WorldWideScience

Sample records for ing eoi tests

  1. Aspectos bionômicos de Eois tegularia (Guenée e Eois glauculata (Walker (Lepidoptera, Geometridae, Larentiinae e seus parasitóides Bionomic aspects of Eois tegularia (Guenée and Eois glauculata (Walker (Lepidoptera, Geometridae, Larentiinae and their parasitoids

    Directory of Open Access Journals (Sweden)

    Sandra Maria Pasenow Braga

    2001-09-01

    Full Text Available Eois tegularia (Guenée, [1858] and Eois glauculata (Walker, [1863] larvae were studied by one year in semidec iduous forest at Canchim Farm (EMBRAPA, São Carlos, São Paulo, Brazil. Specimens were hosted by species of Piper Linnaeus (Piperaceae: P. mollicomum Kunth, P. amalogo Linnaeus, P. glabratum Kunth and P. gaudichaudianum Kunth. Some parasitoids were reared from the larvae of Eois Hübner, 1818 species, as follow. Hymenoptera: Cotesia Cameron, 1891, Apanteles Foerster, 1862, Glyptapanteles Ashmead, 1904, Dolichogenidea Viereck, 1911, Meteorus Haliday, 1835 (Braconidae; Mesochorus Gravenhorst, 1829, Venturia Schrottky, 1902 (Ichneumonidae; Elachertus Spinola, 1811 (Eulophidae; Perilampus Latreille, 1809 (Perilampidae, Diptera: Myiopharus Brauer & Bergenstamm, 1889 (Tachinidae.

  2. Science Teacher Efficacy and Outcome Expectancy as Predictors of Students' End-of-Instruction (EOI) Biology I Test Scores

    Science.gov (United States)

    Angle, Julie; Moseley, Christine

    2009-01-01

    The purpose of this study was to compare teacher efficacy beliefs of secondary Biology I teachers whose students' mean scores on the statewide End-of-Instruction (EOI) Biology I test met or exceeded the state academic proficiency level (Proficient Group) to teacher efficacy beliefs of secondary Biology I teachers whose students' mean scores on the…

  3. Diversification rates, host plant shifts and an updated molecular phylogeny of Andean Eois moths (Lepidoptera: Geometridae.

    Directory of Open Access Journals (Sweden)

    Patrick Strutzenberger

    Full Text Available Eois is one of the best-investigated genera of tropical moths. Its close association with Piper plants has inspired numerous studies on life histories, phylogeny and evolutionary biology. This study provides an updated view on phylogeny, host plant use and temporal patterns of speciation in Eois. Using sequence data (2776 bp from one mitochondrial (COI and one nuclear gene (Ef1-alpha for 221 Eois species, we confirm and reinforce previous findings regarding temporal patterns of diversification. Deep diversification within Andean Eois took place in the Miocene followed by a sustained high rate of diversification until the Pleistocene when a pronounced slowdown of speciation is evident. In South America, Eois diversification is very likely to be primarily driven by the Andean uplift which occurred concurrently with the entire evolutionary history of Eois. A massively expanded dataset enabled an in-depth look into the phylogenetic signal contained in host plant usage. This revealed several independent shifts from Piper to other host plant genera and families. Seven shifts to Peperomia, the sister genus of Piper were detected, indicating that the shift to Peperomia was an easy one compared to the singular shifts to the Chloranthaceae, Siparunaceae and the Piperacean genus Manekia. The potential for close co-evolution of Eois with Piper host plants is therefore bound to be limited to smaller subsets within Neotropical Eois instead of a frequently proposed genus-wide co-evolutionary scenario. In regards to Eois systematics we confirm the monophyly of Neotropical Eois in relation to their Old World counterparts. A tentative biogeographical hypothesis is presented suggesting that Eois originated in tropical Asia and subsequently colonized the Neotropics and Africa. Within Neotropical Eois we were able to identify the existence of six clades not recognized in previous studies and confirm and reinforce the monophyly of all 9 previously delimited

  4. Grow-ING, Age-ING and Die-ING: ING proteins link cancer, senescence and apoptosis

    International Nuclear Information System (INIS)

    Russell, Michael; Berardi, Philip; Gong Wei; Riabowol, Karl

    2006-01-01

    The INhibitor of Growth (ING) family of plant homeodomain (PHD) proteins induce apoptosis and regulate gene expression through stress-inducible binding of phospholipids with subsequent nuclear and nucleolar localization. Relocalization occurs concomitantly with interaction with a subset of nuclear proteins, including PCNA, p53 and several regulators of acetylation such as the p300/CBP and PCAF histone acetyltransferases (HATs), as well as the histone deacetylases HDAC1 and hSir2. These interactions alter the localized state of chromatin compaction, subsequently affecting the expression of subsets of genes, including those associated with the stress response (Hsp70), apoptosis (Bax, MDM2) and cell cycle regulation (p21 WAF1 , cyclin B) in a cell- and tissue-specific manner. The expression levels and subcellular localization of ING proteins are altered in a significant number of human cancer types, while the expression of ING isoforms changes during cellular aging, suggesting that ING proteins may play a role in linking cellular transformation and replicative senescence. The variety of functions attributed to ING proteins suggest that this tumor suppressor serves to link the disparate processes of cell cycle regulation, cell suicide and cellular aging through epigenetic regulation of gene expression. This review examines recent findings in the ING field with a focus on the functions of protein-protein interactions involving ING family members and the mechanisms by which these interactions facilitate the various roles that ING proteins play in tumorigenesis, apoptosis and senescence

  5. In view of the Sixth Framework Programme. An analysis of the EoIs submitted by Dutch entities. Thematic Priority Area Sustainable development, global change and ecosystems

    International Nuclear Information System (INIS)

    Van Mierlo, K.

    2002-01-01

    The FP6 (Sixth Framework Program of the European Union) team of PricewaterhouseCoopers has analysed the EoIs (Expression of Interest) submitted by Dutch parties, as published on the Internet (http://www.cordis.lu/). These 'Dutch EoIs' give a reliable indication of the focus of the Dutch research community, and its participation in pan-European research initiatives. Furthermore, it gives the Dutch submitters of EoIs the opportunity to see what other Dutch parties are involved in their relevant area of research (or in terms of FP6 - Thematic Priority Area (TPA)). The analysis of the Dutch EoIs has been carried out in the first week of October 2002. Considering the dynamics of the EoI database, results from this analysis can vary slightly with searches carried out later in this database

  6. DNA barcode sequencing from old type specimens as a tool in taxonomy: a case study in the diverse genus Eois (Lepidoptera: Geometridae.

    Directory of Open Access Journals (Sweden)

    Patrick Strutzenberger

    Full Text Available In this study we report on the sequencing of the COI barcode region from 96 historical specimens (92 type specimens +4 non-types of Eois. Eois is a diverse clade of tropical geometrid moths and is the target of a number of ongoing studies on life-histories, phylogeny, co-evolution with host plants or parasitoids, and diversity patterns across temporal and spatial dimensions. The unequivocal application of valid names is crucial for all aspects of biodiversity research as well as monitoring and conservation efforts. The availability of barcodes from historical type specimens has the potential to facilitate the much-needed acceleration of species description. We performed non-destructive DNA extraction on the abdomens of Eois specimens between 79 and 157 years of age. We used six primer combinations (recovering between 109 and 130 bp each to target the full-length barcode sequence of each specimen. We were able to obtain sequences for 91 of 96 specimens (success rate 94.8%. Sequence length ranged from 121 bp to full barcode sequences (658 bp, the average sequence length was ~500 bp. We detected a moderately strong and statistically significant negative correlation between specimen age and total sequence length, which is in agreement with expectations. The abdomen proved to be an exceedingly valuable source of DNA in old specimens of Lepidoptera. Barcode sequences obtained in this study are currently being used in an effort towards a step-wise taxonomic revision of Eois. We encourage that DNA barcodes obtained from types specimens should be included in all species descriptions and revisions whenever feasible.

  7. Ingénierie didactique

    OpenAIRE

    Marty , Olivier

    2015-01-01

    Leçon 1 : introduction théoriqueLeçon 2 : concepts fondamentaux de l’ingénierie didactiqueLeçon 3 : construire une ingénierie pédagogiqueLa didactique professionnelle : autour d’un cas pratiqueLeçon 4 : gestion de l’ingénierie de formation; Master; Cours d'ingénierie didactique. Intervention du premier semestre 2015 dans le master Ingénierie de formation de l'université de Lille.Support progressivement mis à disposition des étudiants dans la plateforme d'enseignement à distance Accel (puis co...

  8. RegulatING chromatin regulators

    DEFF Research Database (Denmark)

    Satpathy, Shankha; Nabbi, Arash; Riabowol, Karl

    2013-01-01

    The five human ING genes encode at least 15 splicing isoforms, most of which affect cell growth, differentiation and apoptosis through their ability to alter gene expression by epigenetic mechanisms. Since their discovery in 1996, ING proteins have been classified as type II tumour suppressors on...

  9. Experimental and numerical investigations of radiation characteristics of Russian portable/compact pulsed neutron generators: ING-031, ING-07, ING-06 and ING-10-20-120

    International Nuclear Information System (INIS)

    Chernikova, D.; Romodanov, V.L.; Belevitin, A.G.; Afanas'ev, V.V.; Sakharov, V.K.; Bogolubov, E.P.; Ryzhkov, V.I.; Khasaev, T.O.; Sladkov, A.A.; Bitulev, A.A.

    2014-01-01

    The present paper discusses results of full-scale experimental and numerical investigations of influence of construction materials of portable pulsed neutron generators ING-031, ING-07, ING-06 and ING-10-20-120 (VNIIA, Russia) to their radiation characteristics formed during and after an operation (shutdown period). In particular, it is shown that an original monoenergetic isotropic angular distribution of neutrons emitted by TiT target changes into the significantly anisotropic angular distribution with a broad energy spectrum stretching to the thermal region. Along with the low-energetic neutron part, a significant amount of photons appears during the operation of generators. In the pulse mode of operation of neutron generator, a presence of the construction materials leads to the “tailing” of the original neutron pulse and the appearance of an accompanying photon pulse at ∼3ns after the instant neutron pulse. In addition to that, reactions of neutron capture and inelastic scattering lead to the creation of radioactive nuclides, such as 58 Co, 62 Cu, 64 Cu and 18 F, which form the so-called activation radiation. Thus, the selection of a portable neutron generator for a particular type of application has to be done considering radiation characteristics of the generator itself. This paper will be of interest to users of neutron generators, providing them with valuable information about limitations of a specific generator and with recommendations for improving the design and performance of the generator as a whole

  10. Crystal structure of inhibitor of growth 4 (ING4) dimerization domain reveals functional organization of ING family of chromatin-binding proteins.

    Science.gov (United States)

    Culurgioni, Simone; Muñoz, Inés G; Moreno, Alberto; Palacios, Alicia; Villate, Maider; Palmero, Ignacio; Montoya, Guillermo; Blanco, Francisco J

    2012-03-30

    The protein ING4 binds to histone H3 trimethylated at Lys-4 (H3K4me3) through its C-terminal plant homeodomain, thus recruiting the HBO1 histone acetyltransferase complex to target promoters. The structure of the plant homeodomain finger bound to an H3K4me3 peptide has been described, as well as the disorder and flexibility in the ING4 central region. We report the crystal structure of the ING4 N-terminal domain, which shows an antiparallel coiled-coil homodimer with each protomer folded into a helix-loop-helix structure. This arrangement suggests that ING4 can bind simultaneously two histone tails on the same or different nucleosomes. Dimerization has a direct impact on ING4 tumor suppressor activity because monomeric mutants lose the ability to induce apoptosis after genotoxic stress. Homology modeling based on the ING4 structure suggests that other ING dimers may also exist.

  11. The tumor suppressors p33ING1 and p33ING2 interact with alien in vivo and enhance alien-mediated gene silencing.

    Science.gov (United States)

    Fegers, Inga; Kob, Robert; Eckey, Maren; Schmidt, Oliver; Goeman, Frauke; Papaioannou, Maria; Escher, Niko; von Eggeling, Ferdinand; Melle, Christian; Baniahmad, Aria

    2007-11-01

    The tumor suppressor p33ING1 is involved in DNA repair and cell cycle regulation. Furthermore, p33ING1 is a transcriptional silencer that recognizes the histone mark for trimethylated lysine 4 at histone H3. Interestingly, expression of p33ING1 and p33ING2 is able to induce premature senescence in primary human fibroblasts. The corepressor Alien is involved in gene silencing mediated by selected members of nuclear hormone receptors. In addition, Alien acts as a corepressor for E2F1, a member of the E2F cell cycle regulatory family. Furthermore, recent findings suggest that Alien is complexed with transcription factors participating in DNA repair and chromatin. Here, using a proteomic approach by surface-enhanced laser desorption ionization and mass spectrometry (SELDI-MS) combined with immunological techniques, we show that Alien interacts in vivo with the tumor suppressor p33ING1 as well as with the related tumor suppressor candidate p33ING2. The interaction of Alien with p33ING1 and p33ING2 was confirmed in vitro with GST-pull-down, suggesting a direct binding of Alien to these factors. The binding domain was mapped to a central region of Alien. Functionally, the expression of p33ING1 or p33ING2 enhances the Alien-mediated silencing, suggesting that the interaction plays a role in transcriptional regulation. Thus, the findings suggest that the identified interaction between Alien and the tumor suppressors p33ING1 and p33ING2 reveals a novel cellular protein network.

  12. Immediate relation of ING to fast breeder reactor programs

    Energy Technology Data Exchange (ETDEWEB)

    Lewis, W B

    1969-07-01

    The future large-scale use of nuclear energy is linked in the United States and other major countries to their fast breeder reactor development. Very serious basic problems have been discovered within the last two years, limiting the life in the high fast neutron flux at appropriate temperatures of materials, in particular of metals suitable for fuel cladding in sodium coolant. There is therefore a most urgent need for materials testing facilities under controlled conditions of temperature and neutron flux at sufficiently high ratings to match or surpass those required in commercially competitive fast breeder reactors. None of the test facilities yet planned for 1976 or sooner in the western world appears to match these conditions. The problem is mainly the difficulty of providing the high neutron flux effectively continuously. The spallation reaction in heavy elements was chosen as the basis of ING - the intense neutron generator, because it is the only known reaction that promises a fast neutron source density that is higher than can be controlled from the fission process. It is suggested that several countries will wish to consider urgently whether they should also explore the spallation reaction for the purpose of a fast neutron irradiation test facility. In view of the discontinuance of the ING project in Canada a favourable opportunity will exist over the next few months 10 obtain from Canada by direct personal contact details of the significant study that has been carried on for ING over the last five years. In the event that satisfactory materials are established within the lifetime of the spallation facilities they may continue to be used for the production of selected isotopes more profitably produced in high neutron fluxes. The facilities may be also used for the desirable preirradiation of thorium reactor fuel. The other research purposes planned for ING could also be served. (author)

  13. Immediate relation of ING to fast breeder reactor programs

    International Nuclear Information System (INIS)

    Lewis, W.B.

    1969-01-01

    The future large-scale use of nuclear energy is linked in the United States and other major countries to their fast breeder reactor development. Very serious basic problems have been discovered within the last two years, limiting the life in the high fast neutron flux at appropriate temperatures of materials, in particular of metals suitable for fuel cladding in sodium coolant. There is therefore a most urgent need for materials testing facilities under controlled conditions of temperature and neutron flux at sufficiently high ratings to match or surpass those required in commercially competitive fast breeder reactors. None of the test facilities yet planned for 1976 or sooner in the western world appears to match these conditions. The problem is mainly the difficulty of providing the high neutron flux effectively continuously. The spallation reaction in heavy elements was chosen as the basis of ING - the intense neutron generator, because it is the only known reaction that promises a fast neutron source density that is higher than can be controlled from the fission process. It is suggested that several countries will wish to consider urgently whether they should also explore the spallation reaction for the purpose of a fast neutron irradiation test facility. In view of the discontinuance of the ING project in Canada a favourable opportunity will exist over the next few months 10 obtain from Canada by direct personal contact details of the significant study that has been carried on for ING over the last five years. In the event that satisfactory materials are established within the lifetime of the spallation facilities they may continue to be used for the production of selected isotopes more profitably produced in high neutron fluxes. The facilities may be also used for the desirable preirradiation of thorium reactor fuel. The other research purposes planned for ING could also be served. (author)

  14. ING1 induces apoptosis through direct effects at the mitochondria

    DEFF Research Database (Denmark)

    Bose, P; Thakur, S; Thalappilly, S

    2013-01-01

    The ING family of tumor suppressors acts as readers and writers of the histone epigenetic code, affecting DNA repair, chromatin remodeling, cellular senescence, cell cycle regulation and apoptosis. The best characterized member of the ING family, ING1,interacts with the proliferating cell nuclear....... Bioinformatic analysis of the yeast interactome indicates that yeast ING proteins interact with 64 mitochondrial proteins. Also, sequence analysis of ING1 reveals the presence of a BH3-like domain. These data suggest a model in which stress-induced cytoplasmic relocalization of ING1 by14-3-3 induces ING1-BAX...

  15. SUMOylation of the ING1b tumor suppressor regulates gene transcription

    DEFF Research Database (Denmark)

    Satpathy, Shankha; Guérillon, Claire; Kim, Tae-Sun

    2014-01-01

    members of histone deacetylase complexes, whereas ING3-5 are stoichiometric components of different histone acetyltransferase complexes. The INGs target these complexes to histone marks, thus acting as epigenetic regulators. ING proteins affect angiogenesis, apoptosis, DNA repair, metastasis......1b E195A), we further demonstrate that ING1b SUMOylation regulates the binding of ING1b to the ISG15 and DGCR8 promoters, consequently regulating ISG15 and DGCR8 transcription. These results suggest a role for ING1b SUMOylation in the regulation of gene transcription....

  16. Engineering challenges in ING

    International Nuclear Information System (INIS)

    Wolfe, W.A.

    1965-01-01

    With the Intense Neutron Generator (ING) we intend to produce a neutron flux of 10 16 n/cm 2 sec. Bismuth, bombarded by 1 GeV protons, yields about 20 neutrons per proton with a heat output of 23 MeV/neutron. A circulating liquid bismuth target will dissipate about 34 MW of heat. To produce the beam we will accelerate protons in a separated orbit cyclotron. The 65 mA current will require about 70-75 MW of radio-frequency power (50-200 Mc/s). We must generate and transmit RF efficiently. In ING precise magnet-fields, resonating-cavity electric-fields and well maintained vacuum (10 -6 torr) will place demands on most of today's engineering technology. (author)

  17. Model(ing) Law

    DEFF Research Database (Denmark)

    Carlson, Kerstin

    The International Criminal Tribunal for the former Yugoslavia (ICTY) was the first and most celebrated of a wave of international criminal tribunals (ICTs) built in the 1990s designed to advance liberalism through international criminal law. Model(ing) Justice examines the case law of the ICTY...

  18. ING3 promotes prostate cancer growth by activating the androgen receptor.

    Science.gov (United States)

    Nabbi, Arash; McClurg, Urszula L; Thalappilly, Subhash; Almami, Amal; Mobahat, Mahsa; Bismar, Tarek A; Binda, Olivier; Riabowol, Karl T

    2017-05-16

    The androgen receptor (AR) is a major driver of prostate cancer, and increased AR levels and co-activators of the receptor promote the development of prostate cancer. INhibitor of Growth (ING) proteins target lysine acetyltransferase or lysine deacetylase complexes to the histone H3K4Me3 mark of active transcription, to affect chromatin structure and gene expression. ING3 is a stoichiometric member of the TIP60 lysine acetyltransferase complex implicated in prostate cancer development. Biopsies of 265 patients with prostate cancer were stained for ING3, pan-cytokeratin, and DNA. LNCaP and C4-2 androgen-responsive cells were used for in vitro assays including immunoprecipitation, western blotting, Luciferase reporter assay and quantitative polymerase chain reaction. Cell viability and migration assays were performed in prostate cancer cell lines using scrambled siRNA or siRNA targeting ING3. We find that ING3 levels and AR activity positively correlate in prostate cancer. ING3 potentiates androgen effects, increasing expression of androgen-regulated genes and androgen response element-driven reporters to promote growth and anchorage-independent growth. Conversely, ING3 knockdown inhibits prostate cancer cell growth and invasion. ING3 activates the AR by serving as a scaffold to increase interaction between TIP60 and the AR in the cytoplasm, enhancing receptor acetylation and translocation to the nucleus. Activation is independent of ING3's ability to target the TIP60 complex to H3K4Me3, identifying a previously unknown chromatin-independent cytoplasmic activity for ING3. In agreement with in vitro observations, analysis of The Cancer Genome Atlas (TCGA) data (n = 498) and a prostate cancer tissue microarray (n = 256) show that ING3 levels are higher in aggressive prostate cancers, with high levels of ING3 predicting shorter patient survival in a low AR subgroup. Including ING3 levels with currently used indicators such as the Gleason score provides more

  19. Engineering challenges in ING

    Energy Technology Data Exchange (ETDEWEB)

    Wolfe, W A

    1965-07-01

    With the Intense Neutron Generator (ING) we intend to produce a neutron flux of 10{sup 16} n/cm{sup 2} sec. Bismuth, bombarded by 1 GeV protons, yields about 20 neutrons per proton with a heat output of 23 MeV/neutron. A circulating liquid bismuth target will dissipate about 34 MW of heat. To produce the beam we will accelerate protons in a separated orbit cyclotron. The 65 mA current will require about 70-75 MW of radio-frequency power (50-200 Mc/s). We must generate and transmit RF efficiently. In ING precise magnet-fields, resonating-cavity electric-fields and well maintained vacuum (10{sup -6} torr) will place demands on most of today's engineering technology. (author)

  20. 75 FR 16456 - Inglis Hydropower, LLC; Notice Soliciting Scoping Comments

    Science.gov (United States)

    2010-04-01

    ... Hydropower, LLC; Notice Soliciting Scoping Comments March 26, 2010. Take notice that the following...: Inglis Hydropower, LLC. e. Name of Project: Inglis Hydropower Project. f. Location: The proposed project... Commission staff intends to prepare a single Environmental Assessment (EA) for the Inglis Hydropower Project...

  1. LACEwING: A New Moving Group Analysis Code

    Energy Technology Data Exchange (ETDEWEB)

    Riedel, Adric R. [Department of Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States); Blunt, Sarah C.; Faherty, Jacqueline K. [Department of Astrophysics, American Museum of Natural History, New York, NY 10024 (United States); Lambrides, Erini L. [Department of Physics and Astronomy, Johns Hopkins University, Baltimore, MD 21218 (United States); Rice, Emily L. [Department of Engineering Science and Physics, The College of Staten Island, Staten Island, NY 10314 (United States); Cruz, Kelle L., E-mail: arr@astro.caltech.edu [Department of Physics and Astronomy, Hunter College, New York, NY 10065 (United States)

    2017-03-01

    We present a new nearby young moving group (NYMG) kinematic membership analysis code, LocAting Constituent mEmbers In Nearby Groups (LACEwING), a new Catalog of Suspected Nearby Young Stars, a new list of bona fide members of moving groups, and a kinematic traceback code. LACEwING is a convergence-style algorithm with carefully vetted membership statistics based on a large numerical simulation of the Solar Neighborhood. Given spatial and kinematic information on stars, LACEwING calculates membership probabilities in 13 NYMGs and three open clusters within 100 pc. In addition to describing the inputs, methods, and products of the code, we provide comparisons of LACEwING to other popular kinematic moving group membership identification codes. As a proof of concept, we use LACEwING to reconsider the membership of 930 stellar systems in the Solar Neighborhood (within 100 pc) that have reported measurable lithium equivalent widths. We quantify the evidence in support of a population of young stars not attached to any NYMGs, which is a possible sign of new as-yet-undiscovered groups or of a field population of young stars.

  2. ING1 and 5-azacytidine act synergistically to block breast cancer cell growth.

    Directory of Open Access Journals (Sweden)

    Satbir Thakur

    Full Text Available Inhibitor of Growth (ING proteins are epigenetic "readers" that recognize trimethylated lysine 4 of histone H3 (H3K4Me3 and target histone acetyl transferase (HAT and histone deacetylase (HDAC complexes to chromatin.Here we asked whether dysregulating two epigenetic pathways with chemical inhibitors showed synergistic effects on breast cancer cell line killing. We also tested whether ING1 could synergize better with chemotherapeutics that target the same epigenetic mechanism such as the HDAC inhibitor LBH589 (Panobinostat or a different epigenetic mechanism such as 5-azacytidine (5azaC, which inhibits DNA methyl transferases. Simultaneous treatment of breast cancer cell lines with LBH589 and 5azaC did not show significant synergy in killing cells. However, combination treatment of ING1 with either LBH589 or 5azaC did show synergy. The combination of ING1b with 5azaC, which targets two distinct epigenetic mechanisms, was more effective at lower doses and enhanced apoptosis as determined by Annexin V staining and cleavage of caspase 3 and poly-ADP-ribose polymerase (PARP. ING1b plus 5azaC also acted synergistically to increase γH2AX staining indicating significant levels of DNA damage were induced. Adenoviral delivery of ING1b with 5azaC also inhibited cancer cell growth in a murine xenograft model and led to tumor regression when viral concentration was optimized in vivo.These data show that targeting distinct epigenetic pathways can be more effective in blocking cancer cell line growth than targeting the same pathway with multiple agents, and that using viral delivery of epigenetic regulators can be more effective in synergizing with a chemical agent than using two chemotherapeutic agents. This study also indicates that the ING1 epigenetic regulator may have additional activities in the cell when expressed at high levels.

  3. Co-Story-ing: Collaborative Story Writing with Children Who Fear

    Science.gov (United States)

    Pehrsson, Dale-Elizabeth

    2007-01-01

    This article offers a guide for using collaborative story writing (co-story-ing), an assessment technique as well as a therapeutic intervention for children who demonstrate fears, extreme shyness and difficulty in establishing relationships. Co-story-ing draws from Gardner's Mutual Story Telling Technique. Co-story-ing guides clients as they…

  4. Modulators of inhibitor of growth (ING) family expression in development and disease.

    Science.gov (United States)

    Maher, Stacey K; Helbing, Caren C

    2009-05-01

    The inhibitor of growth (ING) gene family proteins regulate many critical cellular processes such as cell proliferation and growth, apoptosis, DNA repair, senescence, angiogenesis, and drug resistance. Their transcripts and proteins are differentially expressed in health and disease and there is evidence for developmental regulation. The vast majority of studies have characterized ING levels in the context of cancer. However, relatively little attention has been paid to the expression of ING family members in other contexts. This review summarizes the findings from human and animal model systems that provide insight into the factors influencing the expression of these important proteins. We examine the influence of cell cycle and aging as well as genotoxic stress on ING expression levels and evaluate several emerging areas of inquiry demonstrating that ING gene activity may be modulated by factors such as the p53 tumor suppressor, DNA methylation, and ING proteins themselves with external factors such as hormones, reactive oxygen species, TGFbeta signalling, and other proteins of pathological significance also influencing ING levels. We then briefly discuss the influence of post-translational modification and changes in subcellular localization as it pertains to modulation of ING expression. Understanding how ING expression is modulated represents a vital aspect of effective drug targeting strategies.

  5. Inge Lehmann’s work materials and seismological epistolary archive

    Directory of Open Access Journals (Sweden)

    Erik Hjortenberg

    2009-06-01

    Full Text Available

     

    The Inge Lehmann archive contains thousands of seismological work documents from Inge Lehmann’s private home. For a long time the author thought that the main concern was to keep the documents for posterity. There is now a renewed interest in Inge Lehmann, and some documents were presented in a poster at ESC Potsdam 2004, and the collection of documents were scanned and catalogued 2005-2006 at Storia Geofisica Ambiente in Bologna. Inge Lehmann (1888-1993 is famous for her discovery in 1936 of the earth’s inner core and for work on the upper mantle. A short biography is given. After her retirement in 1953 she worked at home in Denmark, and abroad in USA and in Canada. She took part in the creation of the European Seismological Commission in 1951, and in the creation of the International Seismological Centre in 1964. Inge Lehmann received many awards. Some letters from her early correspondence with Harold Jeffreys are discussed, they show how the inner core was discussed already in 1932. A few of the author’s reminiscences of Inge Lehmann are given.


  6. Elusloom lennukiga puhkusele / Inge Parring

    Index Scriptorium Estoniae

    Parring, Inge

    2003-01-01

    Ilmunud ka: Delovõje Vedomosti 1. okt. lk. 13. Air Cargo Estonia/ACE Logisticsi müügijuht Inge Parring tutvustab elusloomade transpordivõimalusi. Vt. samas: Loomade transportimiseks vajalikud dokumendid

  7. Nuclear localization signal of ING4 plays a key role in its binding to p53

    International Nuclear Information System (INIS)

    Zhang Xin; Wang Kesheng; Wang Zhiqin; Xu Lusheng; Wang Qingwan; Chen Fei; Wei Dongzhi; Han Zeguang

    2005-01-01

    ING4, a novel member of ING family, is recently reported to interact with tumor suppressor p53 and negatively regulate the cell growth with significant G2/M arrest of cell cycle in HepG2 cells through upregulation of p53-inducible gene p21. However, which region of ING4 could have contributed to the binding to p53 remains largely unclear. Herein, the GST-pulldown experiments revealed that the middle region of ING4, a potential bipartite nuclear localization signal (NLS), could be involved in the binding to p53. Furthermore, the interaction of ING4 to p53 was abrogated in vitro and in vivo when certain mutations or the entire deletion of the NLS domain occurred. More interestingly, the mutations of the NLS domain could alter the ING4 nuclear localization, disrupt the interaction of ING4 with p53, and even, deregulate the p53-inducible gene p21 in MCF-7 cells. All data indicated that the NLS domain of ING4 is essential for the binding of ING4 to p53 and the function of ING4 associated with p53

  8. Cooperation of Ad-hING4 and 125I seed in tumor-suppression on human pancreatic cancer xenograft in nude mice

    International Nuclear Information System (INIS)

    Zhai Hongyan; Fa Yihua; Su Chenghai; Yang Jicheng; Sheng Weihua; Xie Yufeng

    2009-01-01

    This work is to investigate the combined tumor-suppression effect of Adenovirus-mediated human ING4 (Ad-hING4) and 125 I seed on human pancreatic cancer xenograft and the possible mechanisms. Ad-hING4 recombinant adenovirus vector was transected into QBI-293A cells and high titre adenovirus was obtained. Subcutaneous tumor models were established with 25 nude mice with human pancreatic cancer cell line PANC-1. They were randomly divided into 5 groups: PBS control group, Ad carrier group, 125 I seed brachytherapy group, Ad-hING4 gene treatment group, combined 125 I seed and Ad-hING4 group. The tumor volumes were measured every 5 days after treatment, and were sacrificed on the 20th day. The tumors were measured and weighed to determine the ratio of tumor-suppression and Jin-Shi q value. Morphological changes of tumor cells,the tissue injury and apoptotic index AI were examined on pathological sections. MVD, Survivin and Caspase3 were tested in immunohistochemistry. The results show that the tumor-suppressive ratio of the 125 I seed group, Ad-hING4 group, combined treatment group were,respectively, 34.19%(P 0.05). It can be concluded that 125 I seed and Ad-hING4 inhibit the growth of PANC-1 pancreatic cancer on nude mice significantly. These indicate a synergy of the combined treatments in tumor-suppression and Ad-hING4 is a promising novel radiosensitizer. The mechanisms of tumor-suppressive may be multi-pathways such as down-regulation the expression of Survivin and up-regulation the expression of Caspase3 to induce apoptosis and inhibit angiogenesis. (authors)

  9. 75 FR 65620 - Inglis Hydropower, LLC; Notice of Application Ready for Environmental Analysis and Soliciting...

    Science.gov (United States)

    2010-10-26

    ... Hydropower, LLC; Notice of Application Ready for Environmental Analysis and Soliciting Comments...: Inglis Hydropower, LLC. e. Name of Project: Inglis Hydropower Project. f. Location: The project would be... ready for environmental analysis at this time. l. The proposed 2.0-megawatt Inglis Hydropower Project...

  10. ING Genes Work as Tumor Suppressor Genes in the Carcinogenesis of Head and Neck Squamous Cell Carcinoma

    Directory of Open Access Journals (Sweden)

    Xiaohan Li

    2011-01-01

    Full Text Available Head and neck squamous cell carcinoma (HNSCC is the sixth most common cancer in the world. The evolution and progression of HNSCC are considered to result from multiple stepwise alterations of cellular and molecular pathways in squamous epithelium. Recently, inhibitor of growth gene (ING family consisting of five genes, ING1 to ING5, was identified as a new tumor suppressor gene family that was implicated in the downregulation of cell cycle and chromatin remodeling. In contrast, it has been shown that ING1 and ING2 play an oncogenic role in some cancers, this situation being similar to TGF-β. In HNSCC, the ING family has been reported to be downregulated, and ING translocation from the nucleus to the cytoplasm may be a critical event for carcinogenesis. In this paper, we describe our recent results and briefly summarize current knowledge regarding the biologic functions of ING in HNSCC.

  11. De quels ingénieurs parle-t-on ? Situation et trajectoires des ingénieurs des grandes écoles. Le cas du Maroc

    Directory of Open Access Journals (Sweden)

    Pierre Vermeren

    2009-05-01

    Full Text Available Cet article est consacré au cas des « ingénieurs de conception » marocains, formés la plupart du temps dans les grandes écoles françaises. Cette fraction des ingénieurs marocains (dont la majorité est formée dans les écoles d'ingénieurs du Maroc n'est pas loin de constituer une véritable aristocratie de fonction. Ce phénomène illustre la structure sociale très inégalitaire du Maroc et la stratification opérée par la monarchie (le Makhzen pour sélectionner ses élites, qui sont aujourd'hui des élites à la fois technocratiques et sociales. Cette domination des « technocrates » sur l'appareil d'Etat marocain, analysée ici à travers des publics étudiants de grandes écoles, s'accompagne de l'émergence d'une contre-élite sociale de contestation. Les écoles d'ingénieurs de second rang, peuplées par les éléments des classes moyennes, ont été le premier terreau des mouvements islamistes en milieu universitaire. Elles produisent aujourd'hui une contre-élite politique et sociale qui piétine aux portes du vrai pouvoir.

  12. Idiopathic nodular glomerulosclerosis (ING) in an African American (AA) man with hepatitis C.

    Science.gov (United States)

    Onteddu, Nirmal K; Duggirala, Jayasri; Reddy, Anand C

    2018-05-18

    Idiopathic nodular glomerulosclerosis (ING) in a non-diabetic patient is uncommon. Nodular glomerulosclerosis is hallmark sign of diabetic nephropathy. ING is a very rare clinicopathological disease associated with smoking, obesity and hypertension, chronic obstructive pulmonary disease and metabolic syndrome. A 68-year-old non-obese African American man with hypertension, smoking and history of hepatitis C presented to the clinic with progressive worsening of lower extremity oedema and declining renal function over few months. Renal biopsy demonstrated nodular glomerulosclerosis. In this case, ING is hypothesised to be associated with hepatitis C along with smoking and hypertension (HTN). We present this case to speculate the existence of yet unknown aetiologies of ING. © BMJ Publishing Group Ltd (unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  13. ING status report July 1967

    Energy Technology Data Exchange (ETDEWEB)

    Church, T G

    1967-07-01

    Evolution of ING from initial concept to advanced systems and the interplay between participating disciplines are illustrated in Fig. 1.2. Anticipated requirements for intense continuous fluxes of thermal neutrons set the initial goal and dictated the scale and other guidelines of the system including the desired completion date. While neutron applications were given prime consideration in conceptual planning, much wider fields of research, both pure and applied, would benefit from the facility now being studied. (author)

  14. ING status report July 1967

    International Nuclear Information System (INIS)

    Church, T.G.

    1967-01-01

    Evolution of ING from initial concept to advanced systems and the interplay between participating disciplines are illustrated in Fig. 1.2. Anticipated requirements for intense continuous fluxes of thermal neutrons set the initial goal and dictated the scale and other guidelines of the system including the desired completion date. While neutron applications were given prime consideration in conceptual planning, much wider fields of research, both pure and applied, would benefit from the facility now being studied. (author)

  15. introduction à l'ingénierie documentaire et aux sciences de l'information

    OpenAIRE

    Guyot, Brigitte

    2011-01-01

    polycopié introductif pour la formation chef de projet en ingénierie documentaire, Cnam; introductory course on documentary engineering: definition, applications, objects, process, actors of the market, historical elements; cours introductif à l'ingénierie documentaire : positionnement, objets, processus, acteurs du marché, repères historiques

  16. N-methyl-N-nitro-N-nitrosoguanidine-mediated ING4 downregulation contributed to the angiogenesis of transformed human gastric epithelial cells.

    Science.gov (United States)

    Chen, Yansu; Fu, Rui; Xu, Mengdie; Huang, Yefei; Sun, Guixiang; Xu, Lichun

    2018-04-15

    Angiogenesis is associated with the progression and mortality of gastric cancer. Epidemiological evidences indicate that long-term N-nitroso compounds (NOCs) exposure predominantly contributes to the mortality of gastric cancer. Therefore, further reduced mortality of gastric cancer demands to explore the exact mechanisms of NOCs induced angiogenesis. As a tumor suppressor gene, inhibitor of growth protein 4 (ING4) plays an important role in pathological angiogenesis. In this study, we will investigate ING4 expression level in human gastric epithelial cells after the long-term low dose exposure of N-methyl-N-nitro-N-nitrosoguanidine (MNNG) and the pathological impact of MNNG-reduced ING4 on angiogenesis of transformed cells. The soft agar colony formation assay, Western blotting, immunofluorescence and wound healing assay were used to evaluate the characteristics of transformed cells. HUVEC growth and tube formation assays were performed to test the angiogenic abilities. EMSA, luciferase reporter gene assay, real-time PCR and Western blotting were used to explore the exact mechanism. By establishing transformed human gastric epithelial cells via chronic low dose treatment, a gradually ING4 downregulation was observed in the later-stage of MNNG-induced cell transformation. Moreover, we demonstrated that MNNG exposure-reduced ING4 expression significantly resulted into aggravating angiogenesis through increasing the phosphorylation level of NF-κB p65 and subsequently DAN binding activity and regulating the expressions of NF-κB p65 downstream pro-angiogenic genes, MMP-2 and MMP-9. Our findings provided a significant mechanistic insight into angiogenesis of MNNG-transformed human gastric epithelial cell and supported the concept that ING4 may be a relevant therapeutic target for gastric cancer. Copyright © 2018 Elsevier Inc. All rights reserved.

  17. The inhibitor of growth protein 5 (ING5 depends on INCA1 as a co-factor for its antiproliferative effects.

    Directory of Open Access Journals (Sweden)

    Feng Zhang

    Full Text Available The proteins of the Inhibitor of Growth (ING family are involved in multiple cellular functions such as cell cycle regulation, apoptosis, and chromatin remodeling. For ING5, its actual role in growth suppression and the necessary partners are not known. In a yeast-two-hybrid approach with human bone marrow derived cDNA, we identified ING5 as well as several other proteins as interaction partners of Inhibitor of cyclin A1 (INCA1 that we previously characterized as a novel interaction partner of cyclin A1/CDK2. ING5 expression in leukemic AML blasts was severely reduced compared to normal bone marrow. In line, ING5 inhibited bone marrow colony formation upon retroviral transduction. However, Inca1(-/- bone marrow colony formation was not suppressed by ING5. In murine embryonic fibroblast (MEF cells from Inca1(+/+ and Inca1(-/- mice, overexpression of ING5 suppressed cell proliferation only in the presence of INCA1, while ING5 had no effect in Inca1(-/- MEFs. ING5 overexpression induced a delay in S-phase progression, which required INCA1. Finally, ING5 overexpression enhanced Fas-induced apoptosis in Inca1(+/+ MEFs, while Inca1(-/- MEFs were protected from Fas antibody-induced apoptosis. Taken together, these results indicate that ING5 is a growth suppressor with suppressed expression in AML whose functions depend on its interaction with INCA1.

  18. 78 FR 39023 - ING Investments, LLC, et al.;

    Science.gov (United States)

    2013-06-28

    ... SECURITIES AND EXCHANGE COMMISSION [Investment Company Act Release No. 30566; File No. 812-14111] ING Investments, LLC, et al.; Notice of Application June 24, 2013. AGENCY: Securities and Exchange Commission (``Commission''). ACTION: Notice of an application under section 6(c) of the Investment Company...

  19. The 'Techniques de l'ingénieur' available online at CERN!

    CERN Multimedia

    2001-01-01

    Those already familiar with 'Techniques de l'ingénieur' will be delighted. This engineering technology database widely known among French-speaking engineers and technicians can now be consulted online from the CERN Intranet until the end of the summer. To access this database of reference articles in French, all you need to do is go to the CERN Library's Web pages (http://library.cern.ch) and click on the 'Techniques de l'ingénieur' link under the 'News' heading. The Library will be monitoring the use of the database for a couple of months, at the end of which an access licence may be negotiated. Don't hesitate to use it because the decision whether or not to purchase it will depend on the extent to which it is used. The Library is seeking partners within the Laboratory to finance the purchase if it is decided to go ahead with it. Contributions from the CERN community are therefore welcome. For those who are not yet familiar with it, the 'Techniques de l'ingénieur' database ...

  20. 77 FR 58375 - Inglis Hydropower, LLC; Notice of Preliminary Permit Application Accepted for Filing and...

    Science.gov (United States)

    2012-09-20

    ... Hydropower, LLC; Notice of Preliminary Permit Application Accepted for Filing and Soliciting Comments, Motions To Intervene, and Competing Applications On May 18, 2012, Inglis Hydropower, LLC filed an... study the feasibility of a hydropower project located at the Inglis Bypass Channel, located on the...

  1. Pour une ingénierie des Environnements Informatiques pour l'Apprentissage Humain

    OpenAIRE

    Tchounikine , Pierre

    2002-01-01

    Nous proposons dans cet article une réflexion sur la notion d'ingénierie des EIAH (Environnements Informatiques pour l'Apprentissage Humain). Nous posons tout d'abord une définition de l'ingénierie des EIAH : travaux visant à définir des éléments de méthodes et de techniques reproductibles et/ou réutilisables facilitant la mise en place (conception – réalisation – expérimentation – évaluation - diffusion) d'environnements de formation ou d'apprentissage (dans leur articulation avec les dispos...

  2. The ING Seismic Network Databank (ISND : a friendly parameters and waveform database

    Directory of Open Access Journals (Sweden)

    G. Smriglio

    1995-06-01

    Full Text Available he Istituto Nazionale di Geofisica (ING Seismic Network Database (ISND includes over 300000 arrivaI times of Italian, Mediterranean and teleseismic earthquakes from 1983 to date. This database is a useful tool for Italian and foreign seismologists ( over 1000 data requests in the first 6 months of this year. Recently (1994 the ING began storing in the ISND, the digital waveforms associated with arri,Tal times and experimen- tally allowed users to retrieve waveforms recorded by the ING acquisition system. In this paper we describe the types of data stored and the interactive and batch procedures available to obtain arrivaI times and/or asso- ciated waveforms. The ISND is reachable via telephone line, P.S.I., Internet and DecNet. Users can read and send to their E-mail address alI selected earthquakes locations, parameters, arrivaI times and associated digital waveforms (in SAC, SUDS or ASCII format. For r;aedium or large amounts of data users can ask to receive data by means of magnetic media (DAT, Video 8, floppy disk.

  3. How Inge Lehmann Discovered the Inner Core of the Earth

    Science.gov (United States)

    Rousseau, Christiane

    2013-01-01

    The mathematics behind Inge Lehmann's discovery that the inner core of the Earth is solid is explained using data collected around the Earth on seismic waves and their travel time through the Earth.

  4. 76 FR 45303 - ING Asia Pacific High Dividend Equity Income Fund, et al.; Notice of Application

    Science.gov (United States)

    2011-07-28

    ... Premium Opportunity Fund (``IGA''); ING Global Equity Dividend and Premium Opportunity Fund (``IGD''); ING... Exchange. PRT has also issued preferred shares. Each Current Fund reserves the right to issue preferred... market price and its net asset value per common share (``NAV'')) and the relationship between such Fund's...

  5. 75 FR 10230 - Inglis Hydropower, LLC; Notice of Application Accepted for Filing and Soliciting Motions To...

    Science.gov (United States)

    2010-03-05

    ... Hydropower, LLC; Notice of Application Accepted for Filing and Soliciting Motions To Intervene and Protests... No.: P-12783-003. c. Date filed: July 22, 2009. d. Applicant: Inglis Hydropower, LLC. e. Name of Project: Inglis Hydropower Project. f. Location: The proposed project would be located at the existing...

  6. Efficacy of combining ING4 and TRAIL genes in cancer-targeting gene virotherapy strategy: first evidence in preclinical hepatocellular carcinoma.

    Science.gov (United States)

    Galal El-Shemi, A; Mohammed Ashshi, A; Oh, E; Jung, B-K; Basalamah, M; Alsaegh, A; Yun, C-O

    2018-01-01

    Current treatments of hepatocellular carcinoma (HCC) are ineffective and unsatisfactory in many aspects. Cancer-targeting gene virotherapy using oncolytic adenoviruses (OAds) armed with anticancer genes has shown efficacy and safety in clinical trials. Nowadays, both inhibitor of growth 4 (ING4), as a multimodal tumor suppressor gene, and tumor necrosis factor-related apoptosis-inducing ligand (TRAIL), as a potent apoptosis-inducing gene, are experiencing a renaissance in cancer gene therapy. Herein we investigated the antitumor activity and safety of mono- and combined therapy with OAds armed with ING4 (Ad-ΔB/ING4) and TRAIL (Ad-ΔB/TRAIL) gene, respectively, on preclinical models of human HCC. OAd-mediated expression of ING4 or TRAIL transgene was confirmed. Ad-ΔB/TRAIL and/or Ad-ΔB/ING4 exhibited potent killing effect on human HCC cells (HuH7 and Hep3B) but not on normal liver cells. Most importantly, systemic therapy with Ad-ΔB/ING4 plus Ad-ΔB/TRAIL elicited more eradicative effect on an orthotopic mouse model of human HCC than their monotherapy, without causing obvious overlapping toxicity. Mechanistically, Ad-ΔB/ING4 and Ad-ΔB/TRAIL were remarkably cooperated to induce antitumor apoptosis and immune response, and to repress tumor angiogenesis. This is the first study showing that concomitant therapy with Ad-ΔB/ING4 and Ad-ΔB/TRAIL may provide a potential strategy for HCC therapy and merits further investigations to realize its possible clinical translation.

  7. 18 January 2011 - Ing. Vittorio Malacalza, ASG Superconductors S.p.A, Italy in the LHC superconducting magnet test hall with Deputy Department Head L. Rossi, in the LHC tunnel at Point 5 and CMS experimental area with Spokesperson G. Tonelli.

    CERN Multimedia

    Maximilien Brice

    2011-01-01

    18 January 2011 - Ing. Vittorio Malacalza, ASG Superconductors S.p.A, Italy in the LHC superconducting magnet test hall with Deputy Department Head L. Rossi, in the LHC tunnel at Point 5 and CMS experimental area with Spokesperson G. Tonelli.

  8. Ingénierie des compétences et scénarisation pédagogique

    Directory of Open Access Journals (Sweden)

    Josianne Basque

    2007-01-01

    Full Text Available Cet article décrit un processus d’ingénierie éducative orienté compétences d’une activité d’autoévaluation et son intégration à un scénario pédagogique de cours à distance. Cette description est documentée par deux cas d’application dans un contexte de formation universitaire à distance. Le travail d’ingénierie utilise une approche en autogestion des compétences pour concevoir l’activité d’autoévaluation et l’instrumentaliser avec l’outil logiciel web d’autodiagnostic des compétences, appelé Compétences+. Cet acte d’ingénierie pédagogique porte l’attention de l’enseignant-concepteur sur une démarche centrée sur l’apprentissage dans une perspective d’autogestion des connaissances et de sa validation dans un usage en contexte isomorphe à une situation professionnelle réelle.

  9. Radioprotection et ingénierie nucléaire

    CERN Document Server

    2006-01-01

    Le développement de l'énergie nucléaire repose sur deux piliers essentiels : la sûreté nucléaire, qui concerne la machine, et la radioprotection, qui se préoccupe des hommes. Construit de manière fiable, un réacteur nucléaire se doit d'irradier le moins possible ses opérateurs et conduire à un impact très faible pour les populations avoisinantes. Tout cela est soumis à des règles strictes, élaborées au niveau international, et qui ne tolèrent aucun écart. Les ingénieurs qui ont à concevoir, construire et conduire ces machines doivent maîtriser les règles de protection : cet ouvrage leur est destiné. La radioprotection, si elle se fonde principalement sur des bases scientifiques, intègre également une dimension sociétale exigeante. Ces activités sont en effet sous le regard critique et permanent de nos concitoyens, qui exigent des acteurs de cette industrie une maîtrise totale de la radioprotection ; un ingénieur qui ne connaîtrait pas la genèse de la radioprotection, ses règle...

  10. Loyola University distingue al Ing. Martínez

    OpenAIRE

    Lezcano, Liseth

    2011-01-01

    El Ing. Axel Martínez, Director de Recursos Humanos de la Universidad Tecnológica de Panamá (UTP), recibió un reconocimiento que le hizo el Instituto de Recursos Humanos y Relaciones Industriales de Loyola University Chicago (LUC), como egresado destacado del Programa de Maestría en Recursos Humanos, por la prestigiosa carrera académica y por sus éxitos profesionales en un importante ambiente académico.

  11. Linnagaleriis avati ülevaatenäitus 'Pärnu sügis 98' / Leonhard Lapin, Inge Teder ; interv. Tiiu Leis

    Index Scriptorium Estoniae

    Lapin, Leonhard, 1947-

    1998-01-01

    14. okt avati Pärnu Linnagaleriis Pärnu kunstnike maalinäitus, töid valisid Kunstiakadeemia õppejõud Leonhard Lapin ja Inge Teder ning Linnagalerii nõukogu liige Feliks Krapp. Intervjuu L. Lapini ja Inge Tederiga.

  12. Detennination Qf Optimuni on-fann Seed Pri~ing Time for Maize ...

    African Journals Online (AJOL)

    maize seed to on-far111 priming is an important development which can be used to improve ... Key words: semi-arid: crop establishment; sorghum; maize: on-farm seed priming; Zimbapwe. ... faster growth and higher yield after seed prim-, ing.

  13. FoRSIC : De l'ingénierie des compétences à l'ingénierie des connaissances.

    OpenAIRE

    Ertzscheid , Olivier; Link-Pezet , Jo; Lacombe , Elisabeth

    2002-01-01

    FoRSIC [1] est un dispositif d'ingénierie des connaissances, qui s'ancre dans le champ de la formation à la recherche documentaire. Après avoir précisé le contexte théorique qui le sous-tend, nous décrirons ici les méthodologies qui nous ont permis de faire émerger des représenta-tions structurantes et partageables de ce domaine, à l'aide d'une ontologie des compétences docu-mentaires que nous relions au réseau sémantique du modèle de domaine.

  14. SCFJFK is a bona fide E3 ligase for ING4 and a potent promoter of the angiogenesis and metastasis of breast cancer

    Science.gov (United States)

    Yan, Ruorong; He, Lin; Li, Zhongwu; Han, Xiao; Liang, Jing; Si, Wenzhe; Chen, Zhe; Li, Lei; Xie, Guojia; Li, Wanjin; Wang, Peiyan; Lei, Liandi; Zhang, Hongquan; Pei, Fei; Cao, Dengfeng

    2015-01-01

    Loss of function/dysregulation of inhibitor of growth 4 (ING4) and hyperactivation of NF-κB are frequent events in many types of human malignancies. However, the molecular mechanisms underlying these remarkable aberrations are not understood. Here, we report that ING4 is physically associated with JFK. We demonstrated that JFK targets ING4 for ubiquitination and degradation through assembly of an Skp1–Cul1–F-box (SCF) complex. We showed that JFK-mediated ING4 destabilization leads to the hyperactivation of the canonical NF-κB pathway and promotes angiogenesis and metastasis of breast cancer. Significantly, the expression of JFK is markedly up-regulated in breast cancer, and the level of JFK is negatively correlated with that of ING4 and positively correlated with an aggressive clinical behavior of breast carcinomas. Our study identified SCFJFK as a bona fide E3 ligase for ING4 and unraveled the JFK–ING4–NF-κB axis as an important player in the development and progression of breast cancer, supporting the pursuit of JFK as a potential target for breast cancer intervention. PMID:25792601

  15. La sauvegarde des grandes oeuvres de l'ingénierie du XXème siècle

    CERN Document Server

    Graf, Franz

    2016-01-01

    Consacré à la sauvegarde des grandes oeuvres de l’ingénierie du XXe siècle, ce premier numéro des Cahiers du TSAM explore le devenir de certaines des plus remarquables et emblématiques structures en béton du siècle passé. A travers les fi gures d’héroïques constructeurs, il interroge l’héritage construit des ingénieurs, convoquant les plus audacieux d’entre eux (Freyssinet, Isler, Maillart, Nervi, Vierendeel, etc.). Alors que la sauvegarde de l’architecture du XXe siècle s’est récemment constituée en discipline à part entière, la préservation des ouvrages de l’ingénierie de cette période est encore balbutiante. Considérés trop souvent sous le seul point de vue de la sécurité ou de la maintenance, ces ouvrages s’avèrent parfois de véritables chefs-d’oeuvre, jalons d’un «art de l’ingénieur» à la frontière entre performance technique et beauté plastique. Ces cahiers sont donc l’occasion d’initier, à l’appui d’exemples et de projets de sauvegarde con...

  16. 77 FR 74245 - ING Investments, LLC, et al.; Notice of Application

    Science.gov (United States)

    2012-12-13

    ... SECURITIES AND EXCHANGE COMMISSION [Investment Company Act Release No. 30295; 812-14013] ING Investments, LLC, et al.; Notice of Application December 6, 2012. AGENCY: Securities and Exchange Commission (``Commission''). ACTION: Notice of application for an order under section 17(d) of the Investment Company Act...

  17. SCF(JFK) is a bona fide E3 ligase for ING4 and a potent promoter of the angiogenesis and metastasis of breast cancer.

    Science.gov (United States)

    Yan, Ruorong; He, Lin; Li, Zhongwu; Han, Xiao; Liang, Jing; Si, Wenzhe; Chen, Zhe; Li, Lei; Xie, Guojia; Li, Wanjin; Wang, Peiyan; Lei, Liandi; Zhang, Hongquan; Pei, Fei; Cao, Dengfeng; Sun, Luyang; Shang, Yongfeng

    2015-03-15

    Loss of function/dysregulation of inhibitor of growth 4 (ING4) and hyperactivation of NF-κB are frequent events in many types of human malignancies. However, the molecular mechanisms underlying these remarkable aberrations are not understood. Here, we report that ING4 is physically associated with JFK. We demonstrated that JFK targets ING4 for ubiquitination and degradation through assembly of an Skp1-Cul1-F-box (SCF) complex. We showed that JFK-mediated ING4 destabilization leads to the hyperactivation of the canonical NF-κB pathway and promotes angiogenesis and metastasis of breast cancer. Significantly, the expression of JFK is markedly up-regulated in breast cancer, and the level of JFK is negatively correlated with that of ING4 and positively correlated with an aggressive clinical behavior of breast carcinomas. Our study identified SCF(JFK) as a bona fide E3 ligase for ING4 and unraveled the JFK-ING4-NF-κB axis as an important player in the development and progression of breast cancer, supporting the pursuit of JFK as a potential target for breast cancer intervention. © 2015 Yan et al.; Published by Cold Spring Harbor Laboratory Press.

  18. Cultural specificity of emotional overinvolvement: a systematic review.

    Science.gov (United States)

    Singh, Swaran P; Harley, Kath; Suhail, Kausar

    2013-03-01

    Understanding cross-cultural aspects of emotional overinvolvement (EOI) on psychosis outcomes is important for ensuring cultural appropriateness of family interventions. This systematic review explores whether EOI has similar impact in different cultural groups and whether the same norms can be used to measure EOI across cultures. Thirty-four studies were found that have investigated the impact of EOI on outcomes across cultures or culturally adapted EOI measures. The relationship between high EOI and poor outcome is inconsistent across cultures. Attempts to improve predictive ability by post hoc adjustment of EOI norms have had varied success. Few studies have attempted a priori adaptations or development of culture-specific norms. Methodological differences such as use of different expressed emotions (EE) measures and varying definitions of relapse across studies may explain a lack of EOI outcome relationship across cultures. However, our findings suggest that the construct and measurement of EOI itself are culture-specific. EOI may not necessarily be detrimental in all cultures. The effect of high EOI may be moderated by the unexplored dimension of warmth and high levels of mutual interdependence in kin relationships. Researchers should reevaluate the prevailing concepts of the impact of family relations on the course and outcome of psychotic disorders, specifically focusing on the protective aspects of family involvement. Clinically, family interventions based on EE reduction should take cultural differences into account when treating families from different ethnocultural groups.

  19. BE-ing @Work: Wearables and Presence of Mind in the Workplace

    Science.gov (United States)

    Forbes Oste, Heidi

    2016-01-01

    Expectations and demands in the changing contemporary workplace are driven by emergent technologies. Ubiquitous in nature, they are designed to enhance human and organization potential. These technologies provide access to information and connection at all times. They are increasingly reliant on human relationships and connection. BE-ing one's…

  20. Electric generator overhaul of the Ing. Carlos Ramirez Ulloa hydroelectric. Central project conclusions; Rehabilitacion de los generadores de la central hidroelectrica Ing. Carlos Ramirez Ulloa. Conclusiones del proyecto

    Energy Technology Data Exchange (ETDEWEB)

    Campuzano Martinez, Ignacio Roberto; Gonzalez Vazquez, Alejandro Esteban; Robles Pimentel, Edgar Guillermo; Esparza Saucedo, Marcos; Garcia Martinez, Javier; Sanchez Flores, Ernesto; Martinez Romero, Jose Luis [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1999-12-31

    The Hydroelectric Ing. Carlos Ramirez Ulloa Power Central has three 200 MW electric generators. The Central initiated its commercial operation in 1985. The electric generators had design problems that were properly corrected in an overhaul program that was initiated in 1996, with Unit 2 electric generator and completed in 1998 with Unit 1 electric generator. This paper presents the relevant aspects of the experience accumulated in the project. [Espanol] La central hidroelectrica Ing. Carlos Ramirez Ulloa cuenta con tres generadores de 200 MW cada uno. La central inicio su operacion comercial en 1985. Los generadores tenian problemas de diseno que fueron debidamente corregidos en un programa de rehabilitacion que inicio en 1996, con el generador de la unidad 2, y culmino en 1998 con el generador de la unidad 1. En este articulo se presentan los aspectos relevantes de la experiencia acumulada en el proyecto.

  1. Electric generator overhaul of the Ing. Carlos Ramirez Ulloa hydroelectric. Central project conclusions; Rehabilitacion de los generadores de la central hidroelectrica Ing. Carlos Ramirez Ulloa. Conclusiones del proyecto

    Energy Technology Data Exchange (ETDEWEB)

    Campuzano Martinez, Ignacio Roberto; Gonzalez Vazquez, Alejandro Esteban; Robles Pimentel, Edgar Guillermo; Esparza Saucedo, Marcos; Garcia Martinez, Javier; Sanchez Flores, Ernesto; Martinez Romero, Jose Luis [Instituto de Investigaciones Electricas, Cuernavaca (Mexico)

    1998-12-31

    The Hydroelectric Ing. Carlos Ramirez Ulloa Power Central has three 200 MW electric generators. The Central initiated its commercial operation in 1985. The electric generators had design problems that were properly corrected in an overhaul program that was initiated in 1996, with Unit 2 electric generator and completed in 1998 with Unit 1 electric generator. This paper presents the relevant aspects of the experience accumulated in the project. [Espanol] La central hidroelectrica Ing. Carlos Ramirez Ulloa cuenta con tres generadores de 200 MW cada uno. La central inicio su operacion comercial en 1985. Los generadores tenian problemas de diseno que fueron debidamente corregidos en un programa de rehabilitacion que inicio en 1996, con el generador de la unidad 2, y culmino en 1998 con el generador de la unidad 1. En este articulo se presentan los aspectos relevantes de la experiencia acumulada en el proyecto.

  2. Inges Kindlustus kukkus kahjumisse. Kindlustushindade alandamata jätmine viis miinusesse / Kadrin Karner

    Index Scriptorium Estoniae

    Karner, Kadrin

    2011-01-01

    Inges Kindlustuse kahjumi põhjustas kõrgema hinnataseme säilitamine ning juhatuse liikmele välja makstud märkimisväärne tasu. Konkurentide RSA Kindlustus, Ergo Kindlustuse AS ja IF Kindlustus majandustulemused

  3. Loïc Brémaud, Catherine Guillaumin, L'archipel de l'ingénierie de la formation. Transformations, recompositions

    OpenAIRE

    Wahl, Elodie

    2011-01-01

    L'ouvrage L'archipel de l'ingénierie de la formation est la publication des actes d'un colloque qui s'est tenu à l'Université de Rennes 2 en janvier 2009. Le colloque comptait 22 intervenants, l'ouvrage est conséquent, et les articles sont très variés, tant par les perspectives adoptées, que par leurs formes ou leurs contenus. L'ouvrage se divise en trois grandes parties : la première traite de l'évolution de l'ingénierie de la formation, la seconde des nouvelles pratiques d'ingénierie, et la...

  4. BRÉMAUD Loïc & GUILLAUMIN Catherine (dir.). L’archipel de l’ingénierie de formation. Transformations, recompositions

    OpenAIRE

    Lavielle-Gutnik, Nathalie

    2011-01-01

    Cet ouvrage fait suite à un colloque éponyme associant les universités de Rennes 2, Tours et Nantes célébrant les vingt ans du Master SIFA (Stratégie et ingénierie en formation d’adultes). Le projet intellectuel que nourrit cet ouvrage est de reconsidérer les évolutions actuelles du champ de l’ingénierie de la formation. Son intérêt est moins d’identifier les pratiques d’ingénierie de formation, ce qu’il permet toutefois clairement de réaliser, que d’engager un véritable travail de modélisati...

  5. Quality of wooden chips produced by Claas Jaguar fitted with experimental CRA-ING rotor

    Energy Technology Data Exchange (ETDEWEB)

    Pari, L.; Civitarese, V.; Del Giudice, A. [Council for Research in Agriculture, Agricultural Engineering Research Unit, Rome (Italy)

    2010-07-01

    This paper described a newly developed chipper device for mounting on Claas Jaguar chipper harvesters for short rotation forestry harvesting. It was designed by the Agriculture Engineering Research Unit of the Agricultural Research Council in Rome, Italy. The new rotor has a lower number of blades compared to standard rotors and has a different cutting angle and drum insertion. This study evaluated the particle-size distribution of wood chips produced by standard rotors compared to those with the experimental rotor. The objective was to distinguish the particle size distribution of chips produced using the two types of chippers in order to evaluate the influence of wooden species in the chip formation process. Tests were conducted using 860 and 890 Claas Jaguar chipper harvesters, both equipped with standard and CRA-ING rotors. The experiment was conducted on poplar cultivations on biennial shift and on arboreal cultivations. Compared to traditional rotors, CRA-ING rotors provide a considerable product increase within particle sizes ranging from 12.5 to 25 mm, and an equivalent product reduction within the finest particle size classes. The study showed that the new rotor tends to concentrate dimensional increments along the longitudinal section of the chip, regardless of the species used. In order to obtain a better quality chip in terms of particle size, a second rotor was devised to engrave a cleaner cut on the biomass introduced by the feeding rollers.

  6. On Mathematicians' Proof Skimming: A Reply to Inglis and Alcock

    Science.gov (United States)

    Weber, Keith; Mejia-Ramos, Juan Pablo

    2013-01-01

    n a recent article, Inglis and Alcock (2012) contended that their data challenge the claim that when mathematicians validate proofs, they initially skim a proof to grasp its main idea before reading individual parts of the proof more carefully. This result is based on the fact that when mathematicians read proofs in their study, on average their…

  7. EOI Open Learning: un decálogo para la transformación del aprendizaje

    Directory of Open Access Journals (Sweden)

    González, Alfonso

    2011-12-01

    Full Text Available This article covers as a decalogue the most relevant experiences in the transformation held in the last three years by the Industrial Organization School EOI, the eldest business schools in Spain. The education of entrerpreneur managers and entrepreneurs in management requires a response in line with the demands of a society and a market characterized by personalization and humanization of learning that has become the engine of a profound social and economic transformation in which the public, private and citizens come together in achieving the common good. A business school is uniquely positioned to be a laboratory in which to experience the challenges facing learning in today’s society. The concept Open Learning collects the challenges that are facing both training institutions and traditional learning models, with the deep belief of the role of learning in creating a fairer society and a more competitive economy, as well as the crucial importance of technology in this process.

    En el presente artículo se recogen en forma de decálogo las experiencias más relevantes en el proceso de transformación abierto en los tres últimos años por la Escuela de Organización Industrial, decana de las escuelas de negocio. La formación de directivos emprendedores y de emprendedores directivos exige una respuesta alineada a las exigencias de una sociedad y de un mercado caracterizados por una personalización y humanización del aprendizaje que se ha convertido en el motor de una profunda transformación social y económica en donde lo público, lo privado y lo ciudadano se funden en la consecución del bien común. Una escuela de negocios tiene unas condiciones excepcionales para ser un laboratorio en el que experimentar los desafíos a los que se enfrenta el aprendizaje en la sociedad actual. Con la expresión Open Learning se pretende recoger los desafíos a los que se están enfrentando tanto las instituciones formativas como los modelos

  8. A Functional Role for the Epigenetic Regulator ING1 in Activity-induced Gene Expression in Primary Cortical Neurons.

    Science.gov (United States)

    Leighton, Laura J; Zhao, Qiongyi; Li, Xiang; Dai, Chuanyang; Marshall, Paul R; Liu, Sha; Wang, Yi; Zajaczkowski, Esmi L; Khandelwal, Nitin; Kumar, Arvind; Bredy, Timothy W; Wei, Wei

    2018-01-15

    Epigenetic regulation of activity-induced gene expression involves multiple levels of molecular interaction, including histone and DNA modifications, as well as mechanisms of DNA repair. Here we demonstrate that the genome-wide deposition of inhibitor of growth family member 1 (ING1), which is a central epigenetic regulatory protein, is dynamically regulated in response to activity in primary cortical neurons. ING1 knockdown leads to decreased expression of genes related to synaptic plasticity, including the regulatory subunit of calcineurin, Ppp3r1. In addition, ING1 binding at a site upstream of the transcription start site (TSS) of Ppp3r1 depends on yet another group of neuroepigenetic regulatory proteins, the Piwi-like family, which are also involved in DNA repair. These findings provide new insight into a novel mode of activity-induced gene expression, which involves the interaction between different epigenetic regulatory mechanisms traditionally associated with gene repression and DNA repair. Copyright © 2017 IBRO. Published by Elsevier Ltd. All rights reserved.

  9. Forum-ing: Signature practice for public theological discourse

    Directory of Open Access Journals (Sweden)

    Edward P. Wimberly

    2014-05-01

    Full Text Available This article introduces a unique model for public theological conversation and discourse, which was developed by the Concerned Black Clergy of Atlanta (CBC. It was a model developed in response to the problems of poverty, homelessness, and the ‘missing and murdered children’ victimised in Atlanta, Georgia in the United States of America in the early 1980s. It was originally organised to respond to the economic, financial, spiritual, emotional, employment, housing and resource needs of the underserved poor. This unique practice is called forum-ing. The forum meets every Monday morning, except when there is a national holiday. It has operated 30 consecutive years. The forum has a series of presentations, including the opening prayer, self-introductions of each person, a report of the executive director, special presentations from selected community groups, reports, and then questions and answers. The end result is that those attending engage in a process of discourse that enables them to internalise new ideas, approaches, and activities for addressing poverty and injustice in the community. Key to forum-ing for the 21st century is that it is a form of public practical theology rooted and grounded in non-violence growing out of the civil rights movement of the 1950s and 1960s in the United States. The overall purpose of this article is to contribute to the effort of the Faculty of Theology at the University of Pretoria (South Africa to identify those variables that will assist religious leaders in South Africa to develop public conversational spaces to enhance democratic participation. This article presents one model from the African American community in Atlanta, Georgia. The hope is to lift up key variables that might assist in the practical and pastoral theological conversation taking place in South Africa at present.

  10. Residual motion of lung tumors in end-of-inhale respiratory gated radiotherapy based on external surrogates

    International Nuclear Information System (INIS)

    Berbeco, Ross I.; Nishioka, Seiko; Shirato, Hiroki; Jiang, Steve B.

    2006-01-01

    It has been noted that some lung tumors exhibit large periodic motion due to respiration. To limit the amount of dose to healthy lung tissues, many clinics have begun gating radiotherapy treatment using externally placed surrogates. It has been observed by several institutions that the end-of-exhale (EOE) tumor position is more reproducible than other phases of the breathing cycle, so the gating window is often set there. From a treatment planning perspective, end-of-inhale (EOI) phase might be preferred for gating because the expanded lungs will further decrease the healthy tissue within the treatment field. We simulate gated treatment at the EOI phase, using a set of recently measured internal/external anatomy patient data. This paper attempts to answer three questions: (1) How much is the tumor residual motion when we use an external surrogate gating window at EOI? (2) How could we reduce the residual motion in the EOI gating window? (3) Is there a preference for amplitude- versus phase-based gating at EOI? We found that under free breathing conditions the residual motion of the tumors is much larger for EOI phase than for EOE phase. The mean values of residual motion at EOI were found to be 2.2 and 2.7 mm for amplitude- and phase-based gating, respectively, and, at EOE, 1.0 and 1.2 mm for amplitude- and phase-based gating, respectively. However, we note that the residual motion in the EOI gating window is correlated well with the reproducibility of the external surface position in the EOI phase. Using the results of a published breath-coaching study, we deduce that the residual motion of a lung tumor at EOI would approach that at EOE, with the same duty cycle (30%), under breath-coaching conditions. Additionally, we found that under these same conditions, phase-based gating approaches the same residual motion as amplitude-based gating, going from a 28% difference to 11%, for the patient with the largest difference between the two gating modalities. We conclude

  11. Role of TRPV1 and ASIC3 channels in experimental occlusal interference-induced hyperalgesia in rat masseter muscle.

    Science.gov (United States)

    Xu, X X; Cao, Y; Ding, T T; Fu, K Y; Li, Y; Xie, Q F

    2016-04-01

    Masticatory muscle pain may occur following immediate occlusal alteration by dental treatment. The underlying mechanisms are poorly understood. Transient receptor potential vanilloid-1 (TRPV1) and acid-sensing ion channel-3 (ASIC3) mediate muscle hyperalgesia under various pathologic conditions. We have developed a rat model of experimental occlusal interference (EOI) that consistently induces mechanical hyperalgesia in jaw muscles. Whether TRPV1 and ASIC3 mediate this EOI-induced hyperalgesia is unknown. Rat model of EOI-induced masseter hyperalgesia was established. Real-time polymerase chain reaction, Western blot and retrograde labelling combined with immunofluorescence were performed to evaluate the modulation of TRPV1 and ASIC3 expression in trigeminal ganglia (TGs) and masseter afferents of rats after EOI. The effects of intramuscular administration of TRPV1 and ASIC3 antagonists on the EOI-induced hyperalgesia in masseter muscle were examined. After EOI, gene expressions and protein levels of TRPV1 and ASIC3 in bilateral TGs were up-regulated. The percentage of ASIC3- (but not TRPV1-) positive neurons in masseter afferents increased after EOI. More small-sized and small to medium-sized masseter afferents expressed TRPV1 and ASIC3 separately following EOI. These changes peaked at day 7 and then returned to original status within 10 days after EOI. Intramuscular administration of the TRPV1 antagonist AMG-9810 partially reversed this mechanical hyperalgesia in masseter muscle. No improvement was exhibited after administration of the ASIC3 antagonist APETx2. Co-injection of AMG-9810 and APETx2 enhanced the effect of AMG-9810 administration alone. Peripheral TRPV1 and ASIC3 contribute to the development of the EOI-induced mechanical hyperalgesia in masseter muscle. © 2015 European Pain Federation - EFIC®

  12. Finanční analýza podniku Ing. Bronislav Vala

    OpenAIRE

    Valová, Anežka

    2013-01-01

    Aim of this work is to evaluate the financial performance of the company Ing. Bronislav Vala based on financial analysis from 2008 to 2012. The applied methods od financial analysis are selected for this evaluation. The used methods include vertical and horizontal analysis, analysis of ratios, analysis of differential indicators, pyramidal decomposition Du Pont, value and bankruptcy models and inter-company comparisons. The thesis is divided into theoretical and practical parts. The theoretic...

  13. L’ingénierie pédagogique à base d’objets et le référencement par les compétences

    Directory of Open Access Journals (Sweden)

    Gilbert Paquette

    2004-01-01

    Full Text Available Nous situons l’ingénierie pédagogique au confluent du design pédagogique, du génie logiciel et de l’ingénierie cognitive. Puis, dans l’optique d’une ingénierie pédagogique à base d’objets, nous proposons une méthode permettant de représenter graphiquement les connaissances et les compétences, puis de les associer aux ressources d’apprentissage. Par la suite, nous montrons comment cette méthode peut contribuer à améliorer la qualité des environnements en ligne à chacune des phases de leur cycle de vie.

  14. LoopIng: a template-based tool for predicting the structure of protein loops.

    KAUST Repository

    Messih, Mario Abdel

    2015-08-06

    Predicting the structure of protein loops is very challenging, mainly because they are not necessarily subject to strong evolutionary pressure. This implies that, unlike the rest of the protein, standard homology modeling techniques are not very effective in modeling their structure. However, loops are often involved in protein function, hence inferring their structure is important for predicting protein structure as well as function.We describe a method, LoopIng, based on the Random Forest automated learning technique, which, given a target loop, selects a structural template for it from a database of loop candidates. Compared to the most recently available methods, LoopIng is able to achieve similar accuracy for short loops (4-10 residues) and significant enhancements for long loops (11-20 residues). The quality of the predictions is robust to errors that unavoidably affect the stem regions when these are modeled. The method returns a confidence score for the predicted template loops and has the advantage of being very fast (on average: 1 min/loop).www.biocomputing.it/loopinganna.tramontano@uniroma1.itSupplementary data are available at Bioinformatics online.

  15. (EOI) Form

    International Development Research Centre (IDRC) Digital Library (Canada)

    Dorine Odongo

    COLLABORATING TECHNICAL AGENCIES: EXPRESSION OF INTEREST FORM. • Please read the information provided about the initiative and the eligibility requirements in the Prospectus before completing this application form. • Ensure all the sections of the form are accurately completed and saved in PDF format.

  16. Impact of pEGFP mediated ING4 gene on growth of glioma U251 ...

    African Journals Online (AJOL)

    Jane

    2011-06-22

    Jun 22, 2011 ... Full Length Research Paper. Impact of pEGFP mediated ING4 gene on growth of glioma U251 cells and its potential molecular mechanism. Yuefei Deng*, Bingxi Lei and Yiying Zhao. Department of Neurosurgery, Sun Yat-Sen Memorial Hospital, Sun Yat-Sen University, Guangzhou 510120, China.

  17. Predicting early onset of intoxication versus drinking—A population-based prospective study of Norwegian adolescents

    Directory of Open Access Journals (Sweden)

    Frøydis Enstad

    2017-12-01

    Full Text Available Aims: Recent research suggests that early onset of intoxication (EOI may be of greater importance for a wide range of subsequent adverse outcomes than early drinking experiences without intoxication. However, research on antecedents of EOI is scarce. The present study identifies predictors of EOI and whether they differ from those of early onset of drinking (EOD. Methods: Data was drawn from the prospective Tracking Opportunities and Problems (TOPP study of Norwegian families (n=382, which followed up mothers and their children with six data collections from childhood (age 1.5 to adolescence (age 14.5. Self-reports from the adolescents (parenting practices, adolescent's conduct problems and friends' deviant behaviour and their mothers (adolescent temperament, socio-economic factors and household alcohol problems were used to identify predictors of EOI and EOD. Findings: A variety of temperamental, socio-economic, and family factors predicted EOI, whereas EOD was predicted of substantially fewer variables. Particularly, when controlling for relevant covariates, low levels of shyness, own conduct problems and having friends with deviant behaviour prospectively predicted EOI, but not EOD. Conclusions: Future research and prevention efforts should take into consideration that EOI and EOD without getting drunk appear to be predicted by different risk factors in childhood and adolescence. Keywords: Adolescents, Alcohol, Intoxication, Drinking, Onset, Predictors

  18. The Meaning of Emotional Overinvolvement in Early Development: Prospective Relations with Child Behavior Problems

    Science.gov (United States)

    Khafi, Tamar Y.; Yates, Tuppett M.; Sher-Censor, Efrat

    2015-01-01

    Emotional Overinvolvement (EOI) in parents’ Five Minute Speech Samples (FMSS; Magaña-Amato, 1993) is thought to measure overconcern and enmeshment with one’s child. Although related to maladaptive outcomes in studies of adult children, FMSS-EOI evidences varied relations with behavior problems in studies with young children. These mixed findings may indicate that certain FMSS-EOI criteria reflect inappropriate and excessive involvement with adult children, but do not indicate maladaptive processes when parenting younger children. Thus, this study evaluated relations of each FMSS-EOI criterion with changes in child behavior problems from preschool to first grade in a community sample of 223 child-mother dyads (47.98% female; Mage_W1 = 49.08 months; 56.50% Hispanic/Latina). Maternal FMSS-EOI ratings were obtained at wave 1, and independent examiners rated child externalizing and internalizing behavior problems at wave 1 and two years later. Path analyses indicated that both the Self-Sacrifice/Overprotection (SSOP) and Statements of Attitude (SOAs) FMSS-EOI criteria predicted increased externalizing problems. In contrast, Excessive Detail and Exaggerated Praise were not related to child externalizing behavior problems, and Emotional Display was not evident in this sample. None of the FMSS-EOI criteria evidenced significant relations with internalizing behavior problems. Multigroup comparisons indicated that the effect of SOAs on externalizing behavior problems was significant for boys but not for girls, and there were no significant group differences by race/ethnicity. These findings point to the salience of SSOP and SOAs for understanding the developmental significance of EOI in early development. PMID:26147935

  19. Cross-cultural adaptation and validation of the Greek version of the Family Questionnaire for assessing expressed emotion.

    Science.gov (United States)

    Koutra, Katerina; Economou, Marina; Triliva, Sofia; Roumeliotaki, Theano; Lionis, Christos; Vgontzas, Alexandros N

    2014-05-01

    Expressed emotion (EE) has proved to be an established factor in short-term relapse in schizophrenia. The aim of the present study was to examine the psychometric properties of the Greek version of the Family Questionnaire (FQ), a brief self-report questionnaire measuring the EE status of relatives of patients with schizophrenia in terms of criticism (CC) and emotional overinvolvement (EOI). The translated and adapted 20-item FQ was administered to 176 family caregivers of patients with schizophrenia and bipolar disorder. Caregivers' burden (Family Burden Scale) and psychological distress (General Health Questionnaire-28) were also evaluated. The findings indicated that the Greek version displays a two-factor structure with two subscales of EE-CC and EOI-with 10 items each, similarly to the original version. The convergent validity of the subscales was highly supported by correlations with caregivers' burden and psychological distress. The Cronbach's α coefficient measuring internal consistency for the two scales were 0.90 for CC and 0.82 for EOI. The test-retest correlation coefficients measuring reproducibility were 0.99 and 0.98 for CC and EOI, respectively. The Greek version of the FQ appears to be a valid and reliable instrument to be used in both research and clinical assessment of family EE. Copyright © 2014 Elsevier Inc. All rights reserved.

  20. Algõpetuse peajoon ja harupedagoogikad / Sirje Piht, Elve Voltein, Anne Uusen, Inge Timoštšuk

    Index Scriptorium Estoniae

    2012-01-01

    Intervjuu Sirje Pihti ja Anne Uuseniga Tallinna Ülikooli algõpetuse osakonnast, Elve Volteiniga Tartu Ülikooli haridusteaduste instituudi õpetajate seminarist ja Inge Timoštšukiga Tallinna Ülikooli kasvatusteaduste instituudi pedagoogilise praktika keskusest

  1. Deficiencies of effectiveness of intervention studies in veterinary medicine: a cross-sectional survey of ten leading veterinary and medical journals

    Science.gov (United States)

    Meursinge Reynders, Reint

    2016-01-01

    The validity of studies that assess the effectiveness of an intervention (EoI) depends on variables such as the type of study design, the quality of their methodology, and the participants enrolled. Five leading veterinary journals and 5 leading human medical journals were hand-searched for EoI studies for the year 2013. We assessed (1) the prevalence of randomized controlled trials (RCTs) among EoI studies, (2) the type of participants enrolled, and (3) the methodological quality of the selected studies. Of 1707 eligible articles, 590 were EoI articles and 435 RCTs. Random allocation to the intervention was performed in 52% (114/219; 95%CI:45.2–58.8%) of veterinary EoI articles, against 87% (321/371; 82.5–89.7%) of human EoI articles (adjusted OR:9.2; 3.4–24.8). Veterinary RCTs were smaller (median: 26 animals versus 465 humans) and less likely to enroll real patients, compared with human RCTs (OR:331; 45–2441). Only 2% of the veterinary RCTs, versus 77% of the human RCTs, reported power calculations, primary outcomes, random sequence generation, allocation concealment and estimation methods. Currently, internal and external validity of veterinary EoI studies is limited compared to human medical ones. To address these issues, veterinary interventional research needs to improve its methodology, increase the number of published RCTs and enroll real clinical patients. PMID:26835187

  2. Superconducting properties of In-Ge mixture films

    International Nuclear Information System (INIS)

    Gerber, A.; Deutscher, G.

    1987-01-01

    We report on measurements of the perpendicular H/sub c//sub perpendicular/ and parallel H/sub c//sub X/ upper critical fields of superconducting In-Ge mixture films in a wide range of In concentrations. The resistivities of the samples varied from about 10 μΩX, corresponding to high In concentration, up to about 1300 μΩ cm, corresponding to an In concentration close to the percolation threshold of the system. The critical temperatures of the samples in a zero external field have also been studied. For high metal concentrations the results have been analyzed and found to fit the predictions of the dirty limit for type-II superconductors. Near the threshold, however, where the normal-state resistivity goes to infinity, the critical fields saturate to a finite value. This result is in accordance with the prediction of percolation theory in the anomalous diffusion regime. As the threshold is approached the anisotropy ratio decreases to a constant value of 1.2 from its homogeneous type-II limit 1.69

  3. 76 FR 54770 - Public Meeting: Notification by Capital One Financial Corporation, McLean, VA, To Acquire ING...

    Science.gov (United States)

    2011-09-02

    ... FEDERAL RESERVE SYSTEM Public Meeting: Notification by Capital One Financial Corporation, McLean, VA, To Acquire ING Bank, FSB, Wilmington, DE, and Indirectly To Acquire Shares of Sharebuilder... Reserve System. ACTION: Notice of public meeting. SUMMARY: Three public meetings will be held regarding...

  4. Rethinking import-substituting industrialization: Development strategies and institutions in Taiwan and China

    OpenAIRE

    Zhu, Tianbiao

    2006-01-01

    Conventional explanations of Taiwan and China’s economic success point to the shift from an import-substituting industrialization (ISI) strategy to an export-oriented industrialization (EOI) strategy. This paper argues that the development strategies in Taiwan and China have always been a combination of ISI and EOI strategies during their entire miracle-creating period; far from the shift from ISI to EOI strategies, export promotion was used in both cases to sustain ISI, which has always been...

  5. Some neutron measurements with simulated ING targets

    Energy Technology Data Exchange (ETDEWEB)

    Walker, J

    1966-07-01

    Thermal neutron fluxes in the vicinity of a simulated Intense Neutron Generator target have been measured using Mn and Au foils, and a small BF{sub 3} detector. The target was a Pb cylinder either 4-inch or 8-inch in diameter with a 1.2 g Ra-Be neutron source at its centre. This was centrally mounted in a 5' diam. x 5' high tank which was filled with either H{sub 2}O or D{sub 2}O moderator. Various gaps and absorbing annuli were placed around the target, and air-filled aluminum 'beam tubes' were mounted radially or tangentially from the target to simulate typical ING conditions. The measured thermal neutron fluxes were less than calculated at all radii. The single-age computation clearly gives large errors at large radii, but the multi-energy approach seems to give a useful indication of the thermal flux distribution in spite of the extreme simplicity of the model. The fall in measured fluxes at small radii in both D{sub 2}O and H{sub 2}O is most likely caused by absorption in the target material which is not allowed for in the computational model. (author)

  6. Some neutron measurements with simulated ING targets

    International Nuclear Information System (INIS)

    Walker, J.

    1966-01-01

    Thermal neutron fluxes in the vicinity of a simulated Intense Neutron Generator target have been measured using Mn and Au foils, and a small BF 3 detector. The target was a Pb cylinder either 4-inch or 8-inch in diameter with a 1.2 g Ra-Be neutron source at its centre. This was centrally mounted in a 5' diam. x 5' high tank which was filled with either H 2 O or D 2 O moderator. Various gaps and absorbing annuli were placed around the target, and air-filled aluminum 'beam tubes' were mounted radially or tangentially from the target to simulate typical ING conditions. The measured thermal neutron fluxes were less than calculated at all radii. The single-age computation clearly gives large errors at large radii, but the multi-energy approach seems to give a useful indication of the thermal flux distribution in spite of the extreme simplicity of the model. The fall in measured fluxes at small radii in both D 2 O and H 2 O is most likely caused by absorption in the target material which is not allowed for in the computational model. (author)

  7. Application of microtomography and image analysis to the quantification of fragmentation in ceramics after impact loading

    Science.gov (United States)

    Forquin, Pascal; Ando, Edward

    2017-01-01

    Silicon carbide ceramics are widely used in personal body armour and protective solutions. However, during impact, an intense fragmentation develops in the ceramic tile due to high-strain-rate tensile loadings. In this work, microtomography equipment was used to analyse the fragmentation patterns of two silicon carbide grades subjected to edge-on impact (EOI) tests. The EOI experiments were conducted in two configurations. The so-called open configuration relies on the use of an ultra-high-speed camera to visualize the fragmentation process with an interframe time set to 1 µs. The so-called sarcophagus configuration consists in confining the target in a metallic casing to avoid any dispersion of fragments. The target is infiltrated after impact so the final damage pattern is entirely scanned using X-ray tomography and a microfocus source. Thereafter, a three-dimensional (3D) segmentation algorithm was tested and applied in order to separate fragments in 3D allowing a particle size distribution to be obtained. Significant differences between the two specimens of different SiC grades were noted. To explain such experimental results, numerical simulations were conducted considering the Denoual-Forquin-Hild anisotropic damage model. According to the calculations, the difference of crack pattern in EOI tests is related to the population of defects within the two ceramics. This article is part of the themed issue 'Experimental testing and modelling of brittle materials at high strain rates'.

  8. The intense neutron generator INGE-1 at the Technical University of Dresden

    International Nuclear Information System (INIS)

    Bittner, M.; Meisner, A.; Paffrath, E.; Schwiers, H.; Seeliger, D.

    1989-01-01

    The INGE-1 neutron generator developed for intergal 14 MeV neutron experiments is described. The accelerator produces steady d + ion beam in the current range of 1-10 mA with 120-240 keV energies at the target position. The beam is produced with a combined duoplasmatron focalization system on high voltage. A 30 keV beam is accelerated on final energy by a two-gap acceleration tube. The estimations conducted show that the generator maximum strength can reach up to 2x10 12 s -1 at 10 mA beam current and 220 keV energy. 4 refs

  9. Le "projet G." : une ingénierie de formation. Conception et gestion d'un dispositif d'enseignement (le geste et l'effet)

    OpenAIRE

    Marty , Olivier

    2012-01-01

    Document de travail pour l'Axe 4 "Organisations et formation" du CRF [Avec une note additive formalisant les données empiriques]; Le projet d'ingénierie de formation décrit consiste à développer une école de gestion en ligne, d'une durée de trois années, visant un public d'une soixantaine de néo-bacheliers, avec une équipe pédagogique d'une dizaine d'enseignants employés par le Ministère. Décrire ce projet nous permet de présenter l'organisation et l'ingénierie de formation en utilisant à la ...

  10. Kui suur palk oleks õpetaja töö vääriline? / Inge Kalle, Maia Uibo, Lauri Leesi ... [jt.

    Index Scriptorium Estoniae

    2011-01-01

    Küsimusele vastavad Vastse-Kuuste kooli direktor Inge Kalle, Ülenurme gümnaasiumi õpetaja-metoodik Maia Uibo, Tallinna Prantsuse Lütseumi direktor Lauri Leesi, Saaremaa ühisgümnaasiumi direktor Viljar Aro ja Heimtali põhikooli direktor Eero Metsavahi

  11. Queer(y)ing New Schooling Accountabilities through "My School": Using Butlerian Tools to Think Differently about Policy Performativity

    Science.gov (United States)

    Gowlett, Christina

    2015-01-01

    This article takes the role of provocateur to "queer(y)" the rules of intelligibility surrounding new schooling accountabilities. Butler's work is seldom used outside the arena of gender and sexualities research. A "queer(y)ing" methodology is subsequently applied in a context very different to where it is frequently…

  12. Techniques de l’ingénieur, a long-awaited resource

    CERN Multimedia

    GS Department

    2009-01-01

    Since 1 August 2009, a new online resource Les techniques de l’Ingénieur has been available at CERN: and its corpus of over 4,000 articles covering 11 disciplines is now accessible from your computer. This multidisciplinary database covers many subjects ranging from mechanics to the environment. The articles are written by scientific experts recognized in their fields. Online access includes the archives since 1946; it also serves to monitor the latest trends and innovations, and new industry products. This database is therefore both a valuable resource in past and present scientific and technological information and a tool to observe future developments. Anyone can create a free account on this resource. This account is needed to configure your personal alerts and download pdf files of the documents you are interested in. More information on the Library website. Direct access to the database

  13. A forced-gradient tracer test on the Hansrivier Dyke: Beaufort West ...

    African Journals Online (AJOL)

    2011-02-16

    Feb 16, 2011 ... A field-scale pumping test and uranin tracer test was carried out at Hansrivier ... take place via multiple flow paths with differing hydraulic properties, such as fracture aperture, connectivity and perme- ... sivity and longitudinal dispersivity, which ..... ing test confirmed the aquifer's potential as a major source.

  14. Deficiencies of effectiveness of intervention studies in veterinary medicine: a cross-sectional survey of ten leading veterinary and medical journals

    NARCIS (Netherlands)

    Di Girolamo, Nicola; Meursinge Reynders, Reint

    2016-01-01

    The validity of studies that assess the effectiveness of an intervention (EoI) depends on variables such as the type of study design, the quality of their methodology, and the participants enrolled. Five leading veterinary journals and 5 leading human medical journals were hand-searched for EoI

  15. Test of Bell's inequality using the one-atom micromaser

    Indian Academy of Sciences (India)

    However, the advantages of using two-level Rydberg atoms for test- ing Bell's inequalities are ... A couple of two-level. Rydberg atoms ... of decoherence on atomic statistics obtained through numerical analysis is presented inЬ4 where we also ...

  16. SpoonEMF, une brique logicielle pour l'utilisation de l'IDM dans le cadre de la réingénierie de programmes Java5

    OpenAIRE

    Barais , Olivier

    2006-01-01

    2 ième Journée sur l'Ingénièrie Dirigée par les Modèles; Ce document présente succinctement SpoonEMF, une brique logicielle pour l'utilisation de l'IDM dans le cadre de la réingénierie d'applications écrites en Java. L'accent dans cette courte présentation est mis sur les cas d'utilisation possibles de cette brique logicielle et l'intérêt des choix techniques retenus : le framework EMF pour l'expression du méta-modèle afin de favoriser l'interopérabilité avec d'autres outils et l'intégration ...

  17. Télécoms pour l’ingénierie du risque, Tullio Tanzi, Patrick Perrot

    Directory of Open Access Journals (Sweden)

    Jean-Baptiste Morin

    2013-04-01

    Full Text Available "Télécoms pour l’ingénierie du risque" est un ouvrage de 234 pages qui convoque la rencontre entre les Technologies de l’Information de la Communication (TIC et le risque. Les risques naturels, les risques industriels et technologiques ou encore les nouveaux risques générés par des usages déviants dans le domaine du numérique (cybercriminalité sont devenus monnaie courante. Les auteurs Tullio Tanzi (Professeur à Télécom ParisTech, département Traitement du Signal et des Images en télécommun...

  18. CeasIng Cpap At standarD criteriA (CICADA): predicting a successful outcome.

    Science.gov (United States)

    Yin, Yue; Broom, Margaret; Wright, Audrey; Hovey, Donna; Abdel-Latif, Mohamed E; Shadbolt, Bruce; Todd, David A

    2016-01-01

    This is a retrospective analysis of a multicentre randomised controlled trial (RCT) where we concluded that CeasIng Cpap At standerD criteriA (CICADA) in premature babies (PBs) CPAP. To identify factors that may influence the number of attempts to cease CPAP, we reviewed the records of 50 PBs from the RCT who used the CICADA method. PBs were grouped according to number of attempts to cease CPAP (fast group ≤2 attempts and slow group >2 attempts to cease CPAP). There were 26 (fast group) and 24 (slow group) PBs included in the analysis. Results showed significant differences in mean GA (27.8 ± 0.3 vs 26.9 ± 0.3 [weeks ± SE], p = 0.03) and birth weight ([Bwt]; 1080 ± 48.8 vs 899 ± 45.8 [grams ± SE], p = 0.01) between groups. Significantly fewer PBs in the fast group had a patent ductus arteriosus (PDA) compared to the slow group (5/26 (19.2%) vs 13/24 (54.2 %), p = 0.02). Bwt was a significant negative predictor of CPAP duration (r = -0.497, p = 0.03) and CPAP ceasing attempts (r = -0.290, p = 0.04). PBs with a higher GA and Bwt without a PDA ceased CPAP earlier using the CICADA method. Bwt was better than GA for predicting CPAP duration and attempts to cease CPAP. Our previous studies showed that CeasIng Cpap At standarD criteriA (CICADA) significantly reduces CPAP time, oxygen requirements and caffeine use. Some PBs however using the CICADA method required >2 attempts to cease CPAP ('slow CICADA' group). PBs in the 'fast CICADA' group (CPAP) (a) have longer gestational age and higher birth weight, (b) shorter mechanical ventilation and (c) lower incidence of patent ductus arteriosus. Attempts to cease CPAP decreased by 0.5 times per 1 week increase in GA and 0.3 times per 100-g increase in birth weight for PBs <30 weeks gestation.

  19. How to measure the impacts of antibiotic resistance and antibiotic development on empiric therapy: new composite indices.

    Science.gov (United States)

    Hughes, Josie S; Hurford, Amy; Finley, Rita L; Patrick, David M; Wu, Jianhong; Morris, Andrew M

    2016-12-16

    We aimed to construct widely useable summary measures of the net impact of antibiotic resistance on empiric therapy. Summary measures are needed to communicate the importance of resistance, plan and evaluate interventions, and direct policy and investment. As an example, we retrospectively summarised the 2011 cumulative antibiogram from a Toronto academic intensive care unit. We developed two complementary indices to summarise the clinical impact of antibiotic resistance and drug availability on empiric therapy. The Empiric Coverage Index (ECI) measures susceptibility of common bacterial infections to available empiric antibiotics as a percentage. The Empiric Options Index (EOI) varies from 0 to 'the number of treatment options available', and measures the empiric value of the current stock of antibiotics as a depletable resource. The indices account for drug availability and the relative clinical importance of pathogens. We demonstrate meaning and use by examining the potential impact of new drugs and threatening bacterial strains. In our intensive care unit coverage of device-associated infections measured by the ECI remains high (98%), but 37-44% of treatment potential measured by the EOI has been lost. Without reserved drugs, the ECI is 86-88%. New cephalosporin/β-lactamase inhibitor combinations could increase the EOI, but no single drug can compensate for losses. Increasing methicillin-resistant Staphylococcus aureus (MRSA) prevalence would have little overall impact (ECI=98%, EOI=4.8-5.2) because many Gram-positives are already resistant to β-lactams. Aminoglycoside resistance, however, could have substantial clinical impact because they are among the few drugs that provide coverage of Gram-negative infections (ECI=97%, EOI=3.8-4.5). Our proposed indices summarise the local impact of antibiotic resistance on empiric coverage (ECI) and available empiric treatment options (EOI) using readily available data. Policymakers and drug developers can use the

  20. Spre[ing amelanotic malignant melanoma: A rare differential diagnosis with tumors of the glandula submandibularis

    International Nuclear Information System (INIS)

    Ehrenberg, C.; Helmberger, H.

    1998-01-01

    The case reported emphasizes the importance of immediate performance of imaging scans in case of the slightest suspicion that clinical symptoms might indicate malignancy of a detected lesion. Despite the superficially only marginal macroscopic findings, MR imaging as well as the CT scans revealed an [vanced, malignant process that h[ been spre[ing. Particularly the soft tissue differential diagnosis obtained with MRI yields the information required for diagnostic characterization of the space occupying tumor mass. It will however be necessary in any case to verify the diagnosis by biopsy or extirpation and cytologic examination of tissue, as the imaging methods do not always unambigiously reveal the malignant dignity of the tumor. (orig./CB) [de

  1. Mida teed siis, kui töötaja on avaldanud soovi firmast lahkuda? / Inge Rumessen, Andres Hall, Mariliin Saar ... [jt.

    Index Scriptorium Estoniae

    2016-01-01

    Küsimusele vastavad PR Strategies partner ja strateegiline konsultant Inge Rumessen, auto24ring juhataja Andrs Hall, vabakutseline loovjuht ja produtsent Mariliin Saar, advokaadibüroo Tark partner Hannes Küün, ettevõtte Ööloom ja Frank kaasasutaja Jan Plaan, haridus- ja teadusministeeriumi personaliosakonna juhataja Margot Saluse, Sorry as Service müügijuht ja asutaja Indrek Põldvee ja EBS-i rahvusvahelise koostöö prorektor Toomas Danneberg

  2. Tales of Recombinant Femininity: "The Reincarnation of Golden Lotus," the "Chin P'ing Mei," and the Politics of Melodrama in Hong Kong.

    Science.gov (United States)

    Fore, Steve

    1993-01-01

    Examines the film "The Reincarnation of Golden Lotus" and the text upon which it is loosely based, the "Chin P'ing Mei," and the relationship between it and modern Chinese culture. States that the film's screenplay is much less an adaptation of the source novel than it is a female-centered reworking of a particular narrative…

  3. Edge Sharpness Assessment by Parametric Modeling: Application to Magnetic Resonance Imaging.

    Science.gov (United States)

    Ahmad, R; Ding, Y; Simonetti, O P

    2015-05-01

    In biomedical imaging, edge sharpness is an important yet often overlooked image quality metric. In this work, a semi-automatic method to quantify edge sharpness in the presence of significant noise is presented with application to magnetic resonance imaging (MRI). The method is based on parametric modeling of image edges. First, an edge map is automatically generated and one or more edges-of-interest (EOI) are manually selected using graphical user interface. Multiple exclusion criteria are then enforced to eliminate edge pixels that are potentially not suitable for sharpness assessment. Second, at each pixel of the EOI, an image intensity profile is read along a small line segment that runs locally normal to the EOI. Third, the profiles corresponding to all EOI pixels are individually fitted with a sigmoid function characterized by four parameters, including one that represents edge sharpness. Last, the distribution of the sharpness parameter is used to quantify edge sharpness. For validation, the method is applied to simulated data as well as MRI data from both phantom imaging and cine imaging experiments. This method allows for fast, quantitative evaluation of edge sharpness even in images with poor signal-to-noise ratio. Although the utility of this method is demonstrated for MRI, it can be adapted for other medical imaging applications.

  4. The international space of the Danish testing community in the interwar years

    DEFF Research Database (Denmark)

    Ydesen, Christian

    2012-01-01

    The focus of this article is to draw attention to the presence and importance of travelling ideas, knowledge, and practices in Danish history of educational test- ing. The article introduces and employs a spatial methodological approach in relation to the connections between the international...

  5. Experimental test of the renormalizability consequences of the standard electroweak theory

    International Nuclear Information System (INIS)

    Bardin, D.Yu.

    1984-01-01

    The present status of the one-loop radiative corrections calculations in the standard electroweak theory is discussed. The possibilities of experimental tests of the higher order predictions of the standard theory is analysed in view of recent data, inclu-ing CERN p anti pcolcider data on Msub(W) and Msub(Z) measurement. The perspectives of these tests in the near future experiments are discussed

  6. The ING observatory in the 2015-2025 decade

    Science.gov (United States)

    Balcells, M.

    2015-05-01

    The Isaac Newton Group, after nearly 30 years of productive operation of the William Herschel, Isaac Newton and Jacobus Kapteyn telescopes, is reviewing its science focus. The central goal is to respond to the changes in the astronomical landscapes in UK, the Netherlands, and especially in Spain, now a mature world-player community with access to 10-m class telescopes on La Palma and Paranal. The current model, which exploits scientific and instrumentation diversity, will continue to be offered until 2017. In the meantime, an ING-led consortium is building WEAVE, a next-generation spectroscopic facility for the WHT. WEAVE is a multi-fibre system capable of deploying either 1000 single-fibre probes, 25 mini-IFUs or a single large IFU, to feed a two-arm bench spectrograph which delivers resolving powers of either 5000 or 20,000. WEAVE will exploit a new field corrector at the WHT that enlarges the prime-focus FOV diameter from the current 40 arcmin to 2 degrees. WEAVE will be used to carry out massive surveys that exploit Gaia data in topics of Milky Way astronomy and stellar evolution; surveys that carry out galaxy evolution studies linked to various multi-wavelength surveys, including the LOFAR radio telescope; and redshift surveys of distant galaxies for cosmology. Community fibres will be available. The expectation is that these surveys will use 70% of the WHT time until at least 2022. The rest of the time will be available via normal TAC allocations, for use of facility instrumentation. Plans for the INT include involving external institutions in the provision of new instrumentation and/or telescope upgrades in exchange for significant fractions of telescope time.

  7. Running injuries and associated factors in participants of ING Taipei Marathon.

    Science.gov (United States)

    Chang, Wei-Ling; Shih, Yi-Fen; Chen, Wen-Yin

    2012-08-01

    To investigate the distribution of lower extremity running injuries and their associated factors. Descriptive and exploratory study. 1004 participants of the 2005 ING Taipei International Marathon. We used a self-developed questionnaire to collect data of previous running injuries and applied multivariate logistic regression modeling to examine relationships between these injuries and associated factors. Of the 893 valid questionnaires, 396 (44.4%) reported having previous lower extremity pain related to running. Knee joint pain was the most common problem (32.5%). Hip pain was associated with the racing group, training duration, and medial arch support. Use of knee orthotics (P = 0.002) and ankle braces (P = 0.007) was related to a higher rate of knee and ankle pain. Participants of the full marathon group who practiced on a synthetic track had a higher incidence of ankle pain. A training duration of >60 min was linked to an increased rate of foot pain (P = 0.003). Our data indicated that running injuries were associated with training duration and use of orthotics. Clinicians can use this information in treating or preventing running associated injuries and pain. Copyright © 2011 Elsevier Ltd. All rights reserved.

  8. Emergency operating instruction improvements at San Onofre Nuclear Generating Station Units 2 and 3

    International Nuclear Information System (INIS)

    Trillo, M.W.; Smith, B.H.

    1989-01-01

    In late 1987, San Onofre nuclear generating station (SONGS) began an extensive upgrade of the units 2 and 3 emergency operating instructions (EOIs). The original intent of this program was to incorporate revised generic guidance and to correct problems that were identified by operators. While this program was in progress, the US Nuclear Regulatory Commission (NRC) conducted a series of audits of emergency operating procedure (EOP) development and maintenance programs as 16 commercial nuclear facilities in the United States. These audits included four stations with Combustion Engineering-designed nuclear steam supply systems. (One of these audits included a review of preupgrade SONGS units 2 and 3 EOIs.) Significant industrywide comments resulted from these audits. The NRC has stated its intent to continue the review and audit of EOIs and the associated maintenance programs at all US commercial nuclear facilities. The units 2 and 3 EOI upgrade program developed procedural improvements and procedural program maintenance improvements that address many of the existing audit comments that have been received by the industry. Other resulting improvements may be useful in minimizing NRC comments in future such audits. Specific improvements are discussed. The upgrade program resulted in benefits that were not originally anticipated. The results of this program can be of significant use by other utilities in addressing the industrywide concerns that have been raised in recent NRC audits of EOP development and maintenance programs

  9. Finance computationnelle et gestion des risques ingénierie financière avec applications Excel (Visual Basic) et Matlab

    CERN Document Server

    Racicot, François-Éric

    2006-01-01

    Ce manuel propose un exposé rigoureux de la gestion des risques en finance. Les aspects théoriques de la question sont abordés par des démonstrations claires et des rappels élaborés des bases mathématiques de la finance computationnelle. Le texte est émaillé de nombreux programmes écrits en langages Visual Basic (Excel), Matlab et EViews qui prépareront l'étudiant à sa carrière de spécialiste en ingénierie financière.

  10. Mapping the social impacts of small dams: The case of Thailand's Ing River basin.

    Science.gov (United States)

    Fung, Zali; Pomun, Teerapong; Charles, Katrina J; Kirchherr, Julian

    2018-05-24

    The social impacts of large dams have been studied extensively. However, small dams' social impacts have been largely neglected by the academic community. Our paper addresses this gap. We examine the social impacts of multiple small dams in one upstream and one downstream village in Thailand's Ing River basin. Our research is based on semi-structured interviews with beneficiaries, government and NGOs. We argue that small dams' social impacts are multi-faceted and unequal. The dams were perceived to reduce fish abundance and provide flood mitigation benefits. Furthermore, the dams enabled increased access to irrigation water for upstream farmers, who re-appropriated water via the dams at the expense of those downstream. The small dams thus engendered water allocation conflicts. Many scholars, practitioners and environmentalists argue that small dams are a benign alternative to large dams. However, the results of our research mandate caution regarding this claim.

  11. Teeninduse taseme hoidmine ja heade teenindajate leidmine on tööandjatele võtmeküsimus / Anu-Mall Naarits, Anneli Mere, Kristjan Laja, Inge Suder

    Index Scriptorium Estoniae

    2009-01-01

    Anu-Mall Naarits Maratist, Anneli Mere Matkasport OÜ-st, Kristjan Laja Ambient Marketingist ning Inge Suder AS-ist Eesti Post vastavad küsimustele, mis puudutavad tagasisidet teenindusele, teenindajatele pakutavaid koolitusi ja motivatsioonipakette, teeninduse taset Eestis, teenindustöötajate palgataset, hea teenindaja isikuomadusi ning raskemaid ülesandeid teenindaja töös

  12. A Study of the Central Auditory Function in Stutters by Masking Level Difference and Synthetic Sentence Identification Tests

    Directory of Open Access Journals (Sweden)

    Afsaneh Rajab

    2007-06-01

    Full Text Available Background and Aim: There are evidences that indicate a relationship between auditory processing disor¬ders and stuttering,¬ and any disorder in the central auditory function can be at least one of the underly¬ing causes of stuttering. Even though, using the most state of the art radiographic technologies, i.e. MRI, no definitive answer has been given in relative to this question. In this research, using Mask-ing Level Difference (MLD and Synthetic Sentence Identification (SSI tests, the central auditory func¬tion of stutters and normal group was evaluated.Materials and Methods: In this study was analytic cross-sectional, fifteen male patients with stutter-ing and 15 male normal cases with the age range from 16 to 40 years (average age 26.78 year were evalu¬ated. SSI-ICM, SSI-CCM and MLD tests were performed. The results were compared in both groups.Results: Although stutterers mean MLD was less than that of normal group, the different was not signifi¬cant between stutters and normal group in SSI test in right ear at negative MCRs. There was a signifi¬cant difference in ICM state, but in CCM state, there was no significant difference between the aver¬age score of two groups in various MCRs.Conclusion: The findings of this research is compatible with those of similar researches about the SSI test and the pattern of results, probably indicates a partial dysfunction of brainstem in some of the stutters.

  13. The quality of rapid HIV testing in South Africa: an assessment of ...

    African Journals Online (AJOL)

    100%, which was higher than laboratory technicians who scored 99.3%.10 In this study, human error in recording results was considered to be a potential reason for the discrepancy.10 The proficiency of personnel administer- ing HIV testing has an impact on the sensitivity (ability of the kit to correctly detect specimens ...

  14. Cambodian and their Doctors, a Medical Anthropology of Colonial and Post-Colonial Cambodia, Jan Ovesen & Ing-Britt Trankell

    Directory of Open Access Journals (Sweden)

    Didier Bertrand

    2012-09-01

    Full Text Available Cet ouvrage, écrit par Jan Ovesen et Ing-Britt Trankell (professeurs associés d’anthropologie à l’université d’Uppsala engagés dans l’étude de la société cambodgienne depuis 1995, offre une synthèse unique d’anthropologie historique et d’ethnographie contemporaine sur le système de soins de santé cambodgien de la colonisation française à nos jours. Les auteurs décrivent la tension dans le Cambodge moderne entre la tradition médicale occidentale introduite par les colonisateurs français et le...

  15. Unconventional wisdom [Entergy's economic management of five disparate nuclear units

    International Nuclear Information System (INIS)

    Wood, J.

    1996-01-01

    The conventional wisdom is that a competitive nuclear power programme requires standard plants, multi-unit sites and economies of scale. Entergy Operations, Inc (EOI) in the USA has five nuclear units of two reactor types, acquired from five vendors and located on four sites separated by hundreds of miles. EOI set two bench marks in its aim to deliver electricity at the market price from each of its nuclear units while meeting the costs of O and M, fuel, capital investment and overheads. The first was to become the best operator of each type of its differently designed units. The second was to combine the sense of ownership and expertise of single unit operators with the flexibility and efficiency of multi-unit sites. In order to achieve this, EOI aims to operate the five units as though they were on one site. Central to this plan is a set of peer groups, each of which deals with an aspect of plant operation, sharing good practice across all the units. Building on this, increasingly during outages, employees are brought in from other units rather than employing outside contractors. Although EOI employees are more expensive on an hourly basis they are two to three times more efficient than outside contractors. The peer group concept is also leading to rationalisation of expertise as groups become identified with particular specialisations which back-up teams working on other units. (U.K.)

  16. Ingénierie de la maintenance De la conception à l'exploitation d'un bien

    CERN Document Server

    Francastel, Jean-Claude

    2003-01-01

    La maintenance a évolué : d’abord confinée à l’entretien des équipements “réparer“ les pannes puis élargie à leur surveillance “prévoir” les pannes elle est intégrée aujourd’hui dès la phase de conception du produit avec notamment le concept de “maintenabilité” du produit. L’ingénierie de maintenance désigne ce processus d’accompagnement d’un bien industriel durant toutes les phases de son cycle de vie de la conception au démantèlement qui permet d’optimiser l’exploitation de ce bien et son coût global life cycle cost. Cet ouvrage décrit les différentes phases du cycle de vie en exposant les techniques qui permettent d’intégrer à chaque étape les concepts de maintenance.

  17. Mild angle early onset idiopathic scoliosis children avoid progression under FITS method (Functional Individual Therapy of Scoliosis).

    Science.gov (United States)

    Białek, Marianna

    2015-05-01

    Physiotherapy for stabilization of idiopathic scoliosis angle in growing children remains controversial. Notably, little data on effectiveness of physiotherapy in children with Early Onset Idiopathic Scoliosis (EOIS) has been published.The aim of this study was to check results of FITS physiotherapy in a group of children with EOIS.The charts of the patients archived in a prospectively collected database were retrospectively reviewed. The inclusion criteria were:diagnosis of EOIS based on spine radiography, age below 10 years, both girls and boys, Cobb angle between 118 and 308, Risser zero, FITS therapy, no other treatment (bracing), and a follow-up at least 2 years from the initiation of the treatment. The criterion for curve progression were as follows: the Cobb angle increase of 68 or more, for curve stabilization; the Cobb angle was 58 comparing to the initial radiograph,for curve correction; and the Cobb angle decrease of 68 or more at the final follow-up radiograph.There were 41 children with EOIS, 36 girls and 5 boys, mean age 7.71.3 years (range 4 to 9 years) who started FITS therapy. The curve pattern was single thoracic (5 children), single thoracolumbar (22 children) or double thoracic/thoracolumbar (14 children), totally 55 structural curvatures. The minimum follow-up was 2 years after initiation of the FITS treatment, maximum was 16 years, mean 4.8 years). At follow-up the mean age was 12.53.4 years. Out of 41 children, 10 passed pubertal growth spurt at the final follow-up and 31 were still immature and continued FITS therapy. Out of 41 children, 27 improved, 13 were stable, and one progressed. Out of 55 structural curves, 32 improved, 22 were stable and one progressed. For the 55 structural curves, the Cobb angle significantly decreased from 18.085.48 at first assessment to 12.586.38 at last evaluation,pphysiotherapy was effective in preventing curve progression in children with EOIS. Final postpubertal follow-up data is needed.

  18. Kes peaks tagama seaduste täitmise? / Inge Timoštšuk, Volli Kalm, Maiki Udam ; üles kirjutanud Ülo Tikk

    Index Scriptorium Estoniae

    Timoštšuk, Inge, 1970-

    2001-01-01

    Vene koolidel käib Põhikooli- ja Gümnaasiumiseaduse § 52 teise lõike "Riigi- ja munitsipaalgümnaasiumides alustatakse üleminekut eesti õppekeelele hiljemalt 2007/08. õppeaastal" täitmine üle jõu, kuna ei jätku pädevaid õpetajaid. Teemat kommenteerivad Tartu Ülikooli prorektor Volli Kalm, Tallinna Pedagoogikaülikooli õpetajakoolituse osakonna juhataja Inge Timoštšuk ja Haridusministeeriumi kõrghariduse talituse juhataja Maiki Udam

  19. Expressed emotion and sociocultural moderation in the course of schizophrenia.

    Science.gov (United States)

    Aguilera, Adrian; López, Steven R; Breitborde, Nicholas J K; Kopelowicz, Alex; Zarate, Roberto

    2010-11-01

    This study examined whether the sociocultural context moderates the relationship between families' expressed emotion (EE) and clinical outcomes in schizophrenia. In a sample of 60 Mexican American caregivers and their ill relatives, we first assessed whether EE and its indices (criticism, emotional overinvolvement [EOI], and warmth) related to relapse. Second, we extended the analysis of EE and its indices to a longitudinal assessment of symptomatology. Last, we tested whether bidimensional acculturation moderated the relationship between EE (and its indices) and both relapse and symptom trajectory over time. Results indicated that EOI was associated with increased relapse and that criticism was associated with increased symptomatology. Additionally, as patients' Mexican enculturation (Spanish language and media involvement) decreased, EE was increasingly related to relapse. For symptomatology, as patients' U.S. acculturation (English language and media involvement) increased, EE was associated with increased symptoms longitudinally. Our results replicate and extend past research on how culture might shape the way family factors relate to the course of schizophrenia. PsycINFO Database Record (c) 2010 APA, all rights reserved

  20. Dr Oen Boen Ing Patriot doctor, social activist, and doctor of the poor

    Directory of Open Access Journals (Sweden)

    Ravando Lie

    2017-05-01

    Full Text Available This article examines the efforts and achievements of Oen Boen Ing, a Tionghoa doctor, to improve the quality of health of the poorer inhabitants of Surakarta. Dr Oen played an important role in five different periods: Dutch colonialism, the Japanese occupation, the Indonesian revolution, Soekarno’s regime, and Suharto’s New Order. Known for being a benevolent doctor, activist, and patriot of the revolution during his life-time, Dr Oen also gave medical assistance to the needy, which famously earned him the accolade of “doctor of the poor”. During the Indonesian revolution, Dr Oen assisted the Student Soldiers (Tentara Pelajar and afterwards was appointed the member of Supreme Advisory Council (Dewan Pertimbangan Agung/DPA by Soekarno in 1949. As a benevolent doctor and activist, Dr Oen is remembered for founding the Panti Kosala Hospital which was renamed to perpetuate his name on 30 October 1983, exactly a year after his passing. When he died, thousands of peoples gathered to pay their final respects to the doctor. He was honoured with a ceremony conducted in the Mangkunegaran Palace. Dr Oen’s name will be eternally respected, especially in Surakarta.

  1. Safety of Quadrivalent Meningococcal Conjugate Vaccine in Children 2-10 Years.

    Science.gov (United States)

    Tartof, Sara Yee; Sy, Lina S; Ackerson, Bradley K; Hechter, Rulin C; Haag, Mendel; Slezak, Jeffrey M; Luo, Yi; Fischetti, Christine A; Takhar, Harp S; Miao, Yan; Solano, Zendi; Jacobsen, Steven J; Tseng, Hung-Fu

    2017-11-01

    Quadrivalent meningococcal conjugate vaccine is recommended for children, adolescents and adults at increased risk of meningococcal disease. In 2011, MenACWY-CRM (Menveo, GSK, Siena, Italy) was approved for children 2-10 years of age in the United States. Although no safety concerns arose from clinical trials, it remains important to monitor its safety in routine clinical settings. Kaiser Permanente Southern California members 2-10 years old who received MenACWY-CRM between September 2011 and September 2014 were included. Electronic health records were searched using a validated algorithm to identify 26 prespecified events of interests (EOIs) and serious medically attended events (SMAEs) from inpatient or emergency settings up to 1 year after MenACWY-CRM vaccination. SMAEs were categorized by International Classification of Diseases, 9th revision diagnostic categories. All events were reviewed to confirm the diagnosis and symptom onset date. The study was descriptive (NCT01452438); no statistical tests were performed. Among 387 vaccinated children, 327 with ≥6 months membership before vaccination were analyzed. Among EOIs, 9 asthma cases and 1 myasthenia gravis case underwent chart review which confirmed 1 incident asthma case occurring 237 days after concomitant vaccination with MenACWY-CRM and typhoid vaccine. Thirty-one children experienced SMAEs, most commonly because of unrelated injury and poisoning. The remaining events occurred sporadically after vaccination and most were unlikely related to vaccination based on medical record review. One incident EOI of asthma late in the 1-year observation period and sporadic distribution of SMAEs were observed. These data do not suggest safety concerns associated with MenACWY-CRM vaccination in children 2-10 years old.

  2. The plays of Lillian Hellman, Clifford Odets and William Inge on Slovene stages

    Directory of Open Access Journals (Sweden)

    Mateja Slunjski

    2002-12-01

    Full Text Available After the Second World War, Slovene theatres started to include in their repertoires more and more American authors and their plays. Their choice were varied, from serious dramas by Eugene O'Neill, Tennessee Williams and Arthur Miller, to comedies by Norman Krasna and John Van Druten dependant mostly on the availability of the texts. In the immediate postwar years the theatres liked to present playwrights with progressive ideas in their plays, such as Lillian Hellman and her "The Little Foxes", which was successfully produced at three Slovene theatres, while her "The Children's Hour" received negative reviews. In the fifties, three theatres chose two plays by Clifford Odets, "Golden Boy" and "Country Girl", mainly because of his socially critical ideas and his admiration of humanity. His plays were rather well received; however, the critics doubted his literary genius. William Inge and his plays, "Come Back, Little Sheba", "Picnic" and "Bus Stop", chosen mainly because of the warmth with which the author depicted the tragedy and the beauty of life, were produced at three Slovene theatres. The author received rather wide-ranging opinions from the critics. Some thought him to be an unoriginal depicter of dull American life, while others praised his lyricism and new dramatic techniques.

  3. Les métiers innovants de la formation. Le champ de la formation professionnelle et l'ingénierie de formation à distance

    OpenAIRE

    Marty, Olivier

    2013-01-01

    National audience; This document is extracted from a conference for PhD students at La Sorbonne University (Paris) about innovative teaching professions. It describes and analyses the crafts of vocational education as well as public distance education engineering.; Ce document est le support d'une conférence sur les métiers innovants de la formation. Après les définitions d'usage, il décrit et analyse les métiers de la formation professionnelle continue et l'ingénierie de formation à distance...

  4. Sedimentary environments in the south-western Barents Sea during the last deglaciation and the Holocene: a case study outside the Ingøydjupet trough

    Directory of Open Access Journals (Sweden)

    Mauro Pau

    2016-05-01

    Full Text Available A lithological and foraminiferal study of newly acquired sediment cores outside the Ingøydjupet (Ingøy Deep trough has been carried out to improve constraints on the last deglacial history in the south-western Barents Sea. Three lithofacies and three foraminiferal facies were identified. The lowermost lithological unit is a diamicton interpreted as glacial till. It contains a low-abundance, ecologically mixed foraminiferal assemblage, presumably resulting from glacial reworking. Above the diamicton, a layer of ice-rafted debris (IRD, likely associated with intensive iceberg production, marks the initial destabilization of the marine-based ice sheet. At this time, ca. 15.6–15.0 Ky B.P., opportunistic foraminiferal species Nonionellina labradorica and Stainforthia spp. reached peak abundance. During the south-western Barents Sea ice-margin retreat, presumably corresponding to the Bølling interstadial, a sequence of glaciomarine laminations was deposited conformably on the layer of IRD. Sedimentation rates were apparently high (estimated about 0.4 cm per year and the foraminiferal fauna was dominated by Elphidium spp. and Cassidulina reniforme, species common for glacier-proximal environments. A hiatus at the top of the deglacial unit is likely linked to the high bottom-current activity associated with a strengthened inflow of Atlantic water masses into the Barents Sea. The uppermost lithological unit is represented by the Holocene marine sandy mud. It contains a high-abundance, high-diversity foraminiferal fauna with common cassidulinids, Cibicides spp., Epistominella pusilla and planktic species.

  5. Potentially harmful excipients in neonatal medicines

    DEFF Research Database (Denmark)

    Nellis, Georgi; Metsvaht, Tuuli; Varendi, Heili

    2015-01-01

    OBJECTIVES: We aimed to describe administration of eight potentially harmful excipients of interest (EOI)-parabens, polysorbate 80, propylene glycol, benzoates, saccharin sodium, sorbitol, ethanol and benzalkonium chloride-to hospitalised neonates in Europe and to identify risk factors for exposure....... METHODS: All medicines administered to neonates during 1 day with individual prescription and demographic data were registered in a web-based point prevalence study. Excipients were identified from the Summaries of Product Characteristics. Determinants of EOI administration (geographical region......, gestational age (GA), active pharmaceutical ingredient, unit level and hospital teaching status) were identified using multivariable logistical regression analysis. RESULTS: Overall 89 neonatal units from 21 countries participated. Altogether 2095 prescriptions for 530 products administered to 726 neonates...

  6. Une expérience pédagogique du débat public en école d'ingénieur. Le cas du nucléaire

    Directory of Open Access Journals (Sweden)

    Colmellere Cynthia

    2014-01-01

    Full Text Available Cette communication présente un dispositif pédagogique d'exercice de débat public autour d'un projet d'implantation d'un réacteur nucléaire. Cet exercice est mené depuis trois ans dans le cadre d'un cours de sociologie pour des ingénieurs de deuxième année à l'Ecole Centrale Paris. Il concerne un groupe d'une vingtaine d'élèves et s'inspire d'une situation réelle et actuelle : le projet d'implantation d'un réacteur nucléaire de type EPR à Penly (76. Dans cette contribution, nous présentons tout d'abord les enjeux de cette expérience pédagogique dans le contexte de notre établissement et les questions pédagogiques qu'elle pose. Dans une deuxième partie, nous détaillons les différentes séquences du cours qui servent à préparer ce débat. Dans la troisième, nous revenons sur le déroulement du débat et la phase de discussion critique entre les observateurs, les élèves et l'enseignante qui s'ensuit. Nous concluons sur les apports et les limites de cet exercice en les mettant en perspective avec les enjeux de l'enseignement des controverses scientifiques et techniques dans la formation des ingénieurs.

  7. Reliable and sensitive physical testing of elite trapeze sailors

    DEFF Research Database (Denmark)

    Bay, Jonathan; Bojsen-Møller, Jens; Nordsborg, Nikolai Baastrup

    2018-01-01

    It was investigated, if a newly developed discipline specific test for elite-level trapeze sailors is reli-able and sensitive. Furthermore, the physical demands of trapeze sailing were examined. In part 1, nine national team athletes were accustomed to a simulated sailing test, which subsequently....... 265 ± 45W, Psailing was 54.5 ± 7.2% VO2max , 75.1 ± 3.1% HRmax and 5.8 ± 2.7 mM, respectively. However, VO2 and HR were substantially higher for periods of the race...... as peak values were 83.5 ± 11.4% and 89.9 ± 1.7% of max, respectively. In conclusion, the present test is reliable and sensitive, thus providing a sailing specific alternative to traditional physical testing of elite trapeze sailors. Additionally, on-water rac-ing requires moderate aerobic energy...

  8. Biotechnology; Managing the Risks of Field Testing Genetically Engineered Organisms

    Science.gov (United States)

    1988-06-01

    iSte (t’ I risk Sou Irce rat her thaliaii sIlliply jirol Iibit ing it. Risk-I alanc ing Appuoach lHisk-ha lancing is II ie lii(1 cmi iilly used risk...inely reqIlilt ’S OF it S t(V’tlI&’t 0r 1- tiC 10~-ri NA or-gi- nlisils. As a r-esiult, inl Felwllairy 1 987. viH ix ec nmwnded t hat ap pend ix K< lie

  9. Resonance bending fatigue testing with simultaneous damping measurement and its application on layered coatings

    Czech Academy of Sciences Publication Activity Database

    Kovářík, O.; Haušild, P.; Čapek, J.; Medřický, Jan; Siegl, J.; Mušálek, Radek; Pala, Zdeněk; Curry, N.; Bjorklund, S.

    2016-01-01

    Roč. 82, January (2016), s. 300-309 ISSN 0142-1123. [International Conference on Fatigue Damage of Structural Materials Conference/10./. Massachusetts, 21.09.2014-26.09.2014] R&D Projects: GA ČR GB14-36566G Institutional support: RVO:61389021 Keywords : Crack detection * Damping * Fatigue * Hastelloy-X * Nondestructive test ing Subject RIV: JK - Corrosion ; Surface Treatment of Materials Impact factor: 2.899, year: 2016 http://www.sciencedirect.com/science/article/pii/S0142112315002443

  10. Gérer l'interface entre ingénierie, didactique, pédagogie et dispositifs ouverts Interfacing open learning environments, didactics and pedagogy

    Directory of Open Access Journals (Sweden)

    Guy Achard-Bayle

    2003-06-01

    Full Text Available Nous proposons de croiser le regard du didacticien linguiste et celui du spécialiste de l'utilisation des TIC pour la formation et de l'ingénierie de formation, afin d'analyser des dispositifs expérimentaux "ouverts" que nous avons pu observer de près. Le premier est un dispositif à distance basé sur une pédagogie du projet, le second relève de l'autoformation guidée en centre de ressources. Dans les deux cas on relève le rôle pivot du centre de ressources et la disparition du groupe-classe. Quelques points importants pour une approche des dispositifs ouverts se dégagent, entre autres tutorat et suivi des apprenants, rapport au temps (temps perdu, temps retrouvé, choix des ressources supports des apprentissages (outils de référence et matériaux pédagogiques. Nous plaiderons pour une meilleure gestion de l'interface entre ingénierie, didactique, pédagogie et dispositifs ouverts par une remobilisation du didacticien autour de quelques axes se dégageant de nos observations.We acted as linguists interested in didactics and specialists in the use of ICT to analyze two language learning environments we had an opportunity to closely follow. Both can be labeled as open learning systems relying on self directed learning. We point out the importance of the self access learning centre where learners come and the disappearance of the traditional group. Several relevant elements are analyzed such as tutoring and coaching of learners, changes in the relationship to time (wasting and finding time, choosing appropriate materials (reference tools or teaching materials. We will argue in favor of a more deliberate implication of didactics so as to better approach open learning situations and self directed learning.

  11. Material development in the SI sub 3 N sub 4 system using glass encapsulated Hip'ing

    Energy Technology Data Exchange (ETDEWEB)

    Corbin, N.D.; Sundberg, G.J.; Siebein, K.N.; Willkens, C.A.; Pujari, V.K.; Rossi, G.A.; Hansen, J.S.; Chang, C.L.; Hammarstrom, J.L.

    1992-04-01

    This report covers a two-year program to develop fully dense Si{sub 3}N{sub 4} matrix SiC whisker composites with enhanced properties over monolithic Si{sub 3}N{sub 4} materials. The primary goal was to develop a composite with a fracture toughness > 10 MPa{radical}m, capable of using high pressure glass encapsulated HIP'ing. Coating methods were developed to apply thin (<150nm) stoichiometric BN layers to SiC whiskers and also to apply a dual coating of SiC over carbon to the whiskers. Fracture toughness of the composites was determined to increase as the quantity of whiskers (or elongated grains) with their axis perpendicular to the crack plane increased. Of the interface compositions evaluated in this effort, carbon was determined to be the most effective for increasing toughness. The highest toughnesses (6.8--7.0 MPa{radical}m) were obtained with uniaxially aligned carbon coated whiskers. There was no evidence of the carbon coating compromising the oxidation resistance of the composites at 1370{degree}C.

  12. An Anomaly in the Inglis-Teller Limits of the C VI Lyman and Balmer Series in Laser-Produced Plasmas

    Science.gov (United States)

    Elton, R.; Iglesias, E.; Griem, H.; Weaver, J.; Pien, G.; Mancini, R.

    2002-11-01

    Soft x-ray spectra from thin carbon layers heated by the OMEGA and NIKE lasers have been obtained with both spherical and planar targets, respectively, using a flat-field grazing incidence spectrograph equipped with a gated microchannel plate for temporal resolution. In both experiments, late-time (recombining) hydrogenic C VI spectra show an n-to-1 Lyman spectral series blending with the continuum at n=4, contrary to n=9 in the n-to-2 Balmer series. It appears unlikely that plasma inhomogeneities are the sole cause of this anomaly, given the difference in the experimental configurations. Other explanations for the line-to-continuum merging (other than the usual Stark-broadened Inglis-Teller effect) under consideration include non-thermal Doppler broadening, deviations from statistical sublevel population distributions, and opacity effects. Collisional-radiative and hydrodynamic modeling, including cascades, is employed to further understand this phenomenon.

  13. Guilt, shame and expressed emotion in carers of people with long-term mental health difficulties: A systematic review.

    Science.gov (United States)

    Cherry, Mary Gemma; Taylor, Peter James; Brown, Stephen Lloyd; Rigby, Jake Wilfred; Sellwood, William

    2017-03-01

    Expressed emotion (EE) is a global index of familial emotional climate, whose primary components are emotional over-involvement (EOI) and critical comments (CC)/hostility. There is a strong theoretical rationale for hypothesising that carers' guilt and shame may be differentially associated with their EOI and CC/hostility respectively. This systematic review investigates the magnitude of these theorised associations in carers of people with long-term mental health difficulties. Electronic searches (conducted in May 2016 across Medline, CINAHL, Embase, PsycINFO and ProQuest) were supplemented with iterative hand searches. Ten papers, reporting data from eight studies, were included. Risk of bias was assessed using a standardised checklist. Relevant data were extracted and synthesised narratively. EOI was positively associated with both guilt and shame, whereas CC/hostility was positively associated with shame. The strength of associations varied depending on whether or not guilt and shame were assessed within the context of the caring relationship. Based on these data, an argument can be made for the refinement, development and evaluation of systemic and individual interventions designed to target carers' guilt and shame. However, more research is needed to clarify the strength of these associations and their direction of effect before firm conclusions can be drawn. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  14. SU-E-J-227: Breathing Pattern Consistency and Reproducibility: Comparative Analysis for Supine and Prone Body Positioning

    International Nuclear Information System (INIS)

    Laugeman, E; Weiss, E; Chen, S; Hugo, G; Rosu, M

    2014-01-01

    Purpose: Evaluate and compare the cycle-to-cycle consistency of breathing patterns and their reproducibility over the course of treatment, for supine and prone positioning. Methods: Respiratory traces from 25 patients were recorded for sequential supine/prone 4DCT scans acquired prior to treatment, and during the course of the treatment (weekly or bi-weekly). For each breathing cycle, the average(AVE), end-of-exhale(EoE) and end-of-inhale( EoI) locations were identified using in-house developed software. In addition, the mean values and variations for the above quantities were computed for each breathing trace. F-tests were used to compare the cycle-to-cycle consistency of all pairs of sequential supine and prone scans. Analysis of variances was also performed using population means for AVE, EoE and EoI to quantify differences between the reproducibility of prone and supine respiration traces over the treatment course. Results: Consistency: Cycle-to-cycle variations are less in prone than supine in the pre-treatment and during-treatment scans for AVE, EoE and EoI points, for the majority of patients (differences significant at p<0.05). The few cases where the respiratory pattern had more variability in prone appeared to be random events. Reproducibility: The reproducibility of breathing patterns (supine and prone) improved as treatment progressed, perhaps due to patients becoming more comfortable with the procedure. However, variability in supine position continued to remain significantly larger than in prone (p<0.05), as indicated by the variance analysis of population means for the pretreatment and subsequent during-treatment scans. Conclusions: Prone positioning stabilizes breathing patterns in most subjects investigated in this study. Importantly, a parallel analysis of the same group of patients revealed a tendency towards increasing motion amplitude of tumor targets in prone position regardless of their size or location; thus, the choice for body positioning

  15. Enzymatic biosensors based on ingá-cipó peroxidase immobilised on sepiolite for TBHQ quantification.

    Science.gov (United States)

    Regina de Oliveira, Tássia; Grawe, Gregory Ferreira; Moccelini, Sally Katiuce; Terezo, Ailton J; Castilho, Marilza

    2014-05-07

    Sepiolite clay mineral was used as a support for the immobilisation of the peroxidase enzyme from ingá-cipó (Inga edulis Mart.) and was used with graphite powder, multi-walled carbon nanotubes (CNTs), mineral oil, and nafion 0.5% (v/v) in the development of a new biosensor for the determination of the antioxidant tert-butylhydroquinone (TBHQ) by square-wave voltammetry (SWV). For the optimisation and application of the biosensor, several parameters were investigated to determine the optimum experimental conditions using SWV. The best performance was obtained using a 0.1 mol L(-1) phosphate buffer solution (pH 7.0), 4.0 × 10(-4) mol L(-1) hydrogen peroxide, a frequency of 50 Hz, a pulse amplitude of 60 mV, and a scan increment of 6 mV. The biosensor showed good repeatability and reproducibility and remained stable for a period of 20 weeks. The analytical curve revealed a linear response range of 1.65 to 9.82 mg L(-1) (r = 0.994) with detection and quantification limits of 0.41 and 1.25 mg L(-1). A recovery study of TBHQ in salad dressing samples yielded values from 99.6-104.8%. The proposed biosensor was successfully used for the determination of TBHQ in commercial salad dressing samples, giving a relative error of 5.4% in relation to the comparative method (chromatographic).

  16. Nigerian Food Journal - Vol 24, No 1 (2006)

    African Journals Online (AJOL)

    Physico-chemical properties of maize and sorghum starches and their effects on the sensory ... BA Njoku, EOI Banigo, CN Ubbaonu, 61-72 ... Physico-chemical properties of precooked cassava (Manihot esculenta Crantz) flour prepared by ...

  17. Le français, clé de l’avenir professionnel de l’étudiant : exemple de la formation des ingénieurs en télécommunications

    Directory of Open Access Journals (Sweden)

    Mª Ángeles Lence

    2014-12-01

    Full Text Available Cet article veut attirer l’attention sur l’importance de la langue française dans la formation des étudiants universitaires, non seulement au niveau académique pour qu’ils puissent poursuivre leurs études dans un pays francophone, mais aussi au niveau professionnel pour leur future immersion sur le marché de l’emploi. Dans le contexte de la globalisation qui impose la maîtrise de l’anglais comme un requis inexcusable dans les offres d’emploi, la connaissance d’une deuxième langue étrangère accorde une valeur de plus au curriculum des diplômés espagnols, en les mettant en conditions égales avec leurs homologues européens, en augmentant leurs possibilités de travail au niveau international, en les rendant enfin aussi compétitifs que les diplômés d’autres universités où le bagage de deux langues étrangères conditionne l’obtention du diplôme d’ingénieur. Comme exemple, nous exposons comment les étudiants peuvent apprendre le français dans les études actuelles de Grado en Ingénierie Technique de Télécommunications de l’Universitat Politècnica de València (UPV, en comparant en même temps avec l’apprentissage des langues dans une École homologue en France.

  18. Approches par points de vue pour l’ingénierie des Systèmes d’information

    Directory of Open Access Journals (Sweden)

    Brahim Lahna

    2009-07-01

    Full Text Available Les concepts de point de vue, de rôle, de perspective et de vue ont été largement étudiés et utilisés dans de nombreux travaux, dans divers domaines de l’informatique. On retrouve ces notions dans les Systèmes de Représentation de Connaissances par Objets, les Bases de Données Orientées Objets, les Méthodes de Conception, la Programmation Orientée Objets, etc. Chaque domaine lui donne sa propre définition et l’utilise dans son propre contexte. La notion de vue se développe indépendamment dans ces différentes disciplines. Bien que les propositions différent, elles sont confrontées aux mêmes problèmes : établir des relations entre vues et garantir la cohérence des vues entre elles ou vis-à-vis d'un modèle de référence. Nous présentons dans cet article des travaux relatifs aux notions de vues et points de vue dans différentes disciplines informatiques en insistant sur une proposition originale pour une nouvelle ingénierie des systèmes d’information orientée perspectives et composants multivues réutilisables.

  19. Thermal Exposure and Environment Effects on Tension, Fracture and Fatigue of 5XXX Alloys Tested in Different Orientations

    Science.gov (United States)

    2017-12-27

    Thermal Exposure and Environment Effects on Tension, Fracture and Fatigue of 5XXX Alloys Tested in Different Orientations Sb. GRANT NUMBER ONR-N000 14...e.g.Hl31, HI 16, HI 28), thermal exposure conditions (i .e. time, temperature), and environment (e.g. dry air, humid air, solutions) on the... environmental cracking susceptibility at different load ing rates in both the S-T and L-T orientations. Experiments were conducted using slow strain rate

  20. Product-Improvement Test (Phase II), Jetcal Tester, Model H119A.

    Science.gov (United States)

    1969-03-05

    Ao—A0 51 113 ARMY AVIATION ‘Cs’ BOARD FORT tUCKER ALA — P*OOUCTeII ROVEMCNT TEST ( FHAS ~ I I ) . JETCAL TESTER, MODEL M119A~~’ETC(U) MAR S9...Phase i i ) , Jetcal Tester , Model H 119A , USATECOM Project No. 4-6-5011-03 b . No fur ther consideration be given to the TEMPCAL heater probe as a...essen t i a l component of the Jetcal Tester. e. The service manual instruct ions for con t inu i ty te s t ing of EG1 thermocouples be revised to

  1. The European Expression Of Interest For High Purity U-233 Materials

    Energy Technology Data Exchange (ETDEWEB)

    Giaquinto, Joseph M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Younkin, James R. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-04-01

    The purpose of this letter report is to document the response for an Expression of Interest (EOI) sent to the European Safeguards and research and development (R&D) scientific communities for the distribution of small amounts of high purity 233U materials for use in safeguards, nonproliferation, and basic R&D in the nuclear disciplines. The intent for the EOI was to gauge the level of international interest for these materials from government and research institutions with programmatic missions in the nuclear security or nuclear R&D arena. The information contained herein is intended to provide information to assist key decision makers in DOE as to the ultimate disposition path for the high purity materials currently being recovered at Oak Ridge National Laboratory (ORNL) and only those items for which there is no United States (U.S.) sponsor identified.

  2. The no-arbitrage efficiency test of the OMX Index option market

    DEFF Research Database (Denmark)

    Hou, Ai Jun; Wiktorsson, Magnus; Zhao, RuiZhi

    2012-01-01

    In this paper, we test the market efficiency of the OMXS30 Index option market. The market efficiency definition is the absence of arbitrage oppor- tunity in the market. We first check the arbitrage opportunity by examining the boundary conditions and the Put-Call-Parity that must be satisfied...... in the market. Then a variance based efficiency test is performed by establish- ing a risk neutral portfolio and re-balance the initial portfolio in different trading strategies. In order to choose the most appropriate model for option price and hedging strategies, we calibrate several most applied models, i.......e. the BS, Merton, Heston, Bates model and Affine Jump Diffusion models. Our results indicate that the AJD model significantly outperforms other models in the option price forecast and the trading strategies. The bound- ary and the PCP test and the dynamic hedging strategy results evidence...

  3. Large-Eddy Simulation (LES of Spray Transients: Start and End of Injection Phenomena

    Directory of Open Access Journals (Sweden)

    Battistoni Michele

    2016-01-01

    Full Text Available This work reports investigations on Diesel spray transients, accounting for internal nozzle flow and needle motion, and demonstrates how seamless calculations of internal flow and external jet can be accomplished in a Large-Eddy Simulation (LES framework using an Eulerian mixture model. Sub-grid stresses are modeled with the Dynamic Structure (DS model, a non-viscosity based one-equation LES model. Two problems are studied with high level of spatial and temporal resolution. The first one concerns an End-Of-Injection (EOI case where gas ingestion, cavitation, and dribble formation are resolved. The second case is a Start-Of-Injection (SOI simulation that aims at analyzing the effect of residual gas trapped inside the injector sac on spray penetration and rate of fuel injection. Simulation results are compared against experiments carried out at Argonne National Laboratory (ANL using synchrotron X-ray. A mesh sensitivity analysis is conducted to assess the quality of the LES approach by evaluating the resolved turbulent kinetic energy budget and comparing the outcomes with a length-scale resolution index. LES of both EOI and SOI processes have been carried out on a single hole Diesel injector, providing insights in to the physics of the processes, with internal and external flow details, and linking the phenomena at the end of an injection event to those at the start of a new injection. Concerning the EOI, the model predicts ligament formation and gas ingestion, as observed experimentally, and the amount of residual gas in the nozzle sac matches with the available data. The fast dynamics of the process is described in detail. The simulation provides unique insights into the physics at the EOI. Similarly, the SOI simulation shows how gas is ejected first, and liquid fuel starts being injected with a delay. The simulation starts from a very low needle lift and is able to predict the actual Rate-Of-Injection (ROI and jet penetration, based only on the

  4. High-Gradient Test of a 3 GHz Single-Cell Cavity

    CERN Document Server

    Verdú-Andrés, S; Bonomi, R; Degiovanni, A; Garlasché, M; Garonna, A; Mellace, C; Pearce, P; S. Verdú-Andrés; Wegner, R

    2010-01-01

    Pro­ton and car­bon ion beams pre­sent ad­van­ta­geous depth-dose dis­tri­bu­tions with re­spect to X-rays. Car­bon ions allow a bet­ter con­trol of "ra­diore­sis­tant" tu­mours due to their high­er bi­o­log­i­cal re­sponse. For deep-seat­ed tu­mours pro­ton and car­bon ion beams of some nA and en­er­gies of about 200 MeV and 400 MeV/u re­spec­tive­ly are need­ed. For these ap­pli­ca­tions TERA pro­posed the "cy­clinac": a high-fre­quen­cy linac which boosts the hadrons ac­cel­er­at­ed by a cy­clotron. The di­men­sions of the com­plex can be re­duced if high­er ac­cel­er­at­ing gra­di­ents are achieved in the linac. To test the max­i­mum achiev­able fields, a 3 GHz cav­i­ty has been built by TERA. The 19 mm-long cell is fore­seen to be ex­cit­ed at 200 Hz by 3 us RF puls­es and should reach a 40 MV/m ac­cel­er­at­ing gra­di­ent, which cor­re­sponds to a peak sur­face elec­tric field Es of 260 MV/m. In a first high-pow­er test per­for...

  5. Reactivation of latent HIV-1 by new semi-synthetic ingenol esters

    Energy Technology Data Exchange (ETDEWEB)

    Pandeló José, Diego [Departamento de Genética, Instituto de Biologia, Universidade Federal do Rio de Janeiro, Rio de Janeiro 21941-902 (Brazil); Bartholomeeusen, Koen [Department of Medicine, Microbiology and Immunology, University of California at San Francisco, San Francisco, CA 94143-0703 (United States); Delveccio da Cunha, Rodrigo; Abreu, Celina Monteiro [Departamento de Genética, Instituto de Biologia, Universidade Federal do Rio de Janeiro, Rio de Janeiro 21941-902 (Brazil); Glinski, Jan [PlantaAnalytica LLC, Danbury, CT 06810 (United States); Barbizan Ferreira da Costa, Thais; Bacchi Rabay, Ana Flávia Mello; Pianowski Filho, Luiz Francisco [Kyolab Laboratories, Valinhos, São Paulo 13273-105 (Brazil); Dudycz, Lech W. [Lex Company Research Laboratories, Shirley 01464, MA (United States); Ranga, Udaykumar [Molecular Biology and Genetics Unit, Jawaharlal Nehru Centre for Advanced Scientific Research, Bengaluru 560064 (India); Peterlin, Boris Matija [Department of Medicine, Microbiology and Immunology, University of California at San Francisco, San Francisco, CA 94143-0703 (United States); Pianowski, Luiz Francisco [Kyolab Laboratories, Valinhos, São Paulo 13273-105 (Brazil); Tanuri, Amilcar [Departamento de Genética, Instituto de Biologia, Universidade Federal do Rio de Janeiro, Rio de Janeiro 21941-902 (Brazil); Aguiar, Renato Santana, E-mail: santana@biologia.ufrj.br [Departamento de Genética, Instituto de Biologia, Universidade Federal do Rio de Janeiro, Rio de Janeiro 21941-902 (Brazil)

    2014-08-15

    The ability of HIV to establish long-lived latent infection is mainly due to transcriptional silencing of viral genome in resting memory T lymphocytes. Here, we show that new semi-synthetic ingenol esters reactivate latent HIV reservoirs. Amongst the tested compounds, 3-caproyl-ingenol (ING B) was more potent in reactivating latent HIV than known activators such as SAHA, ingenol 3,20-dibenzoate, TNF-α, PMA and HMBA. ING B activated PKC isoforms followed by NF-κB nuclear translocation. As virus reactivation is dependent on intact NF-κB binding sites in the LTR promoter region ING B, we have shown that. ING B was able to reactivate virus transcription in primary HIV-infected resting cells up to 12 fold and up to 25 fold in combination with SAHA. Additionally, ING B promoted up-regulation of P-TEFb subunits CDK9/Cyclin T1. The role of ING B on promoting both transcription initiation and elongation makes this compound a strong candidate for an anti-HIV latency drug combined with suppressive HAART. - Highlights: • 3-caproyl-ingenol (ING B) reactivates latent HIV better than SAHA, ingenol 3,20-dibenzoate, TNF-α, PMA and HMBA. • ING B promotes PKC activation and NF-kB translocation to the nucleus. • ING B activates virus transcription of B and non-B subtypes of HIV-1. • ING B activates HIV transcription in infected primary resting CD4+ T cells. • ING B induces higher levels of P-TEFb components in human primary cells.

  6. 76 FR 58822 - Announcement of Funding Awards; Fair Housing Initiatives Program; Fiscal Year 2010

    Science.gov (United States)

    2011-09-22

    ... complaints alleging discrimination based on race, color, religion, sex, handicap, familial status or national... Education and Outreach Initiative (EOI) ($6,755,000), and the Fair Housing Organizations Initiative (FHOI... Housing and Equal Opportunity. Applicant name Contact Region Award amt. Education and Outreach/General...

  7. 78 FR 28002 - In the Matter of South Mississippi Electric Power Association, System Energy Resources, Inc...

    Science.gov (United States)

    2013-05-13

    ... of South Mississippi Electric Power Association, System Energy Resources, Inc., Grand Gulf Nuclear... Amendment I South Mississippi Electric Power Association, System Energy Resources, Inc. (SERI), Entergy... Operating License No. NPF-29. South Mississippi Electric Power Association and SERI are the owners and EOI...

  8. The exhibition"La France au CERN" was inaugurated by Danièle Hulin, Directrice adjointe Secteur Physique, Chimie, Sciences pour l'Ingénieur (PCSI), Ministère délégué à l'Enseignement supérieur et à la recherche.

    CERN Document Server

    Patrice Loïez

    2005-01-01

    The exhibition"La France au CERN" was inaugurated by Danièle Hulin, Directrice adjointe Secteur Physique, Chimie, Sciences pour l'Ingénieur (PCSI), Ministère délégué à l'Enseignement supérieur et à la recherche.

  9. Entre culture générale et enjeux des métiers d'ingénieur : la diversité des enseignements en sciences humaines et sociales à l'École Centrale de Lyon

    Directory of Open Access Journals (Sweden)

    Hourcade Nicolas

    2014-01-01

    Full Text Available Ce texte analyse le développement d'enseignements en sciences humaines et sociales à l'École Centrale de Lyon, établissement formant des ingénieurs généralistes. Très limités au milieu des années 1990, les cours de SHS constituent aujourd'hui un aspect significatif de la formation. La première spécificité de cette offre pédagogique est de comprendre un nombre relativement important de cours obligatoires, complétés par des activités optionnelles. Sa seconde particularité est de traiter de thématiques générales à côté de contenus classiques liés aux enjeux des métiers d'ingénieur. Sa troisième caractéristique est de s'appuyer sur une implication de l'équipe SHS dans les activités professionnalisantes, tout en les séparant des enseignements disciplinaires. Enfin, l'inscription des SHS à l'ECL s'effectue plus par l'enseignement que par la recherche, chaque membre de l'équipe étant rattaché à un laboratoire extérieur différent.

  10. Ocorrência e aspectos ecológicos de metazoários parasitos de peixes do Lago do Parque do Ingá, Maringá, Estado do Paraná = Occurrence and ecological aspects of the metazoan fish parasites from Ingá lake, Maringá, Paraná State

    Directory of Open Access Journals (Sweden)

    Marion Haruko Machado

    2007-07-01

    Full Text Available Nenhum estudo de peixes e parasitos foi realizado, até o momento, no Lago do Parque do Ingá que sofre influências antrópicas desde seu represamento, em 1970. Este trabalho analisou alguns aspectos ecológicos dos parasitos metazoários dos peixes deste lago. Dos peixes analisados, (69,5% estavam parasitados por pelo menos uma espécie de parasito. Foram encontrados 1.372 parasitos pertencentes à Nematoda (larvas e Platyhelminthes (Monogenea e Cestoda, sendo estes os mais prevalentes e numerosos. O encontro de larvas decestóides em Tilapia rendalli e Oreochromis niloticus confirma a importância destas espécies como participantes de níveis tróficos intermediários. A maior abundância de T. rendalli e O. niloticus,no local, pode ser um fator determinante no recrutamento de parasitos. O parasito aproveita-se das espécies de hospedeiros mais abundantes para garantir o desenvolvimento de seu ciclo de vida e também por serem os mais disponíveis à predação pelas aves piscívorasali presentes, o que torna o local de grande importância para a sustentação do ciclo de vida desses parasitos. A baixa diversidade de endoparasitos coletados pode ser justificada pela presença de metais pesados – Cu e Pb – no sedimento, o que deve estar interferindo nodesenvolvimento dos invertebrados, possíveis hospedeiros intermediários.Ingá lake was dammed in 1970 and, since then, no study on fish and parasites had been done, but it has suffered anthropic influences. This study analyzed some ecological aspects of the metazoan parasites form this lake. From analyzed fish, 69.5% had at least one species of parasite. Among them, 1.372 parasites were found, prevailing Nematoda (larvae and Platyhelminthes (Monogenea and Cestoda. The discovery of cestode larvae in Tilapia rendalli and Oreochromis nitolicus confirms the importance of these species as participants of intermediate trophic levels. The great number of Tilapia rendalli and Oreochromis nitolicus

  11. THE MEANS TESTING OF BENEFITS AND THE LABOUR SUPPLY OF THE WIVES OF UNEMPLOYED MEN: RESULTS FROM A MOVER-STAYER MODEL

    OpenAIRE

    Aedin Doris;

    1999-01-01

    Women married to unemployed men in Britain have lower participation rates than those married to employed men. Possible reasons include (1) husbands and wives fac-ing similar unfavourable local labour market conditions, (2) their both having characteristics which make it more likely that they will be unemployed, and (3) the means testing of benefit income, which creates a disincentive for the wife to work. These is-sues are investigated using a British survey of unemployed men and their famili...

  12. Physico-chemical properties of Nigerian pumpkin ( Curcurbita pepo ...

    African Journals Online (AJOL)

    Physico-chemical properties of Nigerian pumpkin (Curcurbita pepo) seed oil. NC Ihediohanma, CN Ubbaonu, ENT Akobundu, EOI Banigo. Abstract. No Abstract. Nigerian Food Journal Vol. 24(1) 2006: 123-126. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  13. Procedure and layout for the development of a fatigue test on an agricultural implement by a four poster test bench

    Directory of Open Access Journals (Sweden)

    M. Cutini

    2013-09-01

    Full Text Available The increasing demand in agricultural vehicles’ power requirements, payloads and driving speeds increases issues related to tractors and farm implements exposure to solicitations. One of the main factors to be taken into account for fatigue test developing on agricultural machines is the heterogeneity of the environment and activity in which the tractor operates. In particular, for contractors the use in transport conditions both on terrain and road becomes important. As far as transport is concerned. factors mainly affecting solicitations on carried implement are soil profile roughness, tractor settings and forward speed. In this paper, CRA-ING laboratory of Treviglio, Italy, together with Frandent Group s.r.l. (Osasco, Italy, analyse the possibility of creating a solicitation profile by means of one four poster test bench for fatigue test on a carried implement simulating transport conditions. Accelerations at the hubs of the tractor were acquired during transport on terrain and reproduced with one electro-hydraulic four posters test bench on one dummy of a tractor developed for carrying the implement. Artificial bumps were mathematically created and introduced in the time history to simulate squares solicitations. Twelve hours of test were carried out. This experience confirmed the possibility of carrying out laboratory fatigue test on agricultural implements by reproducing specific field conditions solicitations with four poster test bench.

  14. Internalizing behavior in adolescent girls affects parental emotional overinvolvement: a cross-lagged twin study.

    Science.gov (United States)

    Moberg, Therese; Lichtenstein, Paul; Forsman, Mats; Larsson, Henrik

    2011-03-01

    The aim of this study was to examine the direction and the etiology of the association between different parenting styles (parental emotional overinvolvement [EOI] and parental criticism) and internalizing behavior from adolescence to early adulthood. A longitudinal genetically informative cross-lagged design was applied to a population-based sample of Swedish twins contacted at age 16-17 (n = 2369) and at age 19-20 (n = 1705). Sex-limitation modelling revealed different effects for boys and girls. For girls, genetic influences on internalizing problems at age 16-17 independently explained 2.7% of the heritability in parental EOI at age 19-20. These results suggest that emotionally overinvolved and self-sacrificing parental behavior stems in part from daughters (but not sons) genetic predisposition for internalizing behavior. These findings highlight the importance of genetically influenced child-driven effects underlying the parenting-internalizing association, and clarify that the role of such effects may differ depending on sex, type of parenting and developmental period.

  15. 78 FR 28005 - System Energy Resources, Inc.; Grand Gulf Nuclear Station; Order Approving Direct and Indirect...

    Science.gov (United States)

    2013-05-13

    ... direct transfer of Grand Gulf ESP Site, to a new limited liability company, System Energy Resource, LLC..., LLC, a Delaware limited liability company, will be created, which will be the direct parent company of... Operations, Inc. (EOI), requested on behalf of itself, SERI, and their parent companies (together, the...

  16. The impact of significant other expressed emotion on patient outcomes in chronic fatigue syndrome.

    Science.gov (United States)

    Band, Rebecca; Barrowclough, Christine; Wearden, Alison

    2014-09-01

    Previous literature has identified the importance of interpersonal processes for patient outcomes in chronic fatigue syndrome/myalgic encephalomyelitis (CFS/ME), particularly in the context of significant other relationships. The current study investigated expressed emotion (EE), examining the independent effects of critical comments and emotional overinvolvement (EOI) in association with patient outcomes. Fifty-five patients with CFS/ME and their significant others were recruited from specialist CFS/ME services. Significant other EE status was coded from a modified Camberwell Family Interview. Patient outcomes (fatigue severity, disability, and depression) were derived from questionnaire measures. Forty-four patients (80%) completed follow-up questionnaires 6-months after recruitment. Significant other high-EE categorized by both high levels of critical comments and high EOI was predictive of worse fatigue severity at follow-up. High-critical EE was associated with higher levels of patient depressive symptoms longitudinally; depressive symptoms were observed to mediate the relationship between high critical comments and fatigue severity reported at follow-up. There were higher rates of high-EE in parents than in partners, and this was because of higher rates of EOI in parents. Patients with high-EE significant others demonstrated poorer outcomes at follow-up compared with patients in low-EE dyads. One mechanism for this appears to be as a result of increased patient depression. Future research should seek to further clarify whether the role of interpersonal processes in CFS/ME differs across different patient-significant other relationships. The development of significant other-focused treatment interventions may be particularly beneficial for both patients and significant others. (PsycINFO Database Record (c) 2014 APA, all rights reserved).

  17. EDITORIAL, FOREWORD

    Directory of Open Access Journals (Sweden)

    Editorial Foreword

    2017-06-01

    Full Text Available Biomaterials and SurfacesSeptember 20th-23th, 2016Herbertov, Czech RepublicOrganized by:Department of Materials Engineering, Faculty of Mechanical Engineering, Czech Technical University in PragueInstitute of Rock Structure and Mechanics AS CRSociety for composite and carbon materialsGuest editor: Ing. Zdeněk ToldeThe colloquium "Biomaterials and surfaces" focuses on methods for biocompatibility testing and methods for characterization and modification of biomaterials and their surfaces. The goal of this seminar is to inform the participants about fundamental problematic of biomaterials and the recent state of research and development of prostheses or artificial replacements in Czech Republic. At the seminar, participants and students are meeting with the scientific capacities in the field of biomaterials and surfaces (materials engineering, medicine, physics, chemistry, biology and with the experts from practice (doctors, representatives of leading Czech companies in the industry.Scientific comitee:Doc. RNDr. Vladimír Starý CSc. (Faculty of Mechanical EngineeringIng. Karel Balík, CSc. (Society for composite and carbon materialsIng. Tomáš Suchý Ph.D. (Institute of Rock Structure and Mechanics AS CR Ing. Radek Sedláček Ph.D. (Faculty of Mechanical Engineering Ing. Zdeněk Tolde (Faculty of Mechanical EngineeringGuarantors of peer review process: Prof. RNDr. Petr Špatenka CSc. (Faculty of Mechanical Engineering Doc. RNDr. Vladimír Starý CSc. (Faculty of Mechanical Engineering Ing. Tomáš Suchý Ph.D. (Institute of Rock Structure and Mechanics AS CR Doc. RNDr. Václav Nehasil, Dr. (Faculty of Mathematics and Physics RNDr. Marta Vandrovcová, Ph.D. (Institute of Physiology CAS Guarantor of language editing:Ing. Stanislav Krum PhD.Organizing comitee: Ing. Karel Balík, CSc. RNDr. Martin Braun, Ph.D. Ing. Ladislav Cvrček Ph.D. Ing. Zdeňka Jeníková Ph.D. Ing. Radek Sedláček Ph.D. Doc. RNDr. Vladimír Starý CSc. Ing. Tomáš Such

  18. International Journal of Tropical Agriculture and Food Systems - Vol ...

    African Journals Online (AJOL)

    Effects of processing on the proximate and sensory quality of 'oze\\' (Bosqueia angolensis) seeds · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. JN Nwosu, CN Ubbaonu, A Uzomah, EOI Banigo, 77-82. http://dx.doi.org/10.4314/ijotafs.v2i1.40964 ...

  19. Association test with the principal component analysis in case ...

    Indian Academy of Sciences (India)

    type data provide an unprecedented opportunity for identify- ing genes underlying complex traits. When multiple markers are available, haplotype-based methods and genotype-based methods are commonly used for conducting association between complex traits and a series of possibly linked mark- ers. Owing to the ...

  20. Comparative Test of the Effectiveness of Large Bombs against Reinforced Concrete Structures (Anglo-American Bomb Tests-Project RUBY).

    Science.gov (United States)

    1946-10-31

    reiiforced concrete structure at FMd ,, full details eof whis are given in Appudix "*C. 7. The Target for the uI= Z0OSIII Filled Bomb Trials# is to . be the...MODIFIED MIll FUZE) & ) CONDENSER rOR IGNITING SQUIBS INITIATING PR•OPELL ING & 7TAIL CHARGES ASSEMBLED DETAILS OF 4500 LB C•/ FtA DISNEY IBOMB, II "’m

  1. La démarche de l’« Ingénierie de la formation » appliquée dans le contexte de la didactique du FLE

    Directory of Open Access Journals (Sweden)

    Nicoleta-Loredana MOROSAN

    2012-12-01

    Full Text Available Le but de cette présentation est de faire le bilan de notre réflexion occasionnée par le stage «Ingénierie de la formation» organisé par le Centre régional francophone pour l’Europe centrale et orientale (CREFECO de l’Organisation Internationale de la Francophonie (OIF et déroulé à Sofia, du 18 au 22 juin 2012. Le séminaire a été cordonné par le formateur français Régis CRISTIN, docteur en sciences du langage. Les participants à ce stage, au nombre de 15, ont été des enseignants de FLE venant de différents établissements d’éducation de cinq pays de l’Europe centrale et orientale, à savoir l’Albanie, l’Arménie, la Bulgarie, la Moldavie et la Roumanie.

  2. The PCNA-associated factor KIAA0101/p15PAF binds the potential tumor suppressor product p33ING1b

    International Nuclear Information System (INIS)

    Simpson, Fiona; Lammerts van Bueren, Kelly; Butterfield, Natalie; Bennetts, Jennifer S.; Bowles, Josephine; Adolphe, Christelle; Simms, Lisa A.; Young, Joanne; Walsh, Michael D.; Leggett, Barbara; Fowles, Lindsay F.; Wicking, Carol

    2006-01-01

    The KIAA0101/p15 PAF /OEATC-1 protein was initially isolated in a yeast two-hybrid screen for proliferating cell nuclear antigen (PCNA) binding partners, and was shown to bind PCNA competitively with the cell cycle regulator p21 WAF . PCNA is involved in DNA replication and damage repair. Using polyclonal antisera raised against a p15 PAF fusion protein, we have shown that in a range of mammalian tumor and non-tumor cell lines the endogenous p15 PAF protein localises to the nucleus and the mitochondria. Under normal conditions no co-localisation with PCNA could be detected, however following exposure to UV it was possible to co-immunoprecipitate p15 PAF and PCNA from a number of cell lines, suggesting a UV-enhanced association of the two proteins. Overexpression of p15 PAF in mammalian cells was also found to protect cells from UV-induced cell death. Based on similarities between the behaviour of p15 PAF and the potential tumor suppressor product p33ING1b, we have further shown that these two proteins interact in the same complex in cell cultures. This suggests that p15 PAF forms part of a larger protein complex potentially involved in the regulation of DNA repair, apoptosis and cell cycle progression

  3. DESIGNING THE STRATEGIES FOR SOCIO-ECONOMIC DEVELOPMENT OF MUNICIPALITY DISTRICTS ON THE BASIS OF SYNTHESIS METHODS FOR COMPLEX SYSTEMS RESEARCH

    Directory of Open Access Journals (Sweden)

    Sergey N. Isaev

    2014-01-01

    Full Text Available The article presents the results of research work on designing the strategies for socio-economic development for the Sholokhovskiy municipal district of Rostov region and Chusovskoy municipal district of Perm Region, which was made by research team of autonomous nonprofit organization of higher education «Eurasian Open Institute» (EOI during the 2012-2013.

  4. 78 FR 75376 - Entergy Operations, Inc.; Combined License Application for River Bend Unit 3, Exemption From the...

    Science.gov (United States)

    2013-12-11

    ...) The exemption(s) are authorized by law, will not present an undue risk to public health or safety, and... only temporary relief from the applicable regulation and the licensee or applicant has made good faith.... ML11343A568), and December 3, 2012 (ADAMS Accession No. ML12342A231), EOI has made good faith efforts to...

  5. 78 FR 75379 - Entergy Operations, Inc.; Combined License Application for Grand Gulf Unit 3; Exemption From the...

    Science.gov (United States)

    2013-12-11

    ... law, will not present an undue risk to public health or safety, and are consistent with the common... applicable regulation and the licensee or applicant has made good faith efforts to comply with the regulation.... ML12342A231), EOI has made good faith efforts to comply with 10 CFR 50.71(e)(3)(iii) prior to requesting...

  6. IMPLEMENTATION OF INTERTIAL NAVIGATION SYSTEM MODEL DURING AIRCRAFT TESTING

    Directory of Open Access Journals (Sweden)

    2016-01-01

    Full Text Available The flight subset control is required during the aviation equipment test flights. In order to achieve this objective the complex consisting of strap down inertial navigation system (SINS and user equipment of satellite navigation systems (SNS can be used. Such combination needs to be used for error correction in positioning which is accumulated in SINS with time. This article shows the research results of the inertial navigation system (INS model. The results of the position- ing error calculation for various INS classes are given. Each of the examined INS has a different accumulated error for the same time lag. The methods of combining information of INS and SRNS are covered. The results obtained can be applied for upgrading the aircraft flight and navigation complexes. In particular, they can allow to continuously determine speed, coordinates, angular situation and repositioning rate of change of axes of the instrument frame.

  7. Prenatal genetic testing, counseling and follow-up of 33 Egyptian ...

    African Journals Online (AJOL)

    Khaled R. Gaber

    2015-02-21

    Feb 21, 2015 ... revealed 36.8% (14/33) affected fetuses. During the final .... uated during the course of the study, making them 37 pregnan- cies evaluated and .... Prenatal diagnostic techniques have rendered decision mak- ing about ... This, in addition to the feeling of guilt experienced by many couples for termi- nation of ...

  8. Preselecting Well Test Interpretation Models Using External Data Présélection de modèles d'interprétation de tests de puits par l'utilisation de données externes

    Directory of Open Access Journals (Sweden)

    Harrison I.

    2006-11-01

    Full Text Available The first stage in interpreting a well test is concerned with identifying a well test interpretation (WTI model for the reservoir that is consistent with all the known data and whose theoretical output response is qualitatively similar to the actual well test response. Conventionally, engineers identify WTI models by using WTI software to plot functions of well test pressure against time and then diagnose components of WTI models from their characteristic curve signatures, together with evidence from external (geological and engineering data. This paper focuses on the use of external data for preselecting WTI models, which can then be verified using conventional well test analysis techniques. The KADS methodology for developing knowledge based systems (KBS was adopted and the inference layer structure for the WTI model preselection task was derived. The WTI model preselection task will form one part of a KBS for well test interpretation, SPIRIT, being developed jointly by Artificial Intelligence Applications Institute and Heriot-Watt University. La première étape dans l'interprétation d'un test de puits est celle de l'identification d'un modèle d'interprétation (WTI pour le réservoir, qui soit en accord avec l'ensemble des données connues, et dont la sortie théorique est qualitativement semblable à celle du puits testé. Pour ceci, les ingénieurs de réservoir utilisent habituellement des logiciels WTI qui calculent et tracent la pression de test de puits en fonction du temps. Cela leur permet de diagnostiquer les composantes des modèles WTI à partir de leurs signatures caractéristiques, le diagnostic étant complété par la prise en compte d'informations externes, de géologie ou d'ingénierie. Cet article est consacré à l'utilisation de données externes pour la préselection des modèles WTI, modèles qui peuvent être ensuite validés au moyen de techniques classiques d'analyse de tests de puits. La méthodologie de d

  9. Material development in the SI{sub 3}N{sub 4} system using glass encapsulated Hip`ing. Final report, Phase 2: DOE/ORNL Ceramic Technology Project

    Energy Technology Data Exchange (ETDEWEB)

    Corbin, N.D.; Sundberg, G.J.; Siebein, K.N.; Willkens, C.A.; Pujari, V.K.; Rossi, G.A.; Hansen, J.S.; Chang, C.L.; Hammarstrom, J.L.

    1992-04-01

    This report covers a two-year program to develop fully dense Si{sub 3}N{sub 4} matrix SiC whisker composites with enhanced properties over monolithic Si{sub 3}N{sub 4} materials. The primary goal was to develop a composite with a fracture toughness > 10 MPa{radical}m, capable of using high pressure glass encapsulated HIP`ing. Coating methods were developed to apply thin (<150nm) stoichiometric BN layers to SiC whiskers and also to apply a dual coating of SiC over carbon to the whiskers. Fracture toughness of the composites was determined to increase as the quantity of whiskers (or elongated grains) with their axis perpendicular to the crack plane increased. Of the interface compositions evaluated in this effort, carbon was determined to be the most effective for increasing toughness. The highest toughnesses (6.8--7.0 MPa{radical}m) were obtained with uniaxially aligned carbon coated whiskers. There was no evidence of the carbon coating compromising the oxidation resistance of the composites at 1370{degree}C.

  10. All aboard the Safety Train(ing)!

    CERN Multimedia

    Rosaria Marraffino

    2015-01-01

    Would you like to influence CERN’s safety courses? Do you want to help build better training courses? If your answer is yes to one or both of these questions: now is the time! The Safety Training section is looking for volunteers from the whole CERN community to test new courses before they go online for all members of the personnel.    The Safety Training section is redesigning the CERN e-learning package in order to adopt a more educational approach and to make the courses a more enjoyable experience. The section is now calling for volunteers. “We know we can do much more with testers’ help and feedback,” explains Christoph Balle, Safety Training section leader. “By having the end users actively involved in the process, we’ll achieve our goal of communicating safety in the best possible way. As the volunteers will play an active role in the development of the courses, they will be providing a service to the whole community.&am...

  11. Mode I Failure of Armor Ceramics: Experiments and Modeling

    Science.gov (United States)

    Meredith, Christopher; Leavy, Brian

    2017-06-01

    The pre-notched edge on impact (EOI) experiment is a technique for benchmarking the damage and fracture of ceramics subjected to projectile impact. A cylindrical projectile impacts the edge of a thin rectangular plate with a pre-notch on the opposite edge. Tension is generated at the notch tip resulting in the initiation and propagation of a mode I crack back toward the impact edge. The crack can be quantitatively measured using an optical method called Digital Gradient Sensing, which measures the crack-tip deformation by simultaneously quantifying two orthogonal surface slopes via measuring small deflections of light rays from a specularly reflective surface around the crack. The deflections in ceramics are small so the high speed camera needs to have a very high pixel count. This work reports on the results from pre-crack EOI experiments of SiC and B4 C plates. The experimental data are quantitatively compared to impact simulations using an advanced continuum damage model. The Kayenta ceramic model in Alegra will be used to compare fracture propagation speeds, bifurcations and inhomogeneous initiation of failure will be compared. This will provide insight into the driving mechanisms required for the macroscale failure modeling of ceramics.

  12. Civil Engineering for the SHiP facility

    CERN Document Server

    Osborne, John Andrew

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report represents an annex to the SHiP Technical Proposal summarizing the civil engineering considerations for SHiP.

  13. Radiation protection studies for the SHiP facility

    CERN Document Server

    Strabel, Claudia Christina; Vincke, Helmut

    2015-01-01

    The enlarged scope of the recently proposed experiment to search for Heavy Neutral Leptons, SPSC-EOI-010, is a general purpose fixed target facility which in the initial phase is aimed at a general Search for Hidden Particles (SHiP) as well as tau neutrino physics. This report summarizes radiation protection considerations for the SHiP facility and the primary beam extraction for SHiP.

  14. Work Strategies: The Development and Testing of a Model.

    Science.gov (United States)

    1986-03-01

    strategies (e.g., Craik & Lockhart , 1972); hemispheric process - -7 ing differences (e.g., Seamon & Gazzaniga, 1973); problem-solving strategies (e.g...Charness, N. (1931). Aging and skilled problem solving. 3ournal of Experimental Psychology: General, 110, 21-38. Craik , F. I. \\., & Lockhart , R. S...1972). Levels of processing : A framework for memory research. Journal of Verbal Learning and Verbal Behavior, L1, 671-684. 3ansereau, D. F., McDonald

  15. INDUSTRIAL ROBOT REPEATABILITY TESTING WITH HIGH SPEED CAMERA PHANTOM V2511

    Directory of Open Access Journals (Sweden)

    Jerzy Józwik

    2016-12-01

    Full Text Available Apart from accuracy, one of the parameters describing industrial robots is positioning accuracy. The parameter in question, which is the subject of this paper, is often the decisive factor determining whether to apply a given robot to perform certain tasks or not. Articulated robots are predominantly used in such processes as: spot weld-ing, transport of materials and other welding applications, where high positioning repeatability is required. It is therefore essential to recognise the parameter in question and to control it throughout the operation of the robot. This paper presents methodology for robot positioning accuracy measurements based on vision technique. The measurements were conducted with Phantom v2511 high-speed camera and TEMA Motion software, for motion analysis. The object of the measurements was a 6-axis Yaskawa Motoman HP20F industrial robot. The results of measurements obtained in tests provided data for the calculation of positioning accuracy of the robot, which was then juxtaposed against robot specifications. Also analysed was the impact of the direction of displacement on the value of attained pose errors. Test results are given in a graphic form.

  16. Preparation and Integration of ALHAT Precision Landing Technology for Morpheus Flight Testing

    Science.gov (United States)

    Carson, John M., III; Robertson, Edward A.; Pierrottet, Diego F.; Roback, Vincent E.; Trawny, Nikolas; Devolites, Jennifer L.; Hart, Jeremy J.; Estes, Jay N.; Gaddis, Gregory S.

    2014-01-01

    The Autonomous precision Landing and Hazard Avoidance Technology (ALHAT) project has developed a suite of prototype sensors for enabling autonomous and safe precision land- ing of robotic or crewed vehicles on solid solar bodies under varying terrain lighting condi- tions. The sensors include a Lidar-based Hazard Detection System (HDS), a multipurpose Navigation Doppler Lidar (NDL), and a long-range Laser Altimeter (LAlt). Preparation for terrestrial ight testing of ALHAT onboard the Morpheus free- ying, rocket-propelled ight test vehicle has been in progress since 2012, with ight tests over a lunar-like ter- rain eld occurring in Spring 2014. Signi cant work e orts within both the ALHAT and Morpheus projects has been required in the preparation of the sensors, vehicle, and test facilities for interfacing, integrating and verifying overall system performance to ensure readiness for ight testing. The ALHAT sensors have undergone numerous stand-alone sensor tests, simulations, and calibrations, along with integrated-system tests in special- ized gantries, trucks, helicopters and xed-wing aircraft. A lunar-like terrain environment was constructed for ALHAT system testing during Morpheus ights, and vibration and thermal testing of the ALHAT sensors was performed based on Morpheus ights prior to ALHAT integration. High- delity simulations were implemented to gain insight into integrated ALHAT sensors and Morpheus GN&C system performance, and command and telemetry interfacing and functional testing was conducted once the ALHAT sensors and electronics were integrated onto Morpheus. This paper captures some of the details and lessons learned in the planning, preparation and integration of the individual ALHAT sen- sors, the vehicle, and the test environment that led up to the joint ight tests.

  17. Intraspecific phytochemical variation shapes community and population structure for specialist caterpillars.

    Science.gov (United States)

    Glassmire, Andrea E; Jeffrey, Christopher S; Forister, Matthew L; Parchman, Thomas L; Nice, Chris C; Jahner, Joshua P; Wilson, Joseph S; Walla, Thomas R; Richards, Lora A; Smilanich, Angela M; Leonard, Michael D; Morrison, Colin R; Simbaña, Wilmer; Salagaje, Luis A; Dodson, Craig D; Miller, Jim S; Tepe, Eric J; Villamarin-Cortez, Santiago; Dyer, Lee A

    2016-10-01

    Chemically mediated plant-herbivore interactions contribute to the diversity of terrestrial communities and the diversification of plants and insects. While our understanding of the processes affecting community structure and evolutionary diversification has grown, few studies have investigated how trait variation shapes genetic and species diversity simultaneously in a tropical ecosystem. We investigated secondary metabolite variation among subpopulations of a single plant species, Piper kelleyi (Piperaceae), using high-performance liquid chromatography (HPLC), to understand associations between plant phytochemistry and host-specialized caterpillars in the genus Eois (Geometridae: Larentiinae) and associated parasitoid wasps and flies. In addition, we used a genotyping-by-sequencing approach to examine the genetic structure of one abundant caterpillar species, Eois encina, in relation to host phytochemical variation. We found substantive concentration differences among three major secondary metabolites, and these differences in chemistry predicted caterpillar and parasitoid community structure among host plant populations. Furthermore, E. encina populations located at high elevations were genetically different from other populations. They fed on plants containing high concentrations of prenylated benzoic acid. Thus, phytochemistry potentially shapes caterpillar and wasp community composition and geographic variation in species interactions, both of which can contribute to diversification of plants and insects. © 2016 The Authors. New Phytologist © 2016 New Phytologist Trust.

  18. Auricular Point Acupressure to Manage Chronic Low Back Pain in Older Adults: A Randomized Controlled Pilot Study

    Directory of Open Access Journals (Sweden)

    Chao Hsing Yeh

    2014-01-01

    Full Text Available This prospective, randomized clinical trial (RCT pilot study was designed to (1 assess the feasibility and tolerability of an easily administered, auricular point acupressure (APA intervention and (2 provide an initial assessment of effect size as compared to a sham treatment. Thirty-seven subjects were randomized to receive either the real or sham APA treatment. All participants were treated once a week for 4 weeks. Self-report measures were obtained at baseline, weekly during treatment, at end-of-intervention (EOI, and at a 1-month follow-up. A dropout rate of 26% in the real APA group and 50% in the sham group was observed. The reduction in worst pain from baseline to EOI was 41% for the real and 5% for the sham group with a Cohen’s effect size of 1.22 P<0.00. Disability scores on the Roland Morris Disability Questionnaire (RMDQ decreased in the real group by 29% and were unchanged in the sham group (+3% P<0.00. Given the high dropout rate, results must be interpreted with caution; nevertheless, our results suggest that APA may provide an inexpensive and effective complementary approach for the management of back pain in older adults, and further study is warranted.

  19. Host conservatism, geography, and elevation in the evolution of a Neotropical moth radiation.

    Science.gov (United States)

    Jahner, Joshua P; Forister, Matthew L; Parchman, Thomas L; Smilanich, Angela M; Miller, James S; Wilson, Joseph S; Walla, Thomas R; Tepe, Eric J; Richards, Lora A; Quijano-Abril, Mario Alberto; Glassmire, Andrea E; Dyer, Lee A

    2017-12-01

    The origins of evolutionary radiations are often traced to the colonization of novel adaptive zones, including unoccupied habitats or unutilized resources. For herbivorous insects, the predominant mechanism of diversification is typically assumed to be a shift onto a novel lineage of host plants. However, other drivers of diversification are important in shaping evolutionary history, especially for groups residing in regions with complex geological histories. We evaluated the contributions of shifts in host plant clade, bioregion, and elevation to diversification in Eois (Lepidoptera: Geometridae), a hyper-diverse genus of moths found throughout the Neotropics. Relationships among 107 taxa were reconstructed using one mitochondrial and two nuclear genes. In addition, we used a genotyping-by-sequencing approach to generate 4641 SNPs for 137 taxa. Both datasets yielded similar phylogenetic histories, with relationships structured by host plant clade, bioregion, and elevation. While diversification of basal lineages often coincided with host clade shifts, more recent speciation events were more typically associated with shifts across bioregions or elevational gradients. Overall, patterns of diversification in Eois are consistent with the perspective that shifts across multiple adaptive zones synergistically drive diversification in hyper-diverse lineages. © 2017 The Author(s). Evolution © 2017 The Society for the Study of Evolution.

  20. Green(ing) infrastructure

    CSIR Research Space (South Africa)

    Van Wyk, Llewellyn V

    2014-03-01

    Full Text Available the generation of electricity from renewable sources such as wind, water and solar. Grey infrastructure – In the context of storm water management, grey infrastructure can be thought of as the hard, engineered systems to capture and convey runoff..., pumps, and treatment plants.  Green infrastructure reduces energy demand by reducing the need to collect and transport storm water to a suitable discharge location. In addition, green infrastructure such as green roofs, street trees and increased...

  1. Ocorrência e aspectos ecológicos de metazoários parasitos de peixes do Lago do Parque do Ingá, Maringá, Estado do Paraná - DOI: 10.4025/actascibiolsci.v29i3.507 Occurrence and ecological aspects of the metazoan fish parasites from Ingá lake, Maringá, Paraná State - DOI: 10.4025/actascibiolsci.v29i3.507

    Directory of Open Access Journals (Sweden)

    Marion Haruko Machado

    2007-12-01

    Full Text Available Nenhum estudo de peixes e parasitos foi realizado, até o momento, no Lago do Parque do Ingá que sofre influências antrópicas desde seu represamento, em 1970. Este trabalho analisou alguns aspectos ecológicos dos parasitos metazoários dos peixes deste lago. Dos peixes analisados, (69,5% estavam parasitados por pelo menos uma espécie de parasito. Foram encontrados 1.372 parasitos pertencentes à Nematoda (larvas e Platyhelminthes (Monogenea e Cestoda, sendo estes os mais prevalentes e numerosos. O encontro de larvas de cestóides em Tilapia rendalli e Oreochromis niloticus confirma a importância destas espécies como participantes de níveis tróficos intermediários. A maior abundância de T. rendalli e O. niloticus, no local, pode ser um fator determinante no recrutamento de parasitos. O parasito aproveita-se das espécies de hospedeiros mais abundantes para garantir o desenvolvimento de seu ciclo de vida e também por serem os mais disponíveis à predação pelas aves piscívoras ali presentes, o que torna o local de grande importância para a sustentação do ciclo de vida desses parasitos. A baixa diversidade de endoparasitos coletados pode ser justificada pela presença de metais pesados – Cu e Pb – no sedimento, o que deve estar interferindo no desenvolvimento dos invertebrados, possíveis hospedeiros intermediários.Ingá lake was dammed in 1970 and, since then, no study on fish and parasites had been done, but it has suffered anthropic influences. This study analyzed some ecological aspects of the metazoan parasites form this lake. From analyzed fish, 69.5% had at least one species of parasite. Among them, 1.372 parasites were found, prevailing Nematoda (larvae and Platyhelminthes (Monogenea and Cestoda. The discovery of cestode larvae in Tilapia rendalli and Oreochromis nitolicus confirms the importance of these species as participants of intermediate trophic levels. The great number of Tilapia rendalli and Oreochromis

  2. Field Testing of Activated Carbon Mixing and In Situ Stabilization of PCBs in Sediment

    Science.gov (United States)

    2009-05-01

    tract irritation Carcinogen, lung, GI system disease Zinc Inh, Ing Metal fume fever, skin irritation GI system effects, dermatitis GI...Metal Slag Areas, Parcel E, Hunters Point Shipyard, San Francisco, California. Appendix D: Final Radiation Control Plan. June 18. Draft Hunters...printed) Signature Final Radiological Control Plan Metal Debris Reef and Metal Slag Areas Parcel E, Hunters Point

  3. Rectal cooling test in the differentiation between constipation due to rectal inertia and anismus.

    Science.gov (United States)

    Shafik, A; Shafik, I; El Sibai, O; Shafik, A A

    2007-03-01

    The differentiation between constipation due to rectal inertia and that due to outlet obstruction from non-relaxing puborectalis muscle (PRM) is problematic and not easily achieved with one diagnostic test. Therefore, we studied the hypothesis that the rectal cooling test (RCT) can effectively be used to differentiate between those two forms of constipation. The study enrolled 28 patients with constipation and abnormal transit study in whom radio-opaque markers accumulated in the rectum; 15 healthy volunteers acted as controls. Electromyographic activity of the external anal sphincter (EAS) and PRM was initially recorded. Subsequently rectal wall tone was assessed by a barostat system during rectal infusion with normal saline at 30 degrees C and at 4 degrees C with simultaneous electromyography (EMG). There was a significant increase in EMG activity of the EAS and PRM on strain- ing (panismus, in 10 of 28 patients and 0 of 15 controls. Rectal tone in controls did not respond to saline infusion at 30 degrees C, but it increased at 4 degrees C (panismus (panismus while it had no effect in the remaining patients. Lack of increase of rectal tone may be secondary to rectal inertia. According to these preliminary observations, the rectal cooling test may be useful in differentiating between rectal inertia and anismus.

  4. Usability testing of two e-learning resources: methods to maximize potential for clinician use.

    Science.gov (United States)

    Menon, Anita; Korner-Bitensky, Nicol; Chignell, Mark; Straus, Sharon

    2012-04-01

    Rigorous usability testing of e-learn-ing resources is an important prerequisite to their wide-spread use among clinicians. This study demonstrates the application of an evidence-based approach to usability testing of two stroke-related e-learning resources (StrokEngine). 14 stroke rehabilitation clinicians (occupational therapists and physiotherapists) from Ontario, Canada participated in a 1.5 h in-person testing session. Clinicians navigated StrokEngine in search of information to answer questions on stroke assessment/intervention. Their search patterns were observed and clinicians provided verbal/written feedback about StrokEngine. Content analysis was used to generate themes and categorize them under two broad categories: facilitators and barriers to use. Five key facilitators and three key barriers to Strok-Engine use were identified and related to screen format, layout/organization, ease of navigation, quality of content, likelihood of using StrokEngine in the future, and system dysfunctions. All 14 clinicians were very or extremely satisfied with the layout/organization, quality and clinical relevance of the content, stating that they were likely to use StrokEngine in the future. All identified barriers from this study were addressed with website modifications in order to maximize the usability and navigability of StrokEngine. This rigorous methodology for usability testing can be applied during the design process of any e-learning resource.

  5. History of the 4950th Test Group (N)

    Science.gov (United States)

    1957-10-15

    57, ~ ~ 1 3 . 1 Concept of Air Tamk htp fOg20tl~m BPgp0-n Operation MPDTACT. 33. &el. 7r EXIHIEO Pirul Report b u r a t r , p. 2. 9. 8.0 pp...end t h a t t h i s headquarters would take no action which could be interpreted as attempting t o establish such policy. Consequently, this...ing supplies, PX and sales stores. a. Units of Task Groun 7.4 w i l l receive suppliee in accordance with procedures outlined in Air Foroe Manual

  6. MO-G-18C-03: Evaluation of Deformable Image Registration for Lung Motion Estimation Using Hyperpolarized Gas Tagging MRI

    International Nuclear Information System (INIS)

    Huang, Q; Zhang, Y; Liu, Y; Hu, L; Yin, F; Cai, J; Miller, W

    2014-01-01

    Purpose: Hyperpolarized gas (HP) tagging MRI is a novel imaging technique for direct measurement of lung motion during breathing. This study aims to quantitatively evaluate the accuracy of deformable image registration (DIR) in lung motion estimation using HP tagging MRI as references. Methods: Three healthy subjects were imaged using the HP MR tagging, as well as a high-resolution 3D proton MR sequence (TrueFISP) at the end-of-inhalation (EOI) and the end-of-exhalation (EOE). Ground truth of lung motion and corresponding displacement vector field (tDVF) was derived from HP tagging MRI by manually tracking the displacement of tagging grids between EOI and EOE. Seven different DIR methods were applied to the high-resolution TrueFISP MR images (EOI and EOE) to generate the DIR-based DVFs (dDVF). The DIR methods include Velocity (VEL), MIM, Mirada, multi-grid B-spline from Elastix (MGB) and 3 other algorithms from DIRART toolbox (Double Force Demons (DFD), Improved Lucas-Kanade (ILK), and Iterative Optical Flow (IOF)). All registrations were performed by independent experts. Target registration error (TRE) was calculated as tDVF – dDVF. Analysis was performed for the entire lungs, and separately for the upper and lower lungs. Results: Significant differences between tDVF and dDVF were observed. Besides the DFD and IOF algorithms, all other dDVFs showed similarity in deformation magnitude distribution but away from the ground truth. The average TRE for entire lung ranged 2.5−23.7mm (mean=8.8mm), depending on the DIR method and subject's breathing amplitude. Larger TRE (13.3–23.7mm) was found in subject with larger breathing amplitude of 45.6mm. TRE was greater in lower lung (2.5−33.9 mm, mean=12.4mm) than that in upper lung (2.5−11.9 mm, mean=5.8mm). Conclusion: Significant differences were observed in lung motion estimation between the HP gas tagging MRI method and the DIR methods, especially when lung motion is large. Large variation among different

  7. MO-G-18C-03: Evaluation of Deformable Image Registration for Lung Motion Estimation Using Hyperpolarized Gas Tagging MRI

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Q; Zhang, Y [Duke University, Durham, NC (United States); Liu, Y [Duke University (United States); Hu, L; Yin, F; Cai, J [Duke University Medical Center, Durham, NC (United States); Miller, W [University of Virginia, Charlottesville, VA (United States)

    2014-06-15

    Purpose: Hyperpolarized gas (HP) tagging MRI is a novel imaging technique for direct measurement of lung motion during breathing. This study aims to quantitatively evaluate the accuracy of deformable image registration (DIR) in lung motion estimation using HP tagging MRI as references. Methods: Three healthy subjects were imaged using the HP MR tagging, as well as a high-resolution 3D proton MR sequence (TrueFISP) at the end-of-inhalation (EOI) and the end-of-exhalation (EOE). Ground truth of lung motion and corresponding displacement vector field (tDVF) was derived from HP tagging MRI by manually tracking the displacement of tagging grids between EOI and EOE. Seven different DIR methods were applied to the high-resolution TrueFISP MR images (EOI and EOE) to generate the DIR-based DVFs (dDVF). The DIR methods include Velocity (VEL), MIM, Mirada, multi-grid B-spline from Elastix (MGB) and 3 other algorithms from DIRART toolbox (Double Force Demons (DFD), Improved Lucas-Kanade (ILK), and Iterative Optical Flow (IOF)). All registrations were performed by independent experts. Target registration error (TRE) was calculated as tDVF – dDVF. Analysis was performed for the entire lungs, and separately for the upper and lower lungs. Results: Significant differences between tDVF and dDVF were observed. Besides the DFD and IOF algorithms, all other dDVFs showed similarity in deformation magnitude distribution but away from the ground truth. The average TRE for entire lung ranged 2.5−23.7mm (mean=8.8mm), depending on the DIR method and subject's breathing amplitude. Larger TRE (13.3–23.7mm) was found in subject with larger breathing amplitude of 45.6mm. TRE was greater in lower lung (2.5−33.9 mm, mean=12.4mm) than that in upper lung (2.5−11.9 mm, mean=5.8mm). Conclusion: Significant differences were observed in lung motion estimation between the HP gas tagging MRI method and the DIR methods, especially when lung motion is large. Large variation among different

  8. A full-acceptance detector for the SSC

    International Nuclear Information System (INIS)

    Bjorken, J.D.

    1991-11-01

    In this paper, I will describe very briefly the cartoon of a full-acceptance detector as presented in the expression of interest, along with some of the basic features and technical difficulties. I will describe some theoretical-physics spinoffs emergent from the preparation of the EoI, which bear on general issues relevant to hadron spectroscopy. I review very briefly the capability of the detector for spectroscopy per se. The final section is devoted to concluding remarks

  9. ROC-ing along: Evaluation and interpretation of receiver operating characteristic curves.

    Science.gov (United States)

    Carter, Jane V; Pan, Jianmin; Rai, Shesh N; Galandiuk, Susan

    2016-06-01

    It is vital for clinicians to understand and interpret correctly medical statistics as used in clinical studies. In this review, we address current issues and focus on delivering a simple, yet comprehensive, explanation of common research methodology involving receiver operating characteristic (ROC) curves. ROC curves are used most commonly in medicine as a means of evaluating diagnostic tests. Sample data from a plasma test for the diagnosis of colorectal cancer were used to generate a prediction model. These are actual, unpublished data that have been used to describe the calculation of sensitivity, specificity, positive predictive and negative predictive values, and accuracy. The ROC curves were generated to determine the accuracy of this plasma test. These curves are generated by plotting the sensitivity (true-positive rate) on the y axis and 1 - specificity (false-positive rate) on the x axis. Curves that approach closest to the coordinate (x = 0, y = 1) are more highly predictive, whereas ROC curves that lie close to the line of equality indicate that the result is no better than that obtained by chance. The optimum sensitivity and specificity can be determined from the graph as the point where the minimum distance line crosses the ROC curve. This point corresponds to the Youden index (J), a function of sensitivity and specificity used commonly to rate diagnostic tests. The area under the curve is used to quantify the overall ability of a test to discriminate between 2 outcomes. By following these simple guidelines, interpretation of ROC curves will be less difficult and they can then be interpreted more reliably when writing, reviewing, or analyzing scientific papers. Copyright © 2016 Elsevier Inc. All rights reserved.

  10. Repeated Treatments with Ingenol Mebutate Prevents Progression of UV-Induced Photodamage in Hairless Mice

    DEFF Research Database (Denmark)

    Erlendsson, Andrés Már; Thaysen-Petersen, Daniel; Bay, Christiane

    2016-01-01

    BACKGROUND AND AIM: Ingenol mebutate (IngMeb) is an effective treatment for actinic keratosis. In this study, we hypothesized that repeated treatments with IngMeb may prevent progression of UV-induced photodamage, and that concurrent application of a corticosteroid may reduce IngMeb-induced local...... once daily for 5 days prior to each IngMeb application, as well as 6 h and 1 day post treatment. One week after IngMeb treatment No. 1, 3, and 5 (Days 28, 84, and 140), biopsies from four mice in each group were collected for histological evaluation of UV-damage on a standardized UV-damage scale (0......-12). LSR (0-24) were assessed once daily (Days 1-7) after each IngMeb treatment. RESULTS: IngMeb prevented progression of photodamage in terms of keratosis grade, epidermal hypertrophy, dysplasia, and dermal actinic damage with a lower composite UV-damage score on day 140 (UVR 10.25 vs. UVR+IngMeb 6.00, p...

  11. Dependence of the neutron-gamma log on the porosity of Malmian limestones from the central part of the Nida Trough

    International Nuclear Information System (INIS)

    Szczerba, A.

    1974-01-01

    Results of correlation-regression analysis of the relationship of the prosity Kp to the relative intensity of neutron-induced gamma radiation dIng are reviewed. The geophysical results and laboratory tests of Malmian carbonate rocks from 10 boreholes from the central part of the Nida trough have been utilized to study this relationship. The regression equation dIng=∫(Kp) and the nomogram to determine the porosity Kp on the basis of neutron-gamma log or neutron-gamma and gamma logs, when the correction for the content is to be considered, have been also presented. (author)

  12. Edge on Impact Simulations and Experiments

    OpenAIRE

    Leavy, R. Brian; Clayton, John D.; Strack, O. Erik; Brannon, Rebecca M.; Strassburger, Elmar

    2013-01-01

    In the quest to understand damage and failure of ceramics in ballistic events, simplified experiments have been developed to benchmark behavior. One such experiment is known as edge on impact (EOI). In this experiment, an impactor strikes the edge of a thin square plate, and damage and cracking that occur on the free surface are captured in real time with high speed photography. If the material of interest is transparent, additional information regarding damage and wave mechanics within the s...

  13. FIRST BEAM TESTS OF THE APS MBA UPGRADE ORBIT FEEDBACK CONTROLLER

    Energy Technology Data Exchange (ETDEWEB)

    Sereno, N. S.; Arnold, N.; Brill, A.; Bui, H.; Carwardine, J.; Decker, G.; Deriy, B.; Emery, L.; Farnsworth, R.; Fors, T.; Keane, R.; Lenkszus, F.; Lill, R.; Paskvan, D.; Pietryla, A.; Shang, H.; Shoaf, S.; Veseli, S.; Wang, J.; Xu, S.; Yang, B.X.

    2017-03-25

    The new orbit feedback system required for the APS multi-bend acromat (MBA) ring must meet challenging beam stability requirements. The AC stability requirement is to correct rms beam motion to 10 % the rms beam size at the insertion device source points from 0.01 to 1000 Hz. The vertical plane represents the biggest challenge for AC stability which is required to be 400 nm rms for a 4 micron vertical beam size. In addition long term drift over a period of 7 days is required to be 1 micron or less at insertion de- vice BPMs and 2 microns for arc bpms. We present test re- sults of theMBA prototype orbit feedback controller (FBC) in the APS storage ring. In this test, four insertion device BPMs were configured to send data to the FBC for process- ing into four fast corrector setpoints. The configuration of four bpms and four fast correctors creates a 4-bump and the configuration of fast correctors is similar to what will be implemented in the MBA ring. We report on performance benefits of increasing the sampling rate by a factor of 15 to 22.6 kHz over the existing APS orbit feedback system, lim- itations due to existing storage ring hardware and extrapo- lation to theMBA orbit feedback design. FBC architecture, signal flow and processing design will also be discussed.

  14. IDRC in Sudan

    International Development Research Centre (IDRC) Digital Library (Canada)

    change. Total IDRC support. 57 activities worth CA$11.8 million since 1974 ... ing and testing strategies — from improved crop varieties to accurate climate forecasts ... policymakers, other researchers, and communities around the world.

  15. 78 FR 60887 - Expressions of Interest (EOI) for Chemical Defense Demonstration Projects

    Science.gov (United States)

    2013-10-02

    ... CDP. DATES: Submit the completed and signed DHS Form 10088 (9/12), either electronically or in hard... demonstration project will result in, among other things: (a) A review of current community preparedness...

  16. Cross-species amplification of microsatellites in genera ...

    Indian Academy of Sciences (India)

    species in Chinese freshwater polyculture system. Accord- ing to several recent ... cephala transcriptome database were chosen to test their utility for ..... 2012BAD26B00) and Fundamental Research Funds for the Central. Universities (no.

  17. Human Body Size in Military Aircraft and Personal Equipment

    Science.gov (United States)

    1946-06-01

    Over a given period, more aircraft of a type will be available operationally if some time is invested in the early stages in order to achieve this...elements in the test situation). It immedi- ately became apparent that such familiar bugaboos of fatigue testing as train- ing and variability of subjects

  18. An easy protocol for the domino synthesis of diversely functionalized ...

    Indian Academy of Sciences (India)

    ple starting materials which fulfils both economic and environmental aspects .... was defined as the lowest extract concentration, show- ing no visible fungal ... tration of the compound inhibiting visual growth of the test cultures on the agar plate.

  19. Article

    African Journals Online (AJOL)

    2012-06-15

    Jun 15, 2012 ... try's National Strategic Plan (NSP) for HIV, Sexually Transmitted. Infections and ... HIV testing in a wide variety of settings, including health facilities.3. Preliminary ... HIV home testing – a problem or part of the solution? J Gardner .... newspaper and magazine advertisements.11 One of the worry- ing aspects ...

  20. Acid Pit Stabilization Project (Volume 1 - Cold Testing) and (Volume 2 - Hot Testing)

    International Nuclear Information System (INIS)

    Loomis, G. G.; Zdinak, A. P.; Ewanic, M. A.; Jessmore, J. J.

    1998-01-01

    During the summer and fall of Fiscal Year 1997, a Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) Treatability Study was performed at the Idaho National Engineering and Environmental Laboratory. The study involved subsurface stabilization of a mixed waste contaminated soil site called the Acid Pit. This study represents the culmination of a successful technology development effort that spanned Fiscal Years 1994-1996. Research and development of the in situ grout stabilization technique was conducted. Hardware and implementation techniques are currently documented in a patent pending with the United States Patent and Trademark Office. The stabilization technique involved using jet grouting of an innovative grouting material to form a monolith out of the contamination zone. The monolith simultaneously provides a barrier to further contaminant migration and closes voids in the soil structure against further subsidence. This is accomplished by chemical incorporation of contaminants into less soluble species and achieving a general reduction in hydraulic conductivity within the monolith. The grout used for this study was TECT-HG, a relatively dense iron oxide-based cementitious grout. The treatability study involved cold testing followed by in situ stabilization of the Acid Pit. Volume 1 of this report discusses cold testing, performed as part of a ''Management Readiness Assessment'' in preparation for going hot. Volume 2 discusses the results of the hot Acid Pit Stabilization phase of this project. Drilling equipment was specifically rigged to reduce the spread of contamination, and all grouting was performed under a concrete block containing void space to absorb any grout returns. Data evaluation included examination of implementability of the grouting process and an evaluation of the contaminant spread during grouting. Following curing of the stabilized pit, cores were obtained and evaluated for toxicity characteristic leach ing

  1. L'épistémologie et l'histoire des sciences et des techniques peuvent elles aider les futurs enseignants de sciences physiques dans l'exercice de leur métier ? Regards portés pour une ingénierie de formation

    Directory of Open Access Journals (Sweden)

    Guedj Muriel

    2014-01-01

    Full Text Available Cette étude interroge la place de l'Epistémologie, l'Histoire des Sciences et des Techniques comme élément pertinent pour améliorer la professionnalité des enseignants de sciences physiques. La réflexion se nourrit des nouvelles orientations prises au sein d'écoles d'ingénieurs et de facultés de médecine qui ont fait le choix d'introduire des unités d'enseignement dédiées aux Sciences Humaines et Sociales afin de perfectionner la qualité professionnelle de leurs formations. Une étude de cas dédiée à l'enseignement de l'énergie illustre le propos.

  2. Mercury pOIsonIng

    African Journals Online (AJOL)

    A case of mercury poisoning is reported and clinical observations of 6 .... fish ingested and occupational exposure. .... exposed to mercury as a result of inadequate industrial safety standards, and ... WHO Tech Rep Ser 1980; No. 674: 102-115.

  3. Quantitative aspects of phosphorus absorption and excretion in horses

    Energy Technology Data Exchange (ETDEWEB)

    Bueno, Ives Claudio da Silva; Abdalla, Adibe Luiz; Vitti, Dorinha Miriam Silber Schmidt [Centro de Energia Nuclear na Agricultura (CENA), Piracicaba, SP (Brazil). Lab. de Nutricao Animal]. E-mails: icsbueno@cena.usp.br; abdalla@cena.usp.br; dovitti@cena.usp.br; Furtado, Carlos Eduardo [Universidade Estadual de Maringa, PR (Brazil). Dept. de Zootecnia]. E-mail: cefurtado@uem.br

    2007-07-01

    Phosphorus (P) is one of the most polluting nutrients because of high husbandry concentrations in restricted areas. The present study compiles data from previous studies dealing with true digestibility of different P levels in diets for horses. Database consisted of results from two experiments carried out at the Centre for Nuclear Energy in Agriculture (CENA/USP), using horses fed different levels of P (n=28). True absorption of phosphorus was determined by isotopic dilution technique, using {sup 32}P as tracer. All parameters (P{sub ING}: ingested P; P{sub ABS}: absorbed P; P{sub FECTOT}: total faecal P excretion; P{sub FECENDO}: endogenous faecal P; P{sub URI}: total urinary excretion; and P{sub RET}: retained P) were normalized according to body weight (BW) and linear and quadratic regressions between P{sub ING} and the other parameters were tested. No quadratic effect was observed. P{sub ING} ranged from 41 to 264 mg/kg BW. Faecal P excretion was affected by intake, analysing by total (P{sub FECTOT} = 0.888 (S.E. 0.058) P{sub ING} - 29.40 (S.E. 8.14) (P<0.0001; RMSE=20.37; R{sup 2}=0.90) or by endogenous fraction (P{sub FECENDO} = 0.095 (S.E. 0.029) P{sub ING} + 12.10 (S.E. 4.16) (P=0.0034; RMSE=10.41; {sup R}2=0.29). Urinary P excretion was not affected by intake (P=0.35), although ranging from 0.06 to 59.20 mg/kg BW. The same occurred for P{sub RET} (P=0.25) ranging from -13.69 to 88.78 mg/kg BW. P absorption also was affect by P intake (P{sub ABS} = 0.195 (S.E. 0.060) P{sub ING} + 42.19 (S.E. 8.45) (P=0.0031; RMSE=21.15; R{sup 2}=0.29). The present study showed that only a small part of ingested P was absorbed, i.e. most of ingested P was excreted via faeces, contributing for environmental pollution. (author)

  4. Hollandi pank soovitab Eesti Telekomi müüa / Annika Matson

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2004-01-01

    Hollandi investeerimispanga ING jt pankade analüütikute soovitused tehinguteks Eesti Telekomi aktsiatega. Graafik: Telekomi aktsia on ING arvates ligi neljandiku võrra ülehinnatud. Vt. samas: ING-l on üle maailma 60 miljonit klienti

  5. Safety analysis of accident localization system

    International Nuclear Information System (INIS)

    1999-01-01

    A complex safety analysis of accident localization system of Ignalina NPP was performed. Calculation results obtained, results of non-destruct ing testing and experimental data of reinforced concrete testing of buildings does not revealed deficiencies of buildings of accident localization system at unit 1 of Ignalina NPP. Calculations were performed using codes NEPTUNE, ALGOR, CONTAIN

  6. Physics possibilities at LHC/SSC

    International Nuclear Information System (INIS)

    Hinchliffe, I.

    1991-01-01

    This document reviews some recent work on physics simulations for SSC/LHC. Included are reviews of some of the recent developments in physics simulations for the SSC/LHC and comments upon the requirements that are placed upon detectors by the need to extract specific physics signatures. The material in the various EOI/LOI documents submitted to the SCC Laboratory and the work done at the Aachen LHC workshop are discussed. In the following discussion 1 SSC (LHC) year corresponds to an integrated luminosity of 10 (100) fb -1 . 41 refs., 14 figs

  7. The enthusiasm of a novice

    Indian Academy of Sciences (India)

    Lawrence

    change in the colour of phenolphthalein after it was added to an alkali. ... ing the high school examination with distinction, an aptitude test suggested by my .... this data was selected by the International Agency for Cancer Lyon,. France as one ...

  8. Media violence and youth behaviour

    African Journals Online (AJOL)

    QuickSilver

    2003-05-07

    May 7, 2003 ... and films.(3) ... ings: a test of the validity of the American movie, television, and video game ... forms and includes rock music and music videos, advertising, ... Reliance on the industry as a “watchdog” is clearly inadequate.

  9. opoku asare

    African Journals Online (AJOL)

    dmosman.admin

    Natural dyes from plant, animal and mineral sources have been used for centuries across the ... draining the liquor into a plastic bowl, immersing the test cotton fabric and dyeing it hot or cold. ... ing special types of designs for modern fabrics.

  10. Vortices in Bose–Einstein condensates: A review of the ...

    Indian Academy of Sciences (India)

    Rotating dilute Bose–Einstein condensates (BEC) of alkali atoms offer a test- ing ground ... is no many-body theory for strongly interacting Bose particles with which the ex- perimental ... few tens of a micro-Kelvin and trapped in a magnetic trap.

  11. Priesagos -ng- prūsų hidronimai

    Directory of Open Access Journals (Sweden)

    Feliksas Daubaras

    2011-12-01

    Full Text Available DIE ALTPREUßlSCHEN HYDRONYME MIT -ng- SUFFIXENZusammenfassungIm vorliegenden Artikel werden altpr. Gewässernamen mit den Suffixen –ing- und -ang- besprochen. Hydronyme mit -ing- sind ihrer Herkunft nach Adjektive, die meistens von Substantiven ab­geleitet sind und den Besitz des durch das Stammwort ausgedrückten Begriffes bezeichnen. Manche von ihnen sind zu Eigennamen geworden, z. B. altpr. rag-ingis „Hirsch“ „mit Hörnern“ = *Rag-ing- Fluß, vgl. altpr. ragis „Horn“, lit. rãgas „Horn, Landzunge“; altpr. *stab-ing- „steinig“ = *Stab­-ing- See, vgl. altpr. stabis „Stein“; altpr. *sil-ing- „von Heiden umgeben“ = *Sil-ing- Bach, vgl. altpr. sylo „Heide“. Insgesamt sind im Artikel einunddreißig Hydronyme mit -ing- und drei mit -ang- angeführt. Die Konzentration von Gewässer- bzw. Ortsnamen mit diesen Suffixen in altpreussischen, kurischen und selischen Gebieten hat bereits Būga bemerkt. Das Suffix -ing- bei der Bil­dung von Gewässernamen war ursprünglich wohl nur den westlichen baltischen Stämmen (Preußen und Jatwingen und ihren nächsten Nachbarn Kuren bekannt. Das Suffix -ang- ist nur für Kuren und Preußen typisch. Hydronymische Parallelen mit Wurzeln von altpr. Gewässernamen mit -ing-und -ang- sind in Litauen und Lettland verschieden verbreitet. Mehrere von ihnen sind auf dem ganzen litauischen und lettischen Territorium zu treffen, z, B. *Amel-, *Ard-, *Ar-, *Bal-, *Bert-,*Birkel- , *Dubr-, *Eiv-, *Gisl-, *Kukul-, *Mat-, *Mus-, * Mutet-, *Mar-, *Rag-, *Ser-, *Sil-, *Sav-, *Ulp-, *Vad-. Manche Wurzeln kommen nur in bestimmten Gebieten vor, z. B. *Erl-,*Ranz-, *Skutel- — in Kurland, *Stab- — in Jatwingien, *Īz— in Selenland.Einige altpr. Hydronyme mit -ing- haben Variante mit -ung- (Amel-ink: Amelung, Dalwinge: Dalwunge, Seringe: Serung, was sich durch den Einfluß der deutschen Sprache deuten läßt.

  12. Neutralization of Home Made Explosives (HME) Hazards

    Science.gov (United States)

    2015-04-28

    Octob previous wo nding levels n achieving neral . More B – Explosiv September rch Centre HME Threa ing CIED/EO . ED Disrupte e Test & Ev 1-120, 201...testing ar 204RD, and he choice of mixtures us neral observ hosen mixtu lations. are large a y of water je se of veloci ction. consistency tability

  13. The fashion blog as genre

    DEFF Research Database (Denmark)

    Engholm, Ida; Hansen-Hansen, Erik

    2013-01-01

    - ing them into new formats, where amateur bricolage approaches are combined with the reproduction of fam- iliar features from the established fashion media. The article presents four types of fashion blogs, each represent- ing a specific design strategy for presenting and interact- ing with fashion...

  14. STUDI KOMPARATIF KINERJA BANK SYARIAH DAN BANK KONVENSIONAL DALAM MENGHADAPI KRISIS GLOBAL BERDASARKAN RASIO KEUANGAN

    Directory of Open Access Journals (Sweden)

    Rohmawati Kusumaningtias

    2009-10-01

    Full Text Available At the time of financial crisis, one of the influential institutions in society is banking. Banking sector provide soft loans to create productive employment for the community. On the other hand, customers also need the liquidity from bank-ing. These stakeholders' needs can be met by looking at the performance of bank-ing. This study aims to determine differences in the performance of sharia banking and conventional banking during economic crisis. This study uses t-test to analyze the data. From the research, it was found that in general, the performance of conventional banking is better than sharia banking in the economic crisis. Keywords: shariah banking, conventional banking, performance.

  15. NJP VOLUME 41 NO 4

    African Journals Online (AJOL)

    PROF. EZECHUKWU

    2014-04-12

    Apr 12, 2014 ... weight, birth order and consanguinity was documented. Significant antenatal history like maternal illness, inges- tion of drugs, exposure to radiation and complications of labor was recorded. Antenatal ultrasonography (USS) findings were noted. Relevant radiological, histo- hematological and genetic tests ...

  16. Friction factor of CP aluminium and aluminium–zinc alloys

    Indian Academy of Sciences (India)

    zinc alloys using ring compression test at different temperatures from 303 K to 773 K. It is found that CP aluminium exhibits stick- ing whereas Al–Zn alloys do not exhibit sticking at elevated temperatures. Hot working of Al–Zn alloy is easier.

  17. EMC² = comprehension: A reading strategy instruction framework for ...

    African Journals Online (AJOL)

    Hennie

    framework for reading strategy instruction, aimed specifically at teachers. ... interaction among the reader, the strategies the reader employs, the material ... test performance of low-ability groups (Purpura, ... so & Brown, 1992), teachers draw upon a small ... ing, scaffolding and guided practice, with a recom- ...... Measuring.

  18. Navrhování celodřevěných spojů na příkladu opravy krovu kostela Nanebevzetí Panny Marie ve Vranově nad Dyjí

    Czech Academy of Sciences Publication Activity Database

    Kloiber, Michal; Bláha, Jiří; Kunecký, Jiří; Hasníková, Hana; Tippner, J.; Sebera, V.

    2013-01-01

    Roč. 73, č. 2 (2013), s. 132-139 ISSN 1210-5538 R&D Projects: GA MK(CZ) DF12P01OVV004 Keywords : non-destructive test ing * wood * compression strength Subject RIV: JN - Civil Engineering http://zpp.npu.cz/clanek.php?ID=6832

  19. Abstracts of Research Project Reports by National Naval Dental Center First-, Second-, and Third-Year Residents, June 1982.

    Science.gov (United States)

    1982-12-01

    resin ( Silar ). Three samples of each material ware tested accord- * ing to procedures outlined in ADA Specification No. 27 for 7-day water sorption...and revolving disk apparatus. Water sorption values for Miradapt were signifi- cantly lower than those for Sevriton and Silar , but significantly

  20. Effect of mortality rate, breed type and breed on total herd efficiency

    African Journals Online (AJOL)

    ing in the National Beef Performance Testing Scheme (1980-1985), was investigated by means of a computer simulation program. Simulation runs were ... developments and computer-based genetic evaluation, the potential for greater ..... 1988), while composite and SangalZebu breed types have superior adaptive capacity.

  1. Personal, Situational, and Organizational Determinants of Navy Enlisted Attrition

    Science.gov (United States)

    1980-06-01

    of regular high school instruction. The GED test battery contains five testsz writing skills, social studies, science, reading skills, and mathematics ...expanded apprentice train- ing program for airmen and seamen might, ceteris paribus, bring the GENDET attrition rate closer to acceptable lvels . 13 ] KN

  2. Rapport over modelforsøg

    DEFF Research Database (Denmark)

    Burcharth, Hans F.; Frigaard, Peter

    På foranledning af Monberg og Thorsen A/S (MT) ved ing. Carsten Bojsen og ing. Folmer Christensen er gennemført modelforsøg til vurdering af overskyl af den projekterede kystsikring foran Kattegatcenteret, som på forsøgstidspunktet var under udførelse.......På foranledning af Monberg og Thorsen A/S (MT) ved ing. Carsten Bojsen og ing. Folmer Christensen er gennemført modelforsøg til vurdering af overskyl af den projekterede kystsikring foran Kattegatcenteret, som på forsøgstidspunktet var under udførelse....

  3. "Miss"ing Me and "Ms"ing the Other: Courtesy Titles for Women in Englishes

    Science.gov (United States)

    Winter, Joanne; Pauwels, Anne

    2007-01-01

    The introduction and spread of "Ms" as the courtesy address title for women is a cornerstone of feminist linguistic planning for English. Its introduction aimed to eradicate the discriminatory inequity in the address system that exposed women through their (non)marital relationship with men. The understanding, use and impact of the courtesy title…

  4. Les enjeux liés à l’intégration de l’approche BIM de modélisation des données du bâtiment à l’enseignement universitaire : cas d’une école d’ingénierie

    Directory of Open Access Journals (Sweden)

    Conrad Boton

    2017-01-01

    Full Text Available Le succès grandissant de l’approche de modélisation des données du bâtiment (BIM change le paradigme de fonctionnement de l’industrie de la construction et les universités sont confrontées à des défis importants dans leurs efforts pour introduire l’approche BIM dans l’enseignement. Plusieurs travaux ont étudié la question, mais chaque étude en a abordé des aspects spécifiques. Ainsi, il n’existe pas de cadre global fournissant des lignes directrices pratiques et neutres. Le cadre proposé dans cet article établit sept grands défis : les compétences à acquérir, l’approche pédagogique, les méthodes d’évaluation, l’environnement technologique, les partenariats industriels, l’approche de mise en œuvre et le calendrier. L’étude du cas d’une université d’ingénierie canadienne est également proposée.

  5. Bases psicolingüísticas determinantes no proceso de aprendizaxe de segundas linguas : estudos de caso

    OpenAIRE

    Muradas Sanroman, Macarena

    2016-01-01

    El objetivo del presente estudio de caso es conocer en profundidad la frecuencia de uso de estrategias de aprendizaje por parte de un grupo de alumnos de inglés como L2 (nivel C1) de una EOI española, así como las percepciones de un grupo de docentes de este mismo centro en relación tanto con esta cuestión como con otras tales como el grado de conocimiento de las estrategias de aprendizaje, su utilidad o la atención que reciben en el ámbito educativo. Para ello, se toma como punto de parti...

  6. Analisis Pemberian Antibiotik Berdasarkan Hasil Uji Sensitivitas Terhadap Pencapaian Clinical Outcome Pasien Infeksi Ulkus Diabetik Di RSUD Dr. H. Abdul Moeloek Lampung

    OpenAIRE

    Kahuripan, Ardiansyah; Andrajati, Retnosari; Syafridani, Tetty

    2009-01-01

    The administration of antibiotic at RSUD dr. H. Abdul Moeloek Lampung is based on sensitivity test result and empirical therapy on diabetic ulcer. Therefore, the objective of the research is to analyze the effectivity of various antibiotics adminis-tration based on the sensitivity test result on clinical outcome reached by consider-ing influenced factors. On the other hand, total evaluation of the resistances ofempirical antibiotic used by considering germ and sensitivity test feature was don...

  7. Endovascular treat- ment of post- traumatic carotid- cavernous ...

    African Journals Online (AJOL)

    Kurt

    often preventing balloon deflation where the balloon position was not satisfactory on trial inflations. This technique was improved by perform- ing initial test inflation of the balloon with less viscous iodinated contrast material in order to determine whether the position of the balloon was satisfactory. Once correct place-.

  8. Identification of rice hybrids using microsatellite and RAPD markers

    African Journals Online (AJOL)

    STORAGESEVER

    2009-05-18

    May 18, 2009 ... presence of slower migrating heteroduplex DNA is, there- fore, useful for detection of heterozygous individuals. Maintenance of hybrid seeds conformity in high level is essential for exploitation of hybrid vigor. Therefore, test- ing the hybrid seed purity is necessarily required before its release into the market.

  9. Acute Changes in Creatine Kinase Serum Levels in Adults Submitted a Static Stretching and Maximal Strength Test

    Directory of Open Access Journals (Sweden)

    M.G. Bara Filho

    2008-01-01

    Full Text Available Strength and flexibility are common components of a training program and their maximal values are obtained through specific tests. However, little information about the damage effect of these training procedures in a skeletal muscle is known. Objective: To verify a serum CK changes 24 h after a sub maximal stretching routine and after the static flexibility and maximal strength tests. Methods: the sample was composed by 14 subjects (man and women, 28 ± 6 yr. physical education students. The volunteers were divided in a control group (CG and experimental group (EG that was submitted in a stretching routine (EG-ST, in a maximal flexibility static test (EG-FLEX and in 1-RM test (EG-1-RM, with one week interval among tests. The anthropometrics characteristics were obtained by digital scale with stadiometer (Filizola, São Paulo, Brasil, 2002. The blood samples were obtained using the IFCC method with reference values 26-155 U/L. The De Lorme and Watkins technique was used to access maximal maximal strength through bench press and leg press. The maximal flexibility test consisted in three 20 seconds sets until the point of maximal discomfort. The stretching was done in normal movement amplitude during 6 secons. Results: The basal and post 24 h CK values in CG and EG (ST; Flex and 1 RM were respectively 195,0 ± 129,5 vs. 202,1 ± 124,2; 213,3 ± 133,2 vs. 174,7 ± 115,8; 213,3 ± 133,2 vs. 226,6 ± 126,7 e 213,3 ± 133,2 vs. 275,9 ± 157,2. It was only observed a significant difference (p = 0,02 in the pre and post values inGE-1RM. Conclusion: only maximal strength dynamic exercise was capable to cause skeletal muscle damage.

  10. Design, Simulation, Fabrication and Testing of a Bio-Inspired Amphibious Robot with Multiple Modes of Mobility

    Science.gov (United States)

    2012-01-01

    tail. 8. Discussion 8.1. General Mobility and Stair Climbing Maximum speed and turning radius compare favorably to our past WhegsTM robots . It should be...SeaDog. Climbing three or more stairs is difficult for the robot . The robot’s zero turn radius and the intermittent nature of the wheel-legs make it...Int. J. of Design and Nature, Vol.4, No.4, pp. 1-18, 2009. [18] M. Eich, F. Grimminger, and F. Kirchner, “A Versatile Stair - Climb - ing Robot for

  11. Evaluation of Resource Utilization and Treatment Patterns in Patients with Actinic Keratosis in the United States.

    Science.gov (United States)

    Asche, Carl V; Zografos, Panagiotis; Norlin, Jenny M; Urbanek, Bill; Mamay, Carl; Makin, Charles; Erntoft, Sandra; Chen, Chi-Chang; Hines, Dionne M; Mark Siegel, Daniel

    2016-01-01

    To compare health care resource utilization and treatment patterns between patients with actinic keratosis (AK) treated with ingenol mebutate gel (IngMeb) and those treated with other field-directed AK therapies. A retrospective, propensity-score-matched, cohort study compared refill/repeat and adding-on/switching patterns and outpatient visits and prescriptions (health care resource utilization) over 6 months in patients receiving IngMeb versus those receiving imiquimod, 5-fluorouracil, diclofenac sodium, and methyl aminolevulinate or aminolevulinic acid photodynamic therapy (MAL/ALA-PDT). The final sample analyzed included four matched treatment cohort pairs (IngMeb and comparator; n = 790-971 per treatment arm). Refill rates were similar except for imiquimod (15% vs. 9% for imiquimod and IngMeb, respectively; P < 0.05). MAL/ALA-PDT treatment repetition rates were higher than IngMeb refill rates (20% vs. 10%; P < 0.05). Topical agent add-on/switch rates were comparable. PDT had higher switch rates than did IngMeb (5% vs. 2%; P < 0.05). The IngMeb cohort had a significantly lower proportion of patients with at least one AK-related outpatient visit during the 6-month follow-up than did any other cohort: versus imiquimod (50% vs. 66%; P < 0.0001), versus 5-fluorouracil (50% vs. 69%; P < 0.0001), versus diclofenac sodium (51% vs. 56%; P = 0.034), and versus MAL/ALA-PDT (50% vs. 100%; P < 0.0001). There were significantly fewer AK-related prescriptions among patients receiving IngMeb than among patients in other cohorts. Results based on the first 6 months after treatment initiation suggested that most field-directed AK therapies had clinically comparable treatment patterns except imiquimod, which was associated with higher refill rates, and PDT, which was associated with significantly more frequent treatment sessions and higher switching rates. IngMeb was also associated with significantly fewer outpatient visits than were other field-directed therapies. Copyright

  12. Ühiskonnakriitika kinos / Inge Pitsner

    Index Scriptorium Estoniae

    Pitsner, Inge

    2004-01-01

    Baltimaade dokfilmiprogramm "Subjektiivne kaamera", mis tutvustab uuemaid provokatiivseid, poleemikat tekitavaid autorikeskseid filme. See on osa Tallinnas toimuvast 8. Läänemere Dokumentalistika Foorumist

  13. Viini noored arhitektid / Inge Laurik

    Index Scriptorium Estoniae

    Laurik, Inge

    2001-01-01

    21. augustist Pärnu Muuseumi Aidas Viini noori arhitekte tutvustav näitus "innere szene wien". Näha saab 47 Viini arhitektuuribüroo koostatud prospekte, olustikufotosid ateljeede töökeskkonnast, videoklippi.

  14. Lnc-ing inflammation to disease

    CSIR Research Space (South Africa)

    Magagula, L

    2017-08-01

    Full Text Available by RNAi more than by antisense oligonucleotides. Nucleic Acids Res. 44, 863–877 doi:10.1093/nar/gkv1206 75 Zhen, S., Hua, L., Liu, Y.-H., Sun, X.-M., Jiang, M.-M., Chen, W. et al. (2017) Inhibition of long non-coding RNA UCA1 by CRISPR/Cas9 attenuated...

  15. Guide to the Construction of a Simple 1500 C Test Furnace. Revision

    Science.gov (United States)

    1983-01-01

    A.v e ~1 ue , ’..J -3- ~h i n~,;tor , [)( 20a:p. .. ·HTr~ : 0. Grove $ :~ . r~ . ~.p ;~ir;gs ~l o . of Copies. To ~~Liond l Scrence Foundat ioo...a~-. r~. !.indley ArRese<n·ch Manuf acturi ng Company , AiRe~earOr Cas t ing Company, ?s;~, Wr st ! 90th <,treet, Torrance, CA 90S05 .~TTN : Mr...Tec hnol ogy, De par t men t of i"P to 1 I.Jrgy and Mater i a ls Science , Cambri dge, MA 02139 ATTN : Prof . R. L. Cob l e Prof. H. K. Bowen

  16. Vestibular Balance Deficits Following Head Injury: Recommendations Concerning Evaluation and Rehabilitation in the Military Setting

    Science.gov (United States)

    2012-02-27

    audiogram, magnetic resonance imaging ( MRI ) scan, and a battery of neuro-vestibular tests, etc. (see appendix B). Many of the findings are detailed...bills108/s1217.html 19 E.g., driven by a laptop, tablet PC, or PDA.   42 The authors also considered testing needs immediately after referral (by the... MRI scan   72 Neuro-vestibular testing o Dynamic Computerized Postu rography o Rotat ional chair t est ing of gain, phase, and symmet ry o Step

  17. LHC Beam Loss Monitoring System Verification Applications

    CERN Document Server

    Dehning, B; Zamantzas, C; Jackson, S

    2011-01-01

    The LHC Beam Loss Mon­i­tor­ing (BLM) sys­tem is one of the most com­plex in­stru­men­ta­tion sys­tems de­ployed in the LHC. In ad­di­tion to protecting the col­lid­er, the sys­tem also needs to pro­vide a means of di­ag­nos­ing ma­chine faults and de­liv­er a feed­back of loss­es to the control room as well as to sev­er­al sys­tems for their setup and analysis. It has to trans­mit and pro­cess sig­nals from al­most 4’000 mon­i­tors, and has near­ly 3 mil­lion con­fig­urable pa­ram­e­ters. The system was de­signed with re­li­a­bil­i­ty and avail­abil­i­ty in mind. The spec­i­fied op­er­a­tion and the fail-safe­ty stan­dards must be guar­an­teed for the sys­tem to per­form its func­tion in pre­vent­ing su­per­con­duc­tive mag­net de­struc­tion caused by par­ti­cle flux. Main­tain­ing the ex­pect­ed re­li­a­bil­i­ty re­quires ex­ten­sive test­ing and ver­i­fi­ca­tion. In this paper we re­port our most re­cent ad­di­t...

  18. Proceedings: Annual Conference of the Military Testing Association (24th) Held at San Antonio, Texas on 1-5 November 1982

    Science.gov (United States)

    1983-03-25

    process in acqufsitTon. In E.T. Bilodeau & 1. McD . Bilodeau (Eds.). Principles of skill acquisition. New York: Academic Press, 1969, 141-170. Jones, M. B...revised to include questions on advertising and more questions on motives and economic incentives. Separate forms of the revised survey for active duty...by coloured layer- ing and, as an aid to intervisibility, valleys and ridges are highlighted by coloured lines. Around this map sit the commanders of

  19. f Mo fingerl ortality ings in ch asses n varyi hanges ssment ing sal s ...

    African Journals Online (AJOL)

    sunny

    bioma lead. (Bhup. 410805622606 ccess under the ournal of E reochro and inf oxicity. - Allah Kaf of Lagos, P.M. 10 November, 2 d protection nce of salinit nce and rela nst O. niloti t chemical. C ls of 2, 12, 1 by Probit. Mo. 35 ppt within there was a s imilarly, the significance o confer pr ence on t icochemical ls and pest.

  20. CreatIng Web-based Math learnIng tool for TURKISH mIddle school students: Webquest

    Directory of Open Access Journals (Sweden)

    Aytac KURTULUS

    2009-04-01

    Full Text Available Internet is the most important product for the computer technology and it began to be used in many fields. Especially in the recent years, the usage of Internet has increased in the fields of communication, entertainment, advertisement, media, and technology. In Turkey, the usage of Internet is not used very common and active in primary and secondary education. The fast developments of the new technologies and the Web-Based Education Systems must be increased the importance of giving courses. In this study, the information to be aimed at is to introduce the WebQuest system, which was developed at San Diego State University by Bernie Dodge. A webQuest can be used web-based math learning tool for Turkish middle school students. Therefore, an example of geometry education WebQuest is given to introduce WebQuest system because WebQuest will be active in geometry teaching similar to the other subjects. An overview of WebQuest technology application and several resources for teachers and students interested in creating WebQuests can be found on The WebQutest Page (Dodge, 2001. Table 1 lists web sites that have many of these resources.

  1. DRAWING MUSIC! ANAL Y Z ING AN EXTRACURRICULAR ACTIVITY OF VISUALI Z ING A CONCERT

    Directory of Open Access Journals (Sweden)

    Váradi, Judit

    2018-01-01

    Full Text Available According to the literature and recent studies, a high number of encounters with classical music during childhood and adolescence in the context of positive feelings closely correlates with the formation of classical music competencies. During the investigation of primary students’ attitudes towards classical music, it has been revealed that those who have more opportunities to enter music education will come closer to understanding classical music. At the University of Debrecen Faculty of Music, we have organised and staged various educational youth performances in the last decades. Our goal is to get elementary school children acquainted with live music, classical instruments. A key element of our mission is to form the preferences of children and young people who do not participate in art education, so that they may become interested and sophisticated adults. In our paper we analysis the creations of the drawing competition what connects in theme with the youth concert.

  2. Fibre digestion in the hyra;r

    African Journals Online (AJOL)

    dried samples by calorimeter combustion. The fibre con- tent was determined by the method of Van Soest (1964) us- ing a Fibretec 1020 hot extraction apparatus. Two-way analysis of variance was used to test for differences between the two most important fibre digesting gut regions, the sac- culation and caeca. Results.

  3. Mechanical performance and contact zone of timber joint with oblique faces

    Czech Academy of Sciences Publication Activity Database

    Kunecký, Jiří; Sebera, V.; Tippner, J.; Hasníková, Hana; Kloiber, Michal; Arciszewska-Kędzior, Anna; Milch, J.

    2015-01-01

    Roč. 63, č. 4 (2015), s. 1153-1159 ISSN 1211-8516 R&D Projects: GA MK(CZ) DF12P01OVV004 Keywords : bending * contact zone * digital image correlation * dowel * non-destructive test ing * timber joint Subject RIV: AL - Art, Architecture, Cultural Heritage http://dx.doi.org/10.11118/actaun201563041153

  4. IDRC in Côte d'Ivoire

    International Development Research Centre (IDRC) Digital Library (Canada)

    communities, also contributed to the protection of biodiversity by carry- ing out an inventory of medicinal and edible plants that grow in. Côte d'Ivoire's forests. .... in parasitology at the University of Cocody-Abidjan, is comparing and testing the toxicity and effectiveness of local plants used as traditional anti-malarial medicines.

  5. Canadian International Food Security Research Fund (CIFSRF)

    International Development Research Centre (IDRC) Digital Library (Canada)

    The research team will test innovative mechanisms such as elec- tronic vouchers to target vulnerable groups on a large scale. E-voucher discounts delivered by mobile phone to 65,000 lactat- ing mothers will provide a temporary price incentive to help build a market for the product. The scheme will also enable researchers.

  6. Development of a New Coaxial Balloon Catheter System for Balloon-Occluded Retrograde Transvenous Obliteration (B-RTO)

    International Nuclear Information System (INIS)

    Tanoue, Shuichi; Kiyosue, Hiro; Matsumoto, Shunro; Hori, Yuzo; Okahara, Mika; Kashiwagi, Junji; Mori, Hiromu

    2006-01-01

    Purpose. To develop a new coaxial balloon catheter system and evaluate its clinical feasibility for balloon-occluded retrograde transvenous obliteration (B-RTO). Methods. A coaxial balloon catheter system was constructed with 9 Fr guiding balloon catheter and 5 Fr balloon catheter. A 5 Fr catheter has a high flexibility and can be coaxially inserted into the guiding catheter in advance. The catheter balloons are made of natural rubber and can be inflated to 2 cm (guiding) and 1 cm (5 Fr) maximum diameter. Between July 2003 and April 2005, 8 consecutive patients (6 men, 2 women; age range 33-72 years, mean age 55.5 years) underwent B-RTO using the balloon catheter system. Five percent ethanolamine oleate iopamidol (EOI) was used as sclerosing agent. The procedures, including maneuverability of the catheter, amount of injected sclerosing agent, necessity for coil embolization of collateral draining veins, and initial clinical results, were evaluated retrospectively. The occlusion rate was assessed by postcontrast CT within 2 weeks after B-RTO. Results. The balloon catheter could be advanced into the proximal potion of the gastrorenal shunt beyond the collateral draining vein in all cases. The amount of injected EOI ranged from 3 to 34 ml. Coil embolization of the collateral draining vein was required in 2 cases. Complete obliteration of gastric varices on initial follow-up CT was obtained in 7 cases. The remaining case required re-treatment that resulted in complete obstruction of the varices after the second B-RTO. No procedure-related complications were observed. Conclusion. B-RTO using the new coaxial balloon catheter is feasible. Gastric varices can be treated more simply by using this catheter system

  7. The challenge of conceptual stretching in multi-method research

    OpenAIRE

    Ahram, Ariel

    2009-01-01

    Multi-method research (MMR) has gained enthusiastic support among political scientists in recent years. Much of the impetus for MMR has been based on the seemingly intuitive logic of convergent triangulation: two tests are better than one, since a hypothesis that had survived a series of tests with different methods would be regarded as more valid than a hypothesis tested only a single method. In their seminal Design-ing Social Inquiry, King, Keohane, and Verba (1994) argue that combining qu...

  8. Abrupt change in mean using block bootstrap and avoiding variance estimation

    Czech Academy of Sciences Publication Activity Database

    Peštová, Barbora; Pešta, M.

    2018-01-01

    Roč. 33, č. 1 (2018), s. 413-441 ISSN 0943-4062 Grant - others:GA ČR(CZ) GJ15-04774Y Institutional support: RVO:67985807 Keywords : Block bootstrap * Change in mean * Change point * Hypothesis test ing * Ratio type statistics * Robustness Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.434, year: 2016

  9. Wing-Alone Aerodynamic Characteristics to High Angles of Attack at Subsonic and Transonic Speeds.

    Science.gov (United States)

    1982-11-01

    support subsystems, the test- ing of these models consumes a disproportionate amount of model construction effort and wind-tunnel testing time compared...constant taper ratio with the exception of the aspect ratio 4, taper ratio 0.5 wing at subsonic speeds; the anomalous behavior of this wing is likely...0000000 ...... 0 0 0i 010... 0.. .......... .. .............. tt.. 4t t * PS4 Oft* .. MM.~0o004.0 s.t~o.4

  10. JPRS Report, Science & Technology, Japan

    Science.gov (United States)

    1988-03-03

    function of nematodes and Mitsubishi Electric Corp. is researching the nervous system of the sea hare. This research is aimed at clarify- ing the...First Clean roon Direct nold- ing with 50/jffi aoeuraey ■-» •: Final inspee lion ins Laser To nark- «_ Final ing size inspeo- .- vacuun...transportation of radioactive substances and Y3.7 mil- lion to confirm the safety of transportation of radioac- tive substances. It will also spend Y3

  11. Insulin versus Lipid Emulsion in a Rabbit Model of Severe Propranolol Toxicity: A Pilot Study

    Directory of Open Access Journals (Sweden)

    Martyn Harvey

    2011-01-01

    Full Text Available Background and objective. Beta-blocker overdose may result in intractable cardiovascular collapse despite conventional antidotal treatments. High dose insulin/glucose (ING, and more recently intravenous lipid emulsion (ILE, have been proposed as potentially beneficial therapies in beta blocker intoxication. We compare efficacy of the novel antidotes ING, with ILE, in a rabbit model of combined enteric/intravenous propranolol toxicity. Methods. Sedated, mechanically ventilated and invasively monitored New Zealand White rabbits underwent mini-laparotomy and enterostomy formation with 40 mg/kg propranolol instilled into the proximal small bowel. At 30 minutes propranolol infusion was commenced at 4 mg/kg/hr and continued to a target mean arterial pressure (MAP of 50% baseline MAP. Animals were resuscitated with insulin at 3 U/kg plus 0.5 g/kg glucose (ING group, or 10 mL/kg 20% Intralipid (ILE group. Results. Rate pressure product (RPP; RPP = heart rate × mean arterial pressure was greatest in the ING group at 60 minutes (P<.05. A trend toward greater heart rate was observed in the ING group (P=.06. No difference was observed in survival between groups (4/5 ING versus 2/5 ILE; P=.524. Conclusions. High dose insulin resulted in greater rate pressure product compared with lipid emulsion in this rabbit model of severe enteric/intravenous propranolol toxicity.

  12. Exploring the Domain Specificity of Creativity in Children: The Relationship between a Non-Verbal Creative Production Test and Creative Problem-Solving Activities

    Directory of Open Access Journals (Sweden)

    Ahmed Mohamed

    2012-12-01

    Full Text Available AbstractIn this study, we explored whether creativity was domain specific or domain general. The relationships between students’ scores on three creative problem-solving activities (math, spa-tial artistic, and oral linguistic in the DIS-COVER assessment (Discovering Intellectual Strengths and Capabilities While Observing Varied Ethnic Responses and the TCT-DP (Test of Creative Thinking-Drawing Produc-tion, a non-verbal general measure of creativi-ty, were examined. The participants were 135 first and second graders from two schools in the Southwestern United States from linguisti-cally and culturally diverse backgrounds. Pearson correlations, canonical correlations, and multiple regression analyses were calcu-lated to describe the relationship between the TCT-DP and the three DISCOVER creative problem-solving activities. We found that crea-tivity has both domain-specific and domain-general aspects, but that the domain-specific component seemed more prominent. One im-plication of these results is that educators should consider assessing creativity in specific domains to place students in special programs for gifted students rather than relying only on domain-general measures of divergent think-ing or creativity.

  13. The Role of Preference Axioms and Respondent Behaviour in Statistical Models for Discrete Choice

    DEFF Research Database (Denmark)

    Hougaard, Jens Leth; Tjur, Tue; Østerdal, Lars Peter

    Discrete choice experiments are widely used in relation to healthcare. A stream of recent literature therefore aims at testing the validityof the underlying preference axioms of completeness and transitivity,and detecting other preference phenomena such as unstability, learn-ing/tiredness effects......, ordering effects, dominance, etc. Unfortunatelythere seems to be some confusion about what is actually being tested,and the link between the statistical tests performed and the relevantunderlying model of respondent behaviour has not been explored inthis literature. The present paper tries to clarify...

  14. Fulltext PDF

    Indian Academy of Sciences (India)

    ing systems. 421. CFD. Crystallization: ... able stainless steel for aircraft applications 3. Diamond ... Efficient control of servo pneumatic actuator system utilizing by-pass valve and digital slid- ing mode. 187 ... Environmental safety. Regulatory ...

  15. ANALYSIS OF MOTOR ABILITES OF FOOTBALL AT PLAYERS AT DIFFERENT LEVELS COMPETITION

    Directory of Open Access Journals (Sweden)

    Omer Špirtović

    2013-07-01

    Full Text Available The study was conducted on a sample of 170 respondents, players - seniors, aged 18-27 years, from areas of Montenegro. System was applied 16 variables of motor skills. Research objective was to determine the discriminatory ability of their rank accord¬ing to modalities which belong tested players (second and third league competition. Discriminant analysis results indicate that the motor variables are tested athletes in relation to the level of competition significantly different.

  16. Aeronautical Materials (Selected Articles),

    Science.gov (United States)

    1984-03-13

    technique of structural alloy steel and to find a tempering technique rational for the bainite structure. Test Steel and Test Method 1. This paper used an...ultrahigh tensile steel 30CrMnSiNi2A. Because this steel widely uses bainite or martensite isothermal quenching techniques in production, the large parts...made by this steel possibly have bainite and Ar when in martensite area isothermal quenching or quenching oil and when there is temper- ing. It is

  17. Test Measurements of a 20 ms-1 Carbon Wire Beam Scanner

    CERN Document Server

    De Freitas, J; Emery, J; Herranz Alvarez, J F; Koujili, M; Ramos, D; Sapinski, M; Ait-Amira, Y; Djerdir, A

    2011-01-01

    This paper pre­sents the de­sign of the ac­tu­a­tor for the fast and high ac­cu­ra­cy Wire Scan­ner sys­tem. The ac­tu­a­tor con­sists of a ro­tary brushless syn­chronous motor with the per­ma­nent mag­net rotor in­stalled in­side the vac­u­um cham­ber and the sta­tor in­stalled out­side. The fork, per­ma­nent mag­net rotor and two an­gu­lar po­si­tion sen­sors are mount­ed on the same axis and lo­cat­ed in­side the beam vac­u­um cham­ber. The system has to re­sist a bake-out tem­per­a­ture of 200 C and ion­iz­ing radi­a­tion up to tenths of kGy/year. Max­i­mum wire trav­el­ling speed of 20 m/s and a po­si­tion mea­sure­ment ac­cu­ra­cy of 4 um is re­quired. Therefore, the sys­tem must avoid gen­er­at­ing vi­bra­tion and electromagnet­ic in­ter­fer­ence. A dig­i­tal feed­back con­troller will allow max­i­mum flex­i­bil­i­ty for the loop pa­ram­e­ters and feeds the 3-phase lin­ear power driv­er. The per­for­mance of the pr...

  18. Hoiatus Hansa aktsiale / Annika Matson, Romet Kreek

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2004-01-01

    Hollandi pank ING andis kiirelt kallinenud Hansapanga aktsiale müügisoovituse. Diagramm. Lisa: Hansapanga aktsia on Tallinna börsi suunanäitaja; ING prognoosid Hansapanga kohta on seni üsna täppi läinud

  19. Synthesis of 2-amino-4H-chromene derivatives under microwave ...

    Indian Academy of Sciences (India)

    ing method to construct the 2-amino-4H-chromene skeleton. 2. Experimental. 2.1 Materials and methods .... ing 2-amino-4H-chromene (3a–r) derivatives in good .... Students. Supplementary information. The electronic supporting information ...

  20. Stroke Education in an Emergency Department Waiting Room: a Comparison of Methods

    Directory of Open Access Journals (Sweden)

    Yu-Feng Yvonne Chan1

    2015-03-01

    Full Text Available Background: Since the emergency department (ED waiting room hosts a large, captive audience of patients and visitors, it may be an ideal location for conduct-ing focused stroke education. The aim of this study was to assess the effective-ness of various stroke education methods.Methods: Patients and visitors of an urban ED waiting room were randomized into one of the following groups: video, brochure, one-to-one teaching, combi-nation of these three methods, or control group. We administered a 13-question multiple-choice test to assess stroke knowledge prior to, immediately after, and at 1 month post-education to patients and visitors in the ED waiting room.Results: Of 4 groups receiving education, all significantly improved their test scores immediately post intervention (test scores 9.4±2.5-10.3±2.0, P<0.01. At 1 month, the combination group retained the most knowledge (9.4±2.4 exceed-ing pre-intervention and control scores (both 6.7±2.6, P<0.01.Conclusion: Among the various stroke education methods delivered in the ED waiting room, the combination method resulted in the highest knowledge reten-tion at 1-month post intervention.

  1. The Development of British Incendiary Bombs during the Period of the 1939-45 World War

    Science.gov (United States)

    1946-12-01

    gallons of methanised petrol and had a T.V. of 160 - 180 ft./sec., when falling suspended from its parasheet. 21.2 In the early stages of the design it...34J" lomb Mark I, filled with methanised shale spirit. 80 July ORD Note summari3ing American developments with the M69 bomb. 81 " 7RS Report on Tests

  2. Immobilisation of Acinetobacter calcoaceticus using natural carriers

    African Journals Online (AJOL)

    2005-04-02

    Apr 2, 2005 ... and Cloete, 1995) or ceramic (Kariminiaae-Hamedaani et al.,. 2003) carriers. Besides the synthetic carriers, natural zeolite. (NZ) has been shown as a .... ing 9 mℓ of sterile distilled water, crushed with a sterile glass rod and dispersed by mixing (2 700 r/min for 10 min using the test tube shaker Kartell TK3S) ...

  3. 47{sup th} Annual meeting on nuclear technology (AMNT 2016). Key Topic / Outstanding know-how and sustainable excellence. Workshop: Preserving competence in nuclear technology

    Energy Technology Data Exchange (ETDEWEB)

    Steinwarz, Wolfgang

    2016-10-15

    On the 18{sup th} workshop Preserving Competence in Nuclear Technology 24 young scientists presented the scientific results from their work covering a broad spectrum of technical areas. This demonstrated again the strong engagement of the younger generation as part of the German nuclear society. Prof.Dr.-Ing. Eckart Laurin, Prof.Dr.-Ing. Marco K. Koch, Dr. Katharina Stummeyer, and Dr.-Ing. Wolfgang Steinwarz as members of the jury assessed the written compacts and the oral presentations to award the Siempelkamp Competence Price 2016 to Andreas Wanninger from Technische Universitaet Muenchen.

  4. 47th Annual meeting on nuclear technology (AMNT 2016). Key Topic / Outstanding know-how and sustainable excellence. Workshop: Preserving competence in nuclear technology

    International Nuclear Information System (INIS)

    Steinwarz, Wolfgang

    2016-01-01

    On the 18 th workshop Preserving Competence in Nuclear Technology 24 young scientists presented the scientific results from their work covering a broad spectrum of technical areas. This demonstrated again the strong engagement of the younger generation as part of the German nuclear society. Prof.Dr.-Ing. Eckart Laurin, Prof.Dr.-Ing. Marco K. Koch, Dr. Katharina Stummeyer, and Dr.-Ing. Wolfgang Steinwarz as members of the jury assessed the written compacts and the oral presentations to award the Siempelkamp Competence Price 2016 to Andreas Wanninger from Technische Universitaet Muenchen.

  5. Characterization and monitoring of selected rhizobial strains ...

    African Journals Online (AJOL)

    SERVER

    2007-06-18

    Jun 18, 2007 ... Fax: +66-44-216345. fixing symbiosis with bacteria known as rhizobia. ... Rhizobial strains were cultured on Yeast-Malt extract agar contain- ing bromthymol blue ... Colony form-ing was observed every day as well as the ...

  6. <=ryptochromes and Biological Clocks -36 ...

    Indian Academy of Sciences (India)

    ing from cyanobacteria to humans to plants, and this high degree of ... ing them. The innate or free-running period of circardian rhythms (mea- sured in a ..... neutral radical to the catalytically competent FADH form. The enzyme then dissociates ...

  7. Government-Sponsored Research and Development Efforts in the Area of Intelligent Tutoring Systems. Summary Report.

    Science.gov (United States)

    1995-02-01

    skills using thecnntextof microeconomics . Students work- ing with Smithtown for 5 hours achieved the same gains as those in a classroom gruup which had...ing debrief Via associated workbooks Cognitive apprenticeship with teachers by alternating between diagnostic and training processes Progress

  8. Vantage point.

    Science.gov (United States)

    Kay, Jenny

    2004-06-01

    'Management by expletives' sums up the new Channel 4 programme, Ramsay's Kitchen Nightmares, in which TV chef Gordon Ramsay attempts to turn around a series of failing kitchens. 'It's your f***ing kitchen,' Ramsay tells one hapless head chef, 'F***ing organise it.'

  9. 76 FR 20039 - The Medicine Dropper; Revocation of Registration

    Science.gov (United States)

    2011-04-11

    ..., Respondent has repeatedly violated the terms of the Settlement Agreement'' by ``permitt[ing] doctor shopping, fill[ing] prescriptions for controlled substances without a legitimate medical purpose,'' and violating... intended to resolve the latter's civil and administrative claims based on its contentions that, between...

  10. MANAGEMENT OF CHILDREN WITH CEREBRAL PALSY

    African Journals Online (AJOL)

    Enrique

    ing children with cerbral palsy spans more than 4 decades, and has inspired so many of us to work in .... toy. Prone lying over a longitudinal pillow with weight bearing on the forearms should alternate .... ing being blind and deaf. Assessing a.

  11. Joint Force Quarterly. Issue 39

    Science.gov (United States)

    2005-10-01

    development of countermeasures to disrupt terrorist activities and focus- ing information collection on al Qaeda financing and network operatives...aircraft, provid- ing an hour of coverage each over the assault area. The British carrier-based Seafires operating from HMS Unicorn , Battler, Attacker

  12. Co-occurring Conditions Toolkit: Mild Traumatic Brain Injury and Psychological Health

    Science.gov (United States)

    2009-01-01

    diarrhea, vomit- ing, abdominal pain, polyuria and polydipsia yy Normal fluid and salt intake must be maintained during therapy yy Half life...weak- ness, tremor, headache, hand tremor, nausea, diarrhea, vomit- ing, abdominal pain, polyuria and polydipsia yy Normal fluid and salt intake

  13. through Slicing, DryIng and Packagi.

    African Journals Online (AJOL)

    plastic containers and storedjor nine monthl:. with observation 'carried in ... high value sugars for domestic consumption, in- house at ambient conditions in ... Availability of sweet potato roots is very sea- Shinyanga town in Tanzania in the ...

  14. Idea juht eitas maksupettust / Inge Rumessen

    Index Scriptorium Estoniae

    Rumessen, Inge

    2002-01-01

    Reklaamiagentuuri Idea juht Mark Eikner eitas kohtuistungil seost mitmemiljonilise maksupettuse skeemiga möödunud kohalike valimiste ajal. Kohtuprotsess Meelis Siidirätsepa üle, kes OÜ Rescue juhina jättis tasumata 1,5 milj. krooni käibemaksu

  15. Drypac-ing waste away at Sellafield

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    The Sellafield Drypac Plant (SDP) is designed to treat intermediate level wastes stored on the Sellafield site in the UK. SDP is a key component in the overall strategy of encapsulating ILW for future disposal in an underground repository. Civil work on the plant has started and it is scheduled to begin active operations in 2002. (UK)

  16. SIP-ing the elixir of youth.

    Science.gov (United States)

    Mair, William; Steffen, Kristan K; Dillin, Andrew

    2011-09-16

    AMP-activated protein kinase (AMPK) is a conserved cellular fuel gauge previously implicated in aging. In this issue, Lu et al. (2011) describe how age-related deacetylation of Sip2, a subunit of the AMPK homolog in yeast, acts as a life span clock that can be wound backward or forward to modulate longevity. Copyright © 2011 Elsevier Inc. All rights reserved.

  17. Muinasjutt köideteks / Inge Teder

    Index Scriptorium Estoniae

    Teder, Inge, 1931-

    2005-01-01

    Rahvusvahelisest köitekunsti näitusest ""Scripta manent III" Eesti Tarbekunsti- ja Disainimuuseumis. Raamatust "Maailma parim asi", mis sisaldab eesti laste kirjutatud muinasjutte. Pikemalt Kaire Oldi, Külli Grünbach-Seina ja Jaana Päeva töödest

  18. Ravimid, risk, raha & tervis / Inge Pitsner

    Index Scriptorium Estoniae

    Pitsner, Inge

    2008-01-01

    Ravimifirma Roche Eesti OÜ tegevjuht Kadri Mägi selgitab ravimiäri toimemehhanisme ning põhjuseid, miks ravimitööstus on riskantne ja kallis valdkond. Lisa: Mis on farmakoökonoomika?; Roche Eesti kontor

  19. TRACE-ing human trafficking : Project Findings

    NARCIS (Netherlands)

    Rijken, Conny; Pijnenburg, Annick

    2016-01-01

    Human trafficking is one of the largest criminal enterprises in the world. It is a multi-billion-dollar crime of global scale. This is because human trafficking as a criminal enterprise continues to evolve as a high profit-low risk business for perpetrators and challenges policy makers, law

  20. Air and Space Power Journal. Volume 18, Number 1, Spring 2004

    Science.gov (United States)

    2004-01-01

    entail mesh­ ing traditional synthetic polymer synthesis and processing with biochemistry and molecular change in temperature biology and then... dinosaurs of another technology and business era? Although some of these arguments may have merit, the fact remains that the world is becom­ ing

  1. Hansapanga aktsia vastu ostuhuvi raugenud / Annika Matson

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2004-01-01

    Analüütikud soovitavad Hansapanga aktsiat ostmise asemel hoida. Graafikud: Kümnekordne võit; Aktsia hind järgib ING soovitusi. Vt. samas: ING on seni oma prognoosidega Hansapanga aktsia trendi loonud. Raivo Sormunen. Hansapanga aktsia on julgest investeerijast teinud miljonäri;

  2. Topical corticosteroid has no influence on inflammation or efficacy after ingenol mebutate treatment of grade i to III actinic keratoses (AK)

    DEFF Research Database (Denmark)

    Erlendsson, Andrés Már; Karmisholt, Katrine Elisabeth; Skovbølling Haak, Christina

    2016-01-01

    Background Ingenol mebutate (IngMeb) is approved for treatment of actinic keratoses (AK) and may cause unpredictable local skin responses (LSR). Objectives We sought to investigate whether IngMeb-induced LSR, pain, and pruritus could be alleviated with a topical glucocorticoid and, further, to as...

  3. QSAR models of human data can enrich or replace LLNA testing for human skin sensitization

    Science.gov (United States)

    Alves, Vinicius M.; Capuzzi, Stephen J.; Muratov, Eugene; Braga, Rodolpho C.; Thornton, Thomas; Fourches, Denis; Strickland, Judy; Kleinstreuer, Nicole; Andrade, Carolina H.; Tropsha, Alexander

    2016-01-01

    Skin sensitization is a major environmental and occupational health hazard. Although many chemicals have been evaluated in humans, there have been no efforts to model these data to date. We have compiled, curated, analyzed, and compared the available human and LLNA data. Using these data, we have developed reliable computational models and applied them for virtual screening of chemical libraries to identify putative skin sensitizers. The overall concordance between murine LLNA and human skin sensitization responses for a set of 135 unique chemicals was low (R = 28-43%), although several chemical classes had high concordance. We have succeeded to develop predictive QSAR models of all available human data with the external correct classification rate of 71%. A consensus model integrating concordant QSAR predictions and LLNA results afforded a higher CCR of 82% but at the expense of the reduced external dataset coverage (52%). We used the developed QSAR models for virtual screening of CosIng database and identified 1061 putative skin sensitizers; for seventeen of these compounds, we found published evidence of their skin sensitization effects. Models reported herein provide more accurate alternative to LLNA testing for human skin sensitization assessment across diverse chemical data. In addition, they can also be used to guide the structural optimization of toxic compounds to reduce their skin sensitization potential. PMID:28630595

  4. Iterative Neighbour-Information Gathering for Ranking Nodes in Complex Networks

    Science.gov (United States)

    Xu, Shuang; Wang, Pei; Lü, Jinhu

    2017-01-01

    Designing node influence ranking algorithms can provide insights into network dynamics, functions and structures. Increasingly evidences reveal that node’s spreading ability largely depends on its neighbours. We introduce an iterative neighbourinformation gathering (Ing) process with three parameters, including a transformation matrix, a priori information and an iteration time. The Ing process iteratively combines priori information from neighbours via the transformation matrix, and iteratively assigns an Ing score to each node to evaluate its influence. The algorithm appropriates for any types of networks, and includes some traditional centralities as special cases, such as degree, semi-local, LeaderRank. The Ing process converges in strongly connected networks with speed relying on the first two largest eigenvalues of the transformation matrix. Interestingly, the eigenvector centrality corresponds to a limit case of the algorithm. By comparing with eight renowned centralities, simulations of susceptible-infected-removed (SIR) model on real-world networks reveal that the Ing can offer more exact rankings, even without a priori information. We also observe that an optimal iteration time is always in existence to realize best characterizing of node influence. The proposed algorithms bridge the gaps among some existing measures, and may have potential applications in infectious disease control, designing of optimal information spreading strategies.

  5. M ud indu plants Mill sp. uction s of pig ] cultiv

    African Journals Online (AJOL)

    SAM

    ants in Mur tested, lowe ration of BA on explants. of the regene ridia were als resence of N imary roots. gL-1 of NAA. ing from 40-8 ion, organoge e world whose shney et al., 20. 1793038. phthalene acet terms of the C can Journ and re geon p vars v3 and Dine. Uttar Prades esearch Instit lture and Tec. 2014 multiple shoo.

  6. Sustaining Eleven Years of Counter-Improvised Explosive Device Relevancy for Tomorrow’s War

    Science.gov (United States)

    2013-04-30

    working aggressively in concert with JIEDDO to find, develop, test , and rapidly deliver emerging CIED capabilities to Marine Corps forces for current...Tools Application Senior Leader’s Att;lC’.lr thP 1PltP1 TATT pmvi~ r.mi11ing C:nnnO#’. frtr GC::’F. m:lnPnvPr unit Nunm:utciPrs :lnci .~nff~ :1t thP

  7. Role of Sleep Deprivation in Fear Conditioning and Extinction: Implications for Treatment of PTSD

    Science.gov (United States)

    2014-10-01

    and thus PTSD, is fear condition - ing. Fear conditioning is a Pavlovian response whereby a neutral stimulus is paired with an aversive stimulus until...for drug use, sleep disorders, and psychiatric and medical conditions via structured interview and laboratory tests. Inclu- sion criteria included the...Annual 3. DATES COVERED (From - To) 4. TITLE AND SUBTITLE Role of Sleep Deprivation in Fear Conditioning and Extinction: Implications for

  8. Topical Meeting on Optical Bistability Held at Rochester, New York on 15-17 June 1983.

    Science.gov (United States)

    1983-01-01

    ThB16-1 SELF-BEATING INSTABILITIES IN BISTABLE DEVICES J.A. MARTIN-PEREDA .. M.A. MURIEL DEPARTAMENTO DE ELECTRONICA CUANTICA E.T.S. ING...OPTICAL BISTABLL SYSTEMS J.A. MARTIN PEREDA M.A. MURIEL ; DEPARTAMENIO DE ELECTRONICA CUANTICA E.T.S. ING. TELLCOMUNICACION UNIVERSIDAD POLITECNICA DE

  9. How safe are Indian laboratories?

    Digital Repository Service at National Institute of Oceanography (India)

    Iyer, S.D.

    of the laboratories could be time bombs tic k- ing away slowly but surely. What needs to be done to make the work enviro n- ment safer and user - friendly? The ens u- ing are a few suggestions. Probably these are adopted in some laboratories but they may...

  10. Genetic cancer risk assessment in practice

    International Nuclear Information System (INIS)

    Gruber, S.

    2004-01-01

    The advent of genetic testing has made a dramatic impact on the management of individuals with inherited susceptibility to cancer and their relatives. Genetic counsel ing, with or without testing, is warranted when clues to familial cancer are recognized. Today, genetic testing for classic cancer genetic syndromes is now the standard of care, and has been complemented by genetic testing for other situations commonly encountered in clinical practice. Genetic testing for colorectal cancer, breast cancer, kidney cancer, thyroid cancer, melanoma, and pancreatic cancer raise important issues about the parameters for testing. Genetic cancer risk assessment can lead to measurable reductions in morbidity and mortality through strategies that rely on surveillance, chemo prevention, and risk-reducing surgery

  11. Interactions et formalisations intersubjectives

    OpenAIRE

    Bouvet, Rose-Marie

    2008-01-01

    L'ingénierie, modélisation nécessaire et leurranteDéfinir l'ingénierieL'ingénierie de formation est née d'une volonté de rationaliser des coûts et des pratiques de formation. A cette logique d'efficacité impulsée par les commanditaires et financeurs, (du secteur privé comme du secteur public), notamment depuis la mise en place de la formation professionnelle continue et des politiques d'insertion et réinsertion professionnelle, s'est développée la mise en cause d'un modèle d'enseignement axé ...

  12. The modelling of solar radiation quantities and intensities in a two dimensional compound parabolic collector

    OpenAIRE

    2010-01-01

    M.Ing. A dissertation presented on the basic solar design principles such as sun-earth geometry, energy wavelengths, optics, incidence angles, parabolic collector configurations and design, materials for solar applications, efficiencies, etc to be considered in Solar Concentrating Collector design. These principles were applied in the design and fabrication of a prototype solar collector. The solar collector was tested to verify and correct mathematical models that were generated from exis...

  13. Three Contributions to Robust Regression Diagnostics

    Czech Academy of Sciences Publication Activity Database

    Kalina, Jan

    2015-01-01

    Roč. 11, č. 2 (2015), s. 69-78 ISSN 1336-9180 Grant - others:GA ČR(CZ) GA13-01930S; Nadační fond na podporu vědy(CZ) Neuron Institutional support: RVO:67985807 Keywords : robust regression * robust econometrics * hypothesis test ing Subject RIV: BA - General Mathematics http://www.degruyter.com/view/j/jamsi.2015.11.issue-2/jamsi-2015-0013/jamsi-2015-0013.xml?format=INT

  14. Power, Avionics and Software Communication Network Architecture

    Science.gov (United States)

    Ivancic, William D.; Sands, Obed S.; Bakula, Casey J.; Oldham, Daniel R.; Wright, Ted; Bradish, Martin A.; Klebau, Joseph M.

    2014-01-01

    This document describes the communication architecture for the Power, Avionics and Software (PAS) 2.0 subsystem for the Advanced Extravehicular Mobile Unit (AEMU). The following systems are described in detail: Caution Warn- ing and Control System, Informatics, Storage, Video, Audio, Communication, and Monitoring Test and Validation. This document also provides some background as well as the purpose and goals of the PAS project at Glenn Research Center (GRC).

  15. US Army Medical Bioengineering Research and Development Laboratory Annual Progress Report FY1981.

    Science.gov (United States)

    1981-10-01

    been designed and fabricated. RELATIONSHIP TO CORE PROGRAM: In order to provide adequate patient care, it is essentil to provide equipment in working...DEFINITIONS AS APPLIED TO MEAN TIME BETWEEN BREAKDOWN, * MAINTENANCE TIME, GAS AND OIL CONSUMPTION AND DEFINITION OF HIGH MORTALITY REPAIR PARTS...MINERAL OIL DROPLETS. A DSATT CONTRACT IS PLANNED FOR FURTHER EXPERIMENTAL TEST AND EVALUATION FOR THE KLD ASSOCIATE’S EQUIPMENT. 4 a . .. PROCEfS£ING DATE

  16. Effects of radionuclide contamination on leaf litter decomposition in the Chernobyl exclusion zone

    OpenAIRE

    Bonzom , Jean-Marc; Hättenschwiler , Stephan; Lecomte-Pradines , Catherine; Chauvet , Eric; Gaschak , Sergey; Beaugelin-Seiller , Karine; Della-Vedova , Claire; Dubourg , Nicolas; Maksimenko , Andrey; Garnier-Laplace , Jacqueline; Adam-Guillermin , Christelle

    2016-01-01

    International audience; The effects of radioactive contamination on ecosystem processes such as litter decomposition remain largely un- known. Because radionuclides accumulated in soil and plant biomass can be harmful for organisms, the function- ing of ecosystems may be altered by radioactive contamination. Here, we tested the hypothesis that decomposition is impaired by increasing levels of radioactivity in the environment by exposing uncontaminated leaf litter from silver birch and black a...

  17. The MITLL-AFRL IWSLT 2016 Systems

    Science.gov (United States)

    2016-12-08

    target set T , using a coverage metric g(S, T ). Defin- ing ci( X ) as the count of feature i’s occurrence in corpus X , g(S, T ) = ∑ i∈I f(min(ci(S...use f( x ) = log(1 + x ) as a submodular function to weight counts. For Arabic the feature set I is composed of all unigrams and bigrams, based on testing...target set T is composed of the TED dev and test sets from 2010–2013. 2.4. Neural Probabilistic Language Model Experiments We trained several Neural

  18. The EMMA Non-scaling FFAG

    CERN Document Server

    Edgecock, Thomas; Clarke, James; Griffiths, Stephen; Hill, Clive; Jamison, Steven; Jones, James; Kalinin, Alexander; Marinov, Kiril; Marks, Neil; McIntosh, Peter; Muratori, Bruno; Orrett, Joseph; Saveliev, Yuri; Shepherd, Ben; Smith, Robert; Smith, Susan; Tzenov, Stephan; Wheelhouse, Alan; Berg, J. Scott; Bliss, Neil; Martlew, Brian; White, Christopher; Craddock, Michael; Crisp, James; Johnstone, Carol; Giboudot, Yoel; Keil, Eberhard; Kelliher, David; Machida, Shinji; Koscielniak, Shane; Meot, Francois; Pasternak, Jaroslaw; Sheehy, Suzanne; Yokoi, Takeichiro

    2010-01-01

    The Elec­tron Model for Many Ap­pli­ca­tions (EMMA) will be the World's first non-scal­ing FFAG and is under con­struc­tion at the STFC Dares­bury Lab­o­ra­to­ry in the UK. Con­struc­tion is due for com­ple­tion in March 2010 and will be fol­lowed by com­mis­sion­ing with beam and a de­tailed ex­per­i­men­tal pro­gramme to study the func­tion­ing of this type of ac­cel­er­a­tor. This paper will give an overview of the mo­ti­va­tion for the pro­ject and de­scribe the EMMA de­sign and hard­ware. The first re­sults from com­mis­sion­ing will be pre­sent­ed in a sep­a­rate paper.

  19. Classifier-Guided Sampling for Complex Energy System Optimization

    Energy Technology Data Exchange (ETDEWEB)

    Backlund, Peter B. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Eddy, John P. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)

    2015-09-01

    This report documents the results of a Laboratory Directed Research and Development (LDRD) effort enti tled "Classifier - Guided Sampling for Complex Energy System Optimization" that was conducted during FY 2014 and FY 2015. The goal of this proj ect was to develop, implement, and test major improvements to the classifier - guided sampling (CGS) algorithm. CGS is type of evolutionary algorithm for perform ing search and optimization over a set of discrete design variables in the face of one or more objective functions. E xisting evolutionary algorithms, such as genetic algorithms , may require a large number of o bjecti ve function evaluations to identify optimal or near - optimal solutions . Reducing the number of evaluations can result in significant time savings, especially if the objective function is computationally expensive. CGS reduce s the evaluation count by us ing a Bayesian network classifier to filter out non - promising candidate designs , prior to evaluation, based on their posterior probabilit ies . In this project, b oth the single - objective and multi - objective version s of the CGS are developed and tested on a set of benchm ark problems. As a domain - specific case study, CGS is used to design a microgrid for use in islanded mode during an extended bulk power grid outage.

  20. Picric acid sensing and capture by a sterically encumbered azo ...

    Indian Academy of Sciences (India)

    Dhananjayan Kaleeswaran

    2018-01-25

    Jan 25, 2018 ... above observations in mind, here we demonstrate how the presence of bulky ... can affect the azo-polymerization process, PNACs sens- ing ability and CO2 uptake ... on a JEOL model JSM-7600F electron microscope, operat- ing at the .... i PrTAPB is flanked by two isopropyl groups and hence results in a ...

  1. cDNA cloning and characterization of a mannose-binding lectin from ...

    Indian Academy of Sciences (India)

    Unknown

    of kit protocol except that the RT step was prolonged for a further reaction ... ing a dA-tailing Kit (Sangon). DNA ligation with ... RT-PCR amplification was performed three times. 2.8 Expression of ..... of a new mannose-binding lectin gene from Taxus media; J. Biosci. ... ing: A Laboratory Manual, 2nd edition (New York: Cold.

  2. Medical Surveillance Monthly Report. olume 22, Number 1, January 2015

    Science.gov (United States)

    2015-01-01

    Bragg, NC . . 1 . . 1 2.3 Fort Bliss , TX . 1 . . . 1 2.3 Fort Hood, TX . . 1 . . 1 2.3 Joint base Langley-Eustis, VA 1 . . . . 1 2.3 Fort Lewis, WA...seasons in temperate climates but depends more on other factors aff ect- ing mosquito breeding such as the tim - ing of the rainy season and altitude (below

  3. The Aegis BMD Global Enterprise: A High End Maritime Partnership

    Science.gov (United States)

    2016-04-13

    from further offshore.15 Some would downplay the threat posed by China and the DF-21D missile, argu- ing that—as a result of the “ Walmart Factor” that...January 2011. 16. Matthew Harper, “Chinese Missiles and the Walmart Factor,” U.S. Naval Institute Proceed- ings (July 2011), pp. 16–21. 17. In addition

  4. Role of Mammary Prolactin in Carcinogenesis

    Science.gov (United States)

    1998-10-01

    lactating rats (167) and dairy kines tested, IL-4 was the most potent inhibitor of myome- cows (174) by bromocriptine did not lower immunoreactive trial...of prolactin in dairy cows during lactogenesis. J Dairy 151. Chapitis J, Riddick DH, Betz LM, Brumsted JR, Gibson M, Prior Sci 70:2241-2253 JC, Gout...factors, insulin (30) and EGF (31) stim- ing the presence of functional postreceptor signaling mech- ulate, whereas transforming growth factor-P

  5. Comparison of New Hemostatic Granules/Powders With Currently Deployed Hemostatic Products in a Lethal Model of Extremity Arterial Hemorrhage in Swine

    Science.gov (United States)

    2009-02-01

    femoral vein and nerve was avoided. The vessel was then bathed with a few milliliters of 2% lidocaine to relax vasospasm and dilate the artery to its...stop the bleeding resulting in the eventual exsanguination of all tested pigs. Since the army field dress- ing was found to be ineffective in this...efficacy rate was 92% with eight cases of ineffectiveness in morbid patients with possible coagulopathy. The inability to deliver the material to the

  6. Groundwater Circulating Well Assessment and Guidance

    Science.gov (United States)

    1998-04-03

    storage tank. 1 .3 .3.2.3 Biofiltration . Vapor-phase bioreactors are an effective method for treat ing a variety of gas-phase organic contam inants and...operation. Another advantage of the dipole test is that water is not withdrawn from the ground, eliminating d isposal requirements. It is strongly...example, if a bioprocess is being considered, respiration gases m ust be mon itored to provide evidence for treatment process effectiveness. Conversely

  7. Rehabilitation R&D Progress Reports 1996, Volume 34, May 1997

    Science.gov (United States)

    1997-05-01

    Arlington, VA 22230 PURPOSE!—Atrioventricular (AV) nodal alternans is a pathological cardiac condition characterized by a beat - to- beat alternation...regime where the AV nodal conduc- tion time alternated on a beat -to- beat basis. After using additive white noise to learn the dynamics of the underly... binaurally accord- ing to the NAL-R prescriptive formula. These groups will be followed over a period of 6 months and tested at monthly intervals. At each

  8. Critical success factors model developing for sustainable Kaizen implementation in manufactur-ing industry in Ethiopia

    Directory of Open Access Journals (Sweden)

    Haftu Hailu

    2017-12-01

    Full Text Available The purpose of the research is to identify critical success factors and model developing for sustaining kaizen implementation. Peacock shoe is one of the manufacturing industries in Ethiopia facing challenges on sustaining. The methodology followed is factor analysis and empirically testing hypothesis. A database was designed using SPSS version 20. The survey was validated using statistical validation using the Cronbach alpha index; the result is 0.908. The KMO index value was obtained for the 32 items and had a value of 0.642 with Bartlett's Test of Sphericity Approx. Chi-Square 4503.007, degree of freedom 496 and significance value 0.000. A factor analysis by principal components and varimax rotation was applied for finding the critical success factors. Finding designates that 32 items were merged into eight critical success factors. All the eight factors together explain for 76.941 % of the variance. Multiple regression model analysis has indicated that some of the critical success factors had relationship with success indicators. Due to constraint of time, the researcher focused only at peacock shoe manufacturing industry. Other limitation also includes the absence of any local research that shows the critical success factors at the moment.

  9. Dynamic-energetic balance of agricultural tractors: active systems for the measurement of the power requirements in static tests and under field conditions

    Directory of Open Access Journals (Sweden)

    Daniele Pochi

    2013-09-01

    Full Text Available Modern tractors are characterized by the introduction of devices designed to increase the operative performances of the machines, such as systems for monitoring and controlling various functions (through a massive use of electronics and hydraulics, or deputed to improve the comfort of the driver (paying more attention to ergonomics, air-conditioning, noise and vibration. Such devices need energy to be operated, affecting the energetic balance of the tractor. In this context, the availability of suitable methodologies and instrumental systems could be useful to provide objective, accurate and reliable measurements of the performances of the tractors under different conditions, also considering the power requirements from ancillary services and/or simulating the coupling with operating machines. The tests on the performances of tractors are now made using different methods, including the trial codes issued by the OECD Codes. Beyond their undoubted validity, they fix standard test conditions that often do not adequately represent the operative reality, so that, much remains to investigate on the actual performances provided by the tractors. From this point of view and with reference to fixed point tests, a test bench was developed for the measurement of the power required by various devices, such as transmission and air conditioning. It was used in experimental tests on a tracked tractor and on a wheeled tractor, aimed at validating the test device, measuring the power absorption related to the rotational speed of the organs of propulsion and to the characteristics curves, in order to quantify the power drawn by the transmission and by the air conditioning and assess the residual power for other tractor functions. As to field conditions, a study is being conducted at CRA-ING, within the project PTO (Mi.P.A.A.F., to develop a mobile test bench aimed at evaluating the power required by different operations, such as self displacement, traction, use of

  10. Nano-Optoelectronic Integration on Silicon

    Science.gov (United States)

    2012-12-14

    hole recombination, a material gain spectrum can be derived as dE EE ffM mcn e g ing in vcr r 22 0 2 2 00 2... ffM mhc en r ing in vcr r sp          (4.3) 48 Figure 4.12 Fitting spontaneous emission spectrum. The experimental

  11. Developments in Science and Technology

    Science.gov (United States)

    1984-01-01

    ophthalmology, neurosensory re- search and instrumentation development, cardiovascular systems, patient monitor- ing, therapy and rehabilitation , clinical...session on scenarios. Although scenarios are widely used The term scenario originated in drama but now in analyses, technical evaluations, and wargames and...Wilkinson and D. W. Rabenhorst-High Speed tration Produced during Photoradiation Therapy Us- Imaging Television System, No. 4,453,182 ing a CW

  12. Inhibition of the corrosion of mild steel in hydrochloric acid by isatin ...

    African Journals Online (AJOL)

    The inhibition of corrosion of mild steel in hydrochloric acid by isatin glycine (ING) and isatin (IN) at 30-60 oC and concentrations of 0.0001 M to 0.0005 M was studied via weight loss method. At the highest inhibitor concentration studied ING exhibited inhibition efficiency of 87% while IN exhibited 84% at 60 oC. A chemical ...

  13. Psychometric Properties of The Persian Version of The Prenatal Attachment Inventory in Pregnant Iranian Women

    Directory of Open Access Journals (Sweden)

    Omani Samani Reza

    2016-07-01

    Full Text Available Background In 1993, Muller developed the Prenatal Attachment Inventory (PAI which has been used widely in many studies and translated into several languages. The current study aimed to translate the PAI into Persian, assess the underlying structure of the PAI, and the appropriateness of the one-factor solution proposed by Muller. Materials and Methods In this cross-sectional study, we recruited a total of 322 primi- gravidae in their 27th to 34th gestational weeks that referred to private and governmental prenatal clinics in Tehran, Iran. All participants completed the Persian versions of the PAI and a demographic questionnaire. Participants were re-tested 2 weeks after the initial test- ing. The following psychometric properties of the PAI were investigated: construct validity by confirmatory factor analysis (CFA, internal consistency reliability with Cronbach’s alpha, and test-retest reliability according to the intraclass correlation coefficient (ICC. Results The CFA results indicated that a single-factor model provided good fit to the data, which confirmed the original model by its developer. The Cronbach’s alpha coef- ficient for PAI was 0.856 and the test-retest reliability with ICC was 0.784. Consider- ing the duration between marriage and pregnancy, women with low duration scored significantly higher than women with high duration on PAI (P=0.043. Conclusion The Persian version of the PAI showed that one factor structure was ad- equate and could be used for measuring psychological affectionate attachment between Iranian mothers and their fetuses.

  14. 2012 annual meeting on nuclear technology. Workshop on 'Preservation of competence in nuclear technology'

    International Nuclear Information System (INIS)

    Steinwarz, Wolfgang

    2012-01-01

    Within the 2-day workshop on 'Preservation of Competence in Nuclear Technology,' 31 young scientists competed for the 'Competence Prize' awarded by Siempelkamp Nukleartechnik for the 14th time. They reported about their papers focusing on nuclear technology, reactor technology, innovative reactor systems, radioactive waste management, radiological protection and energy supply systems. The jury composed of Prof. J. Starflinger (Universitaet Stuttgart, IKE), Prof. M.K. Koch (Ruhr-Universitaet Bochum, LEE), and Dr. W. Steinwarz (Siempelkamp Nukleartechnik) assessed the advance compacts as well as the oral presentations. The winner of the 2012 Competence Prize is Dipl.-Ing.(M.S.) Thomas M. Fesich (University Stuttgart). Dr.-Ing. Oliver Czaikowski (Techn. University Clausthal) and Dipl.-Ing. Mario Kuschewski (Universitaet Stuttgart) won the second and third prizes. (orig.)

  15. Architectural slicing

    DEFF Research Database (Denmark)

    Christensen, Henrik Bærbak; Hansen, Klaus Marius

    2013-01-01

    Architectural prototyping is a widely used practice, con- cerned with taking architectural decisions through experiments with light- weight implementations. However, many architectural decisions are only taken when systems are already (partially) implemented. This is prob- lematic in the context...... of architectural prototyping since experiments with full systems are complex and expensive and thus architectural learn- ing is hindered. In this paper, we propose a novel technique for harvest- ing architectural prototypes from existing systems, \\architectural slic- ing", based on dynamic program slicing. Given...... a system and a slicing criterion, architectural slicing produces an architectural prototype that contain the elements in the architecture that are dependent on the ele- ments in the slicing criterion. Furthermore, we present an initial design and implementation of an architectural slicer for Java....

  16. Télécommunications

    OpenAIRE

    Mattatia, Fabrice

    2013-01-01

    L’honneur est sauf : c’est bien un polytechnicien, un ingénieur des télécommunications, qui a inventé le mot « télécommunications » ! Bien évidemment, à cette époque, on parlait plutôt d’ingénieurs des télégraphes. Et notre inventeur est plus connu comme écrivain que comme ingénieur, même s’il a dirigé l’Ecole des télécoms, pardon, l’Ecole des postes et télégraphes. Ce sont ainsi trois destins atypiques qui vont être évoqués dans les pages qui suivent, trois polytechniciens qui sont sortis de...

  17. Towards A Model-based Prognostics Methodology for Electrolytic Capacitors: A Case Study Based on Electrical Overstress Accelerated Aging

    Directory of Open Access Journals (Sweden)

    Gautam Biswas

    2012-12-01

    Full Text Available This paper presents a model-driven methodology for predict- ing the remaining useful life of electrolytic capacitors. This methodology adopts a Kalman filter approach in conjunction with an empirical state-based degradation model to predict the degradation of capacitor parameters through the life of the capacitor. Electrolytic capacitors are important components of systems that range from power supplies on critical avion- ics equipment to power drivers for electro-mechanical actuators. These devices are known for their comparatively low reliability and given their critical role in the system, they are good candidates for component level prognostics and health management. Prognostics provides a way to assess remain- ing useful life of a capacitor based on its current state of health and its anticipated future usage and operational conditions. This paper proposes and empirical degradation model and discusses experimental results for an accelerated aging test performed on a set of identical capacitors subjected to electrical stress. The data forms the basis for developing the Kalman-filter based remaining life prediction algorithm.

  18. LIGHT-ing Up Prostate Cancer for Immunotherapy

    Science.gov (United States)

    2017-10-01

    patients with evanescent carcinoma. According to their location, they are probably IL17-producing type 3 innate lymphoid cells , which have been...with a Hamamatsu camera after performing morphometric analysis. Morphometric Analysis of Lymphoid and B Cell Follicles Lymphoid follicles (LF) were...activation, and CD8 T  cell accumulation are evident in prostate tumor-associated tertiary lymphoid organs (TLO). The 5-µm thick paraffin sections

  19. ING4 Loss in Prostate Cancer Progression

    Science.gov (United States)

    2016-10-01

    it in the desired 245 PCR tube with the water, and then dotting ~1 uL on a labeled fresh LB agar (+ amp ) plate to keep track 246 of the colony. A...using kinetic labeling techniques vs decay following administration of transcriptional inhibitors. Analytical biochemistry 198, 19-29. Heer, R...prostate tissue. Journal of cellular biochemistry 91, 196-205. Valdez, J. M., Zhang, L., Su, Q., Dakhova, O., Zhang, Y., Shahi, P., Spencer, D. M

  20. Modelos, lenguajes y abstracción (ING

    Directory of Open Access Journals (Sweden)

    José Aurelio Sánchez

    2016-03-01

    Full Text Available Every construction process (whatever buildings, machines, software, etc. requires first to make a model of the artifact that is going to be built. This model should be based on a paradigm or meta-model, which defines the basic modeling elements: which real world concepts can be represented, which relationships can be established among them, and son on. There also should be a language to represent, manipulate and think about that model. Usually this model should be redefined at various levels of abstraction. So both, the paradigm an the language, must have abstraction capacity. In this paper I characterize the relationships that exist between these concepts: model, language and abstraction. I also analyze some historical models, like the relational model for databases, the imperative programming model and the object oriented model. Finally, I remark the need to teach that model-driven approach to students, and even go further to higher level models, like component models o business models.

  1. Parading memory and re-member-ing conflict

    DEFF Research Database (Denmark)

    McQuaid, Sara Dybris

    2017-01-01

    In Northern Ireland, parades have long been important carriers of politico-cultural identities and collective memories, as well as arenas of struggle and conflict. Taking as its starting point that these contests over meaning are always framed by their contexts of articulation both in temporal...... and spatial terms, this article examines the role of parades in the current ‘post-conflict’ phase of the peace process as it plays out in a particular location, namely North Belfast. Using theories of cultural and collective memory and examples from republican and loyalist parades in North Belfast......, it is argued that there is fear of memory and identity collapse in particular communities on the margins of the peace process, leading to a conscious doubling of efforts to (re)articulate the hidden recesses of memory in the current transition. In this, the patterns of ‘competitive commemoration’ in parades...

  2. "Kaali saladus" sai Ungaris preemia / Inge Pitsner

    Index Scriptorium Estoniae

    Pitsner, Inge

    2003-01-01

    Populaarteaduslik Eesti-Läti ühisfilm Kaali meteoriidiplahvatusest "Kaali saladus" : stsenarist ja režissöör Urmas E. Liiv : operaator Ago Ruus : produtsent Riho Västrik, sai teadusfilmide festivalil Szolnokis kolmanda koha. R. Västrik valmistab ette uut dokfilmi "Middendorffi jälgedes". Sama ka : Teleleht nr. 45, lk. 12

  3. New concept of age(ing: Prospective age

    Directory of Open Access Journals (Sweden)

    Devedžić Mirjana

    2012-01-01

    Full Text Available While the last century was the century of world population growth, according to demographers, the XXI century will be century of population aging. Statistics undoubtedly show that number of elderly will continue it’s growth in the future. If old age is seen as period of life with reduced physical and mental capabilities and increased disability, and demographic aging as increase of dependent population, trends are quite disturbing, at least in certain societal segments. In developed countries, this population category is no longer treated as passive or as a "burden of society" and efforts are made for better social inclusion of older people. In contrast to growing interest in this phenomenon, the concepts that define the aging of the population remained stagnant. The aim of this paper is to introduce into domestic literature the term "prospective age" as a dynamic category which is more affected with socio-historical conditions, not only with biological as traditional definition of aging suggested. Papers written by Sanderson and Scherbov offer new methodological options for study of population aging, because it takes into account the biometric rather than chronological approach. Calculation of prospective years is a simple operation that requires pair of the same number of remained life expectancy from life tables for two different periods (the year of concern is index, and the one we are comparing with is standard year, so that phrase "40s is the new 30s" or "70s the new 60s" gets scientific foundation. Average remaining years of life represent a realistic indicator suggesting increased capacity, activity and vitality of individuals, which is due to accepted demographic parameters still considered old. „Prospective threshold“ is defined as the age when life expectancy falls below 15 years (it is subjective choice made by Sanderson and Scherbov, which is also used in this paper and during the elaboration of these ideas three demographic indicators was constructed, redefined more precisely, based on prospective age: (prospective share of the elderly, (prospective median age and (prospective old age dependency ratio. With respect to the remaining years of life in the calculation of demographic aging, world’s population will be in rejuvenation process by 2035, longer and more intense than defined by proportion of the elderly. Prospective approach found that longer life expectancy in developing countries is not only a result of the decrease in infant and child mortality, but also the decrease of the old population mortality. Data used in this paper are from period life tables and censuses, for period 1953-2010. Prospective age threshold in Serbia was always higher than retrospective age (60,17 in 1953 .and 63,15 in 2010. for total population , or the proportion of people with a life expectancy less than 15 years has consistently been higher than the share of people older than 65 years (17.86% vs. 16.92% in 2010. According to prospective criteria, differences between men and women almost do not existent, so that it calls into question the widely accepted feminization of the elderly. The same conclusion stands when we discuss (prospective median age, population is older using prospective (47,15 years than traditional (41.41 indicator in 2010, also, compared with rest of the region or with more developed countries, prospective median age is higher in Serbia. Also, prospective old-age dependency ratio is higher than conventional one during analyzed period. Prospective concept and amendments are necessary in public policy, especially pension and health care system, because in combination with traditional approaches can create more justified distribution for older and younger generations.

  4. Parading memory and re-member-ing conflict

    DEFF Research Database (Denmark)

    McQuaid, Sara Dybris

    ; Bar-Tal 1997; Cairns & Roe 2003; Mann 2005; Roudometof 2002; cf. Asmal et al. 1996). In this context, commemoration and memorialisation work to enhance and reinforce exclusive group solidarities (Abou Assi 2010; McDowel & Braniff forthcoming 2014). The study of peace processes thus demands specific...... these ways, they are vernaculars that can unsettle received or official narratives attempting to smooth over differences and anxieties in transitory times. The emotive use of collective memory to charge processes of identity formation often form part of protracted and sectarian conflict (Horowitz [1985] 2000...... understandings of the role of history and memory as conflict dynamics, as well as strategies for studying these as both critical events and as critical continuities. In Northern Ireland, parades provide a unique case for this approach as they draw on and reframe collective memories through partly ritualised...

  5. Watch-ing out for chick limb development.

    Science.gov (United States)

    Pascoal, Susana; Palmeirim, Isabel

    2007-09-01

    Time control is a crucial issue during embryonic development. Nevertheless, little is known about how embryonic cells measure time. Until recently, the only molecular clock known to operate during vertebrate embryonic development was the somitogenesis clock, exclusively functioning in coordinating the precise timing of each new pair of somites formed from the presomitic mesoderm. We have recently evidenced that a similar molecular clock also underlies the timing at which autopod chondrogenic precursors are laid down to form a skeletal limb element. In addition, we herein suggest that the molecular clock is not the only parallelism that can be established between somitogenesis and limb-bud development. In an evolutionary perspective, we support the previously proposed idea that the molecular mechanisms involved in the segmentation of the body axis may have been partially reused in the mesoderm of the lateral plate, thereby allowing the emergence of paired appendages.

  6. Critical success factors model developing for sustainable Kaizen implementation in manufactur-ing industry in Ethiopia

    OpenAIRE

    Haftu Hailu; Abdelkadir Kedir; Getachew Bassa; Kassu Jilcha

    2017-01-01

    The purpose of the research is to identify critical success factors and model developing for sustaining kaizen implementation. Peacock shoe is one of the manufacturing industries in Ethiopia facing challenges on sustaining. The methodology followed is factor analysis and empirically testing hypothesis. A database was designed using SPSS version 20. The survey was validated using statistical validation using the Cronbach alpha index; the result is 0.908. The KMO index value was obtained for th...

  7. Uso de cuatro extractos organicos para el control del pulgon verde (Myzus persicae Sulz) (ING)

    OpenAIRE

    Rodríguez Navas, Hernán; Blanco, Fabio A.

    2016-01-01

    Extracts of leaves and stems of Neurolaena lobata; leaves, stems and fruits of Momordica charantia, wood of Quassia amara and seeds of Annona muricata, were tested regarding their effectiveness for control of green peach aphid (Myzus persicae). In a first stage, groups of 10 individuals of M. persicae were placed inside petri dishes together with a small and slight piece of synthetic cloth soaked with either substance extracted. Several concentrations were used. After two hours; more than 50%...

  8. The Relationship Between Federal Government Revenue and Spending: Empirical Evidence From Asean-5 Countries

    OpenAIRE

    Mohd.Yusoff, Zetty Zahureen; Antoni, Antoni; Abdullah, Azrina Al-Hadi; Asri, Norain Mod; Karim, Zulkefly Abdul

    2006-01-01

    The main objectives of this paper is to examine the long run relationship between total expenditure, revenue (tax and nontax) and economic growth in ASEAN-5 countries namely by Malaysia, Indonesia, Thailand, Singapore and Philippines. According to the prior studies, there are several hypotheses to explain the relationship between revenue and spend-ing such as (1) spend-revenue hypotheses, (2) revenue-spend hypotheses and (3)bi-directional causality hypotheses. To test the validity of these hy...

  9. The Relationship Between Federal Government Revenue and Spending: Empirical Evidence from Asean-5 Countries

    OpenAIRE

    Karim, Zulkefly Abdul; Asri, Norain Mod; Abdullah, Azrina Al-Hadi; Antoni, Antoni; Mohd.Yusoff, Zetty Zahureen

    2009-01-01

    The main objectives of this paper is to examine the long run relationship between total expenditure, revenue (tax and nontax) and economic growth in ASEAN-5 countries namely by Malaysia, Indonesia, Thailand, Singapore and Philippines. According to the prior studies, there are several hypotheses to explain the relationship between revenue and spend-ing such as (1) spend-revenue hypotheses, (2) revenue-spend hypotheses and (3)bi-directional causality hypotheses. To test the validity of these hy...

  10. Medical Surveillance Monthly Report (MSMR). Volume 22, Number 6, June 2015

    Science.gov (United States)

    2015-06-01

    unclassified b. ABSTRACT unclassified c. THIS PAGE unclassified Standard Form 298 (Rev. 8-98) Prescribed by ANSI Std Z39-18 MSMR Vol. 22 No. 6 June...Drowning or submersion, not else-where classifi ed aNATO standardization agreement cause of injury code Service members are at risk for unintentional...diagno- sis post-Pap. Some women may have con- sented to submit to a urinalysis as a part of their clinical encounter. Because such test- ing is

  11. ForgIng New paths in DIabetes PrevenTion (FINDIT): Study Protocol for a Randomized Controlled Trial.

    Science.gov (United States)

    Kullgren, Jeffrey T; Youles, Bradley; Shetty, Shaina; Richardson, Caroline; Fagerlin, Angela; Heisler, Michele

    2017-04-08

    Prediabetes is an asymptomatic condition in which patients' blood glucose levels are higher than normal but do not meet diagnostic criteria for type 2 diabetes mellitus (T2DM). A key window of opportunity to increase engagement of patients with prediabetes in strategies to prevent T2DM is when they are screened for T2DM and found to have prediabetes, yet the effects of this screening and brief counseling are unknown. In this parallel-design randomized controlled trial we will recruit 315 non-diabetic patients from the Ann Arbor VA Medical Center (AAVA) who have one or major risk factors for T2DM and an upcoming primary care appointment at the AAVA, but have not had a hemoglobin A1c (HbA1c) test to screen for T2DM in the previous 12 months. After informed consent, participants will complete a baseline survey and be randomly assigned to, at the time of their next primary care appointment, one of two arms: (1) to have a hemoglobin A1c (HbA1c) test to screen for T2DM and receive brief, standardized counseling about these results or (2) to review a brochure about clinical preventive services. Participants will complete surveys 2 weeks, 3 months, and 12 months after their primary care appointment, and a weight measurement 12 months after their primary care appointment. The primary outcome is weight change after 12 months. The secondary outcomes are changes in perception of risk for T2DM; knowledge of T2DM prevention; self-efficacy and motivation to prevent T2DM; use of pharmacotherapy for T2DM prevention; physical activity; participation in weight management programs; and mental health. Quantitative analyses will compare outcomes among participants in the HbA1c test arm found to have prediabetes with participants in the brochure arm. Among participants in the HbA1c test arm found to have prediabetes we will conduct semi-structured interviews about their understanding of and reactions to receiving a prediabetes diagnosis. This trial will generate foundational data

  12. From Onions to Shallots: Rewarding Tor Relays with TEARS

    Science.gov (United States)

    2014-07-18

    distributed banking using protocols from distributed digital cryp- tocurrency systems like Bitcoin . Shallots are publicly-verifiable, minimiz- ing reliance on...model; none of these have yet been implemented. In this paper, we draw upon the distributed Bitcoin architecture to design a transparent, efficient, and... Bitcoin . Shallots are publicly-veri able, minimiz- ing reliance on and trust in banking authorities, making them auditable while naturally distributing

  13. ExNum 2016 International Symposium on Experimental Methods and Numerical Simulation in Engineering Sciences

    Directory of Open Access Journals (Sweden)

    Editorial Foreword

    2016-12-01

    Full Text Available ExNum 2016International Symposium on Experimental Methods and Numerical Simulation in Engineering SciencesSeptember 18th - 21st, 2016Conference Centre Liblice, Liblice, Czech RepublicOrganized by:Institute of Theoretical and Applied Mechanics ASCR, v.v.i.Faculty of Transportation Sciences CTU in PragueBergische Universität Wuppertal, Faculty 5 - Architecture and Civil EngineeringThe International Symposium on Experimental Methods and Numerical Simulation in Engineering Sciences continues the tradition of the Czech-German bilateral symposium founded by prof. Karl-Hans Laermann and prof. Stanislav Holý in 1985. In the following years, the symposium was extensively developed by prof. Josef Jíra. The symposium shall bring together mainly young scientists who are actively involved in experimental solid mechanics, theoretically and practically, in order to exchange experience, to report on the present state-of-art as well as on running research projects, to discuss due questions and problems and to promote the co-operation between individuals as well as between institutions. Therefore in the symposium discussions will play a highly significant role.Scientific Committeeprof. Ing. Ondřej Jiroušek, Ph.D. (Institute of Theoretical and Applied Mechanics ASCR, v.v.i.Univ.-Prof. Dr.-Ing.Dr.h.c.mult. Karl-Hans Laermann (Bergische Universität WuppertalProf. Dr.- Ing. Reinhard Harte (Bergische Universität Wuppertal, Faculty 5 - Architecture and Civil EngineeringProf. Dr.-Ing. Marc Gutermann (Hochschule BremenIng. Daniel Kytýř, Ph.D. (Czech Technical University in Prague, Faculty of Transportation SciencesIng. Petr Zlámal, Ph.D. (Institute of Theoretical and Applied Mechanics ASCR, v.v.i.Local Organizing CommitteeTomáš DoktorTomáš FílaNela KrčmářováPetr KoudelkaVeronika KoudelkováDaniel KytýřJan ŠleichrtPetr ZlámalEditorsDaniel KytýřPetr ZlámalScientific GuidanceOndřej Jiroušek

  14. From petroleum to natural gas. New assets in electric power industry

    International Nuclear Information System (INIS)

    Velona', F.

    2002-01-01

    Luigi Einaudi Foundation Group organized on November 5th 2001 a roundtable on the theme: Energy in Italy, how to change for surviving. In the congress hall in the National Federation of Italian Press, Valerio Zanone, the president, and other important persons such as Jan Keppler (Associazione Italiana Editori), Edgardo Curcio (Associazione Italiana Economisti dell'Energia), Emilio Gerelli (Pavia University) and Franco Velona' (Bari Politecnico) presented their relations on the theme of competitivity in the italian energy system, on the environmental compatibility and on the diversification sources from petroleum. Among the most interesting ones were those by ing. Machi', president of Gestore Rete Trasmissione Nazionale, by ing. Clavarino, president of Assocarboni, and by ing. Serena, president of Sondel. It seemed that the dialogue between the academies and the production system was taken again successfully [it

  15. Air Break During Preoxygenation and Risk of Altitude Decompression Sickness

    Science.gov (United States)

    2010-10-01

    examination and were representative of the USAF rated aircrew popula- tion. They were not allowed to participate in scuba div- ing, hyperbaric exposures, or...subjects dur- ing the hypobaric exposures and the subjects were not questioned about how they felt during the altitude ex- posures. Each subject was...to consult with the physicians in Hyperbaric Medicine within the same building. Endpoints of the exposures were: 1) comple- tion of the scheduled

  16. An I for an Eye: Personal Narrative and the Great War

    Science.gov (United States)

    1989-05-10

    A number of good overviews of reader-response and reception theory are available: see especially Susan R. Sulieman and Inge Crosman, eds. The Reader...Reader (1987), and Robert C. Holub’s critical introduction to reception theory , Reception Theory (1984). For a recent additions to the debate, see Inge...Yale UP, 1967. Holub, Robert C. Reception Theory : A Critical Introduction. London: Metheun, 1984. 247 Hoy, David Couzens. The Critical Circle

  17. 40 Years MAGLEV Vehicles in Germany

    OpenAIRE

    Meisinger, Reinhold; Guangwei, Shu

    2011-01-01

    On May 6th 1971 the worldwide first MAGLEV vehicle was presented by Messerschmitt-Bölkow-Blohm (MBB) in Ottobrunn near Munich, Germany. Till the year 2000 different test and application MAGLEV vehicles followed, but no commercial use in Germany. Since December 31st 2002 the Shang-hai MAGLEV Transportation System is successfully in operation, as the worldwide first and only one commercial used MAGLEV line. The paper in honour of Prof. Dr.-Ing. Eveline Gottzein for her 80th birthday contains in...

  18. Naval War College Review. Volume 64, Number 2, Spring 2011

    Science.gov (United States)

    2011-01-01

    NBR Analysis (Seattle, Wash.: National Bureau of Asian Research, June 2002); Scobell and Wortzel, eds., China’s Growing Military Power; and Alan D...flat rubber deck—the “carpet”—along which the land- ing aircraft was to skid. Tests with modified gliders dropped onto such a surface showed that a...ill conceived, and so scotched, a scheme by X Corps to employ a unit of the 1st Marine Division for a rubber -raft crossing of the Han River to seize

  19. Promising Properties and System Demonstration of an Environmentally Benign Yellow Smoke Formulation for Hand-Held Signals

    Science.gov (United States)

    2014-04-18

    Yellow 33 (colored smoke dye), sucrose (fuel), potassium chlorate (oxidizer), stearic acid ( lubr icant , process ing aid) , and hydromagnes i te (Mg5(CO3...flight test. ■ EXPERIMENTAL SECTION Materials. Potassium chlorate (MIL-P-150D, grade B, Class 7) and sugar (MIL-AA-20135D, Type 1, Style C) were...consisting of 33.0 wt % potassium nitrate, 24.5 wt % silicon, 20.8 wt % black iron oxide, 12.3 wt % aluminum, 3.8 wt % charcoal, and 5.6 wt % nitrocellulose

  20. The fashion blog as genre

    DEFF Research Database (Denmark)

    Engholm, Ida; Hansen-Hansen, Erik

    2013-01-01

    Fashion as a phenomenon cannot be understood indepen- dently of the visual images and designed presentations that convey the content and forms of fashion. With the breakthrough of the digital media in the 2000s we were introduced to new ways of communicating and staging fashion where the blog...... in particular has established a new media culture for the distribution and exchange of potential fashion-based self-presentation forms and resulted in new design strategies. In this article, the fashion blog is presented as a specific genre that is charac- terised by remediating existing genre forms and combin......- ing them into new formats, where amateur bricolage approaches are combined with the reproduction of fam- iliar features from the established fashion media. The article presents four types of fashion blogs, each represent- ing a specific design strategy for presenting and interact- ing with fashion...

  1. Effects of energy and climate advisory service in 2012, to individuals, businesses and organizations; Effekter av energi och klimatraadgivningen 2012, till privatpersoner, foeretag och organisationer

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-09-01

    The Swedish Energy Agency has government mandate to finance energy and climate consultancy in the country's municipalities. Energy and climate advisors' mission is to provide local and regional custom information about energy efficiency, renewable energy, transportation, energy and climate change and on the potential to transform energy use in commercial and residential premises. The target group for counsel ing are households, businesses and organizations. This report presents the results of an evaluation of the effects of counsel ing, in the advice seekers perspective, with an emphasis on measurable energy savings in kWh. The aim is that the Agency should have a deeper understanding of what effect the counsel ing interventions have. The evaluation highlights the issues covered and the measures taken to reduce energy use and, where possible, an estimate / calculation of the energy saving made by measures taken.

  2. The creation of the artificial RING finger from the cross-brace zinc finger by α-helical region substitution

    International Nuclear Information System (INIS)

    Miyamoto, Kazuhide; Togiya, Kayo

    2010-01-01

    The creation of the artificial RING finger as ubiquitin-ligating enzyme (E3) has been demonstrated. In this study, by the α-helical region substitution between the EL5 RING finger and the Williams-Beuren syndrome transcription factor (WSTF) PHD finger, the artificial E3 (WSTF PHD R ING finger) was newly created. The experiments of the chemical modification of residues Cys and the circular dichroism spectra revealed that the WSTF PHD R ING finger binds two zinc atoms and adopts the zinc-dependent ordered-structure. In the substrate-independent ubiquitination assay, the WSTF PHD R ING finger functions as E3 and was poly- or mono-ubiquitinated. The present strategy is very simple and convenient, and consequently it might be widely applicable to the creation of various artificial E3 RING fingers with the specific ubiquitin-conjugating enzyme (E2)-binding capability.

  3. Cultural variability in Expressed Emotion among families of adolescents with anorexia nervosa.

    Science.gov (United States)

    Hoste, Renee Rienecke; Labuschagne, Zandre; Lock, James; Le Grange, Daniel

    2012-01-01

    To examine the cultural variability in Expressed Emotion (EE) among families of white and ethnic minority adolescents with anorexia nervosa (AN). One-hundred and eighty-nine AN patients and their parents completed the Eating Disorder Examination and the Structured Clinical Family Interview, from which EE ratings were made. No differences were found in the number of white and minority families classified as high EE. White families were higher on warmth (W) and tended to be higher on positive remarks (PR) than minority families. High EE was associated with a longer duration of illness, but was not related to eating disorder pathology. Few differences were found between white and ethnic minority families on the EE dimensions of CC, hostility (H), or EOI. Differences between families on W and PR, however, may have important treatment implications. Copyright © 2010 Wiley Periodicals, Inc.

  4. Hide and Seek: Exploiting and Hardening Leakage-Resilient Code Randomization

    Science.gov (United States)

    2016-05-30

    HMACs generated us- ing 128-bit AES encryption . We do not use AES en- cryption to generate HMACs due to its high overhead; the authors of CCFI report...execute-only permissions on memory accesses, (ii) code pointer hid- ing (e.g., indirection or encryption ), and (iii) decoys (e.g., booby traps). Among...lowing techniques: they a) enforce execute-only permis- sions on code pages to mitigate direct information leak- age, b) introduce an encryption or

  5. Implicações da lipoclasia dermossônica no metabolismo energético e na composição corporal de ratos Wistar saudáveis Implications of dermosonic lipoclasis for energy metabolism and body composition of healthy Wistar rats

    Directory of Open Access Journals (Sweden)

    WLS Gonçalves

    2009-02-01

    Full Text Available OBJETIVOS: Investigar as implicações da lipoclasia dermossônica (LCD, lipólise do tecido adiposo branco subcutâneo induzido por ultrassom (US, no metabolismo energético e na composição corporal de ratos saudáveis. MÉTODOS: Utilizaram-se 20 ratos Wistar saudáveis, com 4 meses de idade, pesando ±380g, divididos aleatoriamente em 2 grupos: 1 controle-sham (CS, 2 terapia ultrassônica de baixa intensidade (TUSBI. Durante 10 dias, após sedação (halotano-3% vaporizado, os animais eram submetidos à TUSBI (I SATA=3MHz, 1W.cm-2, modo pulsado 2:8ms, ciclo de 30% por 3 minutos em região infra-abdominal e inguinal. Medidas de peso, comprimento naso-anal e parâmetros metabólicos (ingestão e excreção foram controlados durante o estudo. Ao final do tratamento, amostras de sangue foram coletadas para dosagens bioquímicas, e então avaliadas adiposidades retroperitoneal (RET, perirenal (PR, epididimal (EP e inguinal (ING. O HOMA-IR (homeostasis model assessment foi calculado para estimar resistência insulínica (RI. Para análise estatística, utilizou-se ANOVA, teste de Tukey e teste t de Student, com diferenças estabelecidas em pOBJECTIVES: To investigate the implications of Dermosonic lipoclasis (DLC, i.e. lipolysis on subcutaneous white adipose tissue induced by ultrasound, for the energy metabolism and body composition of healthy rats. METHODS: Twenty four-month-old male Wistar rats weighting ±380g were randomly divided into two groups: 1 sham control (SC and 2 low-intensity ultrasound therapy (LIUST. For 10 days, after sedation with 3% vaporized halothane, the animals underwent LIUST (I SATA =3MHz, 1 Wcm-2, pulsed mode 2:8ms, 30% cycles for 3 minutes in the infra-abdominal and inguinal regions. Weight measurements, naso-anal length and metabolic parameters (food and water intake and excretion were monitored during the study. At the end of the treatment, blood samples were collected for biochemical analyses. Retroperitoneal (RET

  6. Detection Damage in Bearing System of Jet Engine Using the Vibroacoustic Method

    Directory of Open Access Journals (Sweden)

    Żokowski Mariusz

    2017-09-01

    Full Text Available The article discusses typical, operational systems for monitoring vibrations of jet engines, which constitute the propulsion of combat aircraft of the Armed Forces of the Republic of Poland. After that, the paper presents the stage of installing vibration measuring sensors in the direct area of one of the jet engine bearings, which is a support system for its rotor. The article discusses results of carried out analyses of data gathered during tests of the engine in the conditions a jet engine test bed. Results of detecting damages to the bear-ing, using sensors built in the direct area will be presented.

  7. Aprendizagem de fuga após estímulos apetitivos incontroláveis

    Directory of Open Access Journals (Sweden)

    Angélica Capelari

    Full Text Available O presente experimento teve por objetivo investigar se estímulos apetitivos não-contingentes (incontroláveis produzem interferência na aprendizagem de fuga (desamparo aprendido. Ratos foram divididos em três grupos (n = 8, denominados contingente (C, não contingente (NC e ingênuo (I. Na primeira fase (tratamento, os animais do grupo C receberam reforçamento positivo (água sob contingência de CRF, FR5 e FR20. A cada reforço liberado a um sujeito do grupo C, era liberada uma gota de água (não-contingente a um sujeito do grupo NC. Os animais do grupo ingênuo (I permaneceram no biotério. Na fase seguinte (teste, os animais foram submetidos a choques que poderiam ser desligados em função da resposta de saltar na shuttlebox. Todos os sujeitos aprenderam igualmente a resposta de fuga, independentemente do tratamento prévio recebido. Esses resultados sugerem que estímulos apetitivos incontroláveis não produzem o desamparo aprendido. Discute-se a generalização do efeito entre contextos aversivo e apetitivo.

  8. AGARD Index of Publications 1974-1976

    Science.gov (United States)

    1977-09-01

    Now Mexico . When possible, subusquent flight test darmonstrations Author rsults were compared with thirrse obtained by other InvestigatorsIni other...lEngland). TOSR ik.0M oe .Tng n .S INn BLO ARAAYS THE A. IG HbOFrn Mn A INTDGCuTEmDeg fIRC LageITal TORIllk.DM.Je R aa adN INg nA R ALO AAAY T HE...with disease is diagnosed as tuberculosis , even more so since Camlorniuic able Disease Sell t975 5 p) rafs (For availability tuberrcuiinerion may

  9. Assessment of Electron Beam Welding in Shipyard Construction,

    Science.gov (United States)

    1985-12-01

    ELECTRON BEAM APPLICATORS QUESTIONNAIRE 1. Applicators Name: McCay Tool & Engr. Co. 2. Address: 1449 West Lark, Fenton , Mo. 3...had very li tt le undercut and requ ired no cosmet ic pass. TESTING AND RESULTS ’re~t ing wi ~ pt-f’)rimev oil spc inens inl t he- fol lowing manner. 1...Penetration Cosmet . c Accelerating Voltage (KV) 75 70 Beam Current (ma) 115 30 Travel Speed (IPM) 8 18 Beam focus (Amps programmed) 4.38 4.70 Gun to Work

  10. Readability index as a design criterion for elicited imitation tasks in automatic oral proficiency assessment

    CSIR Research Space (South Africa)

    De Wet, Febe

    2011-08-01

    Full Text Available ) techniques to automatically assess oral proficiency and listen- ing comprehension is one way in which these logistical prob- lems can be obviated. Another appealing feature of automatic tests is that they provide a means to assess consistently and ob...?146, 2008. [2] F. De Wet, C. Van der Walt, and T. R. Niesler, ?Automatic assess- ment of oral language proficiency and listening comprehension,? Speech Communication, vol. 51, pp. 864?874, 2009. [3] C. R. Graham, D. Lonsdale, C. Kennington, A. Johnson...

  11. The Implementation of Monetary Policy in an Emerging Economy: The Case of Chile

    OpenAIRE

    Christian A Johnson; Rodrigo Vergara

    2005-01-01

    Central bank authorities base implementation of monetary policy on an analysis of multiple variables known as monetary policy indicators. In a small open economy such as Chile, these indicators may include in-flation misalignments, unemployment, GDP growth, money growth, the current account balance, exchange rate volatility and international re-serves. A neural network approach is used to establish the correspond-ing weights considered by the Board of the Central Bank of Chile dur-ing the per...

  12. From Pen-and-Paper Sketches to Prototypes: The Advanced Interaction Design Environment

    DEFF Research Database (Denmark)

    Störrle, Harald

    2014-01-01

    Pen and paper is still the best tool for sketching GUIs. How-ever, sketches cannot be executed, at best we have facilitated or animated scenarios. The Advanced User Interaction Environment facilitates turn-ing hand-drawn sketches into executable prototypes.......Pen and paper is still the best tool for sketching GUIs. How-ever, sketches cannot be executed, at best we have facilitated or animated scenarios. The Advanced User Interaction Environment facilitates turn-ing hand-drawn sketches into executable prototypes....

  13. Sub-Saharan Africa Report, No. 2830

    Science.gov (United States)

    1983-08-12

    proceeds abroad and earn in- come. This scheme would require suffi- cient forex reserves. It would provide a counter revenue which could be set...also as- sisted our credit rating. Forex controls Your Money: Is there a benchmark gold price for the lifting of foreign exchange controls? Dc...first and lest it before tak- ing the next step. Your Money: The lift- ing of forex controls could lead to a vola- tile exchange rate. De Loor

  14. Testing Testing Testing.

    Science.gov (United States)

    Deville, Craig; O'Neill, Thomas; Wright, Benjamin D.; Woodcock, Richard W.; Munoz-Sandoval, Ana; Gershon, Richard C.; Bergstrom, Betty

    1998-01-01

    Articles in this special section consider (1) flow in test taking (Craig Deville); (2) testwiseness (Thomas O'Neill); (3) test length (Benjamin Wright); (4) cross-language test equating (Richard W. Woodcock and Ana Munoz-Sandoval); (5) computer-assisted testing and testwiseness (Richard Gershon and Betty Bergstrom); and (6) Web-enhanced testing…

  15. A low-protein, high-carbohydrate diet increases browning in perirenal adipose tissue but not in inguinal adipose tissue.

    Science.gov (United States)

    Pereira, Mayara P; Ferreira, Laís A A; da Silva, Flávia H S; Christoffolete, Marcelo A; Metsios, George S; Chaves, Valéria E; de França, Suélem A; Damazo, Amílcar S; Flouris, Andreas D; Kawashita, Nair H

    2017-10-01

    The aim of this study was to evaluate the browning and origin of fatty acids (FAs) in the maintenance of triacylglycerol (TG) storage and/or as fuel for thermogenesis in perirenal adipose tissue (periWAT) and inguinal adipose tissue (ingWAT) of rats fed a low-protein, high-carbohydrate (LPHC) diet. LPHC (6% protein, 74% carbohydrate) or control (C; 17% protein, 63% carbohydrate) diets were administered to rats for 15 d. The tissues were stained with hematoxylin and eosin for histologic analysis. The content of uncoupling protein 1 (UCP1) was determined by immunofluorescence. Levels of T-box transcription factor (TBX1), PR domain containing 16 (PRDM16), adipose triacylglycerol lipase (ATGL), hormone-sensitive lipase, lipoprotein lipase (LPL), glycerokinase, phosphoenolpyruvate carboxykinase (PEPCK), glucose transporter 4, β 3 -adrenergic receptor (AR), β 1 -AR, protein kinase A (PKA), adenosine-monophosphate-activated protein kinase (AMPK), and phospho-AMPK were determined by immunoblotting. Serum fibroblast growth factor 21 (FGF21) was measured using a commercial kit (Student's t tests, P diet increased FGF21 levels by 150-fold. The presence of multilocular adipocytes, combined with the increased contents of UCP1, TBX1, and PRDM16 in periWAT of LPHC-fed rats, suggested the occurrence of browning. The contents of β 1 -AR and LPL were increased in the periWAT. The ingWAT showed higher ATGL and PEPCK levels, phospho-AMPK/AMPK ratio, and reduced β 3 -AR and PKA levels. These findings suggest that browning occurred only in the periWAT and that higher utilization of FAs from blood lipoproteins acted as fuel for thermogenesis. Increased glycerol 3-phosphate generation by glyceroneogenesis increased FAs reesterification from lipolysis, explaining the increased TG storage in the ingWAT. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. Design, Realization and First Tests of a Prototype of Mower-Conditioner to Harvest Fibre Sorghum through Haymaking

    Energy Technology Data Exchange (ETDEWEB)

    Assirelli, A.; Pari, L. (Consiglio per la Ricerca e la Sperimentazione in Agricoltura, Unita di Ricerca per l' Ingegneria Agraria, Monterotondo, RM (Italy))

    2008-10-15

    The baling of dried fibre sorghum introduces some specific problems due mostly to stalk development, height and rigidity and to the volume of green biomass to process. To improve storage and to reduce transport cost, the main aspect to consider is the achievement of a satisfactory natural drying of the plant on the ground. Previous tests with mowers and mower-conditioners pointed out operational problems: the mowers, in relation to height and rigidity of the stalks, showed low working capacity, while the mower-conditioners, both with rolls or spokes, were not able to obtain a conditioning level good enough to achieve sufficient natural drying. The structure of the plant, particularly of its stalk, is such that without a continuous cleavage along the whole length, water content decreases slower than it would be suitable for harvesting period in Italy. Following these considerations, CRA-ING developed a back mounted harvester prototype, connected to the rear three-point linkage of a reversible drive tractor. Such equipment permits the cutting and conditioning of the whole plant, leaving it spread on the ground, without forming windrows, so to make full use of the solar radiation for drying. When the water contents drops to the optimum value for storing, the product can be collected in windrow and then baled with existing round balers or big balers. The adopted conditioning system is formed by six couples of longitudinal rolls, similar to those used in corn harvesting, because also the fibre sorghum is a row cultivation; each roll is provided with alternate blades and pads to press and cleave all along the stalk while pulling down the plant. Rolls dimensions and rotational speed are such to hit the stalk every 5 cm. Under the rolls, next to the ground, a saw cuts the plants. During the first year tests in Central Italy, the idea was confirmed successful: it was possible, working at 5 km/h speed, corresponding to 1,5 ha/h effective working capacity, to windrow and to

  17. ID’ing Innate and Innate-like Lymphoid Cells

    Science.gov (United States)

    Verykokakis, Mihalis; Zook, Erin C.; Kee, Barbara L.

    2014-01-01

    Summary The immune system can be divided into innate and adaptive components that differ in their rate and mode of cellular activation, with innate immune cells being the first responders to invading pathogens. Recent advances in the identification and characterization of innate lymphoid cells have revealed reiterative developmental programs that result in cells with effector fates that parallel those of adaptive lymphoid cells and are tailored to effectively eliminate a broad spectrum of pathogenic challenges. However, activation of these cells can also be associated with pathologies such as autoimmune disease. One major distinction between innate and adaptive immune system cells is the constitutive expression of ID proteins in the former and inducible expression in the latter. ID proteins function as antagonists of the E protein transcription factors that play critical roles in lymphoid specification as well as B and T-lymphocyte development. In this review, we examine the transcriptional mechanisms controlling the development of innate lymphocytes, including natural killer cells and the recently identified innate lymphoid cells (ILC1, ILC2, and ILC3), and innate-like lymphocytes, including natural killer T cells, with an emphasis on the known requirements for the ID proteins. PMID:25123285

  18. ID'ing innate and innate-like lymphoid cells.

    Science.gov (United States)

    Verykokakis, Mihalis; Zook, Erin C; Kee, Barbara L

    2014-09-01

    The immune system can be divided into innate and adaptive components that differ in their rate and mode of cellular activation, with innate immune cells being the first responders to invading pathogens. Recent advances in the identification and characterization of innate lymphoid cells have revealed reiterative developmental programs that result in cells with effector fates that parallel those of adaptive lymphoid cells and are tailored to effectively eliminate a broad spectrum of pathogenic challenges. However, activation of these cells can also be associated with pathologies such as autoimmune disease. One major distinction between innate and adaptive immune system cells is the constitutive expression of ID proteins in the former and inducible expression in the latter. ID proteins function as antagonists of the E protein transcription factors that play critical roles in lymphoid specification as well as B- and T-lymphocyte development. In this review, we examine the transcriptional mechanisms controlling the development of innate lymphocytes, including natural killer cells and the recently identified innate lymphoid cells (ILC1, ILC2, and ILC3), and innate-like lymphocytes, including natural killer T cells, with an emphasis on the known requirements for the ID proteins. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  19. PUSH-ing Construction Communications & Going Viral for Safety

    OpenAIRE

    Prevost, Dan; McCall, Bill

    2018-01-01

    Over the past 2 years, the Indiana Toll Road Concession Co. (ITRCC) and its contractors have delivered the 80/90 PUSH project, an ambitious rehabilitation of 70 miles of the Indiana Toll Road. The team developed an aggressive communications program to keep its customers and community stakeholders informed, partnering with the Indiana Motor Truck Association to take its Put the Phone Down campaign to social media. Join us for a discussion.

  20. Bioplaguicidas de origen vegetal en Costa Rica (ING)

    OpenAIRE

    García, Jaime

    2016-01-01

    More than hundred plant species reported to have some kind of pesticide effect in Costa Rica are cited. The current situation of supply and demand of these products is presented, emphasizing the principal limitations for the development at commercial level, as well as the potential that the country possesses based on its extraordinary biodiversity. A listing of the institutions related to this matter is given. Finally, additional considerations are made about the toxicity of theses products a...

  1. Ühisrakendusprojektide teostamisest Eestis : [energeetika vallas] / Inge Roos

    Index Scriptorium Estoniae

    Roos, Inge

    2004-01-01

    Kyoto protokolliga sätestatud kasvuhoonegaaside heitkoguste vähendamise paindlikud mehhanismid soodustavad efektiivsete energiat säästvate uute tehnoloogiate toomist arenenud lääneriikidest üleminekumajandusega riikidesse

  2. Un plaidoyer pour Do[ing] The Right Thing

    OpenAIRE

    Pecqueux, Anthony

    2016-01-01

    International audience; Spike Lee’s Do The Right Thing (1989) continues to raise questions and debates. In contrast with traditional analyses, this article studies the film as staging three unusual protagonists: music, heat and the neighborhood. This sensitive configuration allows for a different linkage between a form of ambiantal determinism and a certain expressivity granted to certain characters. It also leads to shedding light on the perfectionist thematic of the film.; Do The Right Thin...

  3. Forum-ing: Signature practice for public theological discourse

    African Journals Online (AJOL)

    2014-05-14

    May 14, 2014 ... response to the problems of poverty, homelessness, and the 'missing and murdered children' ... virtual poor: Reimaging a discourse of reconciliation and social cohesion in South Africa', .... The reality is that God is engaged.

  4. Kaali saladus Eesti-Läti filmis / Inge Pitsner

    Index Scriptorium Estoniae

    Pitsner, Inge

    2003-01-01

    Valminud on populaarteaduslik film Kaali meteoriidiplahvatusest "Kaali saladus" : stsenarist ja režissöör Urmas E. Liiv : operaator Ago Ruus : produtsent Riho Västrik : OÜ Vesilind (Eesti) - Vides Filmu Studija (Läti)

  5. ING: INDOOR ROUTING PROTOCOL FOR GREEN HOME NETWORKS

    OpenAIRE

    Kaouthar Sethom; Nozha Al- Ibrahimi; Guy Pujolle

    2011-01-01

    Because of all the innovations in computer communications and digital consumer device technologies,people have had great interest in researching home networking systems. The home is evolving rapidlyinto a smart Mesh networked environment.Moreover, the energy consumption of wireless devices and networks gradually increases to represent asignificant portion of the operational cost, naturally also causing increased equivalent carbonemissions to the environment. Therefore, reducing the energy con...

  6. "Value"ing Children Differently? Migrant Children in Education

    Science.gov (United States)

    Devine, Dympna

    2013-01-01

    This paper considers dilemmas around "value" and the "valuing" of children and childhood(s) in schools. I argue that in neo-liberal contexts, processes of children's identity making become aligned with the idea of the corporate citizen--value and worth derived from the capacity to produce, excel, self-regulate as well as…

  7. Forum-ing: Signature practice for public theological discourse ...

    African Journals Online (AJOL)

    The forum meets every Monday morning, except when there is a national holiday. It has operated 30 consecutive years. The forum has a series of presentations, including the opening prayer, self-introductions of each person, a report of the executive director, special presentations from selected community groups, reports, ...

  8. Täiskuu tervitas luulefestivali / Inge Põlma, Maire Kõrver

    Index Scriptorium Estoniae

    Põlma, Inge

    2008-01-01

    Ülevaade Täiskuu luulefestivalist, kus esinesid Kristiina Ehin, Andres Ehin, Ly Ehin, Contra, Sujata Bhatt, Ban'ya Natsuishi, Meelika Hainsoo, Lise Sinclair, Jaak Johanson, Lauri Õunapuu, Maria Peterson, Siiri Sisask, Kauksi Ülle, Sayumi Kamakura

  9. Süüdistus Sifi firma vastu / Inge Rumessen

    Index Scriptorium Estoniae

    Rumessen, Inge

    2000-01-01

    Endel Sifi firmat OÜ Rasmusson süüdistatakse omavolilistes ehitus- ja lammutustöödes Bekkeri sadamas. AS Balti Baas ja OÜ Rasmusson vahelise tüli kronoloogia. E. Siff ja Vene naftagigant Onako soovivad saada sadama omanikuks

  10. Streptococcus In man m illeri causIng infection

    African Journals Online (AJOL)

    1983-04-30

    Apr 30, 1983 ... every organ system. Bacteraemia due to Strept. mil- leri was a significant indicator of the presence of an occult abscess. Endocarditis was rare. The penicillins or ... liver, central nervous system, lungs, appendix, pleural cavity and pelvis, as well as from ... or predisposing factors and therapy. Results.

  11. Forum-ing: Signature practice for public theological discourse ...

    African Journals Online (AJOL)

    HTS Teologiese Studies / Theological Studies. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 70, No 1 (2014) >. Log in or Register to get access to full text downloads.

  12. Fulltext PDF

    Indian Academy of Sciences (India)

    Admin

    than one. T he sam e argum ent show s that the average value of Y 2 is also 5. 4 . G e n e ra lisa tio n. N ow see if you can establish the follow ing m ore general resu lt. L et X 1 and X 2 be two random quantities tak- ing ¯nitely m any values such that (i) both are alw ays greater than zero;(ii) the random vectors (X 1 , X 2 ) sat-.

  13. Parallel Readout of Optical Disks

    Science.gov (United States)

    1992-08-01

    r(x,y) is the apparent reflectance function of the disk surface including the phase error. The illuminat - ing optics should be chosen so that Er(x,y...of the light uniformly illuminat - ing the chip, Ap = 474\\im 2 is the area of photodiode, and rs is the time required to switch the synapses. Figure...reference beam that is incident from the right. Once the hologram is recorded the input is blocked and the disk is illuminat - ed. Lens LI takes the

  14. Indian summer monsoon variability during the Holocene as recorded in sediments of the Arabian Sea: Timing and implications

    Digital Repository Service at National Institute of Oceanography (India)

    Thamban, M.; Kawahata, H.; Rao, V.P.

    ., 2005). Recently a 11,000 yr reconstruction of sunspots using tree ring ∆ 14 C data revealed exceptional changes in sunspot activity within the Holocene (Solanki et al., 2004). Since sun is the principal source of energy, changes in solar energy output... seem to be stimulated by the sun, suggest- ing the importance of small changes in solar activity lead- ing to perceptible changes in monsoon conditions. Acknowledgements We thank the Directors of National Centre for Ant- arctic and Ocean Research (NCAOR...

  15. Workshop 3: Conformal Cooling with AM: Presentation held at International Workshop Additive Manufacturing: Ready for the Future? Innovative Solutions for Lightweight Design and Digital Manufacturing, 28. September 2017, Waterloo (Kanada)

    OpenAIRE

    Müller, Bernhard

    2017-01-01

    Bernhard Mueller graduated as »Dipl.-Ing.« in production engineering from Dresden University of Technology, Germany, in 1997 after preparing his final thesis at California State University, Long Beach (USA). He worked in German foundry and automotive supply industry for 12 years, focussing on R&D as well as on management responsibilities, serving as a plant manager in his latest position. In 2001, Bernhard obtained his »Dr.-Ing.« (PhD) degree from TU Dresden, Faculty of Mechanical Engineering...

  16. TU-AB-BRA-09: A Novel Method of Generating Ultrafast Volumetric Cine MRI (VC-MRI) Using Prior 4D-MRI and On-Board Phase-Skipped Encoding Acquisition for Radiotherapy Target Localization

    Energy Technology Data Exchange (ETDEWEB)

    Wang, C; Yin, F; Harris, W; Cai, J; Chang, Z; Ren, L [Duke University Medical Center, Durham, NC (United States)

    2016-06-15

    Purpose: To develop a technique generating ultrafast on-board VC-MRI using prior 4D-MRI and on-board phase-skipped encoding k-space acquisition for real-time 3D target tracking of liver and lung radiotherapy. Methods: The end-of-expiration (EOE) volume in 4D-MRI acquired during the simulation was selected as the prior volume. 3 major respiratory deformation patterns were extracted through the principal component analysis of the deformation field maps (DFMs) generated between EOE and all other phases. The on-board VC-MRI at each instant was considered as a deformation of the prior volume, and the deformation was modeled as a linear combination of the extracted 3 major deformation patterns. To solve the weighting coefficients of the 3 major patterns, a 2D slice was extracted from VC-MRI volume to match with the 2D on-board sampling data, which was generated by 8-fold phase skipped-encoding k-space acquisition (i.e., sample 1 phase-encoding line out of every 8 lines) to achieve an ultrafast 16–24 volumes/s frame rate. The method was evaluated using XCAT digital phantom to simulate lung cancer patients. The 3D volume of end-ofinhalation (EOI) phase at the treatment day was used as ground-truth onboard VC-MRI with simulated changes in 1) breathing amplitude and 2) breathing amplitude/phase change from the simulation day. A liver cancer patient case was evaluated for in-vivo feasibility demonstration. Results: The comparison between ground truth and estimated on-board VC-MRI shows good agreements. In XCAT study with changed breathing amplitude, the volume-percent-difference(VPD) between ground-truth and estimated tumor volumes at EOI was 6.28% and the Center-of-Mass-Shift(COMS) was 0.82mm; with changed breathing amplitude and phase, the VPD was 8.50% and the COMS was 0.54mm. The study of liver patient case also demonstrated a promising in vivo feasibility of the proposed method Conclusion: Preliminary results suggest the feasibility to estimate ultrafast VC-MRI for on

  17. TU-AB-BRA-09: A Novel Method of Generating Ultrafast Volumetric Cine MRI (VC-MRI) Using Prior 4D-MRI and On-Board Phase-Skipped Encoding Acquisition for Radiotherapy Target Localization

    International Nuclear Information System (INIS)

    Wang, C; Yin, F; Harris, W; Cai, J; Chang, Z; Ren, L

    2016-01-01

    Purpose: To develop a technique generating ultrafast on-board VC-MRI using prior 4D-MRI and on-board phase-skipped encoding k-space acquisition for real-time 3D target tracking of liver and lung radiotherapy. Methods: The end-of-expiration (EOE) volume in 4D-MRI acquired during the simulation was selected as the prior volume. 3 major respiratory deformation patterns were extracted through the principal component analysis of the deformation field maps (DFMs) generated between EOE and all other phases. The on-board VC-MRI at each instant was considered as a deformation of the prior volume, and the deformation was modeled as a linear combination of the extracted 3 major deformation patterns. To solve the weighting coefficients of the 3 major patterns, a 2D slice was extracted from VC-MRI volume to match with the 2D on-board sampling data, which was generated by 8-fold phase skipped-encoding k-space acquisition (i.e., sample 1 phase-encoding line out of every 8 lines) to achieve an ultrafast 16–24 volumes/s frame rate. The method was evaluated using XCAT digital phantom to simulate lung cancer patients. The 3D volume of end-ofinhalation (EOI) phase at the treatment day was used as ground-truth onboard VC-MRI with simulated changes in 1) breathing amplitude and 2) breathing amplitude/phase change from the simulation day. A liver cancer patient case was evaluated for in-vivo feasibility demonstration. Results: The comparison between ground truth and estimated on-board VC-MRI shows good agreements. In XCAT study with changed breathing amplitude, the volume-percent-difference(VPD) between ground-truth and estimated tumor volumes at EOI was 6.28% and the Center-of-Mass-Shift(COMS) was 0.82mm; with changed breathing amplitude and phase, the VPD was 8.50% and the COMS was 0.54mm. The study of liver patient case also demonstrated a promising in vivo feasibility of the proposed method Conclusion: Preliminary results suggest the feasibility to estimate ultrafast VC-MRI for on

  18. L’étudiant comme acteur de sa formation

    Directory of Open Access Journals (Sweden)

    Jules Richard

    2004-01-01

    Full Text Available Cette communication présente les résultats d’une expérimentation menée dans le cadre d’un cours de communication à des étudiants de premier cycle en ingénierie. À partir d’une thématique portant sur la communication et l’ingénierie, chaque équipe d’étudiants a réalisé un document audiovisuel sur support cédérom comportant des entrevues avec des ingénieurs. Cette expérimentation constitue une démarche d’appropriation du savoir par les étudiants. Les étudiants devenant acteurs de leur propre formation par une démarche active de recherche et de construction de l’information, ils se sentent davantage impliqués dans ce projet. Ce projet met donc en évidence les notions de stimulation, de construit de motivation et d’intégration des nouvelles technologies de l’information et de la communication à l’enseignement.

  19. Inhibition of the corrosion of mild steel in hydrochloric acid by isatin and isatin glycine

    Directory of Open Access Journals (Sweden)

    B.I. Ita

    2006-12-01

    Full Text Available The inhibition of corrosion of mild steel in hydrochloric acid by isatin glycine (ING and isatin (IN at 30-60 oC and concentrations of 0.0001 M to 0.0005 M was studied via weight loss method. At the highest inhibitor concentration studied ING exhibited inhibition efficiency of 87% while IN exhibited 84% at 60 oC. A chemical adsorption mechanism was proposed on the basis of the temperature effect and obtained average activation energy values of 143.9 kJ/mol for ING and 118.5 kJ/mol for IN. The two inhibitors were confirmed to obey the Langmuir adsorption isotherm equation at the concentrations studied. Also a first-order type of mechanism was proposed from the kinetic treatment of the result. The difference in the inhibitory properties of the inhibitors was explained in terms of the difference in their molecular structures and solubility rather than difference in molecular weights alone.

  20. APLIKASI MODEL ARTIFICIAL NEURAL NETWORKS UNTUK STOCK FORECASTING DI PASAR MODAL INDONESIA

    Directory of Open Access Journals (Sweden)

    Christian Herdinata

    2017-03-01

    Full Text Available This research showed the applicat ion of model Art if icial Neural Networks (ANN orJaringan Syaraf Tiruan (JST at the f ield of monetary science, especially for the applicat ion off inancial forecast ing. ANN or JST was a new alternat ive for the applicat ion of f inancialforecast ing.The purpose of this research was to know whether the stock index instantaneouslyand fully ref lect historical informat ion, in Indonesia Stock Exchange (IDX. The research usedcomparison between return of technical t rading rule based Art if icial Neural Networks (ANNmodel and return of buy & hold st rategy. The result showed that the weakness form ofef f icient market hypothesis was rejected in the Indonesian capital market . Expectat ion ofthis research was giving informat ion and securing the market perpet rators that st ill enabledto get abnormal of return by doing commerce in chnical through forecast ing of model Art ificial Neural Networks (ANN or Jaringan Syaraf Tiruan ( JST.

  1. Colloquium held in honour of Prof.em.Dr.-Ing. F. Adler and Prof.Dr.-Ing. Dr.h.c. F.L. Wilke

    International Nuclear Information System (INIS)

    1992-01-01

    The following subjects are discussed: Acceptance of social responsibility; introduction of a management information system B-FIS at Friedrich Heinrich mine; new engineering tasks in reinsurance; mining education and the mining industry; exodus of German mining engineers; developments in shaft drilling in the last 20 years. (HS) [de

  2. How vulnerable is Indian coast to oil spills? Impact of MV Ocean Seraya oil spill

    Digital Repository Service at National Institute of Oceanography (India)

    Sivadas, S.; George, A.; Ingole, B.S.

    by the application of f–x–y prediction filters in the f–x domain and tested on a new dataset from the Gulf of Mexico with a long streamer configuration of 9000 m. The input RMS noise plot from a line that was contaminated with seismic interference is plotted..., the process preserves the signal while attenuat- ing SI. Interference noise and random noise have also been studied on the stack sections which are also contaminated. An example of the seismic stack section from a different line in the Gulf of Mexico...

  3. An Implicit Enumeration Algorithm with Binary-Valued Constraints.

    Science.gov (United States)

    1986-03-01

    problems is the National Basketball Association ( NBA -) schedul- ing problems developed by Bean (1980), as discussed in detail in the Appendix. These...fY! X F L- %n~ P ’ % -C-10 K7 K: K7 -L- -7".i - W. , W V APPENDIX The NBA Scheduling Problem §A.1 Formulation The National Basketball Association...16 2.2 4.9 40.2 15.14 §6.2.3 NBA Scheduling Problem The last set of testing problems involves the NBA scheduling problem. A detailed description of

  4. Alkylation Induced DNA Repair and Mutagenesis in Escherichia coli.

    Science.gov (United States)

    1987-11-23

    unrepaired 3-methyladenine in DNA 29 2.4.1 Cytotoxic effects of persisting m3A in DNA 30 2.4.2 Mutagenic bypass synthesis of depurinat ,d DNA 30 3 CONCLUDING...induced by a single exposure to the ca’rcinogen N- methyl-N- nitrosourea (MNU) due to activation of the malignant Ha-ras-i locus. Analysis of the induced...ing CO:A uolymerase I for repair synthesis . Since DNA polymerase I would be required to complete repair after the in~uial activity of TagII, we tested

  5. Operational Helicopter Aviation Medicine

    Science.gov (United States)

    1978-12-01

    attachments through the years; and finally, the blades used the same technology as in the U.S.--aluminum extruded leading edge spar and aluminum sheet...fabric cover- ing. Subsequent models have aluminum extruded spars and aluminum pockets. The blades are electrically de-iced as is the windshield. The...x 2000 to x x x 2145 Flight x x x x x 2200 to x x x 2345 Flight x x x x x x 2400 to Snack & x 0100 Testing x x x x 22-3 TABLE 2 FLIGHT PROFILE Bad

  6. Resolving Overlimiting Current Mechanisms in Microchannel-Nanochannel Interface Devices

    Science.gov (United States)

    Yossifon, Gilad; Leibowitz, Neta; Liel, Uri; Schiffbauer, Jarrod; Park, Sinwook

    2015-11-01

    We present results demonstrating the space charge-mediated transition between classical, diffusion-limited current and surface-conduction dominant over-limiting currents in a shallow micro-nanochannel device. The extended space charge layer develops at the depleted micro-nanochannel entrance at high current and is correlated with a distinctive maximum in the dc resistance. Experimental results for a shallow surface-conduction dominated system are compared with theoretical models, allowing estimates of the effective surface charge at high voltage to be obtained. Further, we extend the study to microchannels of moderate to large depths where the role of various electro-convection mechanisms becomes dominant. In particular, electro-osmotic of the second kind and electro-osmotic instability (EOI) which competes each other at geometrically heterogeneous (e.g. undulated nanoslot interface, array of nanoslots) nanoslot devices. Also, these effects are also shown to be strongly modulated by the non-ideal permselectivity of the nanochannel.

  7. 3D-Calibration for IMU of the Strapdown Inertial Navigation Systems

    Directory of Open Access Journals (Sweden)

    Avrutov V.V.

    2017-01-01

    Full Text Available A new calibration method for Inertial Measurement Unit (IMU of Strapdown Iner-tial Navigation Systems was presented. IMU has been composed of accelerometers, gyroscopes and a circuit of signal processing. Normally, a rate transfer test and multi-position tests are us-ing for IMU calibration. The new calibration method is based on whole angle rotation or finite rotation. In fact it’s suggested to turn over IMU around three axes simultaneously. In order to solve the equation of calibration, it is necessary to provide an equality of a rank of basic matrix into degree of basic matrix. The results of simulated IMU data presented to demonstrate the performance of the new calibration method.

  8. Through-Flow Calculations in Axial Turbomachinery

    Science.gov (United States)

    1976-10-01

    MEETING Dr Ing. G.Winterfeld, DFVLR, Germany PANEL EXECUTIVE Lt. Colonel J.B.Catiller, USAF - Meeting Organisation Dipl. Ing. J.H.Krengel, D.I.G...ralemenc subsonique. Ceci. ne veut d’ailleurs pas dire quo 10 problt~me du passage d’u-ne zone cupersonique A une zone subsonique ( chocs , blocago) se...ph~nom~nes tols que ci~collement, ondes do choc , etc... Nous avons v~rifi6 qu’une force do frottemont oppos~e A la viteese pout rernplir ce role sar.s

  9. Port and EGR Mass Flow Sensors

    DEFF Research Database (Denmark)

    Hendricks, Elbert

    1998-01-01

    The note documents briefly work done on what is thought to be a new method of measurement of the pulsating flow in the intake port ot and SI engine and in the EGR returen line. The work reviewed has been carried out in close cooperation with Civ. Ing. Michael Føns, Civ. Ing. Christian Jepsen, the......, the author (IAU) and Spencer C. Sorenson (ET). The theory which decribes in detail the overall dynamic chracteristics of the sensor was developed at IAU and ET, DTU....

  10. Multifunctional Nanocomposites for Improved Sustainability and Protection of Facilities

    Science.gov (United States)

    2015-05-01

    ballistic-resistant panels. Equipment needed for cur- ing the epoxy is more expensive, and the viscosity of the epoxy material is too high for use in common...fracture. It was concluded that the lower V50 of the clay -modified Nylon 6 nanocomposite was brittle and had lower toughness than that of the neat...levels (0.5, 1.0, 2.0, and 3.0 wt%) in the polyester matrix. Higher load- ing of the CNTs was attempted but was constrained by the viscosity increase of

  11. UTILIZAÇÃO DO TESTE DE CONDUTIVIDADE ELÉTRICA PARA PREVISÃO DO POTENCIAL GERMINATIVO DE SEMENTES DE INGÁ

    Directory of Open Access Journals (Sweden)

    C.J. BARBEDO

    1998-05-01

    Full Text Available Sementes de espécies do gênero Inga apresentam curta longevidade em condições naturais, freqüentemente inferiores a 15 dias. O teste de germinação para estas sementes tem duração de 7 a 15 dias, tornando-o de difícil aplicabilidade na separação de lotes de sementes a serem beneficiados e armazenados. Assim, esta pesquisa visou verificar a eficiência da utilização do teste de condutividade elétrica na separação, quanto à qualidade fisiológica, de lotes de sementes de ingá (Inga uruguensis Hook. & Arn.. Foram utilizados três lotes de sementes distintos quanto à sua época de coleta, cada qual com dois sublotes em função da forma de obtenção (colheita diretamente nas árvores e coleta sobre o solo. Todos foram armazenados por período de 80 dias, em vermiculita úmida dentro de câmara fria, com análises a cada 20 dias. Os resultados comprovaram a eficiência do teste na separação de lotes de alta (germinação superior a 50%, média (germinação entre 10 e 40% ou baixa (germinação inferior a 10% qualidade fisiológica que corresponderam a valores de condutividade elétrica de, respectivamente, 0-25, 25-60 e acima de 60 mS.g de peso de matéria seca-1.cm-1.Inga seeds have short life under natural conditions, often lower than 15 days. Since, the germination tests for these seeds last 7-15 days, they are inefficient to separate seed lots for processing and storage. This research was carried out to verify the efficacy of the electrical conductivity test to determine the physiological seed quality of I. uruguensis. Fruits were collected at three dates, directly from the trees or from the ground, forming six sublots of different quality. All of them were stored for 80 days in wet vermiculite and in a cold chamber. Seed quality was evaluated every 20 days. The results confirmed the test efficacy to separate of seed lots in three categories: high (more than 50% germination, intermediate (germination between 10 and 40% and

  12. Temporal and Spatial Shaping of X-Ray Free-Electron Lasers

    Energy Technology Data Exchange (ETDEWEB)

    Guo, G [SLAC National Accelerator Lab., Menlo Park, CA (United States); Marinelli, AGOSTINO

    2018-04-01

    The x-ray free-elec­tron laser is the bright­est source of x-rays, with a peak bright­ness ten or­ders of mag­ni­tude higher than con­ven­tional syn­chro­tron ra­di­a­tion sources. Much like con­ven­tional lasers, XFELs are ex­tremely flex­i­ble ma­chines and the prop­er­ties of the x-rays can be con­trolled by ac­cu­rately ma­nip­u­lat­ing the las­ing medium, i.e. the elec­tron beam. In my talk I will dis­cuss past and pre­sent re­search on shap­ing the tem­po­ral prop­er­ties of the x-rays at the Linac Co­her­ent Light Source (LCLS). I will dis­cuss the two-color FEL modes and their ap­pli­ca­tions in user ex­per­i­ments. Fi­nally I will pre­sent our re­sults on laser-shap­ing of x-ray pulses and our plans for at­tosec­ond op­er­a­tion in the soft x-ray regime.

  13. Elistagem eestimaist. Abikaasade meelevallas / Aita Kivi

    Index Scriptorium Estoniae

    Kivi, Aita, 1954-

    2002-01-01

    Sisu : Anton Nigov [Tõnu Õnnepalu]. Harjutused; Elme Väljaste. Kiusatus; Reet Kudu. Täiskuu ja tänavalatern; Vaapo Vaher. Surmakuul & seemnepurse; Jelena Skulskaja. Vene rulett; Inge Ojala. Asendusema ja olematud lapsed; Inge Ojala. Andesta - ma kasvasin tänaval; Barbara Vine. Korstnapühkija poeg; Charlotte Bingham. Suveaeg; Lisa Gardner. Täiuslik abikaasa; Wendy Northcutt. Darwini auhinnad 2; Dean Foster. Euroopa riikide etikett ja tavad; J. P. Donleavy. Naine, kellele meeldisid puhtad tualettruumid; Karin Altvegen. Kadunud hing; Grant Naylor. Punane kääbus; Dylan Evans. Emotsioon. Sentimenditeooria

  14. OSRD Reports: Bibliography and Index of Declassified Reports Having OSRD Numbers

    Science.gov (United States)

    1947-06-01

    Jln 191114. • sbp photo., dl.gra. HI $2.00 Ph $8.00. Bibliography OSRO 3312 Pll 12023 (1-831) The Psychological CO~POl𔃽t Ion. Mew York Info...tltl 16 ~ It fire control- n (a) tra inIng couru upon tlle lr vl.ual pra- flc l ncy. (Applied psychology plnll: lee- tlon and tra In Ing of rengeflnder...other. Ex_lnation of en8llV . atar ! el (0D-113: fitrn: "-119): Metallurgical elornlnlltlon of a tall "".,.;1 u,.bly ... d lending gear hydraulle

  15. Heavy sediment influx during early Holocene: Inference from clay mineral studies in a core from the western Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Reddy, N.P.C.; Rao, K.M.

    is attributed to heavy sediment influx du r- ing Mid Termination (MT) (12,500 ? 10,000 years BP), due to i n creased precipitation and run - off resulting from high inte n sity monsoonal regime. C LAY minerals are a powerful source for the interpret a... to address to the prov e nance of the sediments in a sediment core from the western Bengal Fan. In this paper, we report clay mi n eralogy and provide an explanation for the heavy sed i ment deposition du r ing the Holocene. A sediment core of 650...

  16. Major turbidity flows in the Western Indus Fan between 290 and 360 kyr

    Digital Repository Service at National Institute of Oceanography (India)

    Govil, P.; Naidu, P.D.; Radhika, T.K.

    controlled by the surface - water biological production, rate of dissolution du r- ing its journey through the water column as well as on the sea floor and dilution by the non - carbonate fraction and terr i- genous matter 7 . The ODP Site 720A... sediment a- tion of a few centimetres thickness within the main feeder channel and Indus Canyon. This kind o f turbidite sedime n- tation was noticed on the eastern part of the Indus Fan du r- ing the Last Glacial Maximum when the sea level was low 10...

  17. New stable isotope records of sediment cores from the SE Arabian Sea - Inferences on the variations in monsoon regime during the late Quaternery

    Digital Repository Service at National Institute of Oceanography (India)

    Thamban, M.; Rao, V.P.

    , Vidyanagar 671 123, India We reconstruct here the changes in regional hydr o- graphy related to the fluctuations in Indian mo n soons du r ing the late Quaternary based on the stable isotope composition of the foraminifers and organic matter in three... value du r ing the early Holocene for the eastern Arabian Sea 21 . The SW monsoon intensity was very weak and the dry NE mo n soon was the dominant feature during the LGM in the Ar a bian Sea 3 . The cool winds of the north - easterly winter...

  18. Post-tsunami oceanographic conditions in southern Arabian Sea and Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    AnilKumar, N.; Sarma, Y.V.B.; Babu, K.N.; Sudhakar, M.; Pandey, P.C.

    m depth. This high - salinity water mass was earlier ident i fied as Arabian Sea High Salinity Water mass ( ASHSW), which forms in the northern Arabian Sea du r- ing winter 12 . A pool of low - s a linity waters occupies the upper 50 m around... of t he Bay of Bengal du r ing the southwest monsoon season flows southward along the coast by the coastal currents during winter period 9 . The relatively high s a line waters (33.7 psu) are seen north of Nagapattinam, separating two low - salinity...

  19. An ancient harbour at Dwarka: Study based on the recent underwater explorations

    Digital Repository Service at National Institute of Oceanography (India)

    Gaur, A.S.; Sundaresh; Tripati, S.

    vegetation were rarely n o ticed. A number of artifacts were discovered du r ing offshore ex - plo rations between 3 and 16 m water depths. Broadly, these artifacts can be d i vi ded into the following two categories. (A) Structures : Underwater... of underwater struc tures at Dwarka. A 19th century map of the area indicates that shoreline has advanced land - ward by 550 m du r ing the last 130 years 24 with an ave - rage of 4 m/yr. The pr e sent offshore explorations have indi - cated that most...

  20. Software architecture for an indigenous knowledge management system

    CSIR Research Space (South Africa)

    Fogwill, T

    2011-11-01

    Full Text Available in technological land- scape. It preserves IK in a digital form that remains acces- sible to the original IK holders. It does so by recording and archiving audio/visual content that captures, to the extent possible, the oral, visual and performed aspects of IK...-end (described in section 6.2). The knowledge repository and the Fedora technology at its core are described in this section. The DKR stores and maintains digital audio/visual record- ings of the captured IK. While these audio/visual record- ings may...

  1. Daňová soustava a dohody o zamezení dvojího zdanění

    OpenAIRE

    Žiačik, Jan

    2008-01-01

    The subject of the thesis is analysis of tax systems. The author is writ ing about the subject from general point of view as wel l as focusing on the tax system in the Czech Republic as in 2008 whi le indicat ing the possible future development in terms of the EC tax harmonization process and existing double taxation t reaties. The first part explains the general characteristics of the tax system. It defines some related key terms: tax, tax system, subject and object of the tax immunity, tax ...

  2. The Risk of Noise-Induced Hearing Loss During Simulated Dives in Canadian Forces Hyperbaric Facilities

    Science.gov (United States)

    2012-10-01

    développement, à l’ingénierie et aux évaluations (STO/DEE) formulée par le SMA (Mat) relativement à la collecte de données sur le risque de perte...l’ingénierie et aux évaluations (STO/DEE) formulée par le SMA (Mat) relativement à la collecte de données sur le risque de perte auditive due au bruit chez...Selection of human participants The protocol was approved in advance by the Human Research Ethics Committee of Defence Research and Development Canada

  3. Effect of Pipe Flattening in API X65 Linepipe Steels Having Bainite vs. Ferrite/Pearlite Microstructures

    Directory of Open Access Journals (Sweden)

    Singon Kang

    2018-05-01

    Full Text Available The influence of microstructure on pipe flattening response was assessed using two different commercially produced U-ing, O-ing, and expansion (UOE pipes from API X65 steels having either a bainitic microstructure (steel B or a ferrite/pearlite microstructure (steel FP. A four-point bending apparatus and distinctive procedure were used to minimize strain localization during flattening. The flattened specimens were sectioned at different positions through the thickness, and tensile tested in both the longitudinal (LD and transverse directions (TD to assess the through-thickness variation in properties. Yield strength (YS distributions in the LD show V-shaped profiles through thickness in both steels, whereas the YS in the TD nearest the outside diameter (OD surface is reduced. These variations in YS are due to the Bauschinger effect associated with the compressive flattening pre-strain. The uniform elongation (UE of steel FP is almost independent of specimen position through the thickness, but for steel B there is a substantial reduction of the UE at both the inside and outside diameter positions and this reduction is greater in the LD. This work confirms that flattened pipe mechanical properties exhibit an important dependence on their microstructure type and it is postulated that the flattening procedure also influences the mechanical properties.

  4. Supervised Transfer Sparse Coding

    KAUST Repository

    Al-Shedivat, Maruan

    2014-07-27

    A combination of the sparse coding and transfer learn- ing techniques was shown to be accurate and robust in classification tasks where training and testing objects have a shared feature space but are sampled from differ- ent underlying distributions, i.e., belong to different do- mains. The key assumption in such case is that in spite of the domain disparity, samples from different domains share some common hidden factors. Previous methods often assumed that all the objects in the target domain are unlabeled, and thus the training set solely comprised objects from the source domain. However, in real world applications, the target domain often has some labeled objects, or one can always manually label a small num- ber of them. In this paper, we explore such possibil- ity and show how a small number of labeled data in the target domain can significantly leverage classifica- tion accuracy of the state-of-the-art transfer sparse cod- ing methods. We further propose a unified framework named supervised transfer sparse coding (STSC) which simultaneously optimizes sparse representation, domain transfer and classification. Experimental results on three applications demonstrate that a little manual labeling and then learning the model in a supervised fashion can significantly improve classification accuracy.

  5. From petroleum to natural gas. New assets in electric power industry; Dal petrolio al gas naturale. Nuovi assetti e linee di sviluppo nel settore dell'energia elettrica

    Energy Technology Data Exchange (ETDEWEB)

    Velona' , F. [Bari Politecnico, Bari (Italy). Centrali Termiche della Facolta' di Ingegneria

    2002-02-01

    Luigi Einaudi Foundation Group organized on November 5th 2001 a roundtable on the theme: Energy in Italy, how to change for surviving. In the congress hall in the National Federation of Italian Press, Valerio Zanone, the president, and other important persons such as Jan Keppler (Associazione Italiana Editori), Edgardo Curcio (Associazione Italiana Economisti dell'Energia), Emilio Gerelli (Pavia University) and Franco Velona' (Bari Politecnico) presented their relations on the theme of competitivity in the italian energy system, on the environmental compatibility and on the diversification sources from petroleum. Among the most interesting ones were those by ing. Machi', president of Gestore Rete Trasmissione Nazionale, by ing. Clavarino, president of Assocarboni, and by ing. Serena, president of Sondel. It seemed that the dialogue between the academies and the production system was taken again successfully. [Italian] La fondazione Luigi Einaudi ha organizzato il 5 novembre 2001 una giornata di studio sul tema L'Energia in Italia, Cambiare per sopravvivere. Nella bella sala convegni della Federazione nazionale della stampa italiana in Roma si sono succeduti dopo l'introduzione del Presidente della Federazione, Valerio Zanone, Jan Keppler dell'AIE, Edgardo Curcio dell'AIEE, Emilio Gerelli dell'Universita' di Pavia e Franco Velona' del Politecnico di Bari, che hanno introdotto le discussioni sulla competitivita' del sistema energetico italiano, sulla compatibilita' ambientale sulla diversificazione dal petrolio. Fra i numerosi interventi, di particolare importanza sono stati quelli dell'in. S. Machi', presidente del Grtn, dell'ing. Clavarino, presidente dell'Assocarboni, dell'ing. Serena della Sondel. Ha concluso i lavori Marcello Inghilesi, che ha ripreso i punti di vista piu' salienti espressi dalle aziende, dai ministeri e dalle associazioni ambientaliste, Il dialogo tra

  6. Automating Test Activities: Test Cases Creation, Test Execution, and Test Reporting with Multiple Test Automation Tools

    OpenAIRE

    Loke Mun Sei

    2015-01-01

    Software testing has become a mandatory process in assuring the software product quality. Hence, test management is needed in order to manage the test activities conducted in the software test life cycle. This paper discusses on the challenges faced in the software test life cycle, and how the test processes and test activities, mainly on test cases creation, test execution, and test reporting is being managed and automated using several test automation tools, i.e. Jira, ...

  7. An Integrated Information System for Supporting Quality Management Tasks

    Science.gov (United States)

    Beyer, N.; Helmreich, W.

    2004-08-01

    In a competitive environment, well defined processes become the strategic advantage of a company. Hence, targeted Quality Management ensures efficiency, trans- parency and, ultimately, customer satisfaction. In the particular context of a Space Test Centre, a num- ber of specific Quality Management standards have to be applied. According to the revision of ISO 9001 dur- ing 2000, and due to the adaptation of ECSS-Q20-07, process orientation and data analysis are key tasks for ensuring and evaluating the efficiency of a company's processes. In line with these requirements, an integrated management system for accessing the necessary infor- mation to support Quality Management and other proc- esses has been established. Some of its test-related fea- tures are presented here. Easy access to the integrated management system from any work place at IABG's Space Test Centre is ensured by means of an intranet portal. It comprises a full set of quality-related process descriptions, information on test facilities, emergency procedures, and other relevant in- formation. The portal's web interface provides direct access to a couple of external applications. Moreover, easy updating of all information and low cost mainte- nance are features of this integrated information system. The timely and transparent management of non- conformances is covered by a dedicated NCR database which incorporates full documentation capability, elec- tronic signature and e-mail notification of concerned staff. A search interface allows for queries across all documented non-conformances. Furthermore, print ver- sions can be generated at any stage in the process, e.g. for distribution to customers. Feedback on customer satisfaction is sought through a web-based questionnaire. The process is initiated by the responsible test manager through submission of an e- mail that contains a hyperlink to a secure website, ask- ing the customer to complete the brief online form, which is directly fed to a database

  8. Mini-Symposium on Micromechanics at the CSME Mechanical Engineering Forum

    CERN Document Server

    Muschik, W

    1991-01-01

    This volume contains the lectures presented at the mini-symposium on "Micromechanics" held in conjunction with the CSME Mechanical Engineer­ ing Forum 1990 between the 3rd and 8th June, 1990 at the University of Toronto, Canada. The expressed purpose of this symposium was to discuss some recent developments in the Micromechanics of Materials and how ad­ vances in this field now relate to the solution of practical engineer­ ing problems. Due to the time limit set for this section of the Engineer­ ing Forum as well as the restriction on the number of papers to be pre­ sented, it was not possible to cover a much wider range of topics. How­ ever, an attempt was made to include the most important advances asso­ ciated with the progress made in micromechanics in its application to material science and engineering over the past decade. Thus, the topics are concerned with: the fundamental aspects of the thermodynamics of structured solids (part I), - the micromechanical behaviour of alloys (part II), - the mod...

  9. Expression of Interest for a very long baseline neutrino oscillation experiment (LBNO)

    CERN Document Server

    Stahl, A; Guler, A M; Kamiscioglu, M; Sever, R; Yilmazer, A U; Gunes, C; Yilmaz, D; Del Amo Sanchez, P; Duchesneau, D; Pessard, H; Marcoulaki, E; Papazoglou, I A; Berardi, V; Cafagna, F; Catanesi, M G; Magaletti, L; Mercadante, A; Quinto, M; Radicioni, E; Ereditato, A; Kreslo, I; Pistillo, C; Weber, M; Ariga, A; Ariga, T; Strauss, T; Hierholzer, M; Kawada, J; Hsu, C; Haug, S; Jipa, A; Lazanu, I; Cardini, A; Lai, A; Oldeman, R; Thomson, M; Blake, A; Prest, M; Auld, A; Elliot, J; Lumbard, J; Thompson, C; Gornushkin, Y A; Pascoli, S; Collins, R; Haworth, M; Thompson, J; Bencivenni, G; Domenici, D; Longhin, A; Blondel, A; Bravar, A; Dufour, F; Karadzhov, Y; Korzenev, A; Noah, E; Ravonel, M; Rayner, M; Asfandiyarov, R; Haesler, A; Martin, C; Scantamburlo, E; Cadoux, F; Bayes, R; Soler, F J P; Aalto-Setälä, L; Enqvist, K; Huitu, K; Rummukainen, K; Nuijten, G; Eskola, K J; Kainulainen, K; Kalliokoski, T; Kumpulainen, J; Loo, K; Maalampi, J; Manninen, M; Moore, I; Suhonen, J; Trzaska, W H; Tuominen, K; Virtanen, A; Bertram, I; Finch, A; Grant, N; Kormos, L L; Ratoff, P; Christodoulou, G; Coleman, J; Touramanis, C; Mavrokoridis, K; Murdoch, M; McCauley, N; Payne, D; Jonsson, P; Kaboth, A; Long, K; Malek, M; Scott, M; Uchida, Y; Wascko, M O; Di Lodovico, F; Wilson, J R; Still, B; Sacco, R; Terri, R; Campanelli, M; Nichol, R; Thomas, J; Izmaylov, A; Khabibullin, M; Khotjantsev, A; Kudenko, Y; Matveev, V; Mineev, O; Yershov, N; Palladino, V; Evans, J; Söldner-Rembold, S; Yang, U K; Bonesini, M; Pihlajaniemi, T; Weckström, M; Mursula, K; Enqvist, T; Kuusiniemi, P; Räihä, T; Sarkamo, J; Slupecki, M; Hissa, J; Kokko, E; Aittola, M; Barr, G; Haigh, M D; de Jong, J; O'Keeffe, H; Vacheret, A; Weber, A; Galvanin, G; Temussi, M; Caretta, O; Davenne, T; Densham, C; Ilic, J; Loveridge, P; Odell, J; Wark, D; Robert, A; Andrieu, B; Popov, B; Giganti, C; Levy, J -M; Dumarchez, J; Buizza-Avanzini, M; Cabrera, A; Dawson, J; Franco, D; Kryn, D; Obolensky, M; Patzak, T; Tonazzo, A; Vanucci, F; Orestano, D; Di Micco, B; Tortora, L; Bésida, O; Delbart, A; Emery, S; Galymov, V; Mazzucato, E; Vasseur, G; Zito, M; Kudryavtsev, V A; Thompson, L F; Tsenov, R; Kolev, D; Rusinov, I; Bogomilov, M; Vankova, G; Matev, R; Vorobyev, A; Novikov, Yu; Kosyanenko, S; Suvorov, V; Gavrilov, G; Baussan, E; Dracos, M; Jollet, C; Meregaglia, A; Vallazza, E; Agarwalla, S K; Li, T; Autiero, D; Chaussard, L; Déclais, Y; Marteau, J; Pennacchio, E; Rondio, E; Lagoda, J; Zalipska, J; Przewlocki, P; Grzelak, K; Barker, G J; Boyd, S; Harrison, P F; Litchfield, R P; Ramachers, Y; Badertscher, A; Curioni, A; Degunda, U; Epprecht, L; Gendotti, A; Knecht, L; Di Luise, S; Horikawa, S; Lussi, D; Murphy, S; Natterer, G; Petrolo, F; Periale, L; Rubbia, A; Sergiampietri, F; Viant, T

    2012-01-01

    This Expression of Interest (EoI) describes the motivation for and the feasibility studies of a long baseline neutrino oscillation experiment (LBNO) with a new conventional neutrino beamline facility (CN2PY). The beam will be aimed at a next generation deep-underground neutrino observatory comprising a double phase liquid argon (LAr) detector and a magnetized iron calorimeter, located at the Pyh\\"asalmi (Finland) mine at a distance of 2300~km. The double phase LAr Large Electron Multiplier Time Projection Chamber (LAr LEM-TPC) is known to provide excellent tracking and calorimetry performance that can outperform other techniques. An initial 20~kton LAr fiducial volume, as considered here, comparable to the fiducial mass of SuperKamiokande and NOvA, offers a new insight and an increase in sensitivity reach for many physics channels. A magnetized iron calorimeter with muon momentum and charge determination collects an independent neutrino sample, and serves as a tail catcher for CERN beam eve...

  10. La ciudad de los prodigios somos nosotros. Actividades de expresión oral a partir de lecturas: una propuesta creativa para los alumnos

    Directory of Open Access Journals (Sweden)

    Eugenio Gillani Martín

    2012-08-01

    Full Text Available Entre los cometidos que tenemos los profesores en el nivel de enseñanza en el que trabajo, enseñanza de lenguas extranjeras (LE en escuelas oficiales de idiomas (E.O.I., están también la práctica de la comprensión escrita y el fomento de la lectura,  tanto en el aula como fuera de ella. Existe, al respecto, el hábito de  proponer a los alumnos, a lo largo del curso y de forma más o  menos obligatoria, la lectura en casa de cuentos y novelas que, posteriormente, se utilizarán en clase para actividades de análisis  lingüístico (generalmente sobre contenidos gramaticales, léxicos, estructuras sintácticas, modelos textuales, etc., o como estímulo para escribir resúmenes y redacciones y, cómo no, como objeto de evaluación de competencia en la expresión oral.

  11. Technical Design Report for large-scale neutrino detectors prototyping and phased performance assessment in view of a long-baseline oscillation experiment

    CERN Document Server

    De Bonis, I.; Duchesneau, D.; Pessard, H.; Bordoni, S.; Ieva, M.; Lux, T.; Sanchez, F.; Jipa, A.; Lazanu, I.; Calin, M.; Esanu, T.; Ristea, O.; Ristea, C.; Nita, L.; Efthymiopoulos, I.; Nessi, M.; Asfandiyarov, R.; Blondel, A.; Bravar, A.; Cadoux, F.; Haesler, A.; Karadzhov, Y.; Korzenev, A.; Martin, C.; Noah, E.; Ravonel, M.; Rayner, M.; Scantamburlo, E.; Bayes, R.; Soler, F.J.P.; Nuijten, G.A.; Loo, K.; Maalampi, J.; Slupecki, M.; Trzaska, W.H.; Campanelli, M.; Blebea-Apostu, A.M.; Chesneanu, D.; Gomoiu, M.C; Mitrica, B.; Margineanu, R.M.; Stanca, D.L.; Colino, N.; Gil-Botella, I.; Novella, P.; Palomares, C.; Santorelli, R.; Verdugo, A.; Karpikov, I.; Khotjantsev, A.; Kudenko, Y.; Mefodiev, A.; Mineev, O.; Ovsiannikova, T.; Yershov, N.; Enqvist, T.; Kuusiniemi, P.; De La Taille, C.; Dulucq, F.; Martin-Chassard, G.; Andrieu, B.; Dumarchez, J.; Giganti, C.; Levy, J.-M.; Popov, B.; Robert, A.; Agostino, L.; Buizza-Avanzini, M.; Dawson, J.; Franco, D.; Gorodetzky, P.; Kryn, D.; Patzak, T.; Tonazzo, A.; Vannucci, F.; Bésida, O.; Bolognesi, S.; Delbart, A.; Emery, S.; Galymov, V.; Mazzucato, E.; Vasseur, G.; Zito, M.; Bogomilov, M.; Tsenov, R.; Vankova-Kirilova, G.; Friend, M.; Hasegawa, T.; Nakadaira, T.; Sakashita, K.; Zambelli, L.; Autiero, D.; Caiulo, D.; Chaussard, L.; Déclais, Y.; Franco, D.; Marteau, J.; Pennacchio, E.; Bay, F.; Cantini, C.; Crivelli, P.; Epprecht, L.; Gendotti, A.; Di Luise, S.; Horikawa, S.; Murphy, S.; Nikolics, K.; Periale, L.; Regenfus, C.; Rubbia, A.; Sgalaberna, D.; Viant, T.; Wu, S.; Sergiampietri, F.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2014-01-01

    In June 2012, an Expression of Interest for a long-baseline experiment (LBNO, CERN-SPSC-EOI-007) has been submitted to the CERN SPSC and is presently under review. LBNO considers three types of neutrino detector technologies: a double-phase liquid argon (LAr) TPC and a magnetised iron detector as far detectors. For the near detector, a high-pressure gas TPC embedded in a calorimeter and a magnet is the baseline design. A mandatory milestone in view of any future long baseline experiment is a concrete prototyping effort towards the envisioned large-scale detectors, and an accompanying campaign of measurements aimed at assessing the systematic errors that will be affecting their intended physics programme. Following an encouraging feedback from 108th SPSC on the technology choices, we have defined as priority the construction and operation of a $6\\times 6\\times 6$m$^3$ (active volume) double-phase liquid argon (DLAr) demonstrator, and a parallel development of the technologies necessary for large magnetised MIN...

  12. First operational tests of an oxycoal hot gas cleaning facility; Erste Betriebstests einer Oxycoal-Heissgasreinigung

    Energy Technology Data Exchange (ETDEWEB)

    Kellermann, A.; Habermehl, M.; Foerster, M.; Kneer, R. [RWTH Aachen University (Germany). Lehrstuhl fuer Waerme- und Stoffuebertragung

    2009-07-01

    An oxyfuel power plant process using a ceramic high temperature membrane for oxygen supply is investigated within the scope of the OXYCOAL-AC project at RWTH Aachen Uni-versity. Implementing the membrane requires a clean gas at a temperature of 850 C. There-fore a hot gas cleaning facility based on porous ceramic candle filters is used, which is state-of-the-art for the gas cleaning of synthesis gas or for flue gas cleaning in pressurised fluid-ised bed furnaces. However, these applications operate at lower temperatures and in a sig-nificantly different atmosphere. Thus, experiences for dust removal at high temperatures in oxyfuel atmoshere are not available. Experiments with a hot gas cleaning facility were con-ducted at the experimental combustion plant of the Institute of Heat and Mass Transfer, us-ing different candle filter materials. The flue gas was provided by a coal fired 100 kW{sub th} oxy-fuel furnace. The operational behaviour of the filtration facility, the adhesion and dedusting properties of the filter cake were investigated. (orig.)

  13. NGDS User Centered Design Meeting the Needs of the Geothermal Community

    Energy Technology Data Exchange (ETDEWEB)

    Boyd, Suzanne [Anthro-Tech, Inc; Zheng, Sam [Siemens Corporation; Patten, Kim [Arizona Geological Survey; Blackman, Harold [Boise State University

    2013-10-15

    In order to ensure the widest and greatest utility of IT and software projects designed for geothermal reservoir engineer- ing the full consideration of end users’ task and workflow needs must be evaluated. This paper describes the user-centered design (UCD) approach taken in the development of a user interface (UI) solution for the National Geothermal Data System (NGDS). This development process has been research based, highly collabora- tive, and incorporates state-of-the-art practices to ensure a quality user experience. Work is continuing on the interface, including future usability tests to further refine the interfaces as the overall system is developed.

  14. Mining Specific and General Features in Both Positive and Negative Relevance Feedback. QUT E-Discovery Lab at the TREC󈧍 Relevance Feedback Track

    Science.gov (United States)

    2009-11-01

    relevance feedback algo- rithm. Four methods, εMap [1], MapA , P10A, and StatAP [2], were used in the track to measure the performance of Phase 2 runs...εMap and StatAP were applied to the runs us- ing the testing set of only ClueWeb09 Category-B, whereas MapA and P10A were applied to those using the...whole ClueWeb09 English set. Because our experiments were based on only ClueWeb09 Category-B, measuring our per- formance by MapA and P10A might not

  15. Early bronchodilator action of glycopyrronium versus tiotropium in moderate-to-severe COPD patients: a cross-over blinded randomized study (Symptoms and Pulmonary function in the moRnING

    Directory of Open Access Journals (Sweden)

    Marin JM

    2016-06-01

    Full Text Available Jose M Marin,1 Kai M Beeh,2 Andreas Clemens,3 Walter Castellani,4 Lennart Schaper,5 Dinesh Saralaya,6 Anthony Gunstone,7 Ricard Casamor,8 Konstantinos Kostikas,3 Maryam Aalamian-Mattheis3 1University Hospital Miguel Servet, IISAragón, CIBERES, Zaragoza, Spain; 2Insaf Respiratory Research Institute, Wiesbaden, Germany; 3Novartis Pharma AG, Basel, Switzerland; 4Hospital Piero Palagi, Fiorenze, Italy; 5Research Institute and Practice, Berlin-Brandenburg, Germany; 6Bradford Teaching Hospitals NHS Foundation Trust, Bradford, UK; 7Staploe Medical Center, Soham, Cambridge, UK; 8Novartis Farmaceutica SA, Barcelona, Spain Background: Morning symptoms associated with COPD have a negative impact on patients’ quality of life. Long-acting bronchodilators with rapid onset may relieve patients’ symptoms. In the Symptoms and Pulmonary function in the moRnING study, we prospectively compared the rapid onset bronchodilator profile of glycopyrronium (GLY and tiotropium (TIO during the first few hours after dosing in patients with moderate-to-severe COPD.Methods: Patients were randomized (1:1 to receive either once-daily GLY (50 µg or TIO (18 µg and corresponding placebos in a cross-over design for 28 days. The primary objective was to demonstrate the superiority of GLY versus TIO in area under the curve from 0 to 4 hours (AUC0-4h forced expiratory volume in 1 second (FEV1 after the first dose. The secondary objective was to compare GLY versus TIO using the patient reported outcomes Morning COPD Symptoms Questionnaire 3 hours post-inhalation.Results: One-hundred and twenty-six patients were randomized (male 70.2%; mean age 65.7 years and 108 patients completed the study. On Day 1, GLY resulted in significantly higher FEV1 AUC0-4h after the first dose versus TIO (treatment difference [Δ], 0.030 L, 95% confidence interval 0.004–0.056, P=0.025. Improvements in morning COPD symptoms from baseline at Days 1 and 28 were similar between GLY and TIO. Post hoc

  16. Variations in nearshore processes along Nagapattinam coast, India

    Digital Repository Service at National Institute of Oceanography (India)

    SanilKumar, V.; Anand, N.M.; Gowthaman, R.

    , with an average value of 0.63 m du r ing 1998 ? 99 (Figure 2 a ). The highest wave heights were recorded in November. The mean wav e period predom i - nantly varied from 3 to 8 s, with an average value of 4 s during both periods (Figure 2 b...? during 1995 ? 96 and 98? du r ing 1998 ? 99 (Figure 2 c ). The maximum wave height was 1.65 times the si g nificant wave height, with the wave heights following the Rayl eigh distribution in both periods (Figure 3 a and c ). Even though...

  17. An occurrence of approx. 74 ka Youngest Toba tephra from the western continental margin of India

    Digital Repository Service at National Institute of Oceanography (India)

    Pattan, J.N.; Shane, P.; Pearce, N.J.G.; Banakar, V.K.; Parthiban, G.

    . Navalgund and Dr M. S. Narayanan du r- ing the course of this work. Useful discussions with Dr P. S. Desai and Dr A. Sarkar are also thankfully acknow l edged. Received 28 July 2000; revised accepted 3 January 2001 An occurrence of ~ 7 4 ka.... The occurrence of Y TT in the west, north - west, south - west and recently north - east in the South China Sea Basin 17 , suggests wind direction du r ing YTT was not in one way. YTT occurred between oxygen isotope stage 5a and 4, a period of ice growth...

  18. A liveable city:

    DEFF Research Database (Denmark)

    Sommerlund, Julie

    2014-01-01

    is increas- ingly based in and on cities rather than nations, and cities compete for businesses, branding, tourists and talent. In the western world, urbanisation has happened simultane- ously to de-industrialisation, which has opened industrial neighbourhoods and harbours for new uses – often focus- ing......There are over 20 cities world-wide with a population of over 10 million people. We have entered ‘The Millennium of the City’. The growth of urban populations has been accompanied by profound changes of the cities’ economic and social profile and of the cities themselves. The world economy...

  19. Rüblikud, vedurid ja sild leidsid omaniku / Inge Põlma

    Index Scriptorium Estoniae

    Põlma, Inge

    2009-01-01

    Rapla valla sünnipäeva tähistamiseks korraldatud vastuvõtul Rapla kultuurikeskuses jagati valla auhindu. Rapla valla kultuuriauhinna Valla Vedur pälvisid 35 aastat Kodila näiteringi juhtinud Juta Blande ja Tarmo Rahuoja, kes on üles ehitanud spordiklubi ATO

  20. Riho Pätsi koolimuusika fond tunnustab parimaid / Inge Raudsepp

    Index Scriptorium Estoniae

    Raudsepp, Inge, 1951-

    2015-01-01

    Riho Pätsi Koolimuusika Fond on üks Tallinna Ülikooli fondidest. Tänavused laureaadid on muusikaõpetaja Kadi Härma, klaveripedagoog Liina Jarovaja, helilooja Juhan Trump ning muusikapedagoogika uurija Anu Sepp

  1. Endoparasites of donkeys in Dessie and its surround- ings ...

    African Journals Online (AJOL)

    Between 2014 to April 2015 a total of 504 donkeys brought to Dessie veteri- nary clinic .... Beyene (2005) (50%), but higher than the report of Teka Tegegn et al. .... Urquahart, G. Armour, M., Duncan, J.L., Dunn, A.M. and Jennings, F.W., 1996.

  2. Puesta en valor de algunas construcciones del ing. Salamone

    OpenAIRE

    Traversa, Luis P.; Di Maio, Ángel A; Longoni, René

    2003-01-01

    En Enero del año 2002, la Legislatura bonaerense sancionó la ley n° 12.854, que declaró Patrimonio provincial a la obra pública municipal del ingeniero Francisco Salamone (1898-1959), construída durante el Gobierno de Manuel Fresco (1936-1940). De casi un centenar de construcciones y proyectos realizados dentro de lo que se denominó Plan de Obras Públicas Municipales, en más de 20 localidades pertenecientes a 16 Partidos del interior bonaerense, al menos, una treintena de ellas son signifi...

  3. Mis on õiglane kaubandus? / Riina Kuusik ; interv. Inge Pitsner

    Index Scriptorium Estoniae

    Kuusik, Riina

    2006-01-01

    ETV saate "Tasakaal" tegijad külastasid Nicaraguat ja Costa Ricat, et vaadata, kuidas elavad ja töötavad "õiglase kaubanduse" süsteemi kuuluvad talunikud, õiglase kaubanduse (fairtrade) mõistest

  4. CT and MRI find- ings in Lhermitte- Duclos disease

    African Journals Online (AJOL)

    Kurt

    no gender bias. The clinical manifesta- ... Germany) of the brain was per- formed. ... in the right cerebellar hemisphere. ... right cerebellum with a large temporal horn of left later- al ventricle. ... autosomal-dominant condition with a prevalence of ...

  5. Medicine Wheel Imag(in)ings: Exploring Holistic Curriculum Perspectives

    Science.gov (United States)

    Kind, Sylvia; Irwin, Rita L.; Grauer, Kit; de Cosson, Alex

    2005-01-01

    Education is longing for a deeper more connected, more inclusive, and more aware way of knowing. One that connects heart and hand and head and does not split knowledge into dualities of thought and being, mind and body, emotion and intellect, but resonates with a wholeness and fullness that engages every part of one's being. Engagement with the…

  6. "Seinte vahel" - klišeevaba film koolist / Inge Unt

    Index Scriptorium Estoniae

    Unt, Inge, 1928-

    2009-01-01

    Prantsusmaa 2008. a. mängufilmist "Seinte vahel" ("Entre les murs"), mille stsenarist oma romaani alusel ning peaosa täitja on Francois Begaudeau, režissöör Laurent Cantet. Filmist, mille kaudu saab teada, kuidas toimib meie põhikooli vanemale astmele vastav prantsuse kool

  7. Extra-uterine pregnancy with the bladder COmmunIcatIng

    African Journals Online (AJOL)

    found in the bladder. The left adnexum was normal. A right salpingectomy was performed and the haematoma lining stripped from the bladder to expose the fistula. This was closed with three invaginating 2/0 extrachromic catgut sutures. A de Pezzer cathe- ter was inserted through ~he bladder fundus, a drain was inserted.

  8. Control of aquatic leeches (Lymnatis nilotica) us- ing Phytolacca ...

    African Journals Online (AJOL)

    also caused mortality of tadpoles, frogs and round worms found in streams while it doesn't cause any visible toxicity to .... immature age died of leech infestation. About 50 calves that were watered at .... vary depending on the type of water medium (Getachew Tilahun et al., 2002) and in cases where higher doses are ...

  9. Torm Balti merel / Märt Treier ; interv. Inge Pitsner

    Index Scriptorium Estoniae

    Treier, Märt, 1975-

    2004-01-01

    TV3 näitab saksa poliitilist põnevusfilmi "Balti torm" ("Baltic Storm"), mis kujutab parvlaev "Estonia" hukku : stsenarist, produtsent Jutta Rabe : režissöör Reuben Leder. Filmi eel on teles Märt Treieri saade "Tormist sündinud tormid"

  10. Suurim tunnustus = Decorations worthy of the President / Inge Pitsner

    Index Scriptorium Estoniae

    Pitsner, Inge

    2008-01-01

    Riigikantselei sümboolikanõunik Gert Uiboaed tutvustab presidendi poolt annetatavaid riiklikke teenetemärke. Vt. samas: Huvitava saatusega kett. Eesti Vabariigi Presidendi ametitunnusest - Riigivapi ketiklassi teenetemärgist; Teenetemärgid valmivad Eestis; Mees märkide keskelt = Man among medals. Falerist Aleks Kivinuki märgikogus on väga haruldasi Eesti teenetemärke

  11. Un episodio del pensamiento francés de la autonomía. Benjamin Constant y las idées très ingénieuses

    Directory of Open Access Journals (Sweden)

    Francisco Gelman Constantin

    2014-03-01

    Full Text Available UN EPISODIO DEL PENSAMIENTO FRANCÉS DE LA AUTONOMÍA Benjamin Constant y las idées très ingénieuses   Francisco Gelman Constantin Facultad de Filosofía y Letras, Universidad de Buenos Aires     Abstract – This paper attempts a consideration of the significance of Benjamin Constant’s aesthetic thoughts within the context of the history of the concept of “aesthetic autonomy”. With that in mind it reevaluates his transformation of the German tradition, by way of its binding to the social theory corresponding to the cultural and historical analysis of early French Romanticism. Taking the coinage of the expression “art for art’s sake” as a starting point, this paper reconstructs the whole of Constant’s thought-system, as well as its exchanges with some of his contemporaries –namely Mme. de Staël and Henry Crabb Robinson– in the means of understanding the proper reach of the conceptual novelties brought in by him, as can be seen from the standing point of Begriffsgeschichte. The paper deals not only with his postulates referring specifically to a negative relationship towards the mercantile society, but also with the analogies he establishes between art, love, religion and morality, while it furthermore examines his theory of social autonomy. The reflexive setting together of this different elements, assembled from his political essays, his journals, the novel Adolphe and other writings, brings to the light a general form of a thought of the autonomous, which explains the manner in which Constant understands aesthetic autonomy in particular, by way of his collaboration and dissent with his European colleagues.   Keywords: autonomy; Constant; art for art’s sake; Begriffsgeschichte; religion     Resumen – Este trabajo se propone reconsiderar la importancia de las reflexiones estéticas de Benjamin Constant en el contexto de la historia del concepto de autonomía estética. Para ello reevalúa las transformaciones

  12. Marking of verb tense in the English of preschool English-Mandarin bilingual children: evidence from language development profiles within subgroups on the Singapore English Action Picture Test.

    Science.gov (United States)

    Brebner, Chris; McCormack, Paul; Liow, Susan Rickard

    2016-01-01

    The phonological and morphosyntactic structures of English and Mandarin contrast maximally and an increasing number of bilinguals speak these two languages. Speech and language therapists need to understand bilingual development for children speaking these languages in order reliably to assess and provide intervention for this population. To examine the marking of verb tense in the English of two groups of bilingual pre-schoolers learning these languages in a multilingual setting where the main educational language is English. The main research question addressed was: are there differences in the rate and pattern of acquisition of verb-tense marking for English-language 1 children compared with Mandarin-language 1 children? Spoken language samples in English from 481 English-Mandarin bilingual children were elicited using a 10-item action picture test and analysed for each child's use of verb tense markers: present progressive '-ing', regular past tense '-ed', third-person singular '-s', and irregular past tense and irregular past-participle forms. For 4-6 year olds the use of inflectional markers by the different language dominance groups was compared statistically using non-parametric tests. This study provides further evidence that bilingual language development is not the same as monolingual language development. The results show that there are very different rates and patterns of verb-tense marking in English for English-language 1 and Mandarin-language 1 children. Furthermore, they show that bilingual language development in English in Singapore is not the same as monolingual language development in English, and that there are differences in development depending on language dominance. Valid and reliable assessment of bilingual children's language skills needs to consider the characteristics of all languages spoken, obtaining accurate information on language use over time and accurately establishing language dominance is essential in order to make a

  13. ORF Alignment: NC_003071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ING ... finger) family protein [Arabidopsis thaliana] ... Length = 48 ... Query: 108 CSVCLSEFEEEDEGRLLPKCGHSFHVDC...IDTWFRSRSTCPLCRAPVQP 155 ... CSVCLSEFEEEDEGRLLPKCGHSFHVDCIDTWFRSRSTCPLCRAPVQP Sbjct: 1 ... CSVCLSEFEEEDEGRLLPKCGHSFHVDCIDTWFRSRSTCPLCRAPVQP 48

  14. Pulse compressor with aberration correction

    Energy Technology Data Exchange (ETDEWEB)

    Mankos, Marian [Electron Optica, Inc., Palo Alto, CA (United States)

    2015-11-30

    In this SBIR project, Electron Optica, Inc. (EOI) is developing an electron mirror-based pulse compressor attachment to new and retrofitted dynamic transmission electron microscopes (DTEMs) and ultrafast electron diffraction (UED) cameras for improving the temporal resolution of these instruments from the characteristic range of a few picoseconds to a few nanoseconds and beyond, into the sub-100 femtosecond range. The improvement will enable electron microscopes and diffraction cameras to better resolve the dynamics of reactions in the areas of solid state physics, chemistry, and biology. EOI’s pulse compressor technology utilizes the combination of electron mirror optics and a magnetic beam separator to compress the electron pulse. The design exploits the symmetry inherent in reversing the electron trajectory in the mirror in order to compress the temporally broadened beam. This system also simultaneously corrects the chromatic and spherical aberration of the objective lens for improved spatial resolution. This correction will be found valuable as the source size is reduced with laser-triggered point source emitters. With such emitters, it might be possible to significantly reduce the illuminated area and carry out ultrafast diffraction experiments from small regions of the sample, e.g. from individual grains or nanoparticles. During phase I, EOI drafted a set of candidate pulse compressor architectures and evaluated the trade-offs between temporal resolution and electron bunch size to achieve the optimum design for two particular applications with market potential: increasing the temporal and spatial resolution of UEDs, and increasing the temporal and spatial resolution of DTEMs. Specialized software packages that have been developed by MEBS, Ltd. were used to calculate the electron optical properties of the key pulse compressor components: namely, the magnetic prism, the electron mirror, and the electron lenses. In the final step, these results were folded

  15. Detorsion night-time bracing for the treatment of early onset idiopathic scoliosis.

    Science.gov (United States)

    Moreau, S; Lonjon, G; Mazda, K; Ilharreborde, B

    2014-12-01

    Management for early onset scoliosis has recently changed, with the development of new surgical procedures. However, multiple surgeries are often required and high complication rates are still reported. Conservative management remains an alternative, serial casting achieving excellent results in young children. Better compliance and improvement over natural history have been reported with night-time bracing in adolescent idiopathic scoliosis (AIS), but this treatment has never been reported in early onset idiopathic scoliosis (EIOS). All patients treated for progressive EOIS by detorsion night-time bracing (DNB), and meeting the Scoliosis Research Society (SRS) criteria for brace studies were reviewed. Recommendations were given to wear the DNB 8h/night and no restriction was given regarding sports activities. Radiological parameters were compared between referral and latest follow-up. Based on the SRS criteria defined for AIS, a similar classification was used as follows to analyze the course of the curves: success group: patients with a progression of 5° or less; unsuccess group (progression or failure): patients with a progression>5°, patients with curves exceeding 45° at maturity, or who have had recommendation for/undergone surgery, or patients who changed orthopaedic treatment, or who were lost to follow-up. Thirty-three patients were included (21 girls and 12 boys), with a median Cobb angle of 31° (Q1-Q3: 22-40). Age at brace initiation averaged 50months (Q1-Q3: 25-60). Median follow-up was 102-months (Q1-Q3: 63-125). Fifteen patients (45.5%) had reached skeletal maturity at last follow-up. The success rate was 67% (22 patients), with a median Cobb angle reduction of 15° (P<0.001). Four patients stopped DNB due to an important regression. Eleven patients were in the unsuccessful group (33%). Only one had surgery. All patients remained balanced in the frontal plane and normokyphotic. Initial curve magnitude and age at brace initiation appeared to be

  16. Relationship between the mechanisms of gamma rhythm generation and the magnitude of the macroscopic phase response function in a population of excitatory and inhibitory modified quadratic integrate-and-fire neurons

    Science.gov (United States)

    Akao, Akihiko; Ogawa, Yutaro; Jimbo, Yasuhiko; Ermentrout, G. Bard; Kotani, Kiyoshi

    2018-01-01

    Gamma oscillations are thought to play an important role in brain function. Interneuron gamma (ING) and pyramidal interneuron gamma (PING) mechanisms have been proposed as generation mechanisms for these oscillations. However, the relation between the generation mechanisms and the dynamical properties of the gamma oscillation are still unclear. Among the dynamical properties of the gamma oscillation, the phase response function (PRF) is important because it encodes the response of the oscillation to inputs. Recently, the PRF for an inhibitory population of modified theta neurons that generate an ING rhythm was computed by the adjoint method applied to the associated Fokker-Planck equation (FPE) for the model. The modified theta model incorporates conductance-based synapses as well as the voltage and current dynamics. Here, we extended this previous work by creating an excitatory-inhibitory (E-I) network using the modified theta model and described the population dynamics with the corresponding FPE. We conducted a bifurcation analysis of the FPE to find parameter regions which generate gamma oscillations. In order to label the oscillatory parameter regions by their generation mechanisms, we defined ING- and PING-type gamma oscillation in a mathematically plausible way based on the driver of the inhibitory population. We labeled the oscillatory parameter regions by these generation mechanisms and derived PRFs via the adjoint method on the FPE in order to investigate the differences in the responses of each type of oscillation to inputs. PRFs for PING and ING mechanisms are derived and compared. We found the amplitude of the PRF for the excitatory population is larger in the PING case than in the ING case. Finally, the E-I population of the modified theta neuron enabled us to analyze the PRFs of PING-type gamma oscillation and the entrainment ability of E and I populations. We found a parameter region in which PRFs of E and I are both purely positive in the case of

  17. Uso de cuatro extractos organicos para el control del pulgon verde (Myzus persicae Sulz (ING

    Directory of Open Access Journals (Sweden)

    Hernán Rodríguez Navas

    2016-03-01

    Full Text Available Extracts of leaves and stems of Neurolaena lobata; leaves, stems and fruits of Momordica charantia, wood of Quassia amara and seeds of Annona muricata, were tested regarding their effectiveness for control of green peach aphid (Myzus persicae. In a first stage, groups of 10 individuals of M. persicae were placed inside petri dishes together with a small and slight piece of synthetic cloth soaked with either substance extracted. Several concentrations were used. After two hours; more than 50% of the individuals had been killed in every petri dish, which allowed all extracts to pass on to the second stage. The second stage consisted of two experiments. The first one was done in spring at a greenhouse day temperature of 10°C,  using only the first three substances, each of them diluted 1:100. The second one was conducted in Summer at about 25°C with the four substances. Distilled water acted as a control in both experiments. Tobacco plants (Nicotiana tabacum infested with M. persicae were sprayed with the solutions and survivors counted 24 and 72 hours later. In the first experiment Q amara  and M. charantia had 78% and 77% effectiveness respectively, which were statiscally (P< 0.05 higher than that of N. lobata  (63%. In the second experiment, because of the warmer weather, they improved their performance, specially N. lobata (98%. This and A. muricata were found statistically (P< 0.05 higher than the others.

  18. Teacher’s Generosity as the Counteraction to the Young People’s Hardening Pedagogic

    Directory of Open Access Journals (Sweden)

    O. B. Akimova

    2012-01-01

    Full Text Available The paper analyzes the growing tendency for young people’s harden- ing. According to the authors that phenomenon is caused by such current trends as the language degradation, the militaristic and alienation vocabulary predominance re- sulting in disdainful attitude towards the surrounding people. As a pedagogic counter- action to such trends, the authors consider the revival of the forgotten domestic moral values in educational sphere. Their objective is to contemplate the necessity of enrich- ing the educational institutions by means of the national moral and cultural potential.The research methodology basis is defined as the axiology principle substantiat- ing the humanistic importance of the specifics of teachers’ vocabulary. To demonstrate the advantages of the humanistic vocabulary educational potential the authors com- pare the specifics of such notions as generosity and tolerance. They prove that the teacher’s tolerant attitude to students deforms both the pedagogic theory and educa- tional practice. In contrast, the generous attitude favors the student’s, as well as teacher’s moral development. The process of the youth refinement can be facilitated by the large-scale revival of half-forgotten national humanistic values and the vocabulary reflecting such values. 

  19. Diagnostic System Commissioning of the EMMA NS-FFAG Facility at Daresbury Laboratory

    CERN Document Server

    Kalinin, A

    2010-01-01

    We pre­sent pre­lim­i­nary re­sults of beam di­ag­nos­tics for the world's first Non-Scal­ing FFAG Ac­cel­er­a­tor 'EMMA'. Amongst other means, a sin­gle-shot/turn-by-turn BPM sys­tem is used, that was first test­ed on the ALICE in­jec­tor. The BPM sys­tem uti­lizes a front-end con­ver­sion of but­ton pick­up sig­nals into flat-top-en­ve­lope 700 MHz bursts, time-do­main mul­ti­plex­ing (in each plane, sig­nals are made spaced by 13.8 ns), and the man­u­fac­ture of both syn­chronous de­tec­tor and ADC clocks di­rect­ly from the beam sig­nal. The sys­tem per­for­mance is dis­cussed; re­sults of beam-based res­o­lu­tion mea­sure­ment are given. First turn beam tra­jec­to­ries fur­thest from the Sep­tum and Kick­er are pre­sent­ed.

  20. Long-range forecast of monthly rainfall over India during summer monsoon season using SST in the north Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Sadhuram, Y.

    only SS T. Utilizing the rainfall data of Pa r tha - sarathy et al. 6 and SSTA data (5 ? 5 d e- gree grids) of Kaplan et al. 8 , it is found that the SSTA over the AS du r ing winter (DJF ? 1/0 year) in the region 15 ? 20 ?N; 60 ? 70 ?E... and b ). The corr e lations are almost zero du r ing April and May, which is not shown. SSTA during fall in the CEIO is strongly and positively corr e lated with the seasonal and monthly rai n fall. It is w eak during other months (Figure 1 c...

  1. The Role of Grammar Instruction in Language Teaching

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    @@ The role of grammar instruction in foreign or second language acquisition is one of the most con troversial issues in foreign/second language teach ing and learning research. The advocators of gram mar instruction argue that grammar should be the core of language instruction and formal instruction enhances formal accuracy. On the other hand, crit ics naintain that the grammar knowledge has lim ited uses and may hinder the students from acquir ing the communicative competence and efficiency. Undoubtedly these two extreme theories often put teachers into a dilemma. What theory should they believe then? Do they accept the one and ignore the other?

  2. Le facteur humain. Réinventer notre rapport à la technologie de Vicente

    Directory of Open Access Journals (Sweden)

    Jacques Leplat

    2005-11-01

    Full Text Available Kim Vicente est connu du milieu ergonomique pour son très bon ouvrage « Cognitive work analysis » qui manifeste à la fois son expertise et son talent pédagogique. Ingénieur de formation, il a enseigné ensuite à l’université en tant que « professeur en ingénierie des facteurs humains ». Professeur invité au MIT et conseiller à la NASA, il est l’auteur de nombreuses publications de recherche qu’on rangerait dans l’ergonomie cognitive. Le présent ouvrage, qu’il a publié en anglais en 2003, est d...

  3. Intelligence Artificielle, ontologies et connaissances en médecine. Les limites de la mécanisation de la pensée

    OpenAIRE

    Declerck , Gunnar; Charlet , Jean

    2011-01-01

    National audience; Cet article de tonalité théorique vise à dresser un état des lieux des dernières avancées en ingénierie des connaissances médicales dans le domaine spécifique de la conception d'ontologies et systèmes à base de connaissances. Reprenant des débats ayant animé le paysage de l'intelligence artificielle (IA) à partir des années 1960, sous l'impulsion des travaux de H. L. Dreyfus, il vise notamment à montrer que la plupart des difficultés aujourd'hui rencontrées par l'ingénierie...

  4. Flexural Strength of Acrylic Resin Denture Bases Processed by Two Different Methods

    Directory of Open Access Journals (Sweden)

    Jafar Gharechahi

    2014-09-01

    Full Text Available Background and aims. The aim of this study was to compare flexural strength of specimens processed by conventional and injection-molding techniques. Materials and methods. Conventional pressure-packed PMMA was used for conventional pressure-packed and injection-molded PMMA was used for injection-molding techniques. After processing, 15 specimens were stored in distilled water at room temperature until measured. Three-point flexural strength test was carried out. Statistical analysis was carried out by SPSS using t-test. Statistical significance was defined at P<0.05. Results. Flexural strength of injection-polymerized acrylic resin specimens was higher than that of theconventional method (P=0.006. This difference was statistically significant (P=0.006. Conclusion. Within the limitations of this study, flexural strength of acrylic resin specimens was influenced by the mold-ing technique.

  5. DETERMINATION OF HYDRODYNAMIC CHARACTERISTICS OF A RADIO-CONTROLLED AIRPLANE MODEL WITH AIR CUSHION LANDING GEAR

    Directory of Open Access Journals (Sweden)

    2016-01-01

    Full Text Available This article presents the results of the hydrodynamic parameters of radio-controlled models (RCM of the aircraft with the landing gear on an air cushion (REFERENCED obtained during tests in the water tank of TSAGI NIMC on land- ing modes with varying alignment and pressure in air cushion chassis on calm and disturbed water surfaces.ACLG’s RCM is based on the Froude criterion. The experimental data of the real aircraft Dingo, LMS, An-26, C-130 Hercules (size, weight, thrust parameters were processed. Tests were carried out, using the standard testbed, utiliz- ing the dynamically-corresponding models in the water tank. Drag best value rate while travelling along the smooth water was reached at the rear centering, with balloon pressure on the water of 700 Pa. In this case, the hump drag, at velocity of 2 mps, does not exceed 29 Newtons (hydrodynamic fineness on the ‘drag hump’ is, Кг=13,5, while at velocity of 10 mps, the drag is 30 Newtons, at Кг =13.The most unfavourable mode of motion is the one with configuration of lowered pressure in the balloons (400 Pa.In these cases, the Кг = 6,5. At motion with yaw angle of 10º, the drag rate meaning practically stands stable (Кг = 13,1, while at 20º it grows (Кг = 10,6.At motion along the waved surface, the critical wave length equals to two thirds of the ACU, while drag raises by the quarter, compared to other wave types. Such vehicles can be used in the hard-to-reach regions of the Russian Federation.

  6. A Dialogue on Time

    DEFF Research Database (Denmark)

    Kofod, Julie Lundbak

    This master thesis examines the distinction between tense logic and first order logic concerning time. In particular it studies whether this distinction exists in physics or not. Firstly a general test is made: translating sentences concern- ing time from physics into the two logics. The results...... here are inconclusive, as it is possible for both logics to represent the sen- tences, so this experiment does not reveal a similar distinction in physics. However this test also reveals some properties of the logics: tense logic holds a local view on time while first order logic holds a global view...... logic and reversibility in physics and tense logic and irreversibility in physics. Through this study it is concluded that it is not possible to see this correspondence with the tested property; time symmetry, since symmetry seems to concern the underlying structures, not the logic itself. It is...

  7. Leg 179 summary

    Digital Repository Service at National Institute of Oceanography (India)

    Pettigrew, T.J.; Casey, J.F.; Miller, D.J.; Araki, E.; Boissonnas, R.; Busby, R.; Einaudi, F.; Gerdom, M.; Guo, Z.P.; Hopkins, H.; Myers, G.; Rao, D.G.; Shibata, T.; Thy, P.

    and the bit was set aside. We then modified a third bit by welding the concentric arms closed. This bit was tripped to the seafloor and we initiated Hole 1104E. After ~1 hr, we had made ~1.5 m of penetration, but the bit stuck in the hole. We were able to free... the bit with left-hand rotation, indicating that the arms had broken free and were causing the bit to stick. Having exhausted all the bits we had on board for hammer test- ing, and with the promise of delivery of a different bit design in a few days from a...

  8. To Capture Dynamic Shop Floor Knowledge in Global Production Networks

    DEFF Research Database (Denmark)

    Madsen, Erik Skov; Riis, Jens Ove; Sørensen, Brian Vejrum

    2007-01-01

    ­ing of the jobs to be transferred and has led to a changed focus for training new workers. Secondly, the paper will address how to capture the knowl­edge associated with carrying out these jobs. And third, planning the trans­fer process will be discussed to form a basis for future continuous improve...... industrial companies with plans to transfer production units to an­other location, this paper addresses  the initial steps of pursuing this issue by presenting and testing a model for identification of the activities, task and  knowledge on the shop floor jobs. This has provided a broader understand...

  9. MODELLING OF THE EMMA NS-FFAG INJECTION LINE USING GPT

    CERN Document Server

    D’Arcy, R T P; Muratori, B D; Jones, J

    2010-01-01

    EMMA (Elec­tron Ma­chine with Many Ap­pli­ca­tions) is a pro­to­type non-scal­ing Fixed Field Al­ter­nat­ing Gra­di­ent (NS-FFAG) ac­cel­er­a­tor present­ly under con­struc­tion at Dares­bury Lab­o­ra­to­ry, UK. The en­er­gy re­cov­ery linac ALICE will serve as an in­jec­tor for EMMA with­in the en­er­gy range of 10 to 20 MeV. The in­jec­tion line con­sists of a sym­met­ric 30° dog­leg to ex­tract the beam from ALICE, a match­ing sec­tion and a to­mog­ra­phy sec­tion for trans­verse emit­tance mea­sure­ments. This is fol­lowed by a trans­port sec­tion to the in­jec­tion point of the EMMA ring. Com­mis­sion­ing of the EMMA in­jec­tion line start­ed in early 2010. A num­ber of dif­fer­ent in­jec­tion en­er­gy and bunch charge regimes are planned; for some of the regimes the ef­fects of space charge will be sig­nif­i­cant. It is there­fore nec­es­sary to model the elec­tron beam trans­port in this line using a code ca­pa­ble of both...

  10. Test Review: TestDaF

    Science.gov (United States)

    Norris, John; Drackert, Anastasia

    2018-01-01

    The Test of German as a Foreign Language (TestDaF) plays a critical role as a standardized test of German language proficiency. Developed and administered by the Society for Academic Study Preparation and Test Development (g.a.s.t.), TestDaF was launched in 2001 and has experienced persistent annual growth, with more than 44,000 test takers in…

  11. High-Assurance Software: LDRD Report.

    Energy Technology Data Exchange (ETDEWEB)

    Hulette, Geoffrey Compton

    2014-06-01

    This report summarizes our work on methods for developing high-assurance digital systems. We present an approach for understanding and evaluating trust issues in digital systems, and for us- ing computer-checked proofs as a means for realizing this approach. We describe the theoretical background for programming with proofs based on the Curry-Howard correspondence, connect- ing the field of logic and proof theory to programs. We then describe a series of case studies, intended to demonstrate how this approach might be adopted in practice. In particular, our stud- ies elucidate some of the challenges that arise with this style of certified programming, including induction principles, generic programming, termination requirements, and reasoning over infinite state spaces.

  12. Effect of Variant End of Injection Period on Combustion Process of Biodiesel Combustion

    Directory of Open Access Journals (Sweden)

    Khalid Amir

    2016-01-01

    Full Text Available Biodiesel is an alternative fuel as a replacement to the standard diesel fuel in combustion diesel engine. The biodiesel fuel has a significantly influences throughout the combustion process and exhaust emission. The purpose of this research is to investigate the combustion process behavior during the End of Injection (EOI period and operates under variant conditions using Rapid Compression Machine (RCM. Experimental of RCM is used to simulate a combustion process and combustion characteristics of diesel engine combustion. Three types of biodiesel blend which are B5, B10 and B15 were tested at several injection pressures of 80 MPa, 90 MPa and 130 MPa under different ambient temperatures, 750 K to 1100 K. The results of this study showed that the ignition delay slightly reduced with increasing the content of biodiesel blends from B5, B10 and B15 and became more shorten as the injection pressure been enhanced. As the injection pressure increased, the behavior of combustion pressure at end of injection is reduced, radically increased the NOX emission. It is noted that the process of combustion at the end of injection increased as the ambient temperature is rising. In fact, higher initial ambient temperature improved the fuel atomization and mixing process. Under the biodiesel combustion with higher ambient temperature condition, the exhaust emission of CO, O2, and HC became less but increased in NOX emission. Besides, increased in blends of biodiesel ratio are found to enhance the combustion process, resulted a decreased in HC emissions.

  13. Single Sign-on Authentication server (part of CLARIN infrastructure)

    NARCIS (Netherlands)

    de Jong, H.A.; Maas, M.

    2013-01-01

    The Huygens Single Sign-on server allows federated logins (authentication) via SURFconext affiliates thus facilitating all connected (academic / research) institutes to use online Huygens ING software services.

  14. Comparative histology in the liver and spleen of three species of freshwater teleost

    Directory of Open Access Journals (Sweden)

    Camila F. Sales

    2017-03-01

    Full Text Available ABSTRACT We describe and compare the histology of liver and spleen ofGeophagus brasiliensis (Perciformes, Hypostomus francisci (Siluriformes and Hoplias aff. malabaricus (Characiformes, tropical freshwater fishes. InG. brasiliensisandH. aff. malabaricusthe hepatocytes were arranged in tubular form whereas in H. franciscithey cord-like. In all species, hepatocytes presented glycogen, but in G. brasiliensis and H. aff. malabaricus they showed strong stained for hemossiderin in the cytoplasm. InG. brasiliensis and H. aff. malabaricus, melanomacrophage centres (MMCs were associated to hepatic structures and only in G. brasiliensis was observed intrahepatic exocrine pancreas. The spleen, in all species, was characterized by red and white pulp without boundary between the two regions, but only in H. francisci was recorded nodular organization in splenic parenchyma. The G. brasiliensisandH. aff. malabaricuspresented in the white pulp MMCs linked mainly to ellipsoids. Besides, we observed large MMCs in the spleen in relation to liver of G. brasiliensis and H. aff. malabaricus. In liver, highest values of reticular fibers and collagen were observed inG. brasiliensis. In spleen, highest values of reticular fibers and collagen were recorded inH. aff. malabaricusandH. francisci, respectively. Histological differences confirm the hypothesis that the phylogenetic distance is reflected in liver and spleen.

  15. MANAGEMENT BOARD OF 20 NOVEMBER 06 (MB99)

    CERN Multimedia

    Low Voltage/SLHC All Low Voltage Power supply orders have now been placed and the issue is prioritising the deliveries, both within CMS and across all LHC detectors. An LHC-wide schedule has been agreed for November-January 2007 and those for further periods will be negotiated. The first agreed cross-detector model was pro-rata sharing of the production based on the total number required. Monthly meetings with CAEN continue and steps are being taken to increase the delivery rate. A draft delivery schedule to CMS sub-detectors is available, but that for the Muon systems should be reviewed and priorities decided. Commissioning the Uninterruptible Power Supplies will start on December 15th and power to the underground systems at point 5 will be delivered in March 2007. It has been agreed to hold an SLHC Workshop jointly with ATLAS on March 19-21 2007 at CERN. Comments on the SLHC EOI before the December CMS Week are still welcome. ESRs for the ECAL Selective Readout Processor and the Global Calorimeter Trigge...

  16. Neutrinos from Stored Muons nuSTORM: Expression of Interest

    CERN Document Server

    Adey, D.; Ankenbrandt, C.M.; Asfandiyarov, R.; Back, J.J.; Barker, G.; Baussan, E.; Bayes, R.; Bhadra, S.; Blackmore, V.; Blondel, A.; Bogacz, S.A.; Booth, C.; Boyd, S.B.; Bravar, A.; Brice, S.J.; Bross, A.D.; Cadoux, F.; Cease, H.; Cervera, A.; Cobb, J.; Colling, D.; Coney, L.; Dobbs, A.; Dobson, J.; Donini, A.; Dornan, P.J.; Dracos, M.; Dufour, F.; Edgecock, R.; Evans, J.; Geelhoed, M.; George, M.A.; Ghosh, T.; de Gouvea, A.; Gomez-Cadenas, J.J.; Haesler, A.; Hanson, G.; Harrison, P.F.; Hartz, M.; Hernandez, P.; Hernando-Morata, J.A.; Hodgson, P.J.; Huber, P.; Izmaylov, A.; Karadhzov, Y.; Kobilarcik, T.; Kopp, J.; Kormos, L.; Korzenev, A.; Kurup, A.; Kuno, Y.; Kyberd, P.; Lagrange, J.B.; Laing, A.M.; Link, J.; Liu, A.; Long, K.R.; McCauley, N.; McDonald, K.T.; Mahn, K.; Martin, C.; Martin, J.; Mena, O.; Mishra, S.R.; Mokhov, N.; Morfin, J.; Mori, Y.; Murray, W.; Neuffer, D.; Nichol, R.; Noah, E.; Palmer, M.A.; Parke, S.; Pascoli, S.; Pasternak, J.; Popovic, M.; Ratoff, P.; Ravonel, M.; Rayner, M.; Ricciardi, S.; Rogers, C.; Rubinov, P.; Santos, E.; Sato, A.; Scantamburlo, E.; Sedgbeer, J.K.; Smith, D.R.; Smith, P.J.; Sobczyk, J.T.; Soldner-Rembold, S.; Soler, F.J.P.; Sorel, M.; Stahl, A.; Stanco, L.; Stamoulis, P.; Striganov, S.; Tanaka, H.; Taylor, I.J.; Touramanis, C.; Tunnell, C.D.; Uchida, Y.; Vassilopoulos, N.; Wascko, M.O.; Wilking, M.J.; Weber, A.; Wildner, E.; Winter, W.; Yang, U.K.; CERN. Geneva. SPS and PS Experiments Committee; SPSC

    2013-01-01

    The $ u$STORM facility has been designed to deliver beams of $ u_e$ and $ u_mu$ from the decay of a stored $mu^pm$ beam with a central momentum of 3.8 GeV/c and a momentum spread of 10%. The facility is unique in that it will: serve the future long- and short-baseline neutrino-oscillation programmes by providing definitive measurements of $ u_e N$ and $ u_mu N$ scattering cross sections with percent-level precision; allow searches for sterile neutrinos of exquisite sensitivity to be carried out; and constitute the essential first step in the incremental development of muon accelerators as a powerful new technique for particle physics. Of the world's proton-accelerator laboratories, only CERN and FNAL have the infrastructure required to mount $ u$STORM. In view of the fact that no siting decision has yet been taken, the purpose of this Expression of Interest (EoI) is to request the resources required to: investigate in detail how $ u$STORM could be implemented at CERN; and develop options for decisive European...

  17. Evaluation of parameters of Black Hole, stellar cluster and dark matter distribution from bright star orbits in the Galactic Center

    Science.gov (United States)

    Zakharov, Alexander

    It is well-known that one can evaluate black hole (BH) parameters (including spin) analyz-ing trajectories of stars around BH. A bulk distribution of matter (dark matter (DM)+stellar cluster) inside stellar orbits modifies trajectories of stars, namely, generally there is a apoas-tron shift in direction which opposite to GR one, even now one could put constraints on DM distribution and BH parameters and constraints will more stringent in the future. Therefore, an analyze of bright star trajectories provides a relativistic test in a weak gravitational field approximation, but in the future one can test a strong gravitational field near the BH at the Galactic Center with the same technique due to a rapid progress in observational facilities. References A. Zakharov et al., Phys. Rev. D76, 062001 (2007). A.F. Zakharov et al., Space Sci. Rev. 148, 301313(2009).

  18. Lennart Meri lennujaamas tunned end koduselt / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2009-01-01

    Tallinna lennujaama reisiterminali laiendusest. Eskiislahendused on loonud Jean-Marie Bonnard Prantsuse firmast Sofreavia SA. Põhiosa arhitektuursest lahendusest koostas Inge Põder arhitektuuri- ja projekteerimisbüroost EA Reng AS

  19. Õpetajakoolituse ümarlaud / Inge Timoštšuk

    Index Scriptorium Estoniae

    Timoštšuk, Inge

    2001-01-01

    TPÜ algatusel kutsuti ümarlauaarutelule kokku Eesti õpetajaid koolitavate kõrgkoolide esindajad eesmärgiga arutada õpetajakoolituse aktuaalseid päevaprobleeme. Esimene kohtumine toimus 20. apr. TPÜs ja oli pühendatud õpetajakoolituse õppekavade arendamise küsimustele Bologna deklaratsiooni valguses. Osalesid haridusministeeriumi, Eesti Kunstiakadeemia, Eesti Muusikaakadeemia, Eesti Põllumajandusülikooli, Tallinna Haridusameti, Tallinna Pedagoogilise Seminari, Tartu Ülikooli, Tallinna Pedagoogikaülikooli, TPÜ Haapsalu kolledži ja Rakvere kolledži esindajad. Teine õpetajakoolituse ümarlaud oli pühendatud pedagoogilise praktika ja stažööriaasta probleemidele ning mentorõpetaja rollile, toimus 11. mail TÜ-s. Kolmas kohtumine toimub 31. mail EMA-s arutamaks haridustöötajate täienduskoolitusega seonduvat

  20. Õpetajakoolituse ümarlaud / Inge Timoštšuk

    Index Scriptorium Estoniae

    Timoštšuk, Inge, 1970-

    2001-01-01

    Tallinna Pedagoogikaülikooli algatusel kutsuti kokku Eesti õpetajaid koolitavate kõrgkoolide ümarlaud, et hakata regulaarselt arutama õpetajakoolituse päevaprobleeme. Esimesel kohtumisel 20. aprillil käsitleti õpetajakoolituse õppekavade arendamist Bologna deklaratsiooni valguses. Osalesid haridusministeeriumi, Eesti Kunstiakadeemia, Eesti Muusikaakadeemia, Eesti Põllumajandusülikooli, Tallinna Haridusameti, Tallinna Pedagoogilise Seminari, Tartu Ülikooli, Tallinna Pedagoogikaülikooli, TPÜ Haapsalu kolledži ja Rakvere kolledži esindajad

  1. Mill in Yin ing mine: developments and new technology application

    International Nuclear Information System (INIS)

    Chen Xiangbiao; Liu Zhicheng

    1999-01-01

    Introduces the developments and new technology application of mill in Yining Mine, concretely evaluates the characters and effects employed three kinds of technological process, and considers that there are many advantages and features in the process No.3. It's technology is integrity, practical and worth recommending

  2. Riho Pätsi Koolimuusika Fond austab uusi laureaate / Inge Raudsepp

    Index Scriptorium Estoniae

    Raudsepp, Inge

    2009-01-01

    4. septembril saavad Riho Pätsi Koolimuusika Fond laureaaditiitli muusikaõpetaja Koidu Ilmjärv, tšellopedagoog Mart Laas, helilooja Mart Siimer, dirigent Jüri-Ruut Kangur, Tallinna Ülikooli muusikaosakonna juhataja Tiina Selke

  3. A Jester's Guide to Creative See[k]ing across Disciplines

    Science.gov (United States)

    Rosen, Diane

    2012-01-01

    For many centuries and in many cultures, jesters recited tales of heroic exploits, but they did more than simply recount past events--they amused, cajoled, and spun tales that transported listeners to the edge of mysterious, unmapped territories. Through the transformative power of play and the imagination, they reworked what was already…

  4. Kaali saladus - pühapäevane maiuspala / Inge Pitsner

    Index Scriptorium Estoniae

    Pitsner, Inge

    2003-01-01

    ETV näitab populaarteaduslikku filmi Kaali meteoriidiplahvatusest "Kaali saladus" : stsenarist ja režissöör Urmas E. Liiv : operaator Ago Ruus : produtsent Riho Västrik : OÜ Vesilind (Eesti) - Vides Filmu Studija (Läti)

  5. MUSE-INGS ON AM1354-250: COLLISIONS, SHOCKS, AND RINGS

    Energy Technology Data Exchange (ETDEWEB)

    Conn, Blair C. [Gemini Observatory, Recinto AURA, Colina El Pino, Casilla 603, La Serena (Chile); Fogarty, L. M. R. [Sydney Institute for Astronomy, School of Physics, The University of Sydney, A28, Sydney, 2006 (Australia); Smith, Rory [Yonsei University, Graduate School of Earth System Sciences-Astronomy-Atmospheric Sciences, Yonsei-ro 50, Seoul 120-749 (Korea, Republic of); Candlish, Graeme N., E-mail: bconn@gemini.edu [Departamento de Astronomía, Universidad de Concepción, Casilla 160-C, Concepción (Chile)

    2016-03-10

    We present Multi Unit Spectroscopic Explorer observations of AM1354-250, confirming its status as a collisional ring galaxy that has recently undergone an interaction, creating its distinctive shape. We analyze the stellar and gaseous emission throughout the galaxy finding direct evidence that the gaseous ring is expanding with a velocity of ∼70 km s{sup −1} and that star formation is occurring primarily in H ii regions associated with the ring. This star formation activity is likely triggered by this interaction. We find evidence for several excitation mechanisms in the gas, including emission consistent with shocked gas in the expanding ring and a region of LINER-like emission in the central core of the galaxy. Evidence of kinematic disturbance in both the stars and gas, possibly also triggered by the interaction, can be seen in all of the velocity maps. The ring galaxy retains a weak spiral structure, strongly suggesting the progenitor galaxy was a massive spiral prior to the collision with its companion an estimated 140 ± 12 Myr ago.

  6. Urmas Sõõrumaa avas Kohilas näituse / Inge Põlma

    Index Scriptorium Estoniae

    Põlma, Inge

    2009-01-01

    Näitus Urmas Sõõrumaa kunstikogust pärit Eestimaaga seotud 19. sajandi kunstnike - Lorenz-Heinrich Petersen, Wilhelm Siegfried Stavenhagen, Eugen Gustav Dücker - graafikast, akvarellidest ja maalidest Kohila vallamajas 21. aprillist 22. juunini. Kuraator Marion Tupits

  7. Health music(k)ing - Music therapy or Music and health?

    DEFF Research Database (Denmark)

    Bonde, Lars Ole

    2011-01-01

    The field of music therapy is expanding rapidly into new areas, practices and interdisciplinary fields, as well as redefining its goals and values. Increasingly "music and health" is used to describe the field when it comes to naming new training programs, new interdisciplinary fields of theory...... by Ken Wilber and Gary Ansdell, is presented and illustrated by empirical examples and references from the literature. Metatheoretical reflections include the relevance of interpersonal or relational psychology and vitality dynamics for the theory and practice of health musicing....

  8. postoperative nausea and vomiting in korle bu teach- ing hospital

    African Journals Online (AJOL)

    DOfori-Adjei

    2007-12-01

    Dec 1, 2007 ... SUMMARY. Objective: Postoperative nausea and vomiting (PONV) is one of the most distressing morbidities associated with surgery. Even though the incidence can be as high as 30% elsewhere no work has been done to assess the incidence in any health facility in Ghana. This study was carried out to ...

  9. Jumal tänatud, et sa siin oled! / Inge Pitsner

    Index Scriptorium Estoniae

    Pitsner, Inge

    2007-01-01

    Kanal 2 sketshishõude sarja "Jumal tänatud, et sa siin oled!" esimesest saatest : saatejuht Andrus Vaarik : osalejad Peeter Oja, Anu Saagim, Juhan Ulfsak, Mihkel Raud : kohtunik Eino Baskin : tootjafirma Ruut

  10. modelling and simulation of the batch hydrolysis of acetic ing

    African Journals Online (AJOL)

    eobe

    The kinetic modelling of the batch synthesis of acetic acid from acetic. The kinetic modelling of ... integral method of analysis to determine the kinetic parameters .... Equation (5) is applied to all the components ... In common chemical engineering terminology, the degree of ..... of Physical Organic Chemistry, Vol. 25, Number ...

  11. Bayesian Framework Approach for Prognostic Studies in Electrolytic Capacitor under Thermal Overstress Conditions

    Data.gov (United States)

    National Aeronautics and Space Administration — Electrolytic capacitors are used in several applications rang- ing from power supplies for safety critical avionics equipment to power drivers for electro-mechanical...

  12. Towards A Model-Based Prognostics Methodology For Electrolytic Capacitors: A Case Study Based On Electrical Overstress Accelerated Aging

    Data.gov (United States)

    National Aeronautics and Space Administration — This paper presents a model-driven methodology for predict- ing the remaining useful life of electrolytic capacitors. This methodology adopts a Kalman filter...

  13. Physics Based Electrolytic Capacitor Degradation Models for Prognostic Studies under Thermal Overstress

    Data.gov (United States)

    National Aeronautics and Space Administration — Electrolytic capacitors are used in several applications rang- ing from power supplies on safety critical avionics equipment to power drivers for electro-mechanical...

  14. ASSESSMENT OF LONG TRANSMISSION AND DIS SESSMENT ...

    African Journals Online (AJOL)

    eobe

    cost (AIC) methodology and marginal incremental ... ing, distribution planning, power system economics, long run marginal costing .... and distribution); gas transmission, water supply and ..... future decision making on possible investments.

  15. Estonian mills are going to live again : there are twice as many mills in Estonia as there are manors, but most of them are in ruins / Urmas Vahe

    Index Scriptorium Estoniae

    Vahe, Urmas

    2002-01-01

    Veskite ja hüdroelektrijaamade rajamise ajaloost, taastamisest ning kasutamisest tänapäeval. Alternatiivsed elektrijaamad kui keskkonna osa. Tabel: Eesti hüdroelektrijaamad, 2002. Kommenteerinud Inge Roos

  16. Intellektuaalne luksus-spaa Van Abbemuseumis / Rael Artel, Airi Triisberg

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2008-01-01

    Eindhovenis Van Abbemuseumis 2007. a. lõpul toimunud kolmenädalasest rahvusvahelisest kohtumisest "Be[com]ing Dutch Caucus". Projekt keskendus rahvusliku identiteedi problemaatikale kaasaegses globaalses ühiskonnas. Esinejatest, ettekannetest

  17. Voronezhi kunstivarade kataloog sai valmis / Siim Randla

    Index Scriptorium Estoniae

    Randla, Siim, 1972-

    2006-01-01

    Ilmub esimene osa Inge Kuke koostatud kataloogist "Dorpat-Jurjev-Tartu ja Voronež: ülikooli kollektsiooni saatus", kus tutvustatakse TÜ kunstivarade kollektsiooni, mis Esimese maailmasõja ajal Voronezhisse viidi

  18. Fourteen additional microsatellite markers for Mussaenda ...

    Indian Academy of Sciences (India)

    1Key Laboratory of Plant Resources Conservation and Sustainable Utilization, South China Botanical Garden, .... ing population genetic differentiation patterns, speciation .... Deng X. F. 2007 Taxonomic revision and phylogenetic analysis.

  19. Documentation of Historical Underground Object in Skorkov Village with Selected Measuring Methods, Data Analysis and Visualization

    Science.gov (United States)

    Dlesk, A.

    2016-06-01

    The author analyzes current methods of 3D documentation of historical tunnels in Skorkov village, which lies at the Jizera river, approximately 30 km away from Prague. The area is known as a former military camp from Thirty Years' War in 17th Century. There is an extensive underground compound with one entrance corridor and two transverse, situated approximately 2 to 5 m under the local development. The object has been partly documented by geodetic polar method, intersection photogrammetry, image-based modelling and laser scanning. Data have been analyzed and methods have been compared. Then the 3D model of object has been created and compound with cadastral data, orthophoto, historical maps and digital surface model which was made by photogrammetric method using remotely piloted aircraft system. Then the measuring has been realized with ground penetrating radar. Data have been analyzed and the result compared with real status. All the data have been combined and visualized into one 3D model. Finally, the discussion about advantages and disadvantages of used measuring methods has been livened up. The tested methodology has been also used for other documentation of historical objects in this area. This project has been created as a part of research at EuroGV. s.r.o. Company lead by Ing. Karel Vach CSc. in cooperation with prof. Dr. Ing. Karel Pavelka from Czech Technical University in Prague and Miloš Gavenda, the renovator.

  20. DOCUMENTATION OF HISTORICAL UNDERGROUND OBJECT IN SKORKOV VILLAGE WITH SELECTED MEASURING METHODS, DATA ANALYSIS AND VISUALIZATION

    Directory of Open Access Journals (Sweden)

    A. Dlesk

    2016-06-01

    Full Text Available The author analyzes current methods of 3D documentation of historical tunnels in Skorkov village, which lies at the Jizera river, approximately 30 km away from Prague. The area is known as a former military camp from Thirty Years’ War in 17th Century. There is an extensive underground compound with one entrance corridor and two transverse, situated approximately 2 to 5 m under the local development. The object has been partly documented by geodetic polar method, intersection photogrammetry, image-based modelling and laser scanning. Data have been analyzed and methods have been compared. Then the 3D model of object has been created and compound with cadastral data, orthophoto, historical maps and digital surface model which was made by photogrammetric method using remotely piloted aircraft system. Then the measuring has been realized with ground penetrating radar. Data have been analyzed and the result compared with real status. All the data have been combined and visualized into one 3D model. Finally, the discussion about advantages and disadvantages of used measuring methods has been livened up. The tested methodology has been also used for other documentation of historical objects in this area. This project has been created as a part of research at EuroGV. s.r.o. Company lead by Ing. Karel Vach CSc. in cooperation with prof. Dr. Ing. Karel Pavelka from Czech Technical University in Prague and Miloš Gavenda, the renovator.

  1. UPTF test 21D counterpart test in the MIDAS test facility

    International Nuclear Information System (INIS)

    Yoon, B. C.; Ah, D. J.; Joo, I. C.; Kwon, T. S.; Park, W. M.; Song, C. H.

    2002-01-01

    This paper describes the experimental results of UPTF Test 21D counterpart tests in the downcomer during the late reflood phase of LBLOCA. The experiments have been performed in the MIDAS test facility using superheated steam and water. The test condition was determined,based on the test results of UPTF Test 21D, by applying the 'modified linear scaling method of 1/4.077 length scale. The tests of ECC direct bypass and void height are performed separately to estimate each phenomena quantitatively. The tests were carried out by varying the injection steam flow rate of intact cold legs widely to investigate the effect of steam flow rate on the direct bypass fraction and void height. In the tests, separate effect tests have been performed in cases of DVI-1,DVI- 2 and DVI-1 and 2 injections to see the direct bypass fraction according to the DVI nozzle combination. From the tests, we found that the fraction of direct ECC bypass and the void height observed in the MIDAS test facility reasonably well agree with those of UPTF test 21- D. It confirms that the applied 'modified linear scaling law' reproduces major thermal hydraulics phenomena in the downcomer during the LBLOCA reflood phase

  2. Test report: Electron-proton spectrometer qualification test unit, qualification test

    Science.gov (United States)

    Vincent, D. L.

    1972-01-01

    Qualification tests of the electron-proton spectrometer test unit are presented. The tests conducted were: (1) functional, (2) thermal/vacuum, (3) electromagnetic interference, (4) acoustic, (5) shock, (6) vibration, and (7) humidity. Results of each type of test are presented in the form of data sheets.

  3. Computer-Based Testing: Test Site Security.

    Science.gov (United States)

    Rosen, Gerald A.

    Computer-based testing places great burdens on all involved parties to ensure test security. A task analysis of test site security might identify the areas of protecting the test, protecting the data, and protecting the environment as essential issues in test security. Protecting the test involves transmission of the examinations, identifying the…

  4. GLOBAL FINANCIAL CRISIS AND UNIT-LINKED INSURANCE MARKETS EFFICIENCY: EMPIRICAL EVIDENCE FROM CENTRAL AND EASTERN EUROPEAN COUNTRIES

    Directory of Open Access Journals (Sweden)

    Botoş Horia Mircea

    2012-12-01

    Full Text Available This paper empirically investigates the impact of the Global financial crisis on the efficiency of four Central and Eastern European emerging unit-linked insurance markets, applying the automatic variance ratio (AVR test of Kim (2009 and variance ratio tests using ranks and signs by Wright (2000 for entire, pre-crisis and crisis periods. This study contributes to the existing literature on efficient market hypothesis with several distinct features: it provides a systematic review of the weak-form market efficiency literature that examines return predictability of the daily ING unit-linked funds prices; also the article aims at monitoring any improvement in the degree of efficiency in time and also examines the relative efficiency of unit-linked insurance markets in pre-crisis and crisis periods. Unit linked insurance are life insurance policies with investment component. In the literature there are few studies investigating the effects of a financial crisis on the potential of predictability and implicitly on the degree of efficiency of financial markets. The occurrence of a market crash or financial crisis is a possible contributing factor of market inefficiency. Most of the studies are focused on the Asian crisis in 1997: Holden et al. (2005 examined the weak-form efficiency of eight emerging Asian stock markets using VR tests before, during and after the Asian crisis; Kim and Shamsuddin (2008 used three different types of multiple VR tests for nine Asian stock markets; the findings reported by Lim et al. (2008 are consistent with those reported by Cheong et al. (2007, in which the highest inefficiency occurs during the crisis period. Todea and Lazar (2010 investigated the effects of the Global crisis on the relative efficiency of ten CEE stock markets, using Generalized Spectral test of Escanciano and Velasco (2006. Wright (2000 proposes the alternative non-parametric variance ratio tests using ranks and signs of return and demonstrates that

  5. Fasting plasma glucose and lipid profiles of diabetic patients ...

    African Journals Online (AJOL)

    Teaching Hospital (KATH), Kumasi, Ghana. Corresponding author: ... management, along with diet and medication.4,5 ... Ghana, endorsed educational intervention as preventive measure. ..... ing blood sugar, hemoglobin A1c, apolipoprotein.

  6. 40 CFR 403.10 - Development and submission of NPDES State pretreatment programs.

    Science.gov (United States)

    2010-07-01

    ... AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS GENERAL PRE-TREAT-MENT REGULATIONS FOR EXIST-ING AND... Industrial User is in compliance with Pretreatment Standards; (iv) Seek civil and criminal penalties, and...

  7. Introduction to Gamma Spec

    Energy Technology Data Exchange (ETDEWEB)

    Rees, Brian G. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2018-01-30

    Training for Emergency responders - including international partners. This presentation has the following slides answering questions as to Why, How, What and How, Comparison, Issues, ID’ing, Spectra, and Medical Irradiator.

  8. Sissevaade kunstiilma / Riin Kübarsepp

    Index Scriptorium Estoniae

    Kübarsepp, Riin, 1978-

    2010-01-01

    Rein Raamatu dokumentaalfilmidest "Jaan Manitski tagasitulek" (stsenarist Jaan Kruusvall), "Armsad idealistid Signe ja Arseni Mölder" (stsenarist Juta Kivimäe) ning "Inge Tederi maailm" (stsenarist Juta Kivimäe)

  9. Comment on “A new Arctic hadrosaurid from the Prince Creek Formation (lower Maastrichtian of northern Alaska” by Hirotsugu Mori, Patrick S. Druckenmiller, and Gregory M. Erickson

    Directory of Open Access Journals (Sweden)

    Anthony R. Fiorillo

    2016-02-01

    Full Text Available Recently Mori et al. (2016 published a paper describing a new tax- on of hadrosaurid dinosaur from the Upper Cretaceous Prince Creek Formation of the North Slope Alaska, a rock unit that has recently proven to be a productive source of scientific insights into the work- ings of an ancient Arctic terrestrial ecosystem (Fiorillo and Gangloff 2001; Gangloff et al. 2005; Fiorillo et al. 2009, 2010; Gangloff and Fiorillo 2010; Flaig et al. 2011, 2013, 2014; Fiorillo and Tykoski 2012, 2014. Although thorough testing of the systematics of this proposed taxon will occur over the next few years, one statement in the Mori et al. (2016 paper warrants comment now

  10. Graphene-reinforced aluminum matrix composites prepared by spark plasma sintering

    Institute of Scientific and Technical Information of China (English)

    Wen-ming Tian; Song-mei Li; Bo Wang; Xin Chen; Jian-hua Liu; Mei Yu

    2016-01-01

    Graphene-reinforced 7055 aluminum alloy composites with different contents of graphene were prepared by spark plasma sinter-ing (SPS). The structure and mechanical properties of the composites were investigated. Testing results show that the hardness, compressive strength, and yield strength of the composites are improved with the addition of 1wt% graphene. A clean, strong interface is formed between the metal matrix and graphene via metallurgical bonding on atomic scale. Harmful aluminum carbide (Al4C3) is not formed during SPS processing. Further addition of graphene (above 1wt%) results in the deterioration in mechanical properties of the composites. The agglomeration of graphene plates is exacerbated with increasing graphene content, which is the main reason for this deterioration.

  11. Dark Energy, Newton's Law and the LHC Vacuum Energy: the Dog that Didn’t Bark

    CERN Document Server

    Burgess, C P

    2014-01-01

    This note briefly summarizes two things. First, it states why I believe progress understand- ing Dark Energy hinges crucially on finding a solution to the ‘old’ Cosmological Constant Problem, and more generally reviews why technical naturalness provides such an important clue to solving problems in cosmology. A set of criteria are formulated for judging success when discussing prospective solutions to the problem with their proponents, with a goal to helping properly hold everyone’s feet to the fire. Second, I summarize what I see as the most promising approach (so far), which is possibly the only known technically natural solution yet proposed. Its consistency tests and observational predictions are summarized, as well as a list of outstanding problems.

  12. Differences in response between traumatic and non-traumatic chronic neck pain patients in a multimodal intervention?

    DEFF Research Database (Denmark)

    Ris Hansen, Inge; Søgaard, Karen; Gram, Bibi

    , Pain Bothersomeness, Patient-Specific Functioning Scale, Tampa Scale of Kinesiophobia, Global Perceived Effect) and clinical tests (cervical Range of Motion, Pressure Pain Threshold at infraspinatus, tibialis anterior and cervical spine, Cranio-cervical Flexion, Cervical Extension muscle function......) showed statistically significant improvements in physical HR-QoL, mental HR-QoL, depression, cervical pressure pain threshold, cervical extension movement, muscle function, and oculomotion. Per protocol analyses confirmed these results with additional significant improvements in the exercise group......Abstract title: Do traumatic and non-traumatic chronic neck pain patients respond different on a combination of pain education, exercises and training? Authors: Inge Ris, Karen Søgaard, Bibi Gram, Karina Agerbo, Eleanor Boyle, Birgit Juul-Kristensen Background: Previous studies have investigated...

  13. A case study of continuing teacher professional development ...

    African Journals Online (AJOL)

    Erna Kinsey

    ing of secondary school learners using lesson study for teacher development. ... Villegas-Reimers (2003) reviewed international literature on teacher pro- fessional ... change in practice when the teachers returned to their classrooms.

  14. Nucleotide variation at the dopa decarboxylase (Ddc) gene in ...

    Indian Academy of Sciences (India)

    rates and genetic polymorphism (Begun and Aquadro 1992), balancing selection ... as a neurotransmitter, affecting mating behaviour, fertility, circadian rhythms .... standard DNA polymorphism analyses were carried out us- ing either DNAsp ...

  15. (La2O3) glass–ceramic composites

    Indian Academy of Sciences (India)

    2017-07-26

    Jul 26, 2017 ... School of Materials Science and Engineering, Central South University, Changsha 410083, PR ... ing strength, fracture toughness, glass transition temperature ... which subsequently is crystallized into a compound with a.

  16. Subject Index S¯adhan¯a Vol. 36, 2011

    Indian Academy of Sciences (India)

    Identification of bilinear systems using differential ... On the method of calibration of the energy dispersive ... Evaluation of size dependent design shear strength of ... ing problem on heterogeneous distributed ... temperature distribution. 53.

  17. Experiment list: SRX333576 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ing || stage in reprogramming=8 days after DOX induction...er dox induction || genotype/variation=MBD3flox/- mouse Embryonic Fibroblast Cells (MEF) transgenic for DOX inducible OSKM reprogramm

  18. Experiment list: SRX333572 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ing || stage in reprogramming=4 days after DOX induction...er dox induction || genotype/variation=MBD3flox/- mouse Embryonic Fibroblast Cells (MEF) transgenic for DOX inducible OSKM reprogramm

  19. ÜRO Lastefond toetab Memme Musi eest võitlejaid / Sirje Pärismaa

    Index Scriptorium Estoniae

    Pärismaa, Sirje, 1958-

    2003-01-01

    Riigikogu liige, UNICEF-i Eesti president Elle Kull ning haridus- ja teadusministeeriumi järelevalvetalituse peainspektor Tiina Peterson kohtusid Räpina vallavanema Inge Hirmoga, kes on lasteaia Memme Musi sulgemise poolt

  20. The Transformational Quality of Base Realignment and Closure 2005

    National Research Council Canada - National Science Library

    Lathroum, John A

    2006-01-01

    ...) our infrastructure with defense strategy.. .by maximiz(ing) warfighting capability and efficiency." This study examines the transformational capability of BRAC 2005 by analyzing three recommendations (USA: Operational Army (IGPBS), E&T...