESO PR Photo 16a/03 [Preview - JPEG: 400 x 469 pix - 70k [Normal - JPEG: 800 x 938 pix - 544k] Caption: PR Photo 16a/03 shows the sky region around NGC 3603, a cluster of young, hot stars (of the "OB-type") still partly embedded in its natal cloud of gas and

  6. Maintenance and Durability of the Concrete External Layer of Curtain Walls in Prefabricated Technological Poznan Large Panel System

    Science.gov (United States)

    Jasiczak, Józef; Girus, Krzysztof

    2017-10-01

    The issue of usability and durability of large-panel building constructed several decades ago is a subject of an in-depth analysis of many domestic and foreign investments. When considering the durability of specific large-panel system, one should consider, among others, the process of making external walls. The long-term and direct impact of weather conditions on the external layer of curtain walls is significant for the durability of large-panel buildings. For the needs of the presented paper, in 2016, the survey of cracks and a series of other tests of large-panel façade, residential building constructed in 1986, in Poland, in the PLP process system - Rataje was executed. Several hundred large-size, triple-layer curtain-wall slab with a 6-cm, concrete exterior cladding layer anchored using pins and hangers with the load-bearing layer, a 9-cm insulation layer made of mineral wool, and a 21-cm structural layer were surveyed. Significant deviations in thicknesses of particular wall layers were proven. Other significant damages and defects of external layers were found. At the second stage, many tests, both nondestructive and destructive, were conducted. They involved determining mechanical properties of an external layer. The concrete thickness was measured using with a type N Schmidt sclerometer and core samples were taken from this layer in order to mark concrete’s compressive strength. The range of carbonation (by phenolphthalein method) and the actual location and condition of reinforcement were estimated using a ferromagnetic device to determine the condition of the external layer. The diagnosis conducted in such a manner was the verification of necessary repair of the walls and their thermal efficiency improvement while ensuring safe conditions of their operation and modern functional and utility requirements. It should be also emphasized that the method of diagnosing the external walls presented in this paper may be popularized when evaluating such

  7. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal]. E-mail: marcio.dionizio@gmail.com; picanco@ufv.br; guedes@ufv.br; mateusc3@yahoo.com.br; agronomiasilva@yahoo.com.br

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  8. Mass spectrometric analyses of organophosphate insecticide oxon protein adducts.

    Science.gov (United States)

    Thompson, Charles M; Prins, John M; George, Kathleen M

    2010-01-01

    Organophosphate (OP) insecticides continue to be used to control insect pests. Acute and chronic exposures to OP insecticides have been documented to cause adverse health effects, but few OP-adducted proteins have been correlated with these illnesses at the molecular level. Our aim was to review the literature covering the current state of the art in mass spectrometry (MS) used to identify OP protein biomarkers. We identified general and specific research reports related to OP insecticides, OP toxicity, OP structure, and protein MS by searching PubMed and Chemical Abstracts for articles published before December 2008. A number of OP-based insecticides share common structural elements that result in predictable OP-protein adducts. The resultant OP-protein adducts show an increase in molecular mass that can be identified by MS and correlated with the OP agent. Customized OP-containing probes have also been used to tag and identify protein targets that can be identified by MS. MS is a useful and emerging tool for the identification of proteins that are modified by activated organophosphate insecticides. MS can characterize the structure of the OP adduct and also the specific amino acid residue that forms the key bond with the OP. Each protein that is modified in a unique way by an OP represents a unique molecular biomarker that with further research can lead to new correlations with exposure.

  9. Insecticides promote viral outbreaks by altering herbivore competition.

    Science.gov (United States)

    Pan, Huipeng; Preisser, Evan L; Chu, Dong; Wang, Shaoli; Wu, Qingjun; Carriére, Yves; Zhou, Xuguo; Zhang, Youjun

    2015-09-01

    While the management of biological invasions is often characterized by a series of single-specieg decisions, invasive species exist within larger food webs. These biotic interactions can alter the impact of control/eradication programs and may cause suppression efforts to inadvertently facilitate invasion spread and impact. We document the rapid replacement of the invasive Bemisia Middle East-Asia Minor I (MEAM1) cryptic biotype by the cryptic Mediterranean (MED) biotype throughout China and demonstrate that MED is more tolerant of insecticides and a better vector of tomato yellow leaf curl virus (TYLCV) than MEAMJ. While MEAM1 usually excludes MED under natural conditions, insecticide application reverses the MEAM1-MED competitive hierarchy and allows MED to exclude MEAMI. The insecticide-mediated success of MED has led to TYLCV outbreaks throughout China. Our work strongly supports the hypothesis that insecticide use in China reverses the MEAMl-MED competitive hierarchy and allows MED to displace MEAM1 in managed landscapes. By promoting the dominance of a Bemisia species that is a competent viral vector, insecticides thus increase the spread and impact of TYLCV in heterogeneous agroecosystems.

  10. The global status of insect resistance to neonicotinoid insecticides.

    Science.gov (United States)

    Bass, Chris; Denholm, Ian; Williamson, Martin S; Nauen, Ralf

    2015-06-01

    The first neonicotinoid insecticide, imidacloprid, was launched in 1991. Today this class of insecticides comprises at least seven major compounds with a market share of more than 25% of total global insecticide sales. Neonicotinoid insecticides are highly selective agonists of insect nicotinic acetylcholine receptors and provide farmers with invaluable, highly effective tools against some of the world's most destructive crop pests. These include sucking pests such as aphids, whiteflies, and planthoppers, and also some coleopteran, dipteran and lepidopteran species. Although many insect species are still successfully controlled by neonicotinoids, their popularity has imposed a mounting selection pressure for resistance, and in several species resistance has now reached levels that compromise the efficacy of these insecticides. Research to understand the molecular basis of neonicotinoid resistance has revealed both target-site and metabolic mechanisms conferring resistance. For target-site resistance, field-evolved mutations have only been characterized in two aphid species. Metabolic resistance appears much more common, with the enhanced expression of one or more cytochrome P450s frequently reported in resistant strains. Despite the current scale of resistance, neonicotinoids remain a major component of many pest control programmes, and resistance management strategies, based on mode of action rotation, are of crucial importance in preventing resistance becoming more widespread. In this review we summarize the current status of neonicotinoid resistance, the biochemical and molecular mechanisms involved, and the implications for resistance management. Copyright © 2015 Elsevier Inc. All rights reserved.

  11. Insecticidal and Nematicidal Activities of Novel Mimosine Derivatives

    Directory of Open Access Journals (Sweden)

    Binh Cao Quan Nguyen

    2015-09-01

    Full Text Available Mimosine, a non-protein amino acid, is found in several tropical and subtropical plants, which has high value for medicine and agricultural chemicals. Here, in continuation of works aimed to development of natural product-based pesticidal agents, we present the first significant findings for insecticidal and nematicidal activities of novel mimosine derivatives. Interestingly, mimosinol and deuterated mimosinol (D-mimosinol from mimosine had strong insecticidal activity which could be a result of tyrosinase inhibition (IC50 = 31.4 and 46.1 μM, respectively. Of synthesized phosphoramidothionate derivatives from two these amino alcohols, two compounds (1a and 1b showed high insecticidal activity (LD50 = 0.5 and 0.7 μg/insect, respectively with 50%–60% mortality at 50 μg/mL which may be attributed to acetylcholinesterase inhibition. Compounds 1a and 1b also had strong nematicidal activity with IC50 = 31.8 and 50.2 μM, respectively. Our results suggest that the length of the alkyl chain and the functional group at the C5-position of phosphoramidothionates derived from mimosinol and d-mimosinol are essential for the insecticidal and nematicidal activities. These results reveal an unexplored scaffold as new insecticide and nematicide.

  12. Plant compounds insecticide activity against Coleoptera pests of stored products

    Energy Technology Data Exchange (ETDEWEB)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal; br, picanco@ufv; br, guedes@ufv; br, mateusc3@yahoo com; br, agronomiasilva@yahoo com

    2007-07-15

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD{sub 50} from 2.72 to 39.71 mg g{sup -1} a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  13. Plant compounds insecticide activity against Coleoptera pests of stored products

    International Nuclear Information System (INIS)

    Moreira, Marcio Dionizio; Picanco, Marcelo Coutinho; Guedes, Raul Narciso Carvalho; Campos, Mateus Ribeiro de; Silva, Gerson Adriano; Martins, Julio Claudio; julioufv@yahoo.com.br

    2007-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed (Datura stramonium L.), baleeira herb (Cordia verbenacea L.), mint (Mentha piperita L.), wild balsam apple (Mormodica charantia L.), and billy goat weed or mentrasto (Ageratum conyzoides L.). The insecticide activity of hexane and ethanol extracts from those plants on R. dominica was evaluated. Among them, only hexane extract of A. conyzoides showed insecticide activity; the hexane extract of this species was successively fractionated by silica gel column chromatography, for isolation and purification of the active compounds. Compounds 5,6,7,8,3',4',5'-heptamethoxyflavone; 5,6,7,8,3'-pentamethoxy-4',5'-methilenedioxyflavone and coumarin were identified. However, only coumarin showed insecticide activity against three insect pests (LD 50 from 2.72 to 39.71 mg g -1 a.i.). The increasing order of insects susceptibility to coumarin was R. dominica, S. zeamais and O. surinamensis. (author)

  14. An insecticidal toxin from Nephila clavata spider venom.

    Science.gov (United States)

    Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong

    2017-07-01

    Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.

  15. Intermediate Syndrome Following Organophosphate Insecticide Poisoning

    Directory of Open Access Journals (Sweden)

    Chen-Chang Yang

    2007-11-01

    Full Text Available Acute organophosphate insecticide poisoning can manifest 3 different phases of toxic effects, namely, acute cholinergic crisis, intermediate syndrome (IMS, and delayed neuropathy. Among them, IMS has been considered as a major contributing factor of organophosphate-related morbidity and mortality because of its frequent occurrence and probable consequence of respiratory failure. Despite a high incidence, the pathophysiology that underlies IMS remains unclear. Previously proposed mechanisms of IMS include different susceptibility of various cholinergic receptors, muscle necrosis, prolonged acetylcholinesterase inhibition, inadequate oxime therapy, downregulation or desensitization of postsynaptic acetylcholine receptors, failure of postsynaptic acetylcholine release, and oxidative stress-related myopathy. The clinical manifestations of IMS typically occur within 24 to 96 hours, affecting conscious patients without cholinergic signs, and involve the muscles of respiration, proximal limb muscles, neck flexors, and muscles innervated by motor cranial nerves. With appropriate therapy that commonly includes artificial respiration, complete recovery develops 5–18 days later. Patients with atypical manifestations of IMS, especially a relapse or a continuum of acute cholinergic crisis, however, were frequently reported in clinical studies of IMS. The treatment of IMS is mainly supportive. Nevertheless, because IMS generally concurs with severe organophosphate toxicity and persistent inhibition of acetylcholinesterase, early aggressive decontamination, appropriate antidotal therapy, and prompt institution of ventilatory support should be helpful in ameliorating the magnitude and/or the incidence of IMS. Although IMS is well recognized as a disorder of neuromuscular junctions, its exact etiology, incidence, and risk factors are not clearly defined because existing studies are largely small-scale case series and do not employ a consistent and rigorous

  16. A novel ultrasonication method in the preparation of zirconium impregnated cellulose for effective fluoride adsorption.

    Science.gov (United States)

    Barathi, M; Kumar, A Santhana Krishna; Rajesh, N

    2014-05-01

    In the present work, we propose for the first time a novel ultrasound assisted methodology involving the impregnation of zirconium in a cellulose matrix. Fluoride from aqueous solution interacts with the cellulose hydroxyl groups and the cationic zirconium hydroxide. Ultrasonication ensures a green and quick alternative to the conventional time intensive method of preparation. The effectiveness of this process was confirmed by comprehensive characterization of zirconium impregnated cellulose (ZrIC) adsorbent using Fourier transform infrared spectroscopy (FT-IR), energy dispersive X-ray spectrometry (EDX) and X-ray diffraction (XRD) studies. The study of various adsorption isotherm models, kinetics and thermodynamics of the interaction validated the method. Copyright © 2013 Elsevier B.V. All rights reserved.

  17. Treatment of infectious arthritis of the radiocarpal joint of cattle with gentamicin-impregnated collagen sponges

    International Nuclear Information System (INIS)

    Hirsbrunner, G.; Steiner, A.

    1998-01-01

    Gentamicin-impregnated collagen sponges were used successfully in the treatment of chronic septic arthritis of the radiocarpal joint in two cattle. Both animals were moderately to severely lame and refractory to systemic antibiotics, and one of them was refractory to joint lavage and local antibiotics. The clinical diagnosis was confirmed by radiography and arthrocentesis. Arthroscopy was performed under general anaesthesia and, after debridement and lavage of the joint, gentamicin-impregnated collagen sponges were placed intra-articularly. Synovial fluid was sampled at 10 and 20 days after surgery and radiographs were taken three months (case 1) and two months (case 2) after surgery. The infection was eliminated from both animals and they recovered without residual lameness

  18. Boron removal from aqueous solutions by activated carbon impregnated with salicylic acid

    International Nuclear Information System (INIS)

    Celik, Z. Ceylan; Can, B.Z.; Kocakerim, M. Muhtar

    2008-01-01

    In this study, the removal of boric acid from aqueous solution by activated carbon impregnated with salicylic acid was studied in batch system. pH, adsorbent amount, initial boron concentration, temperature, shaking rate and salicylic acid film thickness were chosen as parameters. Boron removal efficiencies increased with increasing adsorbent amount, temperature and pH, decreasing initial boron concentration. As thickness of salicylic acid film on activated carbon becomes thin up to 0.088 nm, the efficiency increased, and then, the efficiency decreased with becoming thinner than 0.088 nm of salicylic acid film. Shaking rate was no effect on removal efficiency. In result, it was determined that the use of salicylic acid as an impregnant for activated carbon led to the increase of the amount of boron adsorbed. A lactone ring, being the most appropriate conformation, forms between boric acid and -COOH and -OH groups of salicylic acid

  19. Separation of yttrium using carbon nanotube doped polymeric beads impregnated with D2EHPA

    International Nuclear Information System (INIS)

    Dasgupta, Kinshuk; Yadav, Kartikey K.; Singh, D.K.; Anitha, M.; Singh, H.

    2013-01-01

    Di-2-ethylhexyl phosphoric acid impregnated polyethersulfone based composite beads in combination with additives such as polyvinyl alcohol (PVA) and multiwalled carbon nanotube (MWCNT) has been prepared by non-solvent phase inversion method. The synthesized beads were characterized by scanning electron microscopy, thermogravimetry and infra-red spectroscopy. Effect of additives on bead morphology, solvent impregnation capacity, extractability and stability has been examined to compare their suitability for yttrium recovery from acidic medium. Microstructural investigation as well as experimental findings confirmed the role of additives in modifying the pore structures in beads, responsible for varied degree of yttrium extraction. Further the role of metal ion concentration in aqueous phase on its recovery by polymeric beads was also evaluated. Among the tested beads PES/D2EHPA/MWCNT/PVA beads were found to be superior for Y(Ill) extraction. (author)

  20. Microwave heating of electric cable insulated wires before their impregnation with a hydrophobic material

    Energy Technology Data Exchange (ETDEWEB)

    Niculae, D; Mihailescu, A [Romanian Electricity Authority (Romania); Indreias, I; Martin, D [Institute of Atomic Physics, Bucharest (Romania); Margaritescu, A [ICPE Electrostatica, Bucharest, (Romania); Zlatonovici, D

    1998-12-31

    Underground insulated telecommunication cables must be impregnated with a hydrophobic material in order to prevent water penetration damage. To do so, the cable wire bundle must be heated to a temperature of 60 to 90 degrees C to ensure proper fluidity of the hydrophobic material that must fill the free spaces between the copper wires of the telephone cable. This paper described the microwave heating method of the wires before their impregnation. A cylindrical applicator was designed to perform a telephone bundle heating test. 800 W of microwave power were used on a telephone cable made up of 800 wires of 0.4 mm in diameter. A uniform heating was obtained throughout the section. Microwave heating was also found to be 53 per cent more energy efficient than hot air heating. 4 refs., 4 figs.

  1. Boron removal from aqueous solutions by activated carbon impregnated with salicylic acid

    Energy Technology Data Exchange (ETDEWEB)

    Celik, Z. Ceylan [Department of Environmental Engineering, Atatuerk University, Faculty of Engineering, Erzurum (Turkey)], E-mail: zcelik@atauni.edu.tr; Can, B.Z. [Department of Environmental Engineering, Atatuerk University, Faculty of Engineering, Erzurum (Turkey); Kocakerim, M. Muhtar [Department of Chemical Engineering, Atatuerk University, Faculty of Engineering, 25240 Erzurum (Turkey)

    2008-03-21

    In this study, the removal of boric acid from aqueous solution by activated carbon impregnated with salicylic acid was studied in batch system. pH, adsorbent amount, initial boron concentration, temperature, shaking rate and salicylic acid film thickness were chosen as parameters. Boron removal efficiencies increased with increasing adsorbent amount, temperature and pH, decreasing initial boron concentration. As thickness of salicylic acid film on activated carbon becomes thin up to 0.088 nm, the efficiency increased, and then, the efficiency decreased with becoming thinner than 0.088 nm of salicylic acid film. Shaking rate was no effect on removal efficiency. In result, it was determined that the use of salicylic acid as an impregnant for activated carbon led to the increase of the amount of boron adsorbed. A lactone ring, being the most appropriate conformation, forms between boric acid and -COOH and -OH groups of salicylic acid.

  2. Strengthening of limestone by the impregnation - gamma irradiation method. Results of tests

    International Nuclear Information System (INIS)

    Ramiere, R.; Tassigny, C. de

    1975-04-01

    The method developed by the Centre d'Etudes Nucleaires de Grenoble (France) strengthens the stones by impregnation with a styrene resin/liquid polystyrene mixture followed by polymerization under gamma irradiation. This method is applicable to stones which can be taken into the laboratory for treatment. The increase in strength of 6 different species of French limestone has been quantitatively recorded. The following parameters were studied: possibility of water migration inside the stones, improvements of the mechanical properties of the impregnated stone, standing up to freeze-thaw conditions and artificial ageing of the stones which causes only minor changes in the appearance of the stone and a negligible decrease in weight [fr

  3. Lubricant-impregnated surfaces for electrochemical applications, and devices and systems using same

    Energy Technology Data Exchange (ETDEWEB)

    Solomon, Brian Richmond; Chen, Xinwei; Chiang, Yet-Ming; Varanasi, Kripa K.

    2018-04-17

    In certain embodiments, the invention relates to an electrochemical device having a liquid lubricant impregnated surface. At least a portion of the interior surface of the electrochemical device includes a portion that includes a plurality of solid features disposed therein. The plurality of solid features define a plurality of regions therebetween. A lubricant is disposed in the plurality of regions which retain the liquid lubricant in the plurality of regions during operation of the device. An electroactive phase comes in contact with at least the portion of the interior surface. The liquid lubricant impregnated surface introduces a slip at the surface when the electroactive phase flows along the surface. The electroactive phase may be a yield stress fluid.

  4. Extraction and Separation of Uranium (VI) and Thorium (IV) Using Tri-n-dodecylamine Impregnated Resins

    International Nuclear Information System (INIS)

    Metwally, E.; Saleh, A.Sh.; El-Naggar, H.A.

    2005-01-01

    Extraction of U(VI) and Th(IV) from chloride and nitrate solutions with tri-n- dodecylamine impregnated on Amberlite XAD4, was investigated. The distribution of U(VI) and Th(IV) was studied at different concentrations of acid, salting-out agent, extractant, aqueous metal ion and other parameters. Absorption spectral studies have been investigated for uranium species in both aqueous HCl solution and the resin phase. From these studies, it is suggested that the tetrachloro complex of U(VI) is formed in the extraction of uranium (VI) from hydrochloric acid solutions by TDA impregnated resin. Stripping of the extracted U(VI) and Th(IV) was assayed with HCl and HNO 3 . Finally, the separation of uranium from thorium and fission products in HCl media was achieved

  5. Property-porosity relationships for polymer-impregnated superconducting ceramic composite

    International Nuclear Information System (INIS)

    Salib, S.; Vipulanandan, C.

    1990-01-01

    A thermoplastic polymer, poly(methyl methacrylate) (PMMA), was used to improve the flexural properties of the high-temperature superconducting ceramic (YBa 2 Cu 3 O 7-δ ). Ceramic specimens with different porosities were prepared by dry compacting 12.5-mm-diameter disk specimens at various uniaxial pressures. Density-pressure relationships have been developed for before- and after-sintering conditions. The PMMA polymer was impregnated into the porous ceramic at room temperature. The mechanical properties were evaluated by concentrically loading simply supported disk specimens. The load-displacement responses were analyzed using the finite-element method. Impregnation of PMMA polymer at room temperature increased the flexural strength and modulus of the superconducting ceramic without affecting its electrical properties. The flexural properties depended on the porosity of the ceramics, and, hence, linear and nonlinear property-porosity relationships have been used to characterize the behavior of superconducting ceramic with an without the polymer

  6. Development of activated charcoal impregnated air sampling filter media : their characteristics and use

    International Nuclear Information System (INIS)

    Khan, A.A.; Ramarathinam, K.; Gupta, S.K.; Deshingkar, D.S.; Kishore, A.G.

    1975-01-01

    Because of its low maximum permissible concentration in air, air-borne radioiodine must be accurately monitored in contaminated air streams, in the working environment and handling facilities, before release to the environment from the nuclear facilities. Activated charcoal impregnated air sampling filter media are found to be most suitable for monitoring airborne iodine-131. Because of its simplicity and reproducible nature in assessment of air-borne radioactive iodine, the work on the development of such media was undertaken in order to find a suitable substitute for imported activated charcoal impregnated air sampling filter media. Eight different media of such type were developed, evaluated and compared with two imported media. Best suitable medium is recommended for its use in air-borne iodine sampling which was found to be even better suited than imported media of such type. (author)

  7. An experimental study on oil supply in a space bearing with an oil-impregnated retainer

    Science.gov (United States)

    Liu, Jianhai; Fan, Youwen; Wen, Shizhu

    1993-06-01

    Parched elastohydrodynamic lubrication (EHL) film thickness in a space ball bearing is measured by electrical capacitance and resistance, and parched transients of oil film and lubricant breakdown are observed. With different oil-impregnated polymer retainers, which are employed as oil supply resources, parched degradation is restricted to some degree, even lubricant breakdown disappears and a steady state of the oil film is produced. A long-term space bail bearing demands both the lowest driving torque and a steady state oil film, which depends on a strictly controlled oil supply from oil-impregnated retainers. The results of this experimental research describe the effects of oil supply by amounts of oil in retainers on parched EHL.

  8. Influence on sensitivity to insecticides: a case study of a settled area ...

    African Journals Online (AJOL)

    monitoring for successful alternative insecticides. There are currently two ... behaviour or modification avoid landing on insecticide .... aquarium fish food18. When they .... National Statistical Office (NSO) Malawi Government 1998 Census. 16.

  9. Mechanistic modeling of insecticide risks to breeding birds in North American agroecosystems

    Science.gov (United States)

    Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of ...

  10. Influence of Pyrethroid Insecticides on Sodium and Calcium Influx in Neocortical Neurons

    Science.gov (United States)

    Pyrethroid insecticides bind to voltage-gated sodium channels and modify their gating kinetics, thereby disrupting neuronal function. Using murine neocortical neurons in primary culture, we have compared the ability of 11 structurally diverse pyrethroid insecticides to evoke Na+ ...

  11. Effects of tanalith-e impregnation substance on bending strengths and modulus of elasticity in bending of some wood types

    Directory of Open Access Journals (Sweden)

    Hakan Keskin

    2016-04-01

    Full Text Available The aim of this study was to investigate the effects of impregnation with Tanalith-E on the bending strengths and modulus of elasticity in bending of some wood types. The test samples prepared from beech, oak, walnut, poplar, ash and pine wood materials - that are of common use in the forest products industry of TURKEY - according to TS 345, were treated with according to ASTM D 1413-76 substantially. Un-impregnated samples according to impregnated wood materials, the bending strengths in beech to 6.83%, 5.12% in ash, 5.93% in pine, the elasticity module values to 7.15% in oak and ash, at a rate of 6.58% in the higher were found. The highest values of bending strengths and modulus of elasticity in bending were obtained in beech and ash woods impregnated with Tanalith-E, whereas the lowest values were obtained in the poplar wood.

  12. Negative plates for dry-charged lead storage batteries. [higher charging capacity when impregnated with tannin solution

    Energy Technology Data Exchange (ETDEWEB)

    Fiedler, V; Malikova, V; Weber, H

    1970-09-15

    Impregnation of negative plates with acid solutions of sulfomethylated tannins was found to improve the charging properties at low temperatures. Methods for synthesizing tannins are described. Charging capacity at 0/sup 0/ was 7.3A. (RWR)

  13. Improvement of the process for electrochemical impregnation of nickel hydroxide electrodes

    Science.gov (United States)

    Comtat, M.; Lafage, B.; Leonardi, J.

    1986-01-01

    Nickel hydroxide electrodes containing 11g/dsqm hydroxide, with capacities of 3.6 to 3.8 Ah/dsqm were prepared at 353 K by electrochemical impregnation. The reproducibility of the results is obtained by readjusting the pH before each preparation. The control of each electrode is done during two cycles of charge and discharge following the manufacture by a potential relaxation method.

  14. Salts of the iodine oxyacids in the impregnation of adsorbent charcoal for trapping radioactive methyliodide

    International Nuclear Information System (INIS)

    Deitz, V.R.; Blachly, C.H.

    1977-01-01

    Radioactive iodine and radioactive methyliodide can be more than 99.7 percent removed from the air stream of a nuclear reactor by passing the air stream through a 2-inch thick filter which is made up of impregnated charcoal prepared by contacting the charcoal with a solution containing KOH, iodine or an iodide, and an oxyacid, followed by contacting with a solution containing a tertiary amine. 3 claims

  15. Isolation of Trichoderma harzianum (Rifai) growing on ferric hydroxide mud impregnated with gas oil

    Energy Technology Data Exchange (ETDEWEB)

    Gudin, C. (Lavera Refinery, France); Chater, K.W.A.

    1977-09-01

    In northern France, gas oil-impregnated ferric hydroxide mud was found to support fungal growth. The fungus was identified by the Commonwealth Mycological Institute, Kew, with whom a reference culture has been registered. Experiments indicated that its growth resulted from the biodegradation of the gas oil. It is believed that, in this unusual situation, contaminating hydrocarbons may be removed from the environment by microbial activity.

  16. Magnetic properties of iron oxide photolytically produced from Fe(CO)5 impregnated porous glass

    Science.gov (United States)

    Borelli, N. F.; Morse, D. L.; Schreurs, J. W. H.

    1983-06-01

    This article discusses the magnetic properties observed in porous glasses impregnated with metal carbonyls after exposure to light. In the photolyzed and consolidated glasses both superparamagnetic and single domain ferrimagnetic particles were found to be present, with the single domain particles having an exceedingly high coercive force. The concentration ratio between superparamagnetic and single domain particles depends strongly on temperature. An analysis of the observed phenomena is given.

  17. Impregnation and Polymerization Methods and Systems Used in the Production of Wood-Polymer Materials

    Energy Technology Data Exchange (ETDEWEB)

    Mott, W. E.; Rotariu, G. J. [United States Atomic Energy Commission, Washington, DC 20545 (United States)

    1968-10-15

    Studies on the radiation production of wood-polymer materials began in the United States in 1961 at West Virginia University and have continued until today. In this paper the impregnation and polymerization methods and systems that have evolved from these studies are reviewed. Included is a description of the procedures developed at the College of Forestry, Syracuse University, for producing wood-polymers via a thermal-catalytic process. (author)

  18. HZSM-5 Catalyst for Cracking Palm Oil to Gasoline: A Comparative Study with and without Impregnation

    OpenAIRE

    Achmad Roesyadi; Danawati Hariprajitno; Nurjannah Nurjannah; Santi Dyah Savitri

    2013-01-01

    It is important to develop a renewable source of energy to overcome a limited source fossil energy. Palm oil is a potential alternative and environmental friendly energy resource in Indonesia due to high production capacity of this vegetable oil. The research studied effect of catalyst to selectivity of biofuel product from cracking of palm oil. The catalyst consisted of HZSM-5 catalyst with or without impregnation. The research was conducted in two steps, namely catalyst synthesized and cata...

  19. Property improvement by gamma polymerization of methyl methacrylate impregnated local Thai wood Yang (Dipterocarpus Sp.)

    International Nuclear Information System (INIS)

    Saisomboon, S.; Sumitra, T.

    1990-01-01

    Property improvement of a local Thai wood (Yang-Dipterocarpus Sp.) was studied by impregnating with methyl methacrylate before polymerizing with gamma ray. The polymer loading were 126 and 68 percent for sapwood and heart wood, respectively. Significant improvements in impact, compressive and bending strength were observed in the wood polymer composite (WPC). In addition, the microstructure and the impact fractured-surfaces of WPC were also carried with a scanning electron-microscope

  20. Gauze Impregnated With Quaternary Ammonium Salt Reduces Bacterial Colonization of Surgical Drains After Breast Reconstruction.

    Science.gov (United States)

    Strong, Amy L; Wolfe, Emily T; Shank, Nina; Chaffin, Abigail E; Jansen, David A

    2018-06-01

    Surgical site infection after breast reconstruction is associated with increased length of hospital stay, readmission rates, cost, morbidity, and mortality. Identifying methods to reduce surgical site infection without the use of antibiotics may be beneficial at reducing antimicrobial resistance, reserving the use of antibiotics for more severe cases. Quaternary ammonium salts have previously been shown to be a safe and effective antimicrobial agent in the setting of in vitro and in vivo animal experiments. A retrospective study was conducted to investigate the antimicrobial properties of a quaternary ammonium salt, 3-trimethoxysilyl propyldimethyloctadecyl ammonium chloride (QAS-3PAC; Bio-spear), at reducing surgical drain site colonization and infection after breast reconstruction (deep inferior epigastric perforator flap reconstruction or tissue expander placement). Twenty patients were enrolled, with 14 surgical drains covered with nonimpregnated gauze and 17 surgical drains covered with QAS-3PAC impregnated gauze, for the purposes of investigating bacterial colonization. Antibiotic sensitivity analysis was also conducted when bacterial cultures were positive. The overall incidence of bacterial colonization of surgical drains was lower in the treatment group compared with the control group (17.6% vs 64.3%, respectively; P = 0.008). QAS-3PAC impregnated gauze reduced the incidence of bacterial colonization of surgical drains during the first (0.0% vs 33.3%) and second (33.3% vs 87.5%; P = 0.04) postoperative week. Furthermore, no enhanced antibiotic resistance was noted on drains treated with QAS-3PAC impregnated gauze. The results of this study suggest that QAS-3PAC impregnated gauze applied over surgical drains may be an effective method for reducing the incidence of bacterial colonization.

  1. Efficacy of an insecticide paint against insecticide-susceptible and resistant mosquitoes - Part 1: Laboratory evaluation

    Directory of Open Access Journals (Sweden)

    Carnevale Pierre

    2010-11-01

    Full Text Available Abstract Background The main malaria vector Anopheles gambiae and the urban pest nuisance Culex quinquefasciatus are increasingly resistant to pyrethroids in many African countries. There is a need for new products and strategies. Insecticide paint Inesfly 5A IGR™, containing two organophosphates (OPs, chlorpyrifos and diazinon, and insect growth regulator (IGR, pyriproxyfen, was tested under laboratory conditions for 12 months following WHOPES Phase I procedures. Methods Mosquitoes used were laboratory strains of Cx. quinquefasciatus susceptible and resistant to OPs. The paint was applied at two different doses (1 kg/6 m2 and 1 kg/12 m2 on different commonly used surfaces: porous (cement and stucco and non-porous (softwood and hard plastic. Insecticide efficacy was studied in terms of delayed mortality using 30-minute WHO bioassay cones. IGR efficacy on fecundity, fertility and larval development was studied on OP-resistant females exposed for 30 minutes to cement treated and control surfaces. Results After treatment, delayed mortality was high (87-100% even against OP-resistant females on all surfaces except cement treated at 1 kg/12 m2. Remarkably, one year after treatment delayed mortality was 93-100% against OP-resistant females on non-porous surfaces at both doses. On cement, death rates were low 12 months after treatment regardless of the dose and the resistance status. Fecundity, fertility and adult emergence were reduced after treatment even at the lower dose (p -3. A reduction in fecundity was still observed nine months after treatment at both doses (p -3 and adult emergence was reduced at the higher dose (p -3. Conclusions High mortality rates were observed against laboratory strains of the pest mosquito Cx. quinquefasciatus susceptible and resistant to insecticides. Long-term killing remained equally important on non-porous surfaces regardless the resistance status for over 12 months. The paint's effect on fecundity, fertility and

  2. Novel Aluminum Oxide-Impregnated Carbon Nanotube Membrane for the Removal of Cadmium from Aqueous Solution

    Directory of Open Access Journals (Sweden)

    Ihsanullah

    2017-09-01

    Full Text Available An aluminum oxide-impregnated carbon nanotube (CNT-Al2O3 membrane was developed via a novel approach and used in the removal of toxic metal cadmium ions, Cd(II. The membrane did not require any binder to hold the carbon nanotubes (CNTs together. Instead, the Al2O3 particles impregnated on the surface of the CNTs were sintered together during heating at 1400 °C. Impregnated CNTs were characterized using XRD, while the CNT-Al2O3 membrane was characterized using scanning electron microscopy (SEM. Water flux, contact angle, and porosity measurements were performed on the membrane prior to the Cd(II ion removal experiment, which was conducted in a specially devised continuous filtration system. The results demonstrated the extreme hydrophilic behavior of the developed membrane, which yielded a high water flux through the membrane. The filtration system removed 84% of the Cd(II ions at pH 7 using CNT membrane with 10% Al2O3 loading. A maximum adsorption capacity of 54 mg/g was predicted by the Langmuir isotherm model for the CNT membrane with 10% Al2O3 loading. This high adsorption capacity indicated that adsorption was the main mechanism involved in the removal of Cd(II ions.

  3. Adsorption of Carbon Dioxide onto Tetraethylenepentamine Impregnated PMMA Sorbents with Different Pore Structure

    Energy Technology Data Exchange (ETDEWEB)

    Jo, Dong Hyun; Park, Cheonggi; Jung, Hyunchul; Kim, Sung Hyun [Korea University, Seoul (Korea, Republic of)

    2015-02-15

    Poly(methyl methacrylate) (PMMA) supports and amine additives were investigated to adsorb CO{sub 2}. PMMA supports were fabricated by using different ratio of pore forming agents (porogen) to control the BET specific surface area, pore volume and distribution. Toluene and xylene are used for porogens. Supported amine sorbents were prepared by wet impregnation of tetraethylenepentamine (TEPA) on PMMA supports. So we could identify the effect of the pore structure of supports and the quantity of impregnated TEPA on the adsorption capacity. The increased amount of toluene as pore foaming agent resulted in the decreased average pore diameter and the increased BET surface area. Polymer supports with huge different pore distribution could be fabricated by controlling the ratio of porogen. After impregnation, the support with micropore structure is supposed the pore blocking and filling effect so that it has low CO{sub 2} capacity and kinetics due to the difficulty of diffusing. Macropore structure indicates fast adsorption capacity and low influence of amine loading. In case of support with mesopore, it has high performance of adsorption capacity and kinetics. So high surface area and meso-/macro- pore structure is suitable for CO{sub 2} capture.

  4. Pore structure modification of cement concretes by impregnation with sulfur-containing compounds

    Directory of Open Access Journals (Sweden)

    YANAKHMETOV Marat Rafisovich

    2015-02-01

    Full Text Available The authors study how the impregnation with sulfur-containing compounds changes the concrete pore structure and how it influences on the water absorption and watertightness. The results of this research indicate that impregnation of cement concrete with water-based solution of polysulphide modifies pore structure of cement concrete in such a way that it decreases total and effective porosity, reduces water absorption and increases watertightness. The proposed impregnation based on mineral helps to protect for a long time the most vulnerable parts of buildings – basements, foundations, as well as places on the facades of buildings exposed to rain, snow and groundwater. Application of the new product in the construction industry can increase the durability of materials, preventing the destruction processes caused by weathering, remove excess moisture in damp basements. The surfaces treated by protective compounds acquire antisoiling properties for a long time, and due to reduced thermal conductivity the cost of heating buildings is decreased. The effectiveness of the actions and the relatively low cost of proposed hydrophobizator makes it possible to spread widely the proposed protection method for building structures.

  5. Augmentation of tendon healing with butyric acid-impregnated sutures: biomechanical evaluation in a rabbit model.

    Science.gov (United States)

    Leek, Bryan T; Tasto, James P; Tibor, Lisa M; Healey, Robert M; Freemont, Anthony; Linn, Michael S; Chase, Derek E; Amiel, David

    2012-08-01

    Butyric acid (BA) has been shown to be angiogenic and to enhance transcriptional activity in tissue. These properties of BA have the potential to augment biological healing of a repaired tendon. To evaluate this possibility both biomechanically and histologically in an animal tendon repair model. Controlled laboratory study. A rabbit Achilles tendon healing model was used to evaluate the biomechanical strength and histological properties at 6 and 12 weeks after repair. Unilateral tendon defects were created in the middle bundle of the Achilles tendon of each rabbit, which were repaired equivalently with either Ultrabraid BA-impregnated sutures or control Ultrabraid sutures. After 6 weeks, BA-impregnated suture repairs had a significantly increased (P Tendons repaired with BA-impregnated sutures demonstrated improved biomechanical properties at 6 weeks relative to control sutures, suggesting a neoangiogenic mechanism of enhanced healing through an increased myofibroblast presence. These findings demonstrate that a relatively simple alteration of suture material may augment early tendon healing to create a stronger repair construct during this time.

  6. Micro- and macroscopic study on the porosity of marble as a function of temperature and impregnation

    Science.gov (United States)

    Malaga-Starzec, K.; Akesson, U.; Lindqvist, J. E.; Schouenborg, B.

    2003-04-01

    The thermal weathering of marble is demonstrated by the progressive granular decohesion that leads to an increased porosity and subsequently to loss of strength. In order to determine how temperature cycling initiates changes in the porosity of fresh and impregnated stones: two chemically and petrographically very different marble types were tested for water absorption and ultrasonic velocity propagation and analysed by fluorescence microscopy and nitrogen adsorption. The influence of the impregnation materials: GypStop P17 and P22, both silica sols with different particle size, on changes of the porosity was also evaluated. A separate long-term study of thermal expansion was additionally performed on fresh unimpregnated samples. The results indicated that inter-granular decohesion was more pronounced for the calictic marble than the dolomitic marble. The impregnation materials had a mitigating effect on the granular decohesion. Use of fluorescence microscopy, among the other methods, appears to give inexpensive and reliable information about internal structure of the marbles. A better understanding of the effect that temperature has on the porosity of marble could be used as a guide for election of suitable stone material for exterior use as well as an indication for appropriate conditioning of the samples before physical properties testing.

  7. Bacterial flagella as biotemplate for the synthesis of silver nanoparticle impregnated bionanomaterial

    Energy Technology Data Exchange (ETDEWEB)

    Gopinathan, Priya [Nanobiotechnology Laboratory, Nanotech Research Facility, PSG Institute of Advanced Studies, Coimbatore, 641004 (India); Ashok, Anuradha M. [HRTEM facility, Nanotech Research Facility, PSG Institute of Advanced Studies, Coimbatore, 641004 (India); Selvakumar, R., E-mail: selvabiotech@gmail.com [Nanobiotechnology Laboratory, Nanotech Research Facility, PSG Institute of Advanced Studies, Coimbatore, 641004 (India)

    2013-07-01

    The present study was carried out to synthesize one dimensional silver nanoparticle impregnated flagellar bionanomaterial. Flagella was isolated from Salmonella typhimurium and depolymerised into flagellin monomers. The flagellin monomers were repolymerised again into flagella using suitable technique. The molecular weight of native (NF) and polymerized flagella (PF) was determined using polyacrylamide gel electrophoresis. The NF and PF were used as a template, over which silver nanoparticles were impregnated using in situ chemical reduction process. The synthesized flagellar-silver nanoparticle bionanomaterials were characterized using UV–vis, FT-IR Raman and XRD spectroscopy, and High resolution transmission electron microscopy (HR-TEM). The characterization studies confirmed the attachment of silver nanoparticles over flagella and repolymerised flagella. The size of the silver nanoparticles on the flagella and repolymerised flagella varied and was in the range of 3–11 nm. I–V characteristics of the bionanomaterials were analyzed using Kethley meter which indicated the increase of conductivity after impregnation of silver nanoparticles. The results indicated that flagellar-silver nanoparticle bionanomaterials can be used as a potential one dimensional bionanomaterials for various applications.

  8. Unmodified versus caustics-impregnated carbons for control of hydrogen sulfide emissions from sewage treatment plants

    Energy Technology Data Exchange (ETDEWEB)

    Bandosz, T.J.; Bagreev, A.; Adib, F.; Turk, A.

    2000-03-15

    Unmodified and caustic-impregnated carbons were compared as adsorbents for hydrogen sulfide in the North River Water Pollution Control Plant in New York City over a period of 2 years. The carbons were characterized using accelerated H{sub 2}S breakthrough capacity tests, sorption of nitrogen, potentiometric titration, and thermal analysis. The accelerated laboratory tests indicate that the initial capacity of caustic-impregnated carbons exceeds that of unmodified carbon, but the nature of real-life challenge streams, particularly their lower H{sub 2}S concentrations, nullifies this advantage. As the caustic content of the impregnated carbon is consumed, the situation reverses, and the unmodified carbon becomes more effective. When the concentration of H{sub 2}S is low, the developed surface area and pore volume along with the affinity to retain water create a favorable environment for dissociative adsorption of hydrogen sulfide and its oxidation to elemental sulfur, S{sup 4+}, and S{sup 6+}. In the case of the caustic carbon, the catalytic impact of the carbon surface is limited, and its good performance lasts only while active base is present. The results also show the significant differences in performance of unmodified carbons due to combined effects of their porosity and surface chemistry.

  9. Low Cost, Lightweight Gravity Coring and Improved Epoxy Impregnation Applied to Laminated Maar Sediment in Vietnam

    Directory of Open Access Journals (Sweden)

    Jan P. Schimmelmann

    2018-05-01

    Full Text Available In response to the need for lightweight and affordable sediment coring and high-resolution structural documentation of unconsolidated sediment, we developed economical and fast methods for (i recovering short sediment cores with undisturbed topmost sediment, without the need for a firmly anchored coring platform, and (ii rapid epoxy-impregnation of crayon-shaped subcores in preparation for thin-sectioning, with minimal use of solvents and epoxy resin. The ‘Autonomous Gravity Corer’ (AGC can be carried to remote locations and deployed from an inflatable or makeshift raft. Its utility was tested on modern unconsolidated lacustrine sediment from a ~21 m deep maar lake in Vietnam’s Central Highlands near Pleiku. The sedimentary fabric fidelity of the epoxy-impregnation method was demonstrated for finely laminated artificial flume sediment. Our affordable AGC is attractive not only for work in developing countries, but lends itself broadly for coring in remote regions where challenging logistics prevent the use of heavy coring equipment. The improved epoxy-impregnation technique saves effort and costly chemical reagents, while at the same time preserving the texture of the sediment.

  10. Removal of Lead (II from Aqueous Solution Using Chitosan Impregnated Granular Activated Carbon

    Directory of Open Access Journals (Sweden)

    Ali Mousa Ridha

    2017-03-01

    Full Text Available The use of biopolymer material Chitosan impregnated granular activated carbon CHGAC as adsorbent in the removal of lead ions pb.2+ from aqueous solution was studied using batch adsorption mode. The prepared CHGAC was characterized by Scanning Electronic Microscopy (SEM and atomic-absorption pectrophotometer. The adsorption of lead ions onto Chitosan-impregnated granular activated carbon was examined as a function of adsorbent weight, pH and contact time in Batch system. Langmuir and Freundlich models were employed to analyze the resulting experimental data demonstrated that better fitted by Langmuir isotherm model than Freundlich model, with good correlation coefficient. The maximum adsorption capacity calculated from the pseudo second order model in conformity to the experimental values. This means that the adsorption performance of lead ions onto CHGAC follows a pseudo second order model, which illustrates that the adsorption of Pb2+ onto CHGAC was controlled by chemisorption. The granular activated carbon GAC impregnated by Chitosan was effectively applied as adsorbent for the elimination of lead ions from aqueous solution.

  11. Bacterial flagella as biotemplate for the synthesis of silver nanoparticle impregnated bionanomaterial

    International Nuclear Information System (INIS)

    Gopinathan, Priya; Ashok, Anuradha M.; Selvakumar, R.

    2013-01-01

    The present study was carried out to synthesize one dimensional silver nanoparticle impregnated flagellar bionanomaterial. Flagella was isolated from Salmonella typhimurium and depolymerised into flagellin monomers. The flagellin monomers were repolymerised again into flagella using suitable technique. The molecular weight of native (NF) and polymerized flagella (PF) was determined using polyacrylamide gel electrophoresis. The NF and PF were used as a template, over which silver nanoparticles were impregnated using in situ chemical reduction process. The synthesized flagellar-silver nanoparticle bionanomaterials were characterized using UV–vis, FT-IR Raman and XRD spectroscopy, and High resolution transmission electron microscopy (HR-TEM). The characterization studies confirmed the attachment of silver nanoparticles over flagella and repolymerised flagella. The size of the silver nanoparticles on the flagella and repolymerised flagella varied and was in the range of 3–11 nm. I–V characteristics of the bionanomaterials were analyzed using Kethley meter which indicated the increase of conductivity after impregnation of silver nanoparticles. The results indicated that flagellar-silver nanoparticle bionanomaterials can be used as a potential one dimensional bionanomaterials for various applications.

  12. Impregnating Systems for Producing Wood-Plastic Composite Materials and Resinified Woods by Radiochemical Means

    International Nuclear Information System (INIS)

    Laizier, J.; Laroche, R.; Marchand, J.

    1969-01-01

    The effect of the nature of the components in the impregnation mixture on the characteristics of wood-plastic combinations has been studied in the case of beech by applying a wide variety of compositions. In particular, the effect of water (in the impregnator, and in the form of moisture in the wood) on the characteristics of the products obtained has been determined. It has been shown that, in place of the conventional method for preparing resinified woods (using a ternary monomer-solvent-water mixture), it is possible to use a method involving comonomers, which obviate the need to dry the wood after treatment. The evaluation of the results obtained is based on the value of the impregnation rate and on the modifications in microscopic structure; these emphasize the differences between the types of filler and enable comparisons to be drawn with the dimensional stabilities observed. Measurements of variations in dimensions and the recurrence of moisture have made it possible to establish a classification based on the types of monomer used and the operating conditions. It is shown that a whole range of products is obtained, the properties of which differ widely and are comparatively easily adaptable to the purpose specified. These properties illustrate clearly the differences and characteristics of resinified woods as opposed to conventional wood-plastic materials. (author) [fr

  13. Impregnation of β-tricalcium phosphate robocast scaffolds by in situ polymerization.

    Science.gov (United States)

    Martínez-Vázquez, Francisco J; Perera, Fidel H; van der Meulen, Inge; Heise, Andreas; Pajares, Antonia; Miranda, Pedro

    2013-11-01

    Ring-opening polymerization of ε-caprolactone (ε-CL) and L-lactide (LLA) was performed to impregnate β-tricalcium phosphate (β-TCP) scaffolds fabricated by robocasting. Concentrated colloidal inks prepared from β-TCP commercial powders were used to fabricate porous structures consisting of a 3D mesh of interpenetrating rods. ε-CL and LLA were in situ polymerized within the ceramic structure by using a lipase and stannous octanoate, respectively, as catalysts. The results show that both the macropores inside the ceramic mesh and the micropores within the ceramic rods are full of polymer in either case. The mechanical properties of scaffolds impregnated by in situ polymerization (ISP) are significantly increased over those of the bare structures, exhibiting similar values than those obtained by other, more aggressive, impregnation methods such as melt-immersion (MI). ISP using enzymatic catalysts requires a reduced processing temperature which could facilitate the incorporation of growth factors and other drugs into the polymer composition, thus enhancing the bioactivity of the composite scaffold. The implications of these results for the optimization of the mechanical and biological performance of scaffolds for bone tissue engineering applications are discussed. Copyright © 2013 Wiley Periodicals, Inc.

  14. Effect of preceramic and Zr coating on impregnation behaviors of SiC ceramic composite

    Science.gov (United States)

    Jung, Yang-Il; Kim, Sun-Han; Kim, Hyun-Gil; Park, Jeong-Yong; Koo, Yang-Hyun

    2015-01-01

    SiC fiber-reinforced ceramic composites were fabricated using a polymer impregnation and pyrolysis process. To develop the low temperature process, the pyrolysis was conducted at 600 °C in air. Both a microstructural observation and a mechanical test were utilized for the evaluation of the impregnation. For the impregnation, two kinds of polycarbosilane having a different degree of cross-linking were used. The level of cross-linking affected the ceramic yield of the composites. The cross-linking under oxygen containing atmosphere resulted in a dense matrix and high density of filling. However, tight bonding between the matrix and fibers in the fully dense composite samples, which was obtained using a cross-linking agent of divinylbenzene, turned out to be deteriorative on the mechanical properties. The physical isolation of fibers from matrix phase in the composites was very important to attain a mechanical ductility. The brittle fracture was alleviated by introducing an interphase coating with metallic Zr. The combination of forming the dense matrix and interphase coating should be a necessary condition for the SiCf/SiC fiber-reinforce composite, and it is practicable by controlling the process parameters.

  15. Effect of halide impregnation on elemental mercury removal of activated carbons

    Energy Technology Data Exchange (ETDEWEB)

    Yim, Yoon Ji; Park, Soo Jin [Dept. of Chemistry, Inha University, Incheon (Korea, Republic of)

    2017-02-15

    Activated carbons (ACs) were impregnated with potassium halides (KX) to enhance the removal efficiency of elemental mercury (Hg{sup 0}). In this work, the impregnation effect of potassium bromide (KBr) and potassium iodine (KI) were investigated. The surface properties of KX-ACs were determined by scanning electron microscopy (SEM) and energy dispersive spectroscopy (EDS). The pore structures and total pore volumes of the KX-ACs were analyzed using the N{sub 2} /77 K adsorption isotherms. The Hg{sup 0} removal efficiency of KBr-ACs and KI-ACs was studied under simulated flue gas conditions. The effects of KI and KBr loading, adsorption temperature, and flue gas components on Hg{sup 0} removal efficiency were also investigated. The results showed that the Hg{sup 0} removal efficiency of the ACs was significantly enhanced by KI or KBr impregnation, and KI-ACs showed higher Hg{sup 0} removal efficiency than KBr-ACs under the same conditions. An increase in KI or KBr loading and higher adsorption temperatures improved the Hg{sup 0} removal efficiency, indicating that chemisorption occurred due to the reaction between X− and Hg{sup 0}. The lower extent of Hg{sup 0} removal exhibited by the KBr-ACs than by the KI-ACs was due to the difficulty of Br{sub 2} formation on the surfaces.

  16. An innovative process for the impregnation of magnet coils and other structures

    International Nuclear Information System (INIS)

    Evans, D.; Morgan, J.T.

    1992-01-01

    The need to bond and encapsulate the conductor in many types of superconductive magnet is well understood. The choice of materials for bonding may influence the performance of the coil and the technique used for its application. This paper considers the merits of three types of close-quote bonding close-quote procedure and presents details of an innovative method for the vacuum impregnation of coils. The process has been developed and evaluated in an attempt to remove some of the uncertainties of the vacuum impregnation process that traditionally may be eliminated only with the use of sealed mould tools and high quality vacuum chambers. For large magnets or for mass production, this process may lead to a reduction in tooling and plant costs, together with reduced resin consumption and improved health and safety factors. The process has been developed in conjunction with a resin system that has been designed to exhibit excellent thermal shock characteristics and to minimise preparation time and post impregnation cleaning requirements

  17. Development of silver impregnated alumina for iodine separation from off-gas streams

    Energy Technology Data Exchange (ETDEWEB)

    Funabashi, Kiyomi; Fukasawa, Tetsuo; Kikuchi, Makoto [Energy Research Laboratory, Hitachi (Japan)] [and others

    1995-02-01

    An inorganic iodine adsorbent, silver impregnated alumina (AgA), has been developed to separate iodine effectively from off-gas streams of nuclear facilities and to decrease the volume of waste (spent adsorbent). Iodine removal efficiency was improved at relatively high humidity by using alumina carrier with two different pore diameters. Waste volume reduction was achieved by impregnating relatively large amounts of silver into the alumina pores. The developed adsorbent was tested first with simulated off-gas streams under various experimental conditions and finally with actual off-gas streams of the Karlsruhe reprocessing plant. The decontamination factor (DF) was about 100 with the AgA bed depth of 2cm at 70% relative humidity, which was a DF one order higher than that when AgA with one pore size was used. Iodine adsorption capacity was checked by passing excess iodine into the AgA bed. Values were about 0.12 and 0.35 g-I/cm`-AgA bed for 10 and 24wt% silver impregnated AgA, respectively. The results obtained in this study demonstrated the applicability of the developed AgA to the off-gas treatment system of nuclear facilities.

  18. Prevalent material parameters governing spalling of a slag-impregnated refractory

    Energy Technology Data Exchange (ETDEWEB)

    Blond, E.; Schmitt, N.; Arnould, O.; Hild, F. [LMT-Cachan (ENS de Cachan / CNRS-UMR 8535 / Univ. Paris 6), Cachan (France); Blumenfeld, P. [CRDM / ARCELOR Grande Synthe, Dunkerque (France); Poirier, J. [CRDM / ARCELOR Grande Synthe, Dunkerque (France); CRMHT-CNRS, Orleans (France)

    2004-07-01

    In steel ladle linings, bauxite refractories in contact with iron and steel slag are subjected to complex loadings. To identify the causes of degradation in different reactor linings, a coupling diagram made up of three poles is established: namely, slag impregnation (I), Thermomechanics (TM) and phase transformations (P). The variation of the microstructure and the gradient of the chemical composition resulting from the (I-P) coupling are characterized by microprobe analyses; a natural impregnation tracer is identified. The (I-T) coupling is studied by modeling the refractory lining behavior subjected to a cyclic thermal loading within the framework of the mechanics of porous continua. Parameters governing the location and amplitude of the maximum pore pressure are obtained and their influences are studied. The analysis of the (TM) pole leads to the identification of a thermo-elasto-viscoplastic model for bauxite in various states of slag impregnation. Numerical simulations show that the stress state developed during the heating stages can induce spalling, probably generated by a localized over-pressure of slag. (orig.)

  19. Insecticide Usage and Chemical Contamination Assessment in Asiatic Pennywort

    Science.gov (United States)

    Bumroongsook, S.

    2017-07-01

    The insecticide usage in commercially grown asiatic pennywort plantations in Nakhonpatum and Nonthaburi province, Thailand was surveyed during January-June, 2016. The results showed that asiatic pennywort cuttworms was leaf destructive and caused the most damge to the production. The growers used organophosphate insecticides to control the caterpillars the most, followed by pyrethoid, abamectin, carbamate and organochlorine, respectively. The chemical contaminants of pennywort from 9 fresh markets in Bangkok was monitored, the result indicated that lead was not detected in the samples. The amount of arsenic was less than 0.075 mg / kg. The insecticide residue measurement of dicofol, chlorpyrifos and methidathion was 0.98, 2.84 and 0.46 mg / kg, respectively.

  20. Insecticide resistance in the western flower thrips, Frankliniella occidentalis

    DEFF Research Database (Denmark)

    Jensen, Sten Erik

    of acetylcholinesterase, the target site enzyme for methiocarb. The results from bioassays with synergists included indicated involvement of cytochrome P450- monooxygenases and esterases in methiocarb resistance in the most resistant populations. Selection with methiocarb on one of the populations to increase the level......The western flower thrips, Frankliniella occidentalis (Pergande) is a serious pest on a wide range of crops throughout the world. In Denmark F. occidentalis is a pest in greenhouses. F. occidentalis is difficult to control with insecticides because of its thigmokinetic behaviour and resistance...... to insecticides. Since F. occidentulis spread to become a worldwide pest in 1980’es, resistance to a number of different insecticides has been shown in many populations of F. occidentalis. This flower thrips has the potential of fast development of resistance owing to the short generation time, high fecundity...