The diversity of benthic mollusks of Lake Victoria and Lake Burigi ...
African Journals Online (AJOL)
Molluscan diversity, abundance and distribution in sediments of Lake Victoria and its satellite lake, Lake Burigi, were investigated. The survey was carried out in January and February 2002 for Lake Victoria and in March and April 2002 for Lake Burigi. Ten genera were recorded from four zones of Lake Victoria while only ...
Early warnings of hazardous thunderstorms over Lake Victoria
Thiery, Wim; Gudmundsson, Lukas; Bedka, Kristopher; Semazzi, Fredrick H. M.; Lhermitte, Stef; Willems, Patrick; van Lipzig, Nicole P. M.; Seneviratne, Sonia I.
2017-07-01
Weather extremes have harmful impacts on communities around Lake Victoria in East Africa. Every year, intense nighttime thunderstorms cause numerous boating accidents on the lake, resulting in thousands of deaths among fishermen. Operational storm warning systems are therefore crucial. Here we complement ongoing early warning efforts based on numerical weather prediction, by presenting a new satellite data-driven storm prediction system, the prototype Lake Victoria Intense storm Early Warning System (VIEWS). VIEWS derives predictability from the correlation between afternoon land storm activity and nighttime storm intensity on Lake Victoria, and relies on logistic regression techniques to forecast extreme thunderstorms from satellite observations. Evaluation of the statistical model reveals that predictive power is high and independent of the type of input dataset. We then optimise the configuration and show that false alarms also contain valuable information. Our results suggest that regression-based models that are motivated through process understanding have the potential to reduce the vulnerability of local fishing communities around Lake Victoria. The experimental prediction system is publicly available under the MIT licence at http://github.com/wthiery/VIEWS.
Causes and effects of the Lake Victoria ecological revolution
Goudswaard, Pleun Cornelis
2006-01-01
Nile perch was introduced in Lake Victoria in the 1950s and exploded in number during the 1980s. The process of colonization of the lake by this predatory fish is described and explained. The changes in a number of other fauna elements of Lake Victoria are described and explained. Not only Nile
Has climate change disrupted stratification patterns in Lake Victoria ...
African Journals Online (AJOL)
Has climate change disrupted stratification patterns in Lake Victoria, East Africa? ... Climate change may threaten the fisheries of Lake Victoria by increasing density differentials in the water column, thereby strengthening stratification and increasing the ... Keywords: deoxygenation, fisheries, global warming, thermocline
Adaptive responses to environmental changes in Lake Victoria cichlids
Rijssel, Jacobus Cornelis van (Jacco)
2014-01-01
Lake Victoria cichlids show the fastest vertebrate adaptive radiation known which is why they function as a model organism to study evolution. In the past 40 years, Lake Victoria experienced severe environmental changes including the boom of the introduced, predatory Nile perch and eutrophication.
Parameterization of the inherent optical properties of Murchison Bay, Lake Victoria
Okullo, Willy; Ssenyonga, Taddeo; Hamre, Børge; Frette, Øyvind; Sørensen, K.; Stamnes, Jakob J.; Steigen, Andreas; Stamnes, Knut
2007-12-01
Lake Victoria, Africa's largest freshwater lake, suffers greatly from negative changes in biomass of species of fish and also from severe eutrophication. The continuing deterioration of Lake Victoria's ecological functions has great long-term consequences for the ecosystem benefits it provides to the countries bordering its shores. However, knowledge about temporal and spatial variations of optical properties and how they relate to lake constituents is important for a number of reasons such as remote sensing, modeling of underwater light fields, and long-term monitoring of lake waters. Based on statistical analysis of data from optical measurements taken during half a year of weekly cruises in Murchison Bay, Lake Victoria, we present a three-component model for the absorption and a two-component model for the scattering of light in the UV and the visible regions of the solar spectrum along with tests of their ranges of validity. The three-component input to the model for absorption is the chlorophyll-a (Chl-a), total suspended materials concentrations, and yellow substance absorption, while the two-component input to the model for scattering is the Chl-a concentration and total suspended materials.
Malaria vectors in Lake Victoria and adjacent habitats in western Kenya.
Directory of Open Access Journals (Sweden)
Noboru Minakawa
Full Text Available The prevalence of malaria among the residents of the Lake Victoria basin remains high. The environment associated with the lake may maintain a high number of malaria vectors. Lake habitats including water hyacinths have been suspected to be the source of vectors. This study investigated whether malaria vectors breed in the lake habitats and adjacent backwater pools. Anopheline larvae were collected within the littoral zone of the lake and adjacent pools located along approximately 24.3 km of the lakeshore in western Kenya, and their breeding sites characterized. Three primary vector species, Anopheles arabiensis, Anopheles gambiae s.s. and Anopheles funestus s.s., and three potential vectors, were found in the lake habitats. Unexpectedly, An. arabiensis was the most dominant vector species in the lake sampling sites. Its habitats were uncovered or covered with short grass. A potential secondary malaria vector, Anopheles rivulorum, dominated the water hyacinths in the lake. Most breeding sites in the lake were limited to areas that were surrounded by tall emergent plants, including trees, and those not exposed to waves. Nearly half of adjacent habitats were lagoons that were separated from the lake by sand bars. Lagoons contained a variety of microhabitats. Anopheles arabiensis dominated open habitats, whereas An. funestus s.s. was found mainly in vegetated habitats in lagoons. The current study confirmed that several breeding sites are associated with Lake Victoria. Given that Lake Victoria is the second largest lake in the world, the lake related habitats must be extensive; therefore, making targeted vector control difficult. Further exploration is necessary to estimate the effects of lake associated habitats on malaria transmission so as to inform a rational decision-making process for vector control.
Zhou, Minghua; Brandt, Patric; Pelster, David; Rufino, Mariana C.; Robinson, Timothy; Butterbach-Bahl, Klaus
2014-10-01
Using the net anthropogenic nitrogen input (NANI) approach we estimated the N budget for the Lake Victoria Basin in East Africa. The NANI of the basin ranged from 887 to 3008 kg N km-2 yr-1 (mean: 1827 kg N km-2 yr-1) for the period 1995-2000. The net nitrogen release at basin level is due primarily to livestock and human consumption of feed and foods, contributing between 69% and 85%. Atmospheric oxidized N deposition contributed approximately 14% to the NANI of the Lake Victoria Basin, while either synthetic N fertilizer imports or biological N fixations only contributed less than 6% to the regional NANI. Due to the low N imports of feed and food products (export to Lake Victoria accounted for 16%, which is much lower than for watersheds located in Europe and USA (25%). A significant reduction of the uncertainty of our N budget estimate for Lake Victoria Basin would be possible if better data on livestock systems and riverine N export were available. Our study indicates that at present soil N mining is the main source of nitrogen in the Lake Victoria Basin. Thus, sustainable N management requires increasing agricultural N inputs to guarantee food security and rehabilitation and protection of soils to minimize environmental costs. Moreover, to reduce N pollution of the lake, improving management of human and animal wastes needs to be carefully considered in future.
Total mercury concentration in common fish species of Lake Victoria ...
African Journals Online (AJOL)
Total mercury (THg) concentration was analysed in muscles of common fish species of Lake Victoria in the eastern and southern parts of the lake using cold vapour Atomic Absorption Spectrophotometric technique. Mercury concentration in all fish species was generally lower than the WHO maximum allowable ...
('fingerponds\\') in the wetlands of Lake Victoria, Kenya
African Journals Online (AJOL)
The potential effect on ecosystem integrity of the use of natural wetlands for seasonal wetland fishponds ('fingerponds\\'), integrated with vegetable production for livelihood demands, was evaluated using experimental sites at Lake Victoria, Kenya. Soluble reactive phosphorous and total phosphorus, ammonium, nitrate and ...
Levels of toxic metals in multisectoral samples from Winam Gulf of Lake Victoria.
Ongeri, D M K; Lalah, J O; Wandiga, S O; Schramm, K W; Michalke, B
2009-01-01
In this study, the distribution and sources of inputs of trace metals including Cd, Cu, Zn and Pb from various sources as well as Fe which is widely used in the construction industry, into Winam Gulf of Lake Victoria were investigated. The sampling sites were located up streams and down streams of four rivers (Sio, Nyamasaria, Nyando and Sondu-Miriu), in four beaches along the lake (Port Victoria, Kisumu Car Wash, Dunga and Hippo point beaches) and in three estates (Nyamasaria, Migosi and Nyawita) in Kisumu city, covering potential agrochemical and industrial sources and drinking water points, respectively. The concentrations (in microg/L) of trace metals analysed in the lake and river waters ranged from Car Wash area. The study confirmed that the concentrations of the metals accumulate downstream in the rivers both in water and sediment and these rivers are major sources of the heavy metal load into Winam Gulf of Lake Victoria.
Satellite-Based Assessment of the spatial extent of Aquatic Vegetation in Lake Victoria
Clark, W.; Aligeti, N.; Jeyaprakash, T.; Martins, M.; Stodghill, J.; Winstanley, H.
2011-12-01
Lake Victoria in Africa is the second largest freshwater lake in the world and is known for its abundance of aquatic wildlife. In particular over 200 different fish species are caught and sold by local fisherman. The lake is a major contributor to the local economy as a corridor of transportation, source of drinking water, and source of hydropower. However, the invasion of aquatic vegetation such as water hyacinth in the lake has disrupted each of these markets. Aquatic vegetation now covers a substantial area of the coastline blocking waterways, disrupting hydropower, hindering the collection of drinking water and decreasing the profitability of fishing. The vegetation serves as a habitat for disease carrying mosquitoes as well as snakes and snails that spread the parasitic disease bilharzia. The current control measures of invasive aquatic vegetation rely on biological, chemical and mechanical control. The objective of this study was to utilize remote sensing to map aquatic vegetation within Lake Victoria from 2000 to 2011. MODIS, Landsat 4-5TM, and Landsat 7-ETM imagery was employed to perform change detections in vegetation and identify the extent of aquatic vegetation throughout the years. The efficiency of containment efforts were evaluated and ideal time for application of such efforts were suggested. A methodology for aquatic vegetation surveillance was created. The results of this project were presented as a workshop to the Lake Victoria Fisheries Organization, SERVIR, and other partner organizations. The workshop provided instruction into the use of NASA and other satellite derived products. Time series animations of the spatial extent of aquatic vegetation within the lake were created. By identifying seasons of decreased aquatic vegetation, ideal times to employ control efforts were identified. SERVIR will subsequently utilize the methodologies and mapping results of this study to develop operational aquatic vegetation surveillance for Lake Victoria.
Lake Victoria's Water Budget and the Potential Effects of Climate ...
African Journals Online (AJOL)
This paper presents the Lake Victoria water budget for the period 1950-2004 and findings of a study on potential climate change impact on the lake's Hydrology through the 21st Century. The mass balance components are computed from measured and simulated data. A2 and B2 emission scenarios of the Special Report ...
Water hyacinth hotspots in the Ugandan waters of Lake Victoria in ...
African Journals Online (AJOL)
Water hyacinth invaded Lake Victoria in the 1980s and, by 1998, had attained peak coverage of approximately 2 000 ha in the Ugandan waters of the lake. Control interventions, especially via biological means, significantly reduced the weed's coverage to non-nuisance levels (<10 ha) by 1999. Although resurgence was ...
Odada, Eric O; Olago, Daniel O; Kulindwa, Kassim; Ntiba, Micheni; Wandiga, Shem
2004-02-01
Lake Victoria is an international waterbody that offers the riparian communities a large number of extremely important environmental services. Over the past three decades or so, the lake has come under increasing and considerable pressure from a variety of interlinked human activities such as overfishing, species introductions, industrial pollution, eutrophication, and sedimentation. In this paper we examine the root causes for overfishing and pollution in Lake Victoria and give possible policy options that can help remediate or mitigate the environmental degradation.
Fishing Business Arrangements and Sustainability in Lake Victoria ...
African Journals Online (AJOL)
In this article an attempt is made to analyse the existing production relations between the owners of the vessels and the crewmembers and the concern for sustainability. Our results found that the existing sharing system in Lake Victoria poses a big challenge in as far as sustainability is concerned. Some of the system such ...
Distribution of Nile perch Lates niloticus in southern Lake Victoria is ...
African Journals Online (AJOL)
Although Nile perch Lates niloticus is assumed to be sensitive to low oxygen concentrations, it was found in deep water in Lake Victoria, where oxygen depletion is common during the rainy season. Since factors determining Nile perch distribution are not well understood its spatial distribution in the Mwanza Gulf of Lake ...
Transactional sex in the fishing communities along Lake Victoria ...
African Journals Online (AJOL)
The study describes the nature, context and implications of a unique form of transactional sexual relationships in the fishing communities along Lake Victoria in Kisumu County, Kenya. We conducted 12 focus group discussions and 17 key informant interviews among fishermen, fishmongers and fish transporters in Kisumu.
A Bottom-Up Understanding of Illegal, Unreported, and Unregulated Fishing in Lake Victoria
Directory of Open Access Journals (Sweden)
Joseph Luomba
2016-10-01
Full Text Available Illegal, unreported, and unregulated (IUU fishing is a major concern in fisheries management around the world. Several measures have been taken to address the problem. In Lake Victoria, the alleviation of IUU fishing is implemented through the Regional Plan of Action (RPOA-IUU, which restricts use of certain fishing gear, as well as prohibits fishing in closed areas and during closed seasons. Despite the long-term efforts to monitor and control what goes on in the fisheries, IUU fishing has persisted in Lake Victoria. Inspired by interactive governance theory, this paper argues that the persistence of IUU fishing could be due to different images that stakeholders have about the situation, rather than the lack of management competency. Through structured interviews with 150 fisheries stakeholders on Ijinga Island in the southeastern part of Lake Victoria, Tanzania, using paired comparison questionnaires, the study elicits stakeholders’ perspective about the severity of different locally-pertinent fishing-related activities. The results show that while fisheries stakeholder groups agree on their judgments about certain fishing gears, some differences are also apparent. For instance, fisheries managers and scientists do not always agree with fishing people about what activities cause the most damage to fisheries resources and ecosystem. Further, they tend to consider some IUU fishing-related activities less damaging than some non-IUU fishing. Such disparity creates governability challenges, pointing to the need to revisit relevant regulatory measures and to make them consistent with the knowledge and judgments of all stakeholders. Based on these findings, we discuss governing interventions that may contribute to addressing IUU fishing in Lake Victoria and elsewhere.
Energy and Environment in the Lake Victoria basin.
Arungu-Olende, S.
2006-01-01
The local and national economies of Lake Victoria basin communities are heavily dependent on energy that fuels agriculture, industry, commerce, transportation and other economic activities; and powers our houses, offices, hospitals and buildings. Energy is therefore key to facilitating the development income generating opportunities, improving living standards, reducing poverty, and ensuring the protection of the environment. The development and use of various forms of renewable and non-renew...
LAKE VICTORIA AND THE COMMON PROPERTY DEBATE: IS THE TRAGEDY OF THE COMMONS A THREAT TO ITS FUTURE?
Directory of Open Access Journals (Sweden)
Erick Ochieng OGELLO
2013-12-01
Full Text Available Lake Victoria is the largest among the African Great Lakes in East African region that are believed to have both dynamic and fragile aquatic ecosystems. Within two decades, the lake has experienced extensive resource exploitation leading to constrained productivity and drastic decline of native biodiversity. Intensive non-selective fishing, catchment vegetation degradation, industrial and agricultural pollution, the introduction of exotic species and uneven patchwork of governmental laws are some of the reasons for the current ecological woes facing Lake Victoria. This paper intends to stimulate recognition of Lake Victoria and its catchment as a lived Commons, to be shared, protected, managed and enjoyed by all who live around it. The paper compares the original biodiversity status of the lake with the current status and discusses the role of unlimited access as a function of the loss of the Lake’s biological wealth. The Lake’s water resource base, fishery, wetlands and other aquatic resources have been exhaustively discussed. In this review, we uphold the Hardin’s school of thought that freedom of the commoners causes resource overuse leading to poverty. Therefore, limiting freedom could be essential. However, there is need for provision of alternative means of survival since people with no choices would continue over-exploiting ecosystems even under limited access. The Lake Victoria basin commons should be protected by strict legal and clear political framework based on public trust doctrine, reinforced in law that the Lake is vital for the survival of people, plants and animals living on or near it and therefore must be protected for the common good. The political jurisdictions should consider governing the Lake basin as one integrated watershed. It is our fervent hope that bordering communities will secure grass root movements to protect and nurture Lake Victoria and its environs for the benefit of the present and future
Nutritional composition and shelflife of the lake victoria nile perch ...
African Journals Online (AJOL)
Nile perch, the most important commercial fish species from the Lake Victoria fishery, contributes about 67% of Kenya's total annual fish export earnings. Despite the Nile perch being an important foreign exchange earner, little information is available on its nutritional composition and shelf life on ice, information that is ...
B chromosomes have a functional effect on female sex determination in Lake Victoria cichlid fishes.
Directory of Open Access Journals (Sweden)
Kohta Yoshida
2011-08-01
Full Text Available The endemic cichlid fishes in Lake Victoria are a model system for speciation through adaptive radiation. Although the evolution of the sex-determination system may also play a role in speciation, little is known about the sex-determination system of Lake Victoria cichlids. To understand the evolution of the sex-determination system in these fish, we performed cytogenetic analysis in 11 cichlid species from Lake Victoria. B chromosomes, which are present in addition to standard chromosomes, were found at a high prevalence rate (85% in these cichlids. In one species, B chromosomes were female-specific. Cross-breeding using females with and without the B chromosomes demonstrated that the presence of the B chromosomes leads to a female-biased sex ratio in this species. Although B chromosomes were believed to be selfish genetic elements with little effect on phenotype and to lack protein-coding genes, the present study provides evidence that B chromosomes have a functional effect on female sex determination. FISH analysis using a BAC clone containing B chromosome DNA suggested that the B chromosomes are derived from sex chromosomes. Determination of the nucleotide sequences of this clone (104.5 kb revealed the presence of several protein-coding genes in the B chromosome, suggesting that B chromosomes have the potential to contain functional genes. Because some sex chromosomes in amphibians and arthropods are thought to be derived from B chromosomes, the B chromosomes in Lake Victoria cichlids may represent an evolutionary transition toward the generation of sex chromosomes.
Existence versus extinction : Human-hippo conflicts in Lake Victoria Area, Kenya
Post, A.W.C.H.M.
2017-01-01
This PhD dissertation examines the role of different organisations and affected communities in human-wildlife governance, with a focus on human-hippo conflicts in Lake Victoria Area, Kenya. The hippo population in this area is under pressure due to human activities that impact on the wetland
Nile perch fish processing waste along Lake Victoria in East Africa ...
African Journals Online (AJOL)
Nile perch fish processing waste along Lake Victoria in East Africa: Auditing and characterization. ... African Journal of Environmental Science and Technology ... If you would like more information about how to print, save, and work with PDFs, Highwire Press provides a helpful Frequently Asked Questions about PDFs.
Beverly, Emily J.; Peppe, Daniel J.; Driese, Steven G.; Blegen, Nick; Faith, J. Tyler; Tryon, Christian A.; Stinchcomb, Gary E.
2017-11-01
The impact of changing environments on the evolution and dispersal of Homo sapiens is highly debated, but few data are available from equatorial Africa. Lake Victoria is the largest freshwater lake in the tropics and is currently a biogeographic barrier between the eastern and western branches of the East African Rift. The lake has previously desiccated at 17 ka and again at 15 ka, but little is known from this region prior to the Last Glacial Maximum. The Pleistocene terrestrial deposits on the northeast coast of Lake Victoria (94 to 36 ka) are ideal for paleoenvironmental reconstructions where volcaniclastic deposits (tuffs), fluvial deposits, tufa, and paleosols are exposed, which can be used to reconstruct Critical Zones (CZ) of the past (paleo-CZs). The paleo-CZ is a holistic concept that reconstructs the entire landscape using geologic records of the atmosphere, hydrosphere, lithosphere, biosphere, and pedosphere (the focus of this study). New paleosol-based mean annual precipitation (MAP) proxies from Karungu, Rusinga Island, and Mfangano Island indicate an average MAP of 750108 mm yr-1 (CALMAG), 800182 mm yr-1 (CIA-K), and 1010228 mm yr-1 (PPM1.0) with no statistical difference throughout the 11 m thick sequence. This corresponds to between 54 and 72% of modern precipitation. Tephras bracketing these paleosols have been correlated across seven sites, and sample a regional paleo-CZ across a 55 km transect along the eastern shoreline of the modern lake. Given the sensitivity of Lake Victoria to precipitation, it is likely that the lake was significantly smaller than modern between 94 ka and 36 ka. This would have removed a major barrier for the movement of fauna (including early modern humans) and provided a dispersal corridor across the equator and between the rifts. It is also consistent with the associated fossil faunal assemblage indicative of semi-arid grasslands. During the Late Pleistocene, the combined geologic and paleontological evidence suggests a
Directory of Open Access Journals (Sweden)
Emily J. Beverly
2017-11-01
Full Text Available The impact of changing environments on the evolution and dispersal of Homo sapiens is highly debated, but few data are available from equatorial Africa. Lake Victoria is the largest freshwater lake in the tropics and is currently a biogeographic barrier between the eastern and western branches of the East African Rift. The lake has previously desiccated at ~17 ka and again at ~15 ka, but little is known from this region prior to the Last Glacial Maximum. The Pleistocene terrestrial deposits on the northeast coast of Lake Victoria (94–36 ka are ideal for paleoenvironmental reconstructions where volcaniclastic deposits (tuffs, fluvial deposits, tufa, and paleosols are exposed, which can be used to reconstruct Critical Zones (CZ of the past (paleo-CZs. The paleo-CZ is a holistic concept that reconstructs the entire landscape using geologic records of the atmosphere, hydrosphere, lithosphere, biosphere, and pedosphere (the focus of this study. New paleosol-based mean annual precipitation (MAP proxies from Karungu, Rusinga Island, and Mfangano Island indicate an average MAP of 750 ± 108 mm year−1 (CALMAG, 800 ± 182 mm year−1 (CIA-K, and 1,010 ± 228 mm year−1 (PPM1.0 with no statistical difference throughout the 11 m thick sequence. This corresponds to between 54 and 72% of modern precipitation. Tephras bracketing these paleosols have been correlated across seven sites, and sample a regional paleo-CZ across a ~55 km transect along the eastern shoreline of the modern lake. Given the sensitivity of Lake Victoria to precipitation, it is likely that the lake was significantly smaller than modern between 94 and 36 ka. This would have removed a major barrier for the movement of fauna (including early modern humans and provided a dispersal corridor across the equator and between the rifts. It is also consistent with the associated fossil faunal assemblage indicative of semi-arid grasslands. During the Late Pleistocene, the combined geologic and
Dietary shifts in Brycinus sadleri (Pisces : Characidae) from southern Lake Victoria
Wanink, J.H.; Joordens, J.C.A.
2007-01-01
We studied the diet of Brycinus sadleri in Lake Victoria after extensive environmental changes during the 1980s. To check for diet expansion following these changes, as observed in some other fish species, we compared our results with data from the 1950s. Stomach contents were analysed in relation
Nile perch fish processing waste along Lake Victoria in East Africa ...
African Journals Online (AJOL)
In East Africa, Nile perch fish processing into chilled fish fillet for export along Lake Victoria generate large proportions of both solid and liquid wastes. However, no thorough auditing and characterization of the waste has been done that would guide potential value addition through bioconversions and waste management.
Eutrophication, Nile perch and food-web interactions in south-east Lake Victoria
Cornelissen, I.J.M.
2015-01-01
The increasing eutrophication, the introduction of Nile perch (Lates niloticus) and the increasing fishing pressure has changed Lake Victoria tremendously the last century. Since the 1960s, eutrophication increased primary production, enabling an increase in fish production. However,
Diel vertical migration of major fish-species in Lake Victoria, East Africa
Goudswaard, P.C.; Wanink, J.H.; Witte, F.; Katunzi, E.F.B.; Berger, M.R.; Postma, D.J.
2004-01-01
Understanding of migration patterns is essential in the interpretation of hydro-acoustic stock assessment data of partly demersal partly pelagic fish stocks. In this paper we provide this kind of information for some species that were common in the Mwanza Gulf of Lake Victoria in the 1980s, before
Diel vertical migration of major fish-species in Lake Victoria, East Africa.
Goudswaard, KPC; Wanink, JH; Witte, F; Katunzi, EFB; Berger, MR; Postma, DJ
2004-01-01
Understanding of migration patterns is essential in the interpretation of hydro-acoustic stock assessment data of partly demersal partly pelagic fish stocks. In this paper we provide this kind of information for some species that were common in the Mwanza Gulf of Lake Victoria in the 1980s, before
Collapse and reorganization of a food web of Mwanza Gulf, Lake Victoria
Downing, A.S.; Van Nes, E.H.; Janse, J.H.; Witte, F.; Cornelissen, I.J.M.; Scheffer, M.; Mooij, W.M.
2012-01-01
Lake Victoria (in East Africa) is the world's second largest fresh-water system. Over the past century the ecosystem has undergone drastic changes. Some 30 years after the introduction of Nile perch and tilapia in the 1950s, the highly diverse community of native haplochromines collapsed, leaving a
A review of mercury in Lake Victoria, East Africa: implications for human and ecosystem health.
Campbell, Linda; Dixon, D G; Hecky, R E
2003-01-01
Lake Victoria, East Africa, has been the site of many recent studies measuring mercury (Hg) concentrations in water, fish, sediment, soil, and humans. Most of these studies were motivated by concerns about Hg contamination from processing of gold ore on the southern shores. Total Hg (THg) concentrations in fish were usually below permissible World Health Organization (WHO) concentrations and international marketing limits and do not threaten the lucrative export industry. Nile perch 3-10 kg and most >10 kg had THg concentrations above the WHO threshold concentrations for at-risk groups (200 ng/g). Elevated THg concentrations in large Nile perch are not of major concern because Nile perch are rarely consumed by the people living on Lake Victoria and very large Nile perch are becoming increasingly rare in catches. Water THg concentrations were below Canadian drinking water guidelines but were elevated relative to those in the northern Great Lakes. Sediment and soil THg concentrations were within inter-national guidelines and are comparable to those in northern latitudes but are lower than those in the Amazon basin. Biomass burning and soil erosion are estimated to be the major sources of THg for the lake and probably constitute a larger source of THg than gold mining in Tanzania.THg concentrations in urine and hair from human volunteers indicate that while gold miners and frequent skin-bleaching cream users are at risk of inorganic mercury poisoning, the rest of the population, including fishermen, is not. Human exposure assessments demonstrated that fish consumption and soil geophagy constitute major sources of THg for humans, but the total estimated daily intake of THg was below the Health Canada tolerable daily intake (TDI) limits. The use of beauty creams containing high inorganic Hg concentrations, however, caused the estimated THg exposure to exceed the TDI. The high THg content in the hair of regular cream users supports this assessment. The nutritional
National Research Council Canada - National Science Library
Kuhn, Jens H; Radoshitzky, Sheli R; Guth, Alexander C; Warfield, Kelly L; Li, Wenhui; Vincent, Martin J; Towner, Jonathan S; Nichol, Stuart T; Bavari, Sina; Choe, Hyeryun
2006-01-01
.... Both fragments specifically inhibited replication of infectious Zaire ebolavirus, as well as entry of retroviruses pseudotyped with either Lake Victoria marburgvirus or Zaire ebolavirus GP(sub 1,2...
Lake Victoria wetlands and the ecology of the Nile tilapia, Oreochromis niloticus Linne
Balirwa, J.S.
1998-01-01
An ecological study of wetlands was undertaken in northern Lake Victoria (East Africa) between 1993 and 1996 with a major aim of characterising shallow vegetation-dominated interface habitats, and evaluating their importance for fish, in particular, for the stocked and socio-economically
Simulation of Lake Victoria Circulation Patterns Using the Regional Ocean Modeling System (ROMS.
Directory of Open Access Journals (Sweden)
Chrispine Nyamweya
Full Text Available Lake Victoria provides important ecosystem services including transport, water for domestic and industrial uses and fisheries to about 33 million inhabitants in three East African countries. The lake plays an important role in modulating regional climate. Its thermodynamics and hydrodynamics are also influenced by prevailing climatic and weather conditions on diel, seasonal and annual scales. However, information on water temperature and circulation in the lake is limited in space and time. We use a Regional Oceanographic Model System (ROMS to simulate these processes from 1st January 2000 to 31st December 2014. The model is based on real bathymetry, river runoff and atmospheric forcing data using the bulk flux algorithm. Simulations show that the water column exhibits annual cycles of thermo-stratification (September-May and mixing (June-August. Surface water currents take different patterns ranging from a lake-wide northward flow to gyres that vary in size and number. An under flow exists that leads to the formation of upwelling and downwelling regions. Current velocities are highest at the center of the lake and on the western inshore waters indicating enhanced water circulation in those areas. However, there is little exchange of water between the major gulfs (especially Nyanza and the open lake, a factor that could be responsible for the different water quality reported in those regions. Findings of the present study enhance understanding of the physical processes (temperature and currents that have an effect on diel, seasonal, and annual variations in stratification, vertical mixing, inshore-offshore exchanges and fluxes of nutrients that ultimately influence the biotic distribution and trophic structure. For instance information on areas/timing of upwelling and vertical mixing obtained from this study will help predict locations/seasons of high primary production and ultimately fisheries productivity in Lake Victoria.
Simulation of Lake Victoria Circulation Patterns Using the Regional Ocean Modeling System (ROMS).
Nyamweya, Chrispine; Desjardins, Christopher; Sigurdsson, Sven; Tomasson, Tumi; Taabu-Munyaho, Anthony; Sitoki, Lewis; Stefansson, Gunnar
2016-01-01
Lake Victoria provides important ecosystem services including transport, water for domestic and industrial uses and fisheries to about 33 million inhabitants in three East African countries. The lake plays an important role in modulating regional climate. Its thermodynamics and hydrodynamics are also influenced by prevailing climatic and weather conditions on diel, seasonal and annual scales. However, information on water temperature and circulation in the lake is limited in space and time. We use a Regional Oceanographic Model System (ROMS) to simulate these processes from 1st January 2000 to 31st December 2014. The model is based on real bathymetry, river runoff and atmospheric forcing data using the bulk flux algorithm. Simulations show that the water column exhibits annual cycles of thermo-stratification (September-May) and mixing (June-August). Surface water currents take different patterns ranging from a lake-wide northward flow to gyres that vary in size and number. An under flow exists that leads to the formation of upwelling and downwelling regions. Current velocities are highest at the center of the lake and on the western inshore waters indicating enhanced water circulation in those areas. However, there is little exchange of water between the major gulfs (especially Nyanza) and the open lake, a factor that could be responsible for the different water quality reported in those regions. Findings of the present study enhance understanding of the physical processes (temperature and currents) that have an effect on diel, seasonal, and annual variations in stratification, vertical mixing, inshore-offshore exchanges and fluxes of nutrients that ultimately influence the biotic distribution and trophic structure. For instance information on areas/timing of upwelling and vertical mixing obtained from this study will help predict locations/seasons of high primary production and ultimately fisheries productivity in Lake Victoria.
Two new species of zooplanktivorous haplochromine cichlids from Lake Victoria, Tanzania
Directory of Open Access Journals (Sweden)
Marnix de Zeeuw
2013-01-01
Full Text Available Two new species of zooplanktivorous haplochromine cichlids from Lake Victoria, Tanzania, are described and illustrated. These species closely resemble each other. Their affinities to other zooplanktivorous haplochromines from Lake Victoria are discussed. Haplochromis argens sp. n., which featured under nicknames (mainly H. “argens” in more than 50 papers, was caught both in the Mwanza Gulf and the Emin Pasha Gulf, whereas H. goldschmidti sp. n. was only found in the Emin Pasha Gulf. Of the latter species only males are available, but it seems unlikely that it represents a case of male colour polymorphism as several presumably unrelated characters differ in sympatry between the two species, suggesting that there is no gene flow. Statistical analysis revealed that the overall difference between the two species is greater than that between the populations from the two locations. Body depth of the two species in sympatry in the Emin Pasha Gulf was more similar than that of H. goldschmidti sp. n. and the allopatric population of H. argens sp. n. from the Mwanza Gulf, which may indicate an overall environmental effect. However, several measurements related to the width of snout and mouth differed more between the populations of the two species in sympatry than between the allopatric populations. In contrast to a group of zooplanktivorous species that recovered successfully after environmental changes in the lake, H. argens sp. n. is among a group that became extremely rare and probably is in danger of extinction; the conservation status of H. goldschmidti sp. n. is currently unknown.
A pharyngeal jaw evolutionary innovation facilitated extinction in Lake Victoria cichlids.
McGee, Matthew D; Borstein, Samuel R; Neches, Russell Y; Buescher, Heinz H; Seehausen, Ole; Wainwright, Peter C
2015-11-27
Evolutionary innovations, traits that give species access to previously unoccupied niches, may promote speciation and adaptive radiation. Here, we show that such innovations can also result in competitive inferiority and extinction. We present evidence that the modified pharyngeal jaws of cichlid fishes and several marine fish lineages, a classic example of evolutionary innovation, are not universally beneficial. A large-scale analysis of dietary evolution across marine fish lineages reveals that the innovation compromises access to energy-rich predator niches. We show that this competitive inferiority shaped the adaptive radiation of cichlids in Lake Tanganyika and played a pivotal and previously unrecognized role in the mass extinction of cichlid fishes in Lake Victoria after Nile perch invasion. Copyright © 2015, American Association for the Advancement of Science.
Andama, M.; Lejju, J. B.; Tolo, C. U.
2013-11-01
Lake Victoria ecosystem has undergone major ecological changes in the recent decades. Sedimentary diatom analysis and Fe / Mn determined by Energy Dispersive X-ray Fluorescence (EDXRF) have provided phytoplankton (diatom) productivity and the resultant anoxia (Fe / Mn) in Lake Victoria at Napoleon Gulf during the late Holocene (1778 cal yr BP (calibrated years before present) to 2008 AD) with radiocarbon dates determined using Accelerator Mass Spectrometry standard method. The results showed that increased total diatom counts in Napoleon Gulf during the late Holocene correspond with increased Fe / Mn ratio (anoxia) in some of the profiles and not in others and in most cases those that correspond correlate very well with increased eutrophication from nitrate input (Total Nitrogen, TN). Therefore slightly increased anoxia not related to increased diatom productivity was recorded in Lake Victoria at Napoleon Gulf from the period 1778 to 1135 cal yr BP. There was slightly increased diatom productivity at Napoleon Gulf from the period 857 to 758 cal yr BP but it did not increase anoxia in the lake. The period 415 cal yr BP to 2008 AD recorded increased anoxia at Napoleon Gulf related to high diatom productivity especially from 415 to 390 cal yr BP and 191 cal yr BP to 2008 AD.
Biological Diversity and Resilience: Lessons from the Recovery of Cichlid Species in Lake Victoria
Directory of Open Access Journals (Sweden)
Alex O. Awiti
2011-03-01
Full Text Available A fundamental feature of the Anthropocene is the inexorable erosion of the self-repairing capacity or adaptive renewal of natural systems because of natural perturbation, exploitation, or management failure. The concept of resilience offers a systematic framework for understanding the dynamics and variables that govern response dynamics of ecosystems. Resilience of haplochromine cichlids is assessed using limnological and biodiversity changes in Lake Victoria, the world's second largest freshwater lake, over the last five decades. The review explores the resurgence of the haplochromine cichlids using Holling's adaptive renewal cycle and attempts to illustrate how resilience-based management approaches might learn from an inadvertent management experiment. The introduction in the 1980s of the Nile perch (Lates niloticus, a fecund and voracious predator of the endemic phytoplankton feeding haplochromine cichlids, anthropogenic eutrophication, and deep water hypoxia have combined in a synergistic way to increase the vulnerability of the lake ecosystem to perturbations that were hitherto absorbed. However, the upsurge in commercial Nile perch fishing appears to be enabling the resurgence of the haplochromine cichlids. The resurgence of haplochromine cichlids is characterized by phenotypic plasticity, ecological and life history traits and demonstrates the critical role of response diversity in the maintenance of systems resilience. Resilience of the haplochromine cichlids resides in the requisite functional response diversity and habitat diversity that provide the resources for renewal and regeneration. This paper concludes that management of Nile perch fisheries and control of nutrient loading into Lake Victoria could halt or reverse eutrophication, hence offer the best promise for a diverse, productive, and resilient social-ecological system.
Mugo, R. M.; Limaye, A. S.; Nyaga, J. W.; Farah, H.; Wahome, A.; Flores, A.
2016-12-01
The water quality of inland lakes is largely influenced by land use and land cover changes within the lake's catchment. In Africa, some of the major land use changes are driven by a number of factors, which include urbanization, intensification of agricultural practices, unsustainable farm management practices, deforestation, land fragmentation and degradation. Often, the impacts of these factors are observable on changes in the land cover, and eventually in the hydrological systems. When the natural vegetation cover is reduced or changed, the surface water flow patterns, water and nutrient retention capacities are also changed. This can lead to high nutrient inputs into lakes, leading to eutrophication, siltation and infestation of floating aquatic vegetation. To assess the relationship between land use and land cover changes in part of the Lake Victoria Basin, a series of land cover maps were derived from Landsat imagery. Changes in land cover were identified through change maps and statistics. Further, the surface water chlorophyll-a concentration and turbidity were derived from MODIS-Aqua data for Lake Victoria. Chlrophyll-a and turbidity are good proxy indicators of nutrient inputs and siltation respectively. The trends in chlorophyll-a and turbidity concentrations were analyzed and compared to the land cover changes over time. Certain land cover changes related to agriculture and urban development were clearly identifiable. While these changes might not be solely responsible for variability in chlrophyll-a and turbidity concentrations in the lake, they are potentially contributing factors to this problem. This work illustrates the importance of addressing watershed degradation while seeking to solve water quality related problems.
Castillo Cajas, Ruth F; Selz, Oliver M; Ripmeester, Erwin A P; Seehausen, Ole; Maan, Martine E
2012-01-01
Environmental variation in signalling conditions affects animal communication traits, with possible consequences for sexual selection and reproductive isolation. Using spectrophotometry, we studied how male coloration within and between populations of two closely related Lake Victoria cichlid
Reconstruction of a semi-arid late Pleistocene paleocatena from the Lake Victoria region, Kenya
Beverly, Emily J.; Driese, Steven G.; Peppe, Daniel J.; Arellano, L. Nicole; Blegen, Nick; Faith, J. Tyler; Tryon, Christian A.
2015-11-01
The effect of changing environment on the evolution of Homo sapiens is heavily debated, but few data are available from equatorial Africa prior to the last glacial maximum. The Karungu deposits on the northeast coast of Lake Victoria are ideal for paleoenvironmental reconstructions and are best studied at the Kisaaka site near Karunga in Kenya (94 to > 33 ka) where paleosols, fluvial deposits, tufa, and volcaniclastic deposits (tuffs) are exposed over a 2 km transect. Three well-exposed and laterally continuous paleosols with intercalated tuffs allow for reconstruction of a succession of paleocatenas. The oldest paleosol is a smectitic paleo-Vertisol with saline and sodic properties. Higher in the section, the paleosols are tuffaceous paleo-Inceptisols with Alfisol-like soil characteristics (illuviated clay). Mean annual precipitation (MAP) proxies indicate little change through time, with an average of 764 ± 108 mm yr- 1 for Vertisols (CALMAG) and 813 ± 182 to 963 ± 182 mm yr- 1 for all paleosols (CIA-K). Field observations and MAP proxies suggest that Karungu was significantly drier than today, consistent with the associated faunal assemblage, and likely resulted in a significantly smaller Lake Victoria during the late Pleistocene. Rainfall reduction and associated grassland expansion may have facilitated human and faunal dispersals across equatorial East Africa.
Modelling nitrogen transformation and removal in mara river basin wetlands upstream of lake Victoria
Mayo, Aloyce W.; Muraza, Marwa; Norbert, Joel
2018-06-01
Lake Victoria, the largest lake in Africa, is a resource of social-economic potential in East Africa. This lake receives water from numerous tributaries including Mara River, which contributes about 4.8% of the total Lake water inflow. Unfortunately, Mara River basin faces environmental problems because of intensive settlement, agriculture, overgrazing in the basin and mining activities, which has lead to water pollution in the river, soil erosion and degradation, decreased soil fertility, loss of vegetation cover, decreased water infiltration capacity and increased sedimentation. One of the pollutants carried by the river includes nitrogen, which has contributed to ecological degradation of the Lake Victoria. Therefore this research work was intended to determine the effectiveness of Mara River wetland for removal of nitrogen and to establish nitrogen removal mechanisms in the wetland. To predict nitrogen removal in the wetland, the dynamics of nitrogen transformation was studied using a conceptual numerical model that takes into account of various processes in the system using STELLA II version 9.0®2006 software. Samples of model input from water, plants and sediments were taken for 45 days and were analyzed for pH, temperature, and DO in situ and chemical parameters such as NH3-N, Org-N, NO2-N, and NO3-N were analyzed in the laboratory in accordance with Standard methods. For plants, the density, dominance, biomass productivity and TN were determined and for sediments TN was analyzed. Inflow into the wetland was determined using stage-discharge relationship and was found to be 734,400 m3/day and the average wetland volume was 1,113,500 m3. Data collected by this study were used for model calibration of nitrogen transformation in this wetland while data from another wetland were used for model validation. It was found that about 37.8% of total nitrogen was removed by the wetland system largely through sedimentation (26.6%), plant uptake (6.6%) and
International Nuclear Information System (INIS)
Henry, L.; Kishimba, M.A.
2006-01-01
Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) samples were collected from fish landing stations in nine riparian districts on the Tanzanian side of Lake Victoria and screened for residues of 64 organochlorine, organophosphorus, carbamate, and pyrethroid pesticides. The residue levels in the fish fillet were up to 0.003, 0.03 and 0.2 mg/kg fresh weight (0.7, 3.8 and 42 mg/kg lipid weight) of fenitrothion, DDT and endosulfan, respectively. Mean levels within sites were up to 0.002, 0.02 and 0.1 mg/kg fresh weight (0.5, 0.5 and 16 mg/kg lipid weight), respectively. The detection of higher levels of p,p'-DDT than the degradation products (p,p'-DDD and p,p'-DDE), and higher levels of endosulfan isomers (α and β) than the sulphate, in fish samples, implied recent exposure of fish to DDT and endosulfan, respectively. Generally, most of the fish samples had residue levels above the average method detection limits (MDLs), but were within the calculated ADI. - Fish from Lake Victoria had relatively low pesticide levels
Focardi, Silvia; Corsi, Ilaria; Mazzuoli, Stefania; Vignoli, Leonardo; Loiselle, Steven A; Focardi, Silvano
2006-11-01
Aquatic ecosystems around the world, lake, estuaries and coastal areas are increasingly impacted by anthropogenic pollutants through different sources such as agricultural, industrial and urban discharges, atmospheric deposition and terrestrial drainage. Lake Victoria is the second largest lake in the world and the largest tropical lake. Bordered by Tanzania, Uganda, and Kenya, it provides a livelihood for millions of Africans in the region. However, the lake is under threat from eutrophication, a huge decline in the number of native fish species caused by several factors including loss of biodiversity, over fishing and pollution has been recently documented. Increasing usage of pesticides and insecticides in the adjacent agricultural areas as well as mercury contamination from processing of gold ore on the southern shores are currently considered among the most emergent phenomena of chemical contamination in the lake. By the application of globally consistent and comprehensive geospatial data-sets based on remote sensing integrated with information on heavy metals accumulation and insecticides exposure in native and alien fish populations, the present study aims at assessing the environmental risk associated to the contamination of the Lake Victoria water body on fish health, land cover distribution, biodiversity and the agricultural area surrounding the lake. By the elaboration of Landsat 7 TM data of November 2002 and Landsat 7 TM 1986 we have calculated the agriculture area which borders the Lake Victoria bay, which is an upland plain. The resulting enhanced nutrient loading to the soil is subsequently transported to the lake by rain or as dry fall. The data has been inserted in a Geographical information System (ARCGIS) to be upgraded and consulted. Heavy metals in fish fillets showed concentrations rather low except for mercury being higher than others as already described in previous investigations. In the same tissue, cholinesterases activity (ChE) as an
Standley, C J; Stothard, J R
2012-10-01
While Schistosoma rodhaini is typically considered a parasite of small mammals and is very scantly distributed in the Lake Victoria basin, it is known to hybridize with the more widespread Schistosoma mansoni, the causative agent of intestinal schistosomiasis. As part of broader parasitological and malacological surveys for S. mansoni across Lake Victoria, schistosome cercariae were harvested from a field-caught Biomphalaria choanomphala taken on Ngamba Island Chimpanzee Sanctuary, Uganda. Upon DNA barcoding, these cercariae were found to be a mixture of both S. rodhaini and S. mansoni, with further phylogenetic analysis revealing a hitherto unknown sub-lineage within S. rodhaini. Despite repeated sampling for eggs and miracidia from both chimpanzees and staff on Ngamba Island Sanctuary, detection of S. rodhaini within local definitive hosts awaits additional efforts, which should be mindful of a potential host role of spotted-necked otters.
Berke, M.A.; Johnson, T.C.; Werne, J.P.; Grice, K.; Schouten, S.; Sinninghe Damsté, J.S.
2012-01-01
New molecular proxies of temperature and hydrology are helping to constrain tropical climate change and elucidate possible forcing mechanisms during the Holocene. Here, we examine a similar to 14,000 year record of climate variability from Lake Victoria, East Africa, the world's second largest
Energy Technology Data Exchange (ETDEWEB)
Henry, L. [Chemistry Department, University of Dar es Salaam. PO Box 35061, Dar es Salaam (Tanzania); Kishimba, M.A. [Chemistry Department, University of Dar es Salaam. PO Box 35061, Dar es Salaam (Tanzania)]. E-mail: kishimba@chem.udsm.ac.tz
2006-03-15
Nile tilapia (Oreochromis niloticus) and Nile perch (Lates niloticus) samples were collected from fish landing stations in nine riparian districts on the Tanzanian side of Lake Victoria and screened for residues of 64 organochlorine, organophosphorus, carbamate, and pyrethroid pesticides. The residue levels in the fish fillet were up to 0.003, 0.03 and 0.2 mg/kg fresh weight (0.7, 3.8 and 42 mg/kg lipid weight) of fenitrothion, DDT and endosulfan, respectively. Mean levels within sites were up to 0.002, 0.02 and 0.1 mg/kg fresh weight (0.5, 0.5 and 16 mg/kg lipid weight), respectively. The detection of higher levels of p,p'-DDT than the degradation products (p,p'-DDD and p,p'-DDE), and higher levels of endosulfan isomers ({alpha} and {beta}) than the sulphate, in fish samples, implied recent exposure of fish to DDT and endosulfan, respectively. Generally, most of the fish samples had residue levels above the average method detection limits (MDLs), but were within the calculated ADI. - Fish from Lake Victoria had relatively low pesticide levels.
Tsetse fly (G. f. fuscipes distribution in the Lake Victoria basin of Uganda.
Directory of Open Access Journals (Sweden)
Mugenyi Albert
2015-04-01
Full Text Available Tsetse flies transmit trypanosomes, the causative agent of human and animal African trypanosomiasis. The tsetse vector is extensively distributed across sub-Saharan Africa. Trypanosomiasis maintenance is determined by the interrelationship of three elements: vertebrate host, parasite and the vector responsible for transmission. Mapping the distribution and abundance of tsetse flies assists in predicting trypanosomiasis distributions and developing rational strategies for disease and vector control. Given scarce resources to carry out regular full scale field tsetse surveys to up-date existing tsetse maps, there is a need to devise inexpensive means for regularly obtaining dependable area-wide tsetse data to guide control activities. In this study we used spatial epidemiological modelling techniques (logistic regression involving 5000 field-based tsetse-data (G. f. fuscipes points over an area of 40,000 km2, with satellite-derived environmental surrogates composed of precipitation, temperature, land cover, normalised difference vegetation index (NDVI and elevation at the sub-national level. We used these extensive tsetse data to analyse the relationships between presence of tsetse (G. f. fuscipes and environmental variables. The strength of the results was enhanced through the application of a spatial autologistic regression model (SARM. Using the SARM we showed that the probability of tsetse presence increased with proportion of forest cover and riverine vegetation. The key outputs are a predictive tsetse distribution map for the Lake Victoria basin of Uganda and an improved understanding of the association between tsetse presence and environmental variables. The predicted spatial distribution of tsetse in the Lake Victoria basin of Uganda will provide significant new information to assist with the spatial targeting of tsetse and trypanosomiasis control.
International Nuclear Information System (INIS)
Koutsouris, A J; Destouni, G; Jarsjoe, J; Lyon, S W
2010-01-01
Unreliable rainfall may be a main cause of poverty in rural areas, such as the Kisumu district by Lake Victoria in Kenya. Climate change may further increase the negative effects of rainfall uncertainty. These effects could be mitigated to some extent through improved and adaptive water resource management and planning, which relies on our interpretations and projections of the coupled hydro-climatic system behaviour and its development trends. In order to identify and quantify the main differences and consistencies among such hydro-climatic assessments, this study investigates trends and exemplifies their use for important water management decisions for the Lake Victoria drainage basin (LVDB), based on local scale data for the Orongo village in the Kisumu district, and regional scale data for the whole LVDB. Results show low correlation between locally and regionally observed hydro-climatic trends, and large differences, which in turn affects assessments of important water resource management parameters. However, both data scales converge in indicating that observed local and regional hydrological discharge trends are primarily driven by local and regional water use and land use changes.
Red Lake Band of Chippewa Indians response to the draft area recommendation report
International Nuclear Information System (INIS)
1986-01-01
The statement of Little Rock, a Chief of the Red Lake Band of Chippewa Indians, provides the genesis of the Red Lake Band of Chippewa Indian's response to the Department of Energy's efforts to establish a nuclear waste repository on lands ceded under the Treaty of 1863. Of paramount interest to the Red Lake Band of Chippewa Indians are the unresolved issues of hunting and fishing rights, promised in the Treaty negotiations of 1863 and still unresolved to the satisfaction of Tribal members. Comments pertaining to the draft Area Recommendation Report will address the potential impact of a high-level nuclear repository on the human and natural resources of the Red Lake Band of Chippewa Indians. Socio-cultural factors of economics and family displacement and traditional beliefs, combined with potential hazards to natural habitats of wildlife, will be analyzed and synthesized for applicable conclusions. 18 refs., 4 tabs
Mzighani, Semvua I; Nikaido, Masato; Takeda, Miyuki; Seehausen, Ole; Budeba, Yohana L; Ngatunga, Benjamin P; Katunzi, Egid F B; Aibara, Mitsuto; Mizoiri, Shinji; Sato, Tetsu; Tachida, Hidenori; Okada, Norihiro
2010-01-15
More than 500 endemic haplochromine cichlid species inhabit Lake Victoria. This striking species diversity is a classical example of recent explosive adaptive radiation thought to have happened within the last approximately 15,000 years. In this study, we examined the population structure and historical demography of 3 pelagic haplochromine cichlid species that resemble in morphology and have similar niche, Haplochromis (Yssichromis) laparogramma, Haplochromis (Y.) pyrrhocephalus, and Haplochromis (Y.) sp. "glaucocephalus". We investigated the sequences of the mitochondrial DNA control region and the insertion patterns of short interspersed elements (SINEs) of 759 individuals. We show that sympatric forms are genetically differentiated in 4 of 6 cases, but we also found apparent weakening of the genetic differentiation in areas with turbid water. We estimated the timings of population expansion and species divergence to coincide with the refilling of the lake at the Pleistocene/Holocene boundary. We also found that estimates can be altered significantly by the choice of the shape of the molecular clock. If we employ the nonlinear clock model of evolutionary rates in which the rates are higher towards the recent, the population expansion was dated at around the event of desiccation of the lake ca. 17,000 YBP. Thus, we succeeded in clarifying the species and population structure of closely related Lake Victoria cichlids and in showing the importance of applying appropriate clock calibrations in elucidating recent evolutionary events.
Chemodenitrification in the cryoecosystem of Lake Vida, Victoria Valley, Antarctica.
Ostrom, N E; Gandhi, H; Trubl, G; Murray, A E
2016-11-01
Lake Vida, in the Victoria Valley of East Antarctica, is frozen, yet harbors liquid brine (~20% salt, >6 times seawater) intercalated in the ice below 16 m. The brine has been isolated from the surface for several thousand years. The brine conditions (permanently dark, -13.4 °C, lack of O 2 , and pH of 6.2) and geochemistry are highly unusual. For example, nitrous oxide (N 2 O) is present at a concentration among the highest reported for an aquatic environment. Only a minor 17 O anomaly was observed in N 2 O, indicating that this gas was predominantly formed in the lake. In contrast, the 17 O anomaly in nitrate (NO3-) in Lake Vida brine indicates that approximately half or more of the NO3- present is derived from atmospheric deposition. Lake Vida brine was incubated in the presence of 15 N-enriched substrates for 40 days. We did not detect microbial nitrification, dissimilatory reduction of NO3- to ammonium (NH4+), anaerobic ammonium oxidation, or denitrification of N 2 O under the conditions tested. In the presence of 15 N-enriched nitrite (NO2-), both N 2 and N 2 O exhibited substantial 15 N enrichments; however, isotopic enrichment declined with time, which is unexpected. Additions of 15 N-NO2- alone and in the presence of HgCl 2 and ZnCl 2 to aged brine at -13 °C resulted in linear increases in the δ 15 N of N 2 O with time. As HgCl 2 and ZnCl 2 are effective biocides, we interpret N 2 O production in the aged brine to be the result of chemodenitrification. With this understanding, we interpret our results from the field incubations as the result of chemodenitrification stimulated by the addition of 15 N-enriched NO2- and ZnCl 2 and determined rates of N 2 O and N 2 production of 4.11-41.18 and 0.55-1.75 nmol L -1 day -1 , respectively. If these rates are representative of natural production, the current concentration of N 2 O in Lake Vida could have been reached between 6 and 465 years. Thus, chemodenitrification alone is sufficient to explain the
Konijnendijk, N.; Joyce, D.A.; Mrosso, H.D.J.; Egas, M.; Seehausen, O.
2011-01-01
We examined genetic structure among five species of Lake Victoria haplochromine cichlids in four island communities, using a full factorial sampling design that compared genetic differentiation between pairs of species and populations of varying morphological similarity and geographical proximity.
Ajamma, Yvonne Ukamaka; Villinger, Jandouwe; Omondi, David; Salifu, Daisy; Onchuru, Thomas Ogao; Njoroge, Laban; Muigai, Anne W. T.; Masiga, Daniel K.
2016-01-01
The Lake Baringo and Lake Victoria regions of Kenya are associated with high seroprevalence of mosquito-transmitted arboviruses. However, molecular identification of potential mosquito vector species, including morphologically identified ones, remains scarce. To estimate the diversity, abundance, and distribution of mosquito vectors on the mainland shores and adjacent inhabited islands in these regions, we collected and morphologically identified adult and immature mosquitoes and obtained the corresponding sequence variation at cytochrome c oxidase 1 (COI) and internal transcribed spacer region 2 (ITS2) gene regions. A total of 63 species (including five subspecies) were collected from both study areas, 47 of which have previously been implicated as disease vectors. Fourteen species were found only on island sites, which are rarely included in mosquito diversity surveys. We collected more mosquitoes, yet with lower species composition, at Lake Baringo (40,229 mosquitoes, 32 species) than at Lake Victoria (22,393 mosquitoes, 54 species). Phylogenetic analysis of COI gene sequences revealed Culex perexiguus and Cx. tenagius that could not be distinguished morphologically. Most Culex species clustered into a heterogeneous clade with closely related sequences, while Culex pipiens clustered into two distinct COI and ITS2 clades. These data suggest limitations in current morphological identification keys. This is the first DNA barcode report of Kenyan mosquitoes. To improve mosquito species identification, morphological identifications should be supported by their molecular data, while diversity surveys should target both adults and immatures. The diversity of native mosquito disease vectors identified in this study impacts disease transmission risks to humans and livestock. PMID:27402888
Hyseni, Chaz; Kato, Agapitus B; Okedi, Loyce M; Masembe, Charles; Ouma, Johnson O; Aksoy, Serap; Caccone, Adalgisa
2012-01-01
Abstract Background Glossina fuscipes fuscipes is the primary vector of trypanosomiasis in humans and livestock in Uganda. The Lake Victoria basin has been targeted for tsetse eradication using a rolling carpet initiative, from west to east, with four operational blocks (3 in Uganda and 1 in Kenya), under a Pan-African Tsetse and Trypanosomiasis Eradication Campaign (PATTEC). We screened tsetse flies from the three Ugandan PATTEC blocks for genetic diversity at 15 microsatellite loci from con...
Juma, Dauglas Wafula; Wang, Hongtao; Li, Fengting
2014-04-01
Anthropogenic-induced water quality pollution is a major environmental problem in freshwater ecosystems today. As a result of this, eutrophication of lakes occurs. Population and economic development are key drivers of water resource pollution. To evaluate how growth in the riparian population and in the gross domestic product (GDP) with unplanned development affects the water quality of the lake, this paper evaluates Lake Victoria Kenyan waters basin. Waters quality data between 1990 and 2012 were analyzed along with reviews of published literature, papers, and reports. The nitrate-nitrogen (NO3-N), soluble phosphorus (PO4-P), chlorophyll a, and Secchi transparencies were evaluated as they are key water quality indicators. The NO3-N increased from 10 μg l(-1) in 1990 to 98 μg 1(-1) in 2008, while PO4-P increased from 4 μg l(-1) in 1990 to 57 μg l(-1) in 2008. The population and economic growth of Kenya are increasing with both having minimums in 1990 of 24.143 million people and 12.18 billion US dollars, to maximums in 2010 of 39.742 million people and 32.163 billion US dollars, respectively. A Secchi transparency is reducing with time, indicating an increasing pollution. This was confirmed by an increase in aquatic vegetation using an analysis of moderate resolution imaging spectroradiometer (MODIS) images of 2000 and 2012 of Kenyan waters. This study found that increasing population and GDP increases pollution discharge thus polluting lakes. One of major factors causing lake water pollution is the unplanned or poor waste management policy and service.
Directory of Open Access Journals (Sweden)
Richard E Sanya
2017-10-01
Full Text Available Praziquantel-based mass treatment is the main approach to controlling schistosomiasis mansoni in endemic areas. Interventions such as provision and use of safe water, minimising contact with infested water, disposal of stool in latrines and snail control provide key avenues to break the transmission cycle and can sustain the benefits of mass treatment in the long term. Efforts are also being made to develop a schistosomiasis vaccine which, if effective, might reduce the incidence of re-infection after treatment. However, any interventions deployed need to be acceptable to, and sustainable by, the target communities.In this qualitative study, we investigated the perceptions of six Lake Victoria island communities of Koome, Uganda, about interventions to control Schistosoma mansoni infection and their willingness to participate in Schistosoma vaccine trials. Thirty-two in-depth interviews, 12 key informant interviews and 10 focus group discussions were conducted. Data were analysed using a thematic content approach.Intestinal schistosomiasis was not regarded as a serious health problem because a mass treatment programme is in place. However, the communities lack safe water sources and latrines. Mass treatment with praziquantel, safe water supplies and use of toilets were deemed the most acceptable interventions by the participants. The communities are willing to participate in Schistosoma vaccine trials.Knowledge of a community's perception about interventions to control schistosomiasis can be valuable to policy makers and programme implementers intending to set up interventions co-managed by the community members. In this study, the views of the Lake Victoria island communities of Koome are presented. This study also provides data to guide further work on alternative interventions such as Schistosoma vaccine trials in these communities.
Sanya, Richard E; Tumwesige, Edward; Elliott, Alison M; Seeley, Janet
2017-10-01
Praziquantel-based mass treatment is the main approach to controlling schistosomiasis mansoni in endemic areas. Interventions such as provision and use of safe water, minimising contact with infested water, disposal of stool in latrines and snail control provide key avenues to break the transmission cycle and can sustain the benefits of mass treatment in the long term. Efforts are also being made to develop a schistosomiasis vaccine which, if effective, might reduce the incidence of re-infection after treatment. However, any interventions deployed need to be acceptable to, and sustainable by, the target communities. In this qualitative study, we investigated the perceptions of six Lake Victoria island communities of Koome, Uganda, about interventions to control Schistosoma mansoni infection and their willingness to participate in Schistosoma vaccine trials. Thirty-two in-depth interviews, 12 key informant interviews and 10 focus group discussions were conducted. Data were analysed using a thematic content approach. Intestinal schistosomiasis was not regarded as a serious health problem because a mass treatment programme is in place. However, the communities lack safe water sources and latrines. Mass treatment with praziquantel, safe water supplies and use of toilets were deemed the most acceptable interventions by the participants. The communities are willing to participate in Schistosoma vaccine trials. Knowledge of a community's perception about interventions to control schistosomiasis can be valuable to policy makers and programme implementers intending to set up interventions co-managed by the community members. In this study, the views of the Lake Victoria island communities of Koome are presented. This study also provides data to guide further work on alternative interventions such as Schistosoma vaccine trials in these communities.
Directory of Open Access Journals (Sweden)
R. Argent
2015-01-01
Full Text Available Lake Victoria, Africa, supports millions of people. To produce reliable climate projections, it is desirable to successfully model the rainfall over the lake accurately. An initial step is taken here with customization of the Weather, Research, and Forecast (WRF model. Of particular interest is an asymmetrical rainfall pattern across the lake basin, due to a diurnal land-lake breeze. The main aim is to present a customization framework for use over the lake. This framework is developed by conducting several series of model runs to investigate aspects of the customization. The runs are analyzed using Tropical Rainfall Measuring Mission rainfall data and Climatic Research Unit temperature data. The study shows that the choice of parameters and lake surface temperature initialization can significantly alter the results. Also, the optimal physics combinations for the climatology may not necessarily be suitable for all circumstances, such as extreme years. The study concludes that WRF is unable to reproduce the pattern across the lake. The temperature of the lake is too cold and this prevents the diurnal land-lake breeze reversal. Overall, this study highlights the importance of customizing a model to the region of research and presents a framework through which this may be achieved.
Lindgren, R.J.
1996-01-01
Among the duties of the water managers of the Leech Lake Indian Reservation in north-central Minnesota are the development and protection of the water resources of the Reservation. The U.S. Geological Survey, in cooperation with the Leech Lake Indian Reservation Business Committee, conducted a three and one half-year study (1988-91) of the ground-water resources of the Leech Lake Indian Reservation. The objectives of this study were to describe the availability and quality of ground water contained in glacial-drift aquifers underlying the Reservation.
Kambewa, E.
2007-01-01
Keywords: people, profit, planet, marketing channels, contracts, sustainability, quality,
The rise and fall of water hyacinth in Lake Victoria and the Kagera River basin, 1989-2001
Albright, Thomas P.; Moorhouse, T.G.; McNabb, T.J.
2004-01-01
Water hyacinth (Eichhornia crassipes (Mart.) Solms) is an invasive aquatic macrophyte associated with major negative economic and ecological impacts to the Lake Victoria region since the plant's establishment in Uganda in the 1980s. Reliable estimates of water hyacinth distribution and extent are required to gauge the severity of the problem through time, relate water hyacinth abundance to environmental factors, identify areas requiring management action, and assess the efficacy of management actions. To provide such estimates and demonstrate the utility of remote sensing for this application, we processed and analyzed remotely sensed imagery to determine the distribution and extent of water hyacinth. Maps were produced and coverage was quantified using a hybrid unsupervised image classification approach with manual editing for each of the riparian countries of Kenya, Tanzania, and Uganda, as well as for numerous gulfs and bays. A similar procedure was carried out for selected lakes in the Rwanda-Tanzania borderlands lakes region in the Kagera River basin. Results confirm the severity of the water hyacinth infestation, especially in the northern parts of the lake. A maximum lake-wide extent of at least 17,374 ha was attained in 1998. Following this, a combination of factors, including conditions associated with the 1997 to 1998 El Nin??o and biocontrol with water hyacinth weevils, appear to have contributed to a major decline in water hyacinth in the most affected parts of the lake. Some lakes in the Kagera basin, such as Lake Mihindi, Rwanda, were severely infested in the late 1990s, but the level of infestation in most of these decreased markedly by the early 2000s.
Intestinal schistosomiasis among preschool children along the shores of Lake Victoria in Uganda
DEFF Research Database (Denmark)
Nalugwa, A.; Olsen, Annette; Tukahebwa, M. E.
2015-01-01
Schistosomiasis, a disease caused by Schistosoma trematode parasites, affects hundreds of millions of people and accounts for more than 40% of the global health burden due to neglected tropical diseases. In Uganda, intestinal schistosomiasis is endemic in 73 out of 112 districts and about 55......% of the population of 36 million individuals are at risk. There is scanty information on the status and burden of schistosomiasis in preschool children less than six years of age in Uganda. This study aimed to assess the status of Schistosoma mansoni infections in children aged 1-5 years in Uganda. S. mansoni...... prevalence and intensity of infection were examined in 3058 children from 5 districts along Lake Victoria shoreline, eastern Uganda. For each child one stool sample was collected on three consecutive days. The Kato-Katz technique was used to prepare stool smears on slides for microscopic examination. Short...
Directory of Open Access Journals (Sweden)
David Omondi
2017-06-01
Full Text Available Although diverse tick-borne pathogens (TBPs are endemic to East Africa, with recognized impact on human and livestock health, their diversity and specific interactions with tick and vertebrate host species remain poorly understood in the region. In particular, the role of reptiles in TBP epidemiology remains unknown, despite having been implicated with TBPs of livestock among exported tortoises and lizards. Understanding TBP ecologies, and the potential role of common reptiles, is critical for the development of targeted transmission control strategies for these neglected tropical disease agents. During the wet months (April–May; October–December of 2012–2013, we surveyed TBP diversity among 4,126 ticks parasitizing livestock and reptiles at homesteads along the shores and islands of Lake Baringo and Lake Victoria in Kenya, regions endemic to diverse neglected tick-borne diseases. After morphological identification of 13 distinct Rhipicephalus, Amblyomma, and Hyalomma tick species, ticks were pooled (≤8 individuals by species, host, sampling site, and collection date into 585 tick pools. By supplementing previously established molecular assays for TBP detection with high-resolution melting analysis of PCR products before sequencing, we identified high frequencies of potential disease agents of ehrlichiosis (12.48% Ehrlichia ruminantium, 9.06% Ehrlichia canis, anaplasmosis (6.32% Anaplasma ovis, 14.36% Anaplasma platys, and 3.08% Anaplasma bovis,, and rickettsiosis (6.15% Rickettsia africae, 2.22% Rickettsia aeschlimannii, 4.27% Rickettsia rhipicephali, and 4.95% Rickettsia spp., as well as Paracoccus sp. and apicomplexan hemoparasites (0.51% Theileria sp., 2.56% Hepatozoon fitzsimonsi, and 1.37% Babesia caballi among tick pools. Notably, we identified E. ruminantium in both Amblyomma and Rhipicephalus pools of ticks sampled from livestock in both study areas as well as in Amblyomma falsomarmoreum (66.7% and Amblyomma nuttalli (100
Omondi, David; Masiga, Daniel K; Fielding, Burtram C; Kariuki, Edward; Ajamma, Yvonne Ukamaka; Mwamuye, Micky M; Ouso, Daniel O; Villinger, Jandouwe
2017-01-01
Although diverse tick-borne pathogens (TBPs) are endemic to East Africa, with recognized impact on human and livestock health, their diversity and specific interactions with tick and vertebrate host species remain poorly understood in the region. In particular, the role of reptiles in TBP epidemiology remains unknown, despite having been implicated with TBPs of livestock among exported tortoises and lizards. Understanding TBP ecologies, and the potential role of common reptiles, is critical for the development of targeted transmission control strategies for these neglected tropical disease agents. During the wet months (April-May; October-December) of 2012-2013, we surveyed TBP diversity among 4,126 ticks parasitizing livestock and reptiles at homesteads along the shores and islands of Lake Baringo and Lake Victoria in Kenya, regions endemic to diverse neglected tick-borne diseases. After morphological identification of 13 distinct Rhipicephalus, Amblyomma , and Hyalomma tick species, ticks were pooled (≤8 individuals) by species, host, sampling site, and collection date into 585 tick pools. By supplementing previously established molecular assays for TBP detection with high-resolution melting analysis of PCR products before sequencing, we identified high frequencies of potential disease agents of ehrlichiosis (12.48% Ehrlichia ruminantium , 9.06% Ehrlichia canis ), anaplasmosis (6.32% Anaplasma ovis , 14.36% Anaplasma platys , and 3.08% Anaplasma bovis ,), and rickettsiosis (6.15% Rickettsia africae , 2.22% Rickettsia aeschlimannii , 4.27% Rickettsia rhipicephali , and 4.95% Rickettsia spp.), as well as Paracoccus sp. and apicomplexan hemoparasites (0.51% Theileria sp., 2.56% Hepatozoon fitzsimonsi , and 1.37% Babesia caballi ) among tick pools. Notably, we identified E. ruminantium in both Amblyomma and Rhipicephalus pools of ticks sampled from livestock in both study areas as well as in Amblyomma falsomarmoreum (66.7%) and Amblyomma nuttalli (100%) sampled
Microbial quality and safety of fresh and dried Rastrineobola argentea from Lake Victoria, Tanzania
DEFF Research Database (Denmark)
Baniga, Zebedayo; Dalsgaard, Anders; Mhongole, Ofred J
2017-01-01
the bacteriological quality of fresh and dried sardines from Lake Victoria. Sardine samples were randomly collected from main landing sites and retail markets in the city of Mwanza. Total viable counts (TVC) in fresh sardines were in the range of 5.18–7.90 log10 cfu/g while those dried on racks contained 3.......13–4.85 log10 cfu/g which were 0.75% of those dried on sand with 4.80–7.13 log10 cfu/g (p .../g and those dried on sand contained 1.18–3.32 log10 mpn/g, however, sardines dried on racks, did not contain any E. coli. Similar findings were found in the two types of dried sardines from the retail markets. Prevalence of Salmonella spp. in fresh R. argentea was 25% (n = 40), sand dried sardines at landing...
Application of Satellite Observations to Manage Natural Disasters in the Lake Victoria Basin
Habib, Shahid; Policelli, F.; Irwin, D.; Korme, Tesfaye; Adler, Bob; Hong, Yang
2010-01-01
Lake Victoria, the second largest fresh water lake in the Eastern part of Africa is a vital natural resource for the economic well being and prosperity of over 30 million people located in riparian regions of Uganda, Kenya and Tanzania. It covers a large area of about 68,870 km2 and produces a GDP of about US $30 billion per year. The region is also very much prone to natural disasters such as severe floods during heavy precipitation periods in the Eastern part of Africa. In addition to floods, the precipitation also produces large infestations of mosquito larvae due to the standing water in many areas. This further causes multiple vector borne diseases such as Malaria, Rift Valley Fever and more. These problems are of serious concern and require active and aggressive surveillance and management to minimize the loss of human and animal lives and property damage. Satellite imagery and observations along with the in situ measurements provide a great tool to analyze and study this area and inform the policy makers to make calculated policy decisions which are more beneficial to the environment. Recently, NASA and USAID have joined forces with the Regional Center for Mapping of Resources for Development (RCMRD) located in Nairobi, Kenya to utilize multiple NASA sensors such as TRMM, SRTM and MODIS to develop flood potential maps for the Lake Victoria Basin. The idea is to generate a flood forecasts and "nowcasts" that can be sent to the disaster management organizations of Uganda, Kenya, and Tanzania. Post flood event satellite imagery is becoming a common tool to assess the areas inundated by flooding. However, this work is unique undertaking by utilizing land imaging and atmospheric satellites to build credible flood potential maps. At same time, we are also studying the potential occurrence and spread of Rift Valley Fever disease based on the short term climate records and precipitation data. These activities require multi-nation coordination and agreements and
Characterization of V1R receptor (ora) genes in Lake Victoria cichlids.
Ota, Tomoki; Nikaido, Masato; Suzuki, Hikoyu; Hagino-Yamagishi, Kimiko; Okada, Norihiro
2012-05-15
Although olfaction could play a crucial role in underwater habitats by allowing fish to sense a variety of nonvolatile chemical signals, the importance of olfaction in species-rich cichlids is still controversial. In particular, examining whether cichlids rely on olfaction for reproduction is of primary interest to understand the mechanisms of speciation. In the present study, we explored the V1R (also known as ora) genes, which are believed to encode reproductive pheromone receptors in fish, in the genomes of Lake Victoria cichlids. By screening a bacterial artificial chromosome library, we identified all six intact V1R genes (V1R1 to V1R6) that have been reported in other teleost fish. Furthermore, RT-PCR and in situ hybridization analyses showed that all of the V1R genes were expressed in the olfactory epithelium, indicating that these receptors are functional in cichlids. These observations indicate that cichlids use V1R-mediated olfaction in some ways for their social behaviors. Copyright © 2012 Elsevier B.V. All rights reserved.
Red Indian Lake fishway, an innovative design for difficult conditions
International Nuclear Information System (INIS)
Helwig, P.C.; Goosney, R.; Smith, W.L.
1993-01-01
Red Indian Lake Dam is a large concrete gravity structure, 10-12 m high and 245 m long, in the Exploits River watershed in Newfoundland. The watershed is an ideal habitat for production of Atlantic salmon. Since 1985, the watershed above the dam has undergone an extensive stocking program to optimize the salmon production capacity of the upper reaches of the system. To sustain this development, a fishway was needed to permit returning salmon to bypass Red Indian Lake Dam, the last remaining migrational barrier. The difficulties with installing a fishway at the dam site included extreme variation in upstream water levels, the need to retrofit a fishway into an existing structure, and the necessity to attract fish into the fishway in competition with other flows from power plant, spillway, or waterfall. After examining several design approaches, an innovative design was developed incorporating two separate but interrelated flow ways: one to handle attraction water and the other for transportation water. The latter passage leads to a trap at the upper end of the fishway from which salmon are hoisted via a hopper/monorail system across the dam and into the lake. Construction of the fishway was staged over four phases between December 1985 and December 1988. 3 refs., 1 fig
Limaye, Ashutosh; Mugo, Robinson; Wanjohi, James; Farah, Hussein; Wahome, Anastasia; Flores, Africa; Irwin, Dan
2016-01-01
Various land use changes driven by urbanization, conversion of grasslands and woodlands into farmlands, intensification of agricultural practices, deforestation, land fragmentation and degradation are taking place in Africa. In Kenya, agriculture is the main driver of land use conversions. The impacts of these land use changes are observable in land cover maps, and eventually in the hydrological systems. Reduction or change of natural vegetation cover types increases the speed of surface runoff and reduces water and nutrient retention capacities. This can lead to high nutrient inputs into lakes, resulting in eutrophication, siltation and infestation of floating aquatic vegetation. To assess if changes in land use could be contributing to increased phytoplankton blooms and sediment loads into Lake Victoria, we analyzed land use land cover data from Landsat, as well as surface chlorophyll-a and total suspended matter from MODIS-Aqua sensor.
Hydroclimatology of Lake Victoria region using hydrologic model and satellite remote sensing data
Directory of Open Access Journals (Sweden)
S. I. Khan
2011-01-01
Full Text Available Study of hydro-climatology at a range of temporal scales is important in understanding and ultimately mitigating the potential severe impacts of hydrological extreme events such as floods and droughts. Using daily in-situ data over the last two decades combined with the recently available multiple-years satellite remote sensing data, we analyzed and simulated, with a distributed hydrologic model, the hydro-climatology in Nzoia, one of the major contributing sub-basins of Lake Victoria in the East African highlands. The basin, with a semi arid climate, has no sustained base flow contribution to Lake Victoria. The short spell of high discharge showed that rain is the prime cause of floods in the basin. There is only a marginal increase in annual mean discharge over the last 21 years. The 2-, 5- and 10- year peak discharges, for the entire study period showed that more years since the mid 1990's have had high peak discharges despite having relatively less annual rain. The study also presents the hydrologic model calibration and validation results over the Nzoia basin. The spatiotemporal variability of the water cycle components were quantified using a hydrologic model, with in-situ and multi-satellite remote sensing datasets. The model is calibrated using daily observed discharge data for the period between 1985 and 1999, for which model performance is estimated with a Nash Sutcliffe Efficiency (NSCE of 0.87 and 0.23% bias. The model validation showed an error metrics with NSCE of 0.65 and 1.04% bias. Moreover, the hydrologic capability of satellite precipitation (TRMM-3B42 V6 is evaluated. In terms of reconstruction of the water cycle components the spatial distribution and time series of modeling results for precipitation and runoff showed considerable agreement with the monthly model runoff estimates and gauge observations. Runoff values responded to precipitation events that occurred across the catchment during the wet season from March to
DEFF Research Database (Denmark)
Lange, C. N.; Kristensen, Thomas K.; Madsen, Henry
2013-01-01
We investigated freshwater gastropod diversity, abundance and distribution in habitats with and without anthropogenic disturbance in two localities, Ndere in the Winam Gulf and Mbita Point, Lake Victoria, Kenya, from May 2002 to January 2004. A total of 133 984 gastropod specimens belonging to 15...... species were recorded, 14 from Mbita and 12 from Ndere. Two species, Ferrissia kavirondica and Cleopatra cridlandi, which were recorded only from undisturbed habitats, could be indicators of least disturbed habitats. Water chemistry did differ between fish landing sites and undisturbed habitats at some......, while other species may not tolerate these changes. In order to protect gastropod diversity and avoid dominance of intermediate hosts, such as B. choanomphala, a management plan for the use of these fish landing sites should be developed. This could include rules on how to dispose of fish remnants...
International Nuclear Information System (INIS)
Strange, N.E.; Bodaly, R.A.; Fudge, R.J.P.
1991-01-01
Southern Indian and Issett Lakes in northern Manitoba were flooded in 1976 as part of Manitoba Hydro's Churchill River diversion project. Fish were collected from 1975 to 1988 from five regional sites on the lakes to examine the effects of impoundment and river diversion on muscle mercury concentrations. Raw data for individual fish caught in 1987 and 1988 are presented, along with means and analyses calculated over the entire 1975-1988 study period. Mercury concentrations in whitefish, pike, and walleye increased significantly after impoundment. Whitefish mercury levels peaked in 1978 and have since declined to near pre-flooding levels. Northern pike and walleye mercury levels were much higher than for whitefish. Pike mercury concentrations showed no indication of declining after 12 years of impoundment, but walleye mercury levels at 2 of the 5 Southern Indian Lake sites declined from maximum recorded levels. Significant variability in fish mercury concentrations was noted both from year to year and among the sites. It is suggested that site-to-site variations are due to varying conditions in the reservoir which stimulate mercury methylation. Since there appears to be an ongoing long-term source of mercury and organic material from the eroding shorelines, pike and walleye mercury concentrations are expected to remain high for many years. 25 refs., 7 figs., 20 tabs
2012-02-22
... DEPARTMENT OF THE INTERIOR Bureau of Indian Affairs Match-E-Be-Nash-She-Wish Band of Pottawatomi Indians (Gun Lake)-- Amendment to Liquor Beverage Control Ordinance AGENCY: Bureau of Indian Affairs, Interior. ACTION: Notice SUMMARY: This notice publishes the amendments to the Match-E-Be-Nash- She-Wish...
Tumwesigye, Nazarius M; Atuyambe, Lynn; Kibira, Simon P S; Wabwire-Mangen, Fred; Tushemerirwe, Florence; Wagner, Glenn J
2013-09-01
Fish landing sites have high levels of harmful use of alcohol. This paper examines the role of religion and religiosity on alcohol consumption at two fish landing sites on Lake Victoria in Uganda. Questionnaires were administered to randomly selected people at the sites. Dependent variables included alcohol consumption during the previous 30 days, whereas the key independent variables were religion and religiosity. Bivariate and multivariate analysis techniques were applied. People reporting low religiosity were five times more likely to have consumed alcohol (95% confidence interval: 2.45-10.04) compared with those reporting low/average religiosity. Religion and religiosity are potential channels for controlling alcohol use.
Satellite lakes as reservoirs of fish species diversity
Nkalubo, W.; Wandera, S.B.; Namulemo, G.
2010-01-01
Satellite lakes and rivers in the Victoria and Kyoga basins provide a sanctuary for endangered native fish species. The structural heterogeneity of macrophyte covering these lakes has made it possible for most of the biodiversity to be kept intact. The Kyoga minor lakes have the highest fish species diversity especially of the haplochromines. Most fish communities of these satellite lakes are composed of native species.
Scenario-based water resources planning for utilities in the Lake Victoria region
Mehta, Vishal K.; Aslam, Omar; Dale, Larry; Miller, Norman; Purkey, David R.
Urban areas in the Lake Victoria (LV) region are experiencing the highest growth rates in Africa. As efforts to meet increasing demand accelerate, integrated water resources management (IWRM) tools provide opportunities for utilities and other stakeholders to develop a planning framework comprehensive enough to include short term (e.g. landuse change), as well as longer term (e.g. climate change) scenarios. This paper presents IWRM models built using the Water Evaluation And Planning (WEAP) decision support system, for three towns in the LV region - Bukoba (Tanzania), Masaka (Uganda), and Kisii (Kenya). Each model was calibrated under current system performance based on site visits, utility reporting and interviews. Projected water supply, demand, revenues and costs were then evaluated against a combination of climate, demographic and infrastructure scenarios up to 2050. Our results show that water supply in all three towns is currently infrastructure limited; achieving existing design capacity could meet most projected demand until 2020s in Masaka beyond which new supply and conservation strategies would be needed. In Bukoba, reducing leakages would provide little performance improvement in the short-term, but doubling capacity would meet all demands until 2050. In Kisii, major infrastructure investment is urgently needed. In Masaka, streamflow simulations show that wetland sources could satisfy all demand until 2050, but at the cost of almost no water downstream of the intake. These models demonstrate the value of IWRM tools for developing water management plans that integrate hydroclimatology-driven supply to demand projections on a single platform.
International Development Research Centre (IDRC) Digital Library (Canada)
BURUNDI. RWANDA. Indian. Ocean. La ke. Ta n g a n yika. Lake. Victoria. Lake. Malawi. 100 km. Bolstering think tanks. IDRC is strengthening the capacity of three independent policy research institutes in the country. The Think Tank Initiative has awarded core funding to the. • Economic and Social Research Foundation.
International Development Research Centre (IDRC) Digital Library (Canada)
Researchers are working on a vaccine for cattle disease. For more information visit the Regional. Office for Sub-Saharan Africa website: www.idrc.ca/rossa. Subscribe to the IDRC Bulletin: www.idrc.ca/idrcbulletin/. SOMALIA. UGANDA. SUDAN. TANZANIA. Lake. Victoria. Lake. Turkana. INDIAN. OCEAN. Nairobi ✪. ○. ○. ○.
Phytoplankton productivity in newly dug fish ponds within Lake ...
African Journals Online (AJOL)
The declining Lake Victoria fisheries resource led to a growing recognition of aquaculture as a source of livelihood to riparian communities. Finger ponds speculated to naturally stock fish during flooding and retain them during dry seasons were introduced within the lake's wetlands. In order to develop a
Abila, R.
1995-01-01
Lake Victoria, producing over 90% of Kenya's fish, is the principle source of fish for domestic consumption and for export in the country. The three fish species of most economic importance are Lates niloticus, Rastrineobola argentea and Oreochromis species. These constitute 50%, 37% and 6% respectively of the lakes's tonnage. The structure and performance of the marketing system for each of these species differ, depending on certain market features. Among these are the marketing history and ...
climate change and lake water resourcesin sub-saharan africa: case ...
African Journals Online (AJOL)
user
STUDY OF LAKE CHAD AND LAKE VICTORIA ... contribution to agriculture and socio-economic development of the region were ... many developing countries, current levels in water use .... 2050 and will become increasingly urban by implication. ... 4.1 Justification of Selected Case Studies ..... Orstom, Paris France. 1996.
Directory of Open Access Journals (Sweden)
Edwin Kimutai Kanda
2016-11-01
Full Text Available River Nzoia in Kenya, due to its role in transporting industrial and municipal wastes in addition to agricultural runoff to Lake Victoria, is vulnerable to pollution. Dissolved oxygen is one of the most important indicators of water pollution. Artificial neural network (ANN has gained popularity in water quality forecasting. This study aimed at assessing the ability of ANN to predict dissolved oxygen using four input variables of temperature, turbidity, pH and electrical conductivity. Multilayer perceptron network architecture was used in this study. The data consisted of 113 monthly values for the input variables and output variable from 2009–2013 which were split into training and testing datasets. The results obtained during training and testing were satisfactory with R2 varying from 0.79 to 0.94 and RMSE values ranging from 0.34 to 0.64 mg/l which imply that ANN can be used as a monitoring tool in the prediction of dissolved oxygen for River Nzoia considering the non-correlational relationship of the input and output variables. The dissolved oxygen values follow seasonal trend with low values during dry periods.
Kwach, Bowa O; Lalah, Joseph O; Shem, Wandiga O
2009-11-01
Seasonal and offshore concentration variations for selected sixteen priority pollutant polycyclic aromatic hydrocarbons (PAHs) in surface sediments and water of Car Wash and Kisat areas of Winam Gulf, Lake Victoria, have been investigated. PAHs concentrations in sediments and water range from 0.4 to 31.95 microg/g dry weight and 3.32 to 55.8 microg/L, respectively. Statistical analysis of the PAHs concentrations showed that the most contaminated samples are found during rainy season (April, 2006), 5 m offshore for sediments and 10 m offshore for water. Dry season (October, 2005) generally recorded lower concentrations. The variations showed significant difference (p < or = 0.05) with season and distance of sampling from the shore.
Directory of Open Access Journals (Sweden)
Sylvia Kiwuwa-Muyingo
Full Text Available Fishing communities around Lake Victoria in sub-Saharan Africa have been characterised as a population at high risk of HIV-infection.Using data from a cohort of HIV-positive individuals aged 13-49 years, enrolled from 5 fishing communities on Lake Victoria between 2009-2011, we sought to identify factors contributing to the epidemic and to understand the underlying structure of HIV transmission networks. Clinical and socio-demographic data were combined with HIV-1 phylogenetic analyses. HIV-1 gag-p24 and env-gp-41 sub-genomic fragments were amplified and sequenced from 283 HIV-1-infected participants. Phylogenetic clusters with ≥2 highly related sequences were defined as transmission clusters. Logistic regression models were used to determine factors associated with clustering.Altogether, 24% (n = 67/283 of HIV positive individuals with sequences fell within 34 phylogenetically distinct clusters in at least one gene region (either gag or env. Of these, 83% occurred either within households or within community; 8/34 (24% occurred within household partnerships, and 20/34 (59% within community. 7/12 couples (58% within households clustered together. Individuals in clusters with potential recent transmission (11/34 were more likely to be younger 71% (15/21 versus 46% (21/46 in un-clustered individuals and had recently become resident in the community 67% (14/21 vs 48% (22/46. Four of 11 (36% potential transmission clusters included incident-incident transmissions. Independently, clustering was less likely in HIV subtype D (adjusted Odds Ratio, aOR = 0.51 [95% CI 0.26-1.00] than A and more likely in those living with an HIV-infected individual in the household (aOR = 6.30 [95% CI 3.40-11.68].A large proportion of HIV sexual transmissions occur within house-holds and within communities even in this key mobile population. The findings suggest localized HIV transmissions and hence a potential benefit for the test and treat approach even at a community
Identifying Water Insecurity Hotspots in the Lake Victoria Basin of Eastern Africa
Pricope, N. G.; Shukla, S.; Linard, C.; Gaughan, A.
2014-12-01
The Lake Victoria Basin (LVB), one of Africa's most populated transboundary watersheds and home to more than 30 million inhabitants, is increasingly challenged by both water quality problems and water quantity shortages against a backdrop of climate variability and change; and other environmental challenges. As a result of pollution, droughts, more erratic rainfall, heightened demand for water for both consumption and agricultural needs as well as differences in water allocation among the riverine countries of Uganda, Tanzania, Kenya, Rwanda and Burundi, many parts of this region are already experiencing water scarcity on a recurrent basis. Furthermore, given projected annual population growth rates of 2.5 to 3.5% for the next 20 years, water shortages are likely to be exacerbated in the future. Analyzing historical changes in the water resources of this region is hence important to identify "hot spots" that might be most sensitive to future changes in climate and demography. In this presentation, we report the findings of a comprehensive analysis performed to (i) examine changes in water resources of LVB in recent decades and (ii) identify overlap between regions of significant changes in water resources with land cover changes and high population centers that are also projected to grow the fastest over the coming decades. We first utilize several satellite, stations and model(s) based climatic and hydrologic datasets to assess changes in water resources in this region. We then use a quality-controlled Moderate Resolution Imaging Spectroradiometer (MODIS) land cover product to identify areas of significant land cover changes. Simultaneously we use projections of gridded population density based on differential growth rates for rural and urban population to estimate fastest projected human population growth for 2030 and 2050 relative to 2010 data. Using the outcomes of these change analysis we identify water insecurity hotspots in the LVB.
Sanctuaries for lake trout in the Great Lakes
Stanley, Jon G.; Eshenroder, Randy L.; Hartman, Wilbur L.
1987-01-01
Populations of lake trout, severely depleted in Lake Superior and virtually extirpated from the other Great Lakes because of sea lamprey predation and intense fishing, are now maintained by annual plantings of hatchery-reared fish in Lakes Michigan, Huron, and Ontario and parts of Lake Superior. The extensive coastal areas of the Great Lakes and proximity to large populations resulted in fishing pressure on planted lake trout heavy enough to push annual mortality associated with sport and commercial fisheries well above the critical level needed to reestablish self-sustaining stocks. The interagency, international program for rehabilitating lake trout includes controlling sea lamprey abundance, stocking hatchery-reared lake trout, managing the catch, and establishing sanctuaries where harvest is prohibited. Three lake trout sanctuaries have been established in Lake Michigan: the Fox Island Sanctuary of 121, 500 ha, in the Chippewa-Ottawa Treaty fishing zone in the northern region of the lake; the Milwaukee Reef Sanctuary of 160, 000 ha in midlake, in boundary waters of Michigan and Wisconsin; and Julian's Reef Sanctuary of 6, 500 ha, in Illinois waters. In northern Lake Huron, Drummond Island Sanctuary of 55, 000 ha is two thirds in Indian treaty-ceded waters in Michigan and one third in Ontario waters of Canada. A second sanctuary, Six Fathom Bank-Yankee Reef Sanctuary, in central Lake Huron contains 168, 000 ha. Sanctuary status for the Canadian areas remains to be approved by the Provincial government. In Lake Superior, sanctuaries protect the spawning grounds of Gull Island Shoal (70, 000 ha) and Devils Island Shoal (44, 000 ha) in Wisconsin's Apostle Island area. These seven sanctuaries, established by the several States and agreed upon by the States, Indian tribes, the U.S. Department of the Interior, and the Province of Ontario, contribute toward solving an interjurisdictional fishery problem.
Bulletin of Materials Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. U D Lanke1 2. Metallurgical Engineering and Materials Science Department, Indian Institute of Technology, Mumbai 400 076, India; School of Chemical and Physical Sciences, Victoria University of Wellington, P.O. Box 600, Wellington, New Zealand ...
Kwach, B O; Lalah, J O
2009-11-01
Mean concentrations of selected USEPA priority polycyclic aromatic hydrocarbons (PAHs) in surface sediments and water samples from Car Wash and Kisat areas of Winam Gulf, Lake Victoria in Kenya have been determined using GC-FID and GC-MS. Sampling was done during the rainy season in April 2006. The PAH concentrations in sediment and water ranged from 0.04 to 31.95 microg/g dry weight and 3.32 to 55.8 microg/L, respectively, depending upon the sampling location. The total concentration levels of PAHs in both the sediment and water phase in this study were found to be much higher compared with those reported from other regions worldwide, revealing significant PAH pollution of Car Wash and Kisat areas of Kisumu city bay as a consequent of anthropogenic activities as described in the text. The GC-detected PAHs were confirmed by GC-MS.
Mini-FLOTAC and Kato-Katz: helminth eggs watching on the shore of Lake Victoria.
Barda, Beatrice; Zepherine, Henry; Rinaldi, Laura; Cringoli, Giuseppe; Burioni, Roberto; Clementi, Massimo; Albonico, Marco
2013-07-31
One of the challenges for monitoring helminth control programmes based on preventive chemotherapy is the lack of a copro-parasitological gold-standard method that combines good sensitivity with quantitative performance, low cost, and easy-to-learn technique.The aim of our study was to evaluate and compare, the WHO recommended quantitative diagnostic technique (Kato-Katz) and the Mini-FLOTAC. Mini-FLOTAC is an innovative method based on floatation of helminths eggs with two different solutions (FS2 and FS7) using a close system (Fill-FLOTAC) with 5% fixative. Kato-Katz was performed following WHO recommendation. The study was carried out in a rural part of Tanzania, close to Lake Victoria, where the laboratory facilities are fairly scarce, and the basic technique used in the local laboratory (direct smear) was taken as reference standard. 201 children were screened for intestinal helminths and 91% of them were found to be positive. The agreement among the three techniques was calculated with k Cohen coefficient and was fairly good (k = 0.4), although the Mini-FLOTAC results were more sensitive for hookworm (98%) with FS2, and for S.mansoni (90%) with FS7 followed by Kato-Katz (91% and 60% respectively) and direct smear (30% and 10% respectively). A good agreement was found between Mini-FLOTAC and Kato-Katz (k = 0.81) with FS7 (k = 0.76) for hookworm diagnosis and a fairly good one for S.mansoni diagnosis (k = 0.5). For both infections we had a poor agreement between the two quantitative techniques and the direct smear (kMcMaster) and in different settings where other soil-transmitted helminths are also endemic.
Impact of LULC change on the runoff, baseflow and ...
Indian Academy of Sciences (India)
49
assessing the hydrologic impacts of agriculture extensification under multi-scale ... the Indian Space Research Organization-Geosphere Biosphere Programme ...... flood prediction system in Nzoia Basin, Lake Victoria; Africa Nat Hazards 50 109–123, ... Development of decadal (1985–1995–2005) land use and land cover ...
Journal of Astrophysics and Astronomy | Indian Academy of Sciences
Indian Academy of Sciences (India)
Indian Institute of Astrophysics, Koramangala, Bangalore 560 034, India. Kavli Institute for Astronomy & Astrophysics, Peking University, Beijing 100871, China. National Research Council of Canada, Herzberg Institute of Astrophysics, 5071 West Saanich Road, Victoria, British Columbia, Canada. Thirty Meter Project Office, ...
Wharton, Robert A., Jr.; Mckay, Christopher P.; Clow, Gary D.; Andersen, Dale T.; Simmons, George M., Jr.; Love, F. G.
1992-01-01
Results are reported from 10 years of ice-thickness measurements at perennially ice-covered Lake Hoare in southern Victoria Land, Antarctica. The ice cover of this lake had been thinning steadily at a rate exceeding 20 cm/yr during the last decade but seems to have recently stabilized at a thickness of 3.3 m. Data concerning lake level and degree-days above freezing are presented to show the relationship between peak summer temperatures and the volume of glacier-derived meltwater entering Lake Hoare each summer. From these latter data it is inferred that peak summer temperatures have been above 0 C for a progressively longer period of time each year since 1972. Possible explanations for the thinning of the lake ice are considered. The thickness of the ice cover is determined by the balance between freezing during the winter and ablation that occurs all year but maximizes in summer. It is suggested that the term most likely responsible for the change in the ice cover thickness at Lake Hoare is the extent of summer melting, consistent with the rising lake levels.
Evidence for a Drought-driven (pre-industrial) Regime Shift in an Australian Shallow Lake
Mills, K.; Gell, P.; Doan, P.; Kershaw, P.; McKenzie, M.; Lewis, T.; Tyler, J. J.
2015-12-01
We present a 750-year record of ecosystem response to long-term drought history from Lake Colac, Victoria. Using multiple lines of evidence, we test the sensitivity and resilience of Lake Colac to independently reconstructed drought history. The sedimentary archive shows that Lake Colac appears to be sensitive to periods of drought. Following drought conditions c. CE 1390, the lake ecosystem indicates signs of recovery. A succession of droughts in the early 1500s initiates a change in the diatom flora, with freshwater species declining and replaced by saline tolerant species, though there is little interpretable change in aquatic palynomorphs. An inferred drought, around CE 1720 appears to precede a major switch in the lake's ecosystem. The lake became increasingly turbid and saline and there is a distinct switch from a macrophyte-dominated system to an algal-dominated system. The arrival of Europeans in Victoria (CE1840) appears to have little effect on the lake's ecosystem, but the terrestrial vegetation indicates regionally established changes including declines in native trees, especially Casuarina, and arrival and expansion of exotic shade or plantation trees Pinus and Cupressus as well as native and introduced weeds. As European impact in the catchment increases, nutrients appear to play a role in the modification of the lake's ecosystem. A long-term drying trend from c. CE 1975 is evident, culminating in the Millennium Drought, which suggests unprecedented conditions in the ecological history of the Lake.
2013-03-21
... DEPARTMENT OF THE INTERIOR Bureau of Indian Affairs Indian Gaming AGENCY: Bureau of Indian Affairs, Interior. ACTION: Notice of Approved Tribal-State Class III Gaming Compact. SUMMARY: This notice publishes the approval of the Class III Tribal- State Gaming Compact between the Pyramid Lake Paiute Tribe and...
2012-05-23
... DEPARTMENT OF THE INTERIOR Bureau of Indian Affairs Indian Gaming AGENCY: Bureau of Indian Affairs, Interior. ACTION: Notice of Approved Tribal--State Class III Gaming Compact. SUMMARY: This notice publishes approval by the Department of an extension to the Class III Gaming Compact between the Pyramid Lake Paiute...
Fusilli, Lorenzo; Cavalli, Rosa Maria; Laneve, Giovanni; Pignatti, Stefano; Santilli, Giancarlo; Santini, Federico
2010-05-01
Remote sensing allows multi-temporal mapping and monitoring of large water bodies. The importance of remote sensing for wetland and inland water inventory and monitoring at all scales was emphasized several times by the Ramsar Convention on Wetlands and from EU projects like SALMON and ROSALMA, e.g. by (Finlayson et al., 1999) and (Lowry and Finlayson, 2004). This paper aims at assessing the capability of time series of satellite imagery to provide information suitable for enhancing the understanding of the temporal cycles shown by the macrophytes growing in order to support the monitor and management of the lake Victoria water resources. The lake Victoria coastal areas are facing a number of challenges related to water resource management which include growing population, water scarcity, climate variability and water resource degradation, invasive species, water pollution. The proliferation of invasive plants and aquatic weeds, is of growing concern. In particular, let us recall some of the problems caused by the aquatic weeds growing: Ø interference with human activities such as fishing, and boating; Ø inhibition or interference with a balanced fish population; Ø fish killing due to removal of too much oxygen from the water; Ø production of quiet water areas that are ideal for mosquito breeding. In this context, an integrated use of medium/high resolution images from sensors like MODIS, ASTER, LANDSAT/TM and whenever available CHRIS offers the possibility of creating a congruent time series allowing the analysis of the floating vegetation dynamic on an extended temporal basis. Although MODIS imagery is acquired daily, cloudiness and other sources of noise can greatly reduce the effective temporal resolution, further its spatial resolution can results not always adequate to map the extension of floating plants. Therefore, the integrated use of sensors with different spatial resolution, were used to map across seasons the evolution of the phenomena. The
Dicty_cDB: Contig-U04401-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available , 3' end ... 46 1.6 1 ( DQ447660 ) Lake Victoria marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447659 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447658 ) Lake Victoria marburgvirus - An...gola2005 strain An... 44 6.3 1 ( DQ447657 ) Lake Victoria marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447656 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447655 ) Lake Victoria... marburgvirus - Angola2005 strain An... 44 6.3 1 ( DQ447654 ) Lake Victoria marburgvirus -
First evidence of microplastics in the African Great Lakes
DEFF Research Database (Denmark)
Biginagwa, Fares John; Mayoma, Bahati Sosthenes; Shashoua, Yvonne
2016-01-01
-FTIR) spectroscopy. A variety of polymer types were identified with likely sources being urban waste and consumer use. Although further research is required to fully assess the impact of plastic pollution in this region, our study is the first to report the presence of microplastics in Africa's Great Lakes...... on the southern shore of Lake Victoria. The gastrointestinal tracts of locally fished Nile perch (Lates niloticus) and Nile tilapia (Oreochromis niloticus) were examined for plastics. Plastics were confirmed in 20% of fish from each species by Attenuated Total Reflectance Fourier Transform Infrared (ATR...
77 FR 39638 - Safety Zone; Barbara Harder Wedding Fireworks, Lake Erie, Lake View, NY
2012-07-05
... environmental risk to health or risk to safety that may disproportionately affect children. 10. Indian Tribal... be held on Lake Erie near Lake View, NY. The Captain of the Port Buffalo has determined that fireworks launched proximate to a gathering of watercraft pose a significant risk to public safety and...
Optimization of EDXRF for the study of heavy metal pollution of Lake ...
African Journals Online (AJOL)
The spectrometer was subsequently utilized to determine concentrations of heavy metals in water hyacinth (Eichhornia crassipes (Mart) Solms.) found growing along the shore of Lake Victoria. The optimal conditions and detection limits were determined experimentally by variation of the excitation parameters. The study ...
Directory of Open Access Journals (Sweden)
Agnes Robert
2014-01-01
Full Text Available Fatty acids (FAs particularly ω3 and ω6 polyunsaturated fatty acids (PUFAs play important role in human health. This study aimed to investigate the composition and levels of selected ω3 PUFAs in four commercial fish species, Nile perch (Lates niloticus, Nile tilapia (Oreochromis niloticus, Tilapia zillii, and dagaa (Rastrineobola argentea from Mwanza Gulf in Lake Victoria. The results indicated that 36 types of FAs with different saturation levels were detected. These FAs were dominated by docosahexaenoic (DHA, eicosapentaenoic (EPA, docosapentaenoic (DPA, and eicosatetraenoic acids. O. niloticus had the highest composition of FAs (34 compared to L. niloticus (27, T. zillii (26, and R. argentea (21. The levels of EPA differed significantly among the four commercial fish species (F=6.19, P=0.001. The highest EPA levels were found in R. argentea followed by L. niloticus and O. niloticus and the lowest in T. zillii. The DPA levels showed no significant difference among the four fish species studied (F=0.652, P=0.583. The study concluded that all four commercial species collected from Mwanza Gulf are good for human health, but R. argentea is the best for consumption because it contains higher levels of ω3 FAs, mainly EPA.
Naigaga, I.; Kaiser, H.; Muller, W. J.; Ojok, L.; Mbabazi, D.; Magezi, G.; Muhumuza, E.
Growing human population and industrialization have led to the pollution of most aquatic ecosystems and consequent deterioration in environmental water quality. Indicator organisms are needed to improve assessment programmes on the ecological impacts of anthropogenic activities on the aquatic environment. Fish have been widely documented as useful indicators of environmental water quality because of their differential sensitivity to pollution. This study investigated the environmental water quality of selected wetland ecosystems using fish as biological indicators. Fish community structure in relation to water quality was assessed in five wetlands along the shoreline of Lake Victoria from August 2006 to June 2008. Four urban wetlands were variedly impacted by anthropogenic activities while one rural wetland was less impacted, and served as a reference site. Fish species diversity, abundance and richness were assessed, and canonical correspondence analysis (CCA) was used to evaluate the relationship between the fish communities and environmental variables. Results revealed that urban effluent impacted negatively on water quality and consequently the fish community structure. A total of 29 fish species were recorded throughout the study with the lowest number of 15 species recorded in the most impacted site. Shannon diversity and Margalef species richness indices were highest at the references site and lowest at the most impacted site. Wetland haplochromis species dominated the reference site, while oreochromis species dominated the most impacted site. The inshore locations registered higher species diversity and low species richness than the offshore locations. Low dissolved oxygen, pH, secchi depth and high electrical conductivity, total phosphorous, and total nitrogen were strongly associated with the effluent-impacted sites and greatly influenced the fish community structure. This study recommends the use of fish as valuable biological indicators in aquatic
Recent plant studies using Victoria 2.0
International Nuclear Information System (INIS)
Bixler, Nathan E.; Gasser, Ronald D.
2000-01-01
VICTORIA 2.0 is a mechanistic computer code designed to analyze fission product behavior within the reactor coolant system (RCS) during a severe nuclear reactor accident. It provides detailed predictions of the release of radioactive and nonradioactive materials from the reactor core and transport and deposition of these materials within the RCS and secondary circuits. These predictions account for the chemical and aerosol processes that affect radionuclide behavior. VICTORIA 2.0 was released in early 1999; a new version VICTORIA 2.1, is now under development. The largest improvements in VICTORIA 2.1 are connected with the thermochemical database, which is being revised and expanded following the recommendations of a peer review. Three risk-significant severe accident sequences have recently been investigated using the VICTORIA 2.0 code. The focus here is on how various chemistry options affect the predictions. Additionally, the VICTORIA predictions are compared with ones made using the MELCOR code. The three sequences are a station blackout in a GE BWR and steam generator tube rupture (SGTR) and pump-seal LOCA sequences in a 3-loop Westinghouse PWR. These sequences cover a range of system pressures, from fully depressurized to full system pressure. The chief results of this study are the fission product fractions that are retained in the core, RCS, secondary, and containment and the fractions that are released into the environment
Barda, Beatrice; Ianniello, Davide; Zepheryne, Henry; Rinaldi, Laura; Cringoli, Giuseppe; Burioni, Roberto; Albonico, Marco
2014-09-01
Helminths and protozoa infections pose a great burden especially in developing countries, due to morbidity caused by both acute and chronic infection. The aim of our survey was to analyze the intestinal parasitic burden in communities from Mwanza region, Tanzania. Subjects (n=251) from four villages on the South of Lake Victoria have been analyzed for intestinal parasites with direct smear (DS), formol-ether concentration method (FECM) and the newly developed Mini-FLOTAC technique; urinary schistosomiasis was also assessed in a subsample (n=151); symptoms were registered and correlation between clinic and infections was calculated by chi-squared test and logistical regression. Out of the subjects screened for intestinal and for urinary parasites, 87% (218/251) were found positive for any infection, 69% (174/251) carried a helminthic and 67% (167/251) a protozoan infection, almost half of them had a double or triple infection. The most common helminths were hookworms, followed by Schistosoma mansoni and Schistosoma haematobium. Among protozoa, the most common was Entamoeba coli followed by Entamoeba histolytica/dispar and Giardia intestinalis. Mini-FLOTAC detected a number of helminth infections (61.7%) higher than FECM (38.6%) and DS (17.9%). Some positive associations with abdominal symptoms were found and previous treatment was negatively correlated with infection. Despite the limited size of the examined population the current study indicates a high prevalence of intestinal parasitic infection in Bukumbi area, Tanzania, and Mini-FLOTAC showed to be a promising diagnostic tool for helminth infections. This high parasitic burden calls for starting a regular deworming programme and other preventive interventions in schools and in the community. Copyright © 2014 Elsevier B.V. All rights reserved.
Moore, P.; Williams, S. D. P.
2014-12-01
Terrestrial water storage (TWS) change for 2003-2011 is estimated over Africa from GRACE gravimetric data. The signatures from change in water of the major lakes are removed by utilizing kernel functions with lake heights recovered from retracked ENVISAT satellite altimetry. In addition, the contribution of gravimetric change due to soil moisture and biomass is removed from the total GRACE signal by utilizing the GLDAS land surface model. The residual TWS time series, namely groundwater and the surface waters in rivers, wetlands, and small lakes, are investigated for trends and the seasonal cycle using linear regression. Typically, such analyses assume that the data are temporally uncorrelated but this has been shown to lead to erroneous inferences in related studies concerning the linear rate and acceleration. In this study, we utilize autocorrelation and investigate the appropriate stochastic model. The results show the proper distribution of TWS change and identify the spatial distribution of significant rates and accelerations. The effect of surface water in the major lakes is shown to contribute significantly to the trend and seasonal variation in TWS in the lake basin. Lake Volta, a managed reservoir in Ghana, is seen to have a contribution to the linear trend that is a factor of three greater than that of Lake Victoria despite having a surface area one-eighth of that of Lake Victoria. Analysis also shows the confidence levels of the deterministic trend and acceleration identifying areas where the signatures are most likely due to a physical deterministic cause and not simply stochastic variations.
Yihdego, Yohannes; Webb, John A
2017-02-01
The common method to estimate lake levels is the water balance equation, where water input and output result in lake storage and water level changes. However, all water balance components cannot always be quickly assessed, such as due to significant modification of the catchment area. A method that assesses general changes in lake level can be a useful tool in examining why lakes have different lake level variation patterns. Assessment of wetlands using the dynamics of the historical hydrological and hydrogeological data set can provide important insights into variations in wetland levels in different parts of the world. A case study from a saline landscape, Lake Buninjon, Australia, is presented. The aim of the present study was to determine how climate, river regime, and lake hydrological properties independently influence lake water levels and salinity, leaving the discrepancy, for the effect of the non-climatic/catchment modification in the past and the model shows that surface inflow is most sensitive variable. The method, together with the analysis and interpretation, might be of interest to wider community to assess its response to natural/anthropogenic stress and decision choices for its ecological, social, scientific value, and mitigation measures to safe guard the wetland biodiversity in a catchment basin.
Directory of Open Access Journals (Sweden)
Paul E Nevin
Full Text Available In 2010, the Uganda Ministry of Health introduced its Safe Male Circumcision (SMC strategy for HIV prevention with the goal of providing 4.2 million voluntary medical male circumcisions by 2015. Fishing communities, where HIV prevalence is approximately 3-5 times higher than the national average, have been identified as a key population needing targeted HIV prevention services by the National HIV Prevention Strategy. This study aimed to understand perceptions of HIV and identify potential barriers and facilitators to SMC in fishing communities along Lake Victoria.We conducted 8 focus group discussions, stratified by sex and age, with 67 purposefully sampled participants in 4 communities in Kalangala District, Uganda.There was universal knowledge of the availability of SMC services, but males reported high uptake in the community while females indicated that it is low. Improved hygiene, disease prevention, and improved sexual performance and desirability were reported facilitators. Barriers included a perceived increase in SMC recipients' physiological libido, post-surgical abstinence, lost income during convalescence, and lengthier recovery due to occupational hazards. Both males and females reported concerns about spousal fidelity during post-SMC abstinence. Reported misconceptions and community-held cultural beliefs include fear that foreskins are sold after their removal, the belief that a SMC recipient's first sexual partner after the procedure should not be his spouse, and the belief that vaginal fluids aid circumcision wound healing.Previous outreach efforts have effectively reached these remote communities, where availability and health benefits of SMC are widely understood. However, community-specific intervention strategies are needed to address the barriers identified in this study. We recommend the development of targeted counseling, outreach, and communication strategies to address barriers, misconceptions, and community-held beliefs
Okoyo, Collins; Mwandawiro, Charles; Kihara, Jimmy; Simiyu, Elses; Gitonga, Caroline W; Noor, Abdisalan M; Njenga, Sammy M; Snow, Robert W
2015-12-22
Under trial conditions insecticide-treated nets have been shown to provide significant clinical and mortality protection under a range of malaria transmission intensity conditions. There are, however, few operational impact data, notably in very intense transmission conditions. This study, reports on malaria infection among Kenyan schoolchildren living in areas of intense malaria transmission and their reported use of insecticide-treated bed nets. 5188 children in 54 schools were randomly sampled from seven counties surrounding Lake Victoria between May and June 2014. A questionnaire was administered to schoolchildren in classes 2-6 on the use of a long-lasting, insecticide-treated net (LLIN) the night before the survey and provided a single blood sample for a rapid diagnostic test for malaria infection. Analysis of the impact of insecticide-treated net use on malaria prevalence was undertaken using a multivariable, mixed effects, logistic regression at 95% confidence interval (CI), taking into account hierarchical nature of the data and results adjusted for school clusters. The overall prevalence of malaria infection was 48.7%, two-thirds (67.9%) of the children reported using LLIN, 91.3% of the children reported that their households own at least one LLIN and the household LLIN coverage was 2.5 persons per one LLIN. The prevalence of infection showed variation across the counties, with prevalence being highest in Busia (66.9%) and Homabay (51.8%) counties, and lowest in Migori County (29.6%). Generally, malaria parasite prevalence differed between age groups and gender with the highest prevalence occurring in children below 7 years (50.6%) and males (52.2%). Adjusting for county and school, there was a significant reduction in odds of malaria infection among the schoolchildren who reported LLIN use the previous night by 14 % (aOR 0.86, 95% CI 0.74-0.98, P provide protection against infection among school-aged children.
Is History Repeating Itself at Lubicon Lake?
Cloutier, Joe
1988-01-01
Shows impact of industrial development and public policies since 1899 upon Cree Indians at Lubicon Lake, Alberta, Canada. Details development-related destruction of Indian culture and economic base, creating welfare society. Reports Crees' 1987 protest of Calgary Olympics. Calls for educators to broaden and deepen approach to history and cultural…
Munday, Chris I; O'Loingsigh, Tadhg; Tapper, Nigel J; De Deckker, Patrick; Allison, Gwen E
2013-04-15
Dust storms are a major source of aerosolized bacteria, especially in the drought conditions experienced in Australia in the decade to 2009. The major aims of this project were to identify the culturable bacteria in environmental samples and to genetically fingerprint all isolates using repetitive element PCR (Rep-PCR) to investigate the possibility of tracking isolates from their source into the atmosphere. Four field trips were conducted to a dry lake in western Victoria, Australia to sample aerosols and sediments. Aerosols were collected at heights up to 150 m using vacuum pumps with filters attached to a tethered helium balloon, while corresponding sediments were collected in sterile polypropylene tubes. Isolates were cultivated on Tryptic Soy Agar, R2 Agar and Marine Agar, and grown in dark conditions at ambient temperature. By sequencing the 16S rRNA gene of 270 isolates, fifteen different bacterial families were identified, with both the aerosols and sediments dominated by the Bacillaceae family. Four sets of Rep-PCR primers were tested, with the ERIC and (GTG)5 primers proving to be the most suitable for fingerprinting the cultured taxa. Rep-PCR revealed very high strain diversity in the samples collected, however some strains were still able to be tracked from sediments up to 150 m in height. This shows the potential of Rep-PCR, however very large reference databases would be required for the technique to be more useful. Copyright © 2013 Elsevier B.V. All rights reserved.
Monitoring of Heavy Metal Loading into the Wetlands South of Lake ...
African Journals Online (AJOL)
Wetlands impacted by gold mining activities in the South Lake Victoria basin show elevated heavy metal contents in soil and sediment, particularly Cu (13-415 mg/kg), Pb (24-94 mg/kg), Zn (9-80 mg/kg), Cr (19-77 mg/kg), Ni (12-37 mg/kg) and Hg (0.19-1.76 mg/kg), contrary to non-impacted wetlands, which contain ...
victoria cross awards warrants concerning the victoria cross (1920)
African Journals Online (AJOL)
1. WARRANTS CONCERNING THE. VICTORIA CROSS (1920). In order to get a picture of the Royal Warrants promulgated from 1856 to 1920 in respect of the .... to confirmation by us. Eighthly. - It is ordained, where such an act shall not have been performed in the sight of a commanding officer as aforesaid, then the ...
VICTORIA Class Submarine Human-in-the-Loop Experimentation Plan
2014-06-01
1472G. VICTORIA Class Submarine Human-in-the-Loop Experimentation Plan and Preliminary Results © Her Majesty the Queen in Right of...19 th International Command and Control Research and Technology Symposium Title: VICTORIA Class Submarine Human-in-the-Loop...TYPE 3. DATES COVERED 00-00-2014 to 00-00-2014 4. TITLE AND SUBTITLE VICTORIA Class Submarine Human-in-the-Loop Experimentation Plan 5a. CONTRACT
Lifescience Database Archive (English)
Full Text Available sp|Q1PDC9|VP35_MABVR Polymerase cofactor VP35 OS=Lake Victoria m... 32 3.9 sp|Q6UY68|VP35_MABVO Polymerase cofactor VP35 OS=Lake Vict...oria m... 32 3.9 sp|P35259|VP35_MABVM Polymerase cofactor VP35 OS=Lake Victoria m...... 32 3.9 sp|Q1PD52|VP35_MABVA Polymerase cofactor VP35 OS=Lake Victoria m... 32 3.9 sp|O54898|CAC1G_RAT Volt...dependent T-type calcium channel s... 32 5.1 sp|Q03039|VP35_MABVP Polymerase cofactor VP35 OS=Lake Victoria ...C9|VP35_MABVR Polymerase cofactor VP35 OS=Lake Victoria marburgvirus (strain Ravn-87) GN=VP35 PE=3 SV=1 Leng
Exploratory studies into seasonal flow forecasting potential for large lakes
Sene, Kevin; Tych, Wlodek; Beven, Keith
2018-01-01
In seasonal flow forecasting applications, one factor which can help predictability is a significant hydrological response time between rainfall and flows. On account of storage influences, large lakes therefore provide a useful test case although, due to the spatial scales involved, there are a number of modelling challenges related to data availability and understanding the individual components in the water balance. Here some possible model structures are investigated using a range of stochastic regression and transfer function techniques with additional insights gained from simple analytical approximations. The methods were evaluated using records for two of the largest lakes in the world - Lake Malawi and Lake Victoria - with forecast skill demonstrated several months ahead using water balance models formulated in terms of net inflows. In both cases slight improvements were obtained for lead times up to 4-5 months from including climate indices in the data assimilation component. The paper concludes with a discussion of the relevance of the results to operational flow forecasting systems for other large lakes.
Lifescience Database Archive (English)
Full Text Available OS=Drosophila melanogast... 34 0.58 sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria... m... 33 0.99 sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria m... 33 1.7 s... 32 3.8 sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 31 4.... 3956 >sp|P41326|VP30_MABVP Minor nucleoprotein VP30 OS=Lake Victoria marburgvirus (strain Popp-67) GN=VP30 ... NHH R+ ++T Sbjct: 11 RNHQTASSIYHETQLPSKPHYTNHHPRARSMSST 44 >sp|Q6UY65|VP30_MABVO Minor nucleoprotein VP30 OS=Lake Victoria
Maithya, J.
1998-01-01
In 1988, the World Conservation Union (WCU) Red Book of Endangered Species listed hundreds of endemic fishes of Lake Victoria under a single heading - "ENDANGERED". Most of the endemic native food fishes are either endangered or extinct. However, a survey of the fauna of Lake Kanyaboli, revealed that a few remaining samples of these native fishes are actually thriving. These include several unidentified Haplochromis spp., Oreochromis esculentus and Oreochromis variabilis. As a resul...
Lifescience Database Archive (English)
Full Text Available VGP_MABVO Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Ozolin-75) ...s) Value sp|Q6UY66|VGP_MABVO Envelope glycoprotein OS=Lake Victoria marbu... 31 2...P_MABVO Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Ozolin-75) GN
Hemofilie onder die nasate van koningin Victoria
Directory of Open Access Journals (Sweden)
Francois P. Retief
2013-03-01
Full Text Available Hierdie studie bespreek die uitwerking van die sogenaamde Victoriaanse hemofilie op Europese koningshuise gedurende die negentiende en twintigste eeu. Hemofilie as molekulêre defek word verduidelik en die kliniese beeld van die siekte word aangedui. ’n Bespreking van toepaslike terapeutiese ingrepe volg. Dan word ’n historiese oorsig verskaf van die verspreiding van Victoriaanse hemofilie vanaf koningin Victoria (Britse monarg, 1837–1901 via sommige van haar dogters na ander lede van die Britse koningshuis en ook na die Duitse, Russiese en Spaanse koningshuise. Elf bevestigde gevalle van hemofilie onder lede van koningin Victoria se nageslag word vermeld, asook drie ander moontlike gevalle van die siekte. Die effek van hemofilie op die verloop van die geskiedenis word ook ondersoek.Haemophilia amongst the descendants of Queen Victoria. This study discusses the impact of ‘Victorian haemophilia’ on the royal houses of Europe during the 19th and 20th centuries. Haemophilia as a molecular defect is explained and the clinical picture of the condition is indicated. Applicable therapeutic interventions also receive attention. Next, an historical review is provided of how ‘Victorian haemophilia’ spread from Queen Victoria (British monarch, 1837–1901 via some of her daughters to other members of the British royal family and also to the royal houses of Germany, Russia and Spain. Eleven confirmed cases of haemophilia amongst the descendants of Queen Victoria are mentioned, as well as three other possible cases. The effect of haemophilia on the course of history is also investigated.
Polder, A; Müller, M B; Lyche, J L; Mdegela, R H; Nonga, H E; Mabiki, F P; Mbise, T J; Skaare, J U; Sandvik, M; Skjerve, E; Lie, E
2014-08-01
In Tanzania fish is one of the most important protein sources for the rapidly increasing population. Wild fish is threatened by overfishing and pollution from agriculture, industries, mining, household effluents and vector control. To monitor possible implications for public health, the geographical differences of the occurrence and levels of persistent organic pollutants (POPs) in tilapia fish (Oreochromis sp.) from four different Tanzanian lakes were investigated in 2011. Concentrations of organochlorine pesticides (OCPs), polychlorinated biphenyls (PCBs), polybrominated diphenyls (PBDEs) and hexabromocyclododecane (HBCDD) were determined in pooled samples of tilapia muscle from Lake (L) Victoria, L. Tanganyika, L. Nyasa (also called L. Malawi) and L. Babati in Tanzania in 2011. Levels of Σ-DDTs (274 ng/g lipid weight (lw)) and sum of 7 indicator PCBs (Σ-7PCBs) (17 ng/g lw) were significantly higher in tilapia from L. Tanganyika compared to the other lakes. The highest levels of Σ-endosulfan (94 ng/g lw) were detected in tilapia from L. Victoria. Toxaphenes were detected in low levels in fish from L. Tanganyika and L. Babati. Results revealed a geographic difference in the use of DDT and endosulfan between L. Victoria and L. Tanganyika. Low ratios of DDE/DDT in tilapia from L. Tanganyika indicated an on-going use of DDT in the area. Median levels of ΣBDEs, including BDE-209, were highest in L. Victoria (19.4 ng/g lw) and BDE-209 was present in 68% of the samples from this lake. The presence of BDE-209 indicates increasing influence of imported products from heavy industrialized countries. The measured POP levels in the studied tilapia were all below MRLs of EU or were lower than recommended levels, and thus the fish is considered as safe for human consumption. They may, however, pose a risk to the fish species and threaten biodiversity. Copyright © 2014 Elsevier B.V. All rights reserved.
How many species of cichlid fishes are there in African lakes?
Turner, G F; Seehausen, O; Knight, M E; Allender, C J; Robinson, R L
2001-03-01
The endemic cichlid fishes of Lakes Malawi, Tanganyika and Victoria are textbook examples of explosive speciation and adaptive radiation, and their study promises to yield important insights into these processes. Accurate estimates of species richness of lineages in these lakes, and elsewhere, will be a necessary prerequisite for a thorough comparative analysis of the intrinsic and extrinsic factors influencing rates of diversification. This review presents recent findings on the discoveries of new species and species flocks and critically appraises the relevant evidence on species richness from recent studies of polymorphism and assortative mating, generally using behavioural and molecular methods. Within the haplochromines, the most species-rich lineage, there are few reported cases of postzygotic isolation, and these are generally among allopatric taxa that are likely to have diverged a relatively long time in the past. However, many taxa, including many which occur sympatrically and do not interbreed in nature, produce viable, fertile hybrids. Prezygotic barriers are more important, and persist in laboratory conditions in which environmental factors have been controlled, indicating the primary importance of direct mate preferences. Studies to date indicate that estimates of alpha (within-site) diversity appear to be robust. Although within-species colour polymorphisms are common, these have been taken into account in previous estimates of species richness. However, overall estimates of species richness in Lakes Malawi and Victoria are heavily dependent on the assignation of species status to allopatric populations differing in male colour. Appropriate methods for testing the specific status of allopatric cichlid taxa are reviewed and preliminary results presented.
2011-01-01
Background It is widely advocated that integrated strategies for the control of neglected tropical diseases (NTDs) are cost-effective in comparison to vertical disease-specific programmes. A prerequisite for implementation of control interventions is the availability of baseline data of prevalence, including the population at risk and disease overlap. Despite extensive literature on the distribution of schistosomiasis on the mainland in Uganda, there has been a knowledge gap for the prevalence of co-infections with malaria, particularly for island communities in Lake Victoria. In this study, nine lakeshore and island districts were surveyed for the prevalence of NTDs and malaria, as well as educational and health infrastructure. Results A total of 203 communities were surveyed, including over 5000 school-age children. Varying levels of existing health infrastructure were observed between districts, with only Jinja District regularly treating people for NTDs. Community medicine distributors (CMD) were identified and trained in drug delivery to strengthen capacity. Prevalence levels of intestinal schistosomiasis and soil-transmitted helminthiasis were assessed via Kato-Katz thick smears of stool and malaria prevalence determined by microscopy of fingerprick blood samples. Prevalence levels were 40.8%, 26.04% and 46.4%, respectively, while the prevalence of co-infection by Schistosoma mansoni and Plasmodium spp. was 23.5%. Socio-economic status was strongly associated as a risk factor for positive infection status with one or more of these diseases. Conclusions These results emphasise the challenges of providing wide-scale coverage of health infrastructure and drug distribution in remote lakeshore communities. The data further indicate that co-infections with malaria and NTDs are common, implying that integrated interventions for NTDs and malaria are likely to maximize cost-effectiveness and sustainability of disease control efforts. PMID:22166365
Kabatereine, Narcis B; Standley, Claire J; Sousa-Figueiredo, Jose C; Fleming, Fiona M; Stothard, J Russell; Talisuna, Ambrose; Fenwick, Alan
2011-12-13
It is widely advocated that integrated strategies for the control of neglected tropical diseases (NTDs) are cost-effective in comparison to vertical disease-specific programmes. A prerequisite for implementation of control interventions is the availability of baseline data of prevalence, including the population at risk and disease overlap. Despite extensive literature on the distribution of schistosomiasis on the mainland in Uganda, there has been a knowledge gap for the prevalence of co-infections with malaria, particularly for island communities in Lake Victoria. In this study, nine lakeshore and island districts were surveyed for the prevalence of NTDs and malaria, as well as educational and health infrastructure. A total of 203 communities were surveyed, including over 5000 school-age children. Varying levels of existing health infrastructure were observed between districts, with only Jinja District regularly treating people for NTDs. Community medicine distributors (CMD) were identified and trained in drug delivery to strengthen capacity. Prevalence levels of intestinal schistosomiasis and soil-transmitted helminthiasis were assessed via Kato-Katz thick smears of stool and malaria prevalence determined by microscopy of fingerprick blood samples. Prevalence levels were 40.8%, 26.04% and 46.4%, respectively, while the prevalence of co-infection by Schistosoma mansoni and Plasmodium spp. was 23.5%. Socio-economic status was strongly associated as a risk factor for positive infection status with one or more of these diseases. These results emphasise the challenges of providing wide-scale coverage of health infrastructure and drug distribution in remote lakeshore communities. The data further indicate that co-infections with malaria and NTDs are common, implying that integrated interventions for NTDs and malaria are likely to maximize cost-effectiveness and sustainability of disease control efforts.
Directory of Open Access Journals (Sweden)
Shadrack Mule
2015-06-01
Full Text Available The determination of retention efficiencies of halogenated and non-halogenated hydrocarbon in selected wetland ecosystems in Lake Victoria basin was carried out. Qualitative and quantitative determination of the presence of residual hydrocarbons in Kigwal/Kimondi, Nyando and Nzoia wetland ecosystems using Gas Chromatography - Mass Spectrometer (GC-MS instrument indicated the presence of residual organochlorines, organophosphorus, carbamates and synthetic pyrethroid hydrocarbons in water, sediment and plant materials. In order to compare the retention efficiencies of the wetlands, the wetland ecosystems were divided into three different sections, namely: inlet, mid and outlet. Calculations of mass balances of residual halogenated and non-halogenated hydrocarbons at the respective sections was done taking into account the partition of the studied compounds in samples of water, sediments and papyrus reed plant materials and analyzed using validated Gas Chromatography - Mass Spectrometer (GC-MS method. From the analysis, several residual hydrocarbons namely: bendiocarb, benzene hexachloride (BHC, carbaryl, cypermethrin, decis, deltamethrin, diazinon, dieldrin, DDT, DDD, DDE, malathion, propoxur, sumithion, 5-phenylrhodanine, 1,3,5-trichlorobenzene, 1-(2-phenoxybenzylhydrazine were detected and quantified. The levels of the selected residual hydrocarbons in water samples were used to calculate the retention efficiencies of a specific hydrocarbon and the values recorded. Generally, River Nyando wetland recorded mean percentage retention efficiencies of 76 and 94% for dry and rainy seasons respectively; Kigwal/Kimondi wetland had seasonal mean percentage retention efficiencies of 63 to 78%. River Nzoia also had calculated seasonal mean percentage retention efficiencies of between 56 to 88%. Dry season had lower mean percentages retention efficiencies as compared to rainy season in the three wetlands of interest during the period of study. The study
Victoria Law School Ten Years On—A Time to Pause and Reflect
Andrew Clarke
2013-01-01
On 4 November 2010, a large and distinguished audience assembled at the Queen Street Campus of Victoria University to celebrate the tenth anniversary of the founding of Victoria Law School. This Foreword records the diverse achievements of Victoria Law School over the past decade.
Victoria Law School Ten Years On—A Time to Pause and Reflect
Directory of Open Access Journals (Sweden)
Andrew Clarke
2013-11-01
Full Text Available On 4 November 2010, a large and distinguished audience assembled at the Queen Street Campus of Victoria University to celebrate the tenth anniversary of the founding of Victoria Law School. This Foreword records the diverse achievements of Victoria Law School over the past decade.
The Bands Culture in Victoria, Australia: Live Music Benefits Career Paths, Employment and Community
Watson, Amanda; Forrest, David
2012-01-01
This study explores the career paths, employment, business opportunities and community contributions made available through the provision and development of the contemporary performance bands' culture in the State of Victoria. It is framed with the support given to live music performers by Arts Victoria, Small Business Victoria and Music Victoria.…
Pancam Peek into 'Victoria Crater' (Stereo)
2006-01-01
[figure removed for brevity, see original site] Left-eye view of a stereo pair for PIA08776 [figure removed for brevity, see original site] Right-eye view of a stereo pair for PIA08776 A drive of about 60 meters (about 200 feet) on the 943rd Martian day, or sol, of Opportunity's exploration of Mars' Meridiani Planum region (Sept. 18, 2006) brought the NASA rover to within about 50 meters (about 160 feet) of the rim of 'Victoria Crater.' This crater has been the mission's long-term destination for the past 21 Earth months. Opportunity reached a location from which the cameras on top of the rover's mast could begin to see into the interior of Victoria. This stereo anaglyph was made from frames taken on sol 943 by the panoramic camera (Pancam) to offer a three-dimensional view when seen through red-blue glasses. It shows the upper portion of interior crater walls facing toward Opportunity from up to about 850 meters (half a mile) away. The amount of vertical relief visible at the top of the interior walls from this angle is about 15 meters (about 50 feet). The exposures were taken through a Pancam filter selecting wavelengths centered on 750 nanometers. Victoria Crater is about five times wider than 'Endurance Crater,' which Opportunity spent six months examining in 2004, and about 40 times wider than 'Eagle Crater,' where Opportunity first landed. The great lure of Victoria is the expectation that a thick stack of geological layers will be exposed in the crater walls, potentially several times the thickness that was previously studied at Endurance and therefore, potentially preserving several times the historical record.
Associateship | Indian Academy of Sciences
Indian Academy of Sciences (India)
Associate Profile. Period: 2008–2011. Pal, Dr Bipul. Specialization: Semiconductor Physics, Laser Spectroscopy and Quantum Information Processing Address during Associateship: Indian Institute of Science Edn., and Research, Block HC-VII, Sector III, Salt Lake, Kolkata 700 106. Contact: Email: bipulpal@gmail.com.
Funding Victoria's public hospitals: the casemix policy of 2000-2001.
McNair, Peter; Duckett, Stephen
2002-01-01
On 1 July 1993 Victoria became the first Australian state to use casemix information to set budgets for its public hospitals commencing with casemix funding for inpatient services. Victoria's casemix funding approach now embraces inpatient, outpatient and rehabilitation services.
Lifescience Database Archive (English)
Full Text Available 74EF isoform B OS... 32 4.1 sp|P35253|VGP_MABVM Envelope glycoprotein OS=Lake Victoria...S VT Sbjct: 62 SPVT 65 >sp|P35253|VGP_MABVM Envelope glycoprotein OS=Lake Victoria marburgvirus (strain Muso
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Surface snow and lake water samples were collected at different locations around Indian station at Antarctica, Maitri, during December 2004-March 2005 and December 2006-March 2007.Samples were analyzed for major chemical ions. It is found that average pH value of snow is 6.1. Average pH value of lake water with ...
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
pp 753-762. Chemistry of snow and lake water in Antarctic region · Kaushar Ali Sunil Sonbawane D M Chate Devendraa Siingh P S P Rao P D Safai K B Budhavant · More Details Abstract Fulltext PDF. Surface snow and lake water samples were collected at different locations around Indian station at Antarctica, Maitri, ...
Victoria suudlus teeb maapoisist printsi, kuid mitte tulevase kuninga / Kaivo Kopli
Kopli, Kaivo
2010-01-01
Printsess Victoria tulevasest abikaasast Daniel Westlingist, printsess Madelaine'i kihluse lõpetamisest, Bernadotte'ide dünastia asutajast Jean Bernadotte'ist. Monarhia toetajate vähenemisest Rootsis. Printsess Victoria ja Daniel Westlingi pulmatseremooniast 19. juunil
Coal Corporation of Victoria annual report 1986
Energy Technology Data Exchange (ETDEWEB)
1986-01-01
Information is presented on operations, strategic planning, brown coal production and finance. Divisional reports are presented for the following divisions of the Coal Corporation of Victoria: marketing, technical marketing and special projects, research and development, and corporate services. The activities of the technical marketing and special projects division are discussed under the following headings: the coal for industry programme, the Brown Coal Liquefaction (Victoria) Pty. Ltd. project, dried brown coal activities, and resource development planning and policy activities. The corporation is currently conducting research into the following areas: ion exchange materials, activated carbons, and horticultural and agricultural applications of brown coal.
Late-life depression and the death of Queen Victoria.
Abrams, Robert C
2010-12-01
The objective of this study was to evaluate relationships between the death of Queen Victoria and the depressive episode she experienced during the last year of her life. The last volume of Queen Victoria's personal Journal was reviewed from a geriatrician's perspective, tracing the onset and course of depressive symptoms from entries beginning on 17 August 1900 and ending on 13 January 1901, 9 days before her death. The Queen's own words are supplemented with observations from contemporaneous secondary sources. The antecedents of Queen Victoria's late-life depression, including multiple losses, disabilities, and chronic pain, taken together with the presentation of vegetative, affective, and late cognitive symptoms, suggested the presence of a distinctively geriatric major depressive disorder. The absence of any other medical condition to explain the clinical picture seemed probable but not certain. Although historians and biographers have long been aware of Queen Victoria's final depression, the emphasis has mostly been on her earlier and prolonged mourning for her husband Prince Albert. Re-examined now, the Queen's Journal suggests that a severe late-life depressive episode occurring approximately in her last 5 months contributed meaningfully to her death. Copyright © 2010 John Wiley & Sons, Ltd.
VICTORIA PARK: A DEMOCTRATIC PUBLIC OPEN SPACE FOR INDONESIA DOMESTIC HELPERS (TKW
Directory of Open Access Journals (Sweden)
Parmonangan Manurung
2016-01-01
Full Text Available Victoria Park is the largest city park in Hong Kong. This city park is not only known in Hong Kong, but also very well known in Indonesia as a gathering place for Indonesia domestic helpers (TKW in Hong Kong. This research tried to find out some determinant factors that have been affected the public open spac of Victoria Park to be a gathering place for thousands of TKW in Sunday and holidays as their day off. In order to get the results of research, some methodological research had been conducted such as: observation (survey, mapping, interviews and literature studies. The results showed that Victoria Park has a number of factors capable of meeting the needs of domestic help-ers in Hong Kong, these factors consist of internal factors and external factors. Internally, the character and functions held Victoria Park became a very influential factor, while externally, the accessibility and support functions around Victoria Park also has a considerable influence.
La Ferla, Rosabruna; Azzaro, Maurizio; Michaud, Luigi; Caruso, Gabriella; Lo Giudice, Angelina; Paranhos, Rodolfo; Cabral, Anderson S; Conte, Antonella; Cosenza, Alessandro; Maimone, Giovanna; Papale, Maria; Rappazzo, Alessandro Ciro; Guglielmin, Mauro
2017-08-01
Victoria Land permafrost harbours a potentially large pool of cold-affected microorganisms whose metabolic potential still remains underestimated. Three cores (BC-1, BC-2 and BC-3) drilled at different depths in Boulder Clay (Northern Victoria Land) and one sample (DY) collected from a core in the Dry Valleys (Upper Victoria Valley) were analysed to assess the prokaryotic abundance, viability, physiological profiles and potential metabolic rates. The cores drilled at Boulder Clay were a template of different ecological conditions (different temperature regime, ice content, exchanges with atmosphere and with liquid water) in the same small basin while the Dry Valleys site was very similar to BC-2 conditions but with a complete different geological history and ground ice type. Image analysis was adopted to determine cell abundance, size and shape as well as to quantify the potential viable and respiring cells by live/dead and 5-cyano-2,3-ditolyl-tetrazolium chloride staining, respectively. Subpopulation recognition by apparent nucleic acid contents was obtained by flow cytometry. Moreover, the physiological profiles at community level by Biolog-Ecoplate™ as well as the ectoenzymatic potential rates on proteinaceous (leucine-aminopeptidase) and glucidic (ß-glucosidase) organic matter and on organic phosphates (alkaline-phosphatase) by fluorogenic substrates were tested. The adopted methodological approach gave useful information regarding viability and metabolic performances of microbial community in permafrost. The occurrence of a multifaceted prokaryotic community in the Victoria Land permafrost and a large number of potentially viable and respiring cells (in the order of 10 4 -10 5 ) were recognised. Subpopulations with a different apparent DNA content within the different samples were observed. The physiological profiles stressed various potential metabolic pathways among the samples and intense utilisation rates of polymeric carbon compounds and carbohydrates
Mississippi River Headwaters Lakes in Minnesota
1990-10-01
2.368.00, well below the national poverty level. Unemployment, alcoholism , illiteracy and other social blights are pervasive problems among Indian...germination seeds and by the release of nutrients that accompanies the oxydation and drying of sediments. Effects of Low Lake Stage on Wild Rice 3.10 Wild
Chemistry models in the Victoria code
International Nuclear Information System (INIS)
Grimley, A.J. III
1988-01-01
The VICTORIA Computer code consists of the fission product release and chemistry models for the MELPROG severe accident analysis code. The chemistry models in VICTORIA are used to treat multi-phase interactions in four separate physical regions: fuel grains, gap/open porosity/clad, coolant/aerosols, and structure surfaces. The physical and chemical environment of each region is very different from the others and different models are required for each. The common thread in the modelling is the use of a chemical equilibrium assumption. The validity of this assumption along with a description of the various physical constraints applicable to each region will be discussed. The models that result from the assumptions and constraints will be presented along with samples of calculations in each region
Directory of Open Access Journals (Sweden)
Emmanuelle Gérard
2018-05-01
Full Text Available Lake Dziani Dzaha is a thalassohaline tropical crater lake located on the “Petite Terre” Island of Mayotte (Comoros archipelago, Western Indian Ocean. Stromatolites are actively growing in the shallow waters of the lake shores. These stromatolites are mainly composed of aragonite with lesser proportions of hydromagnesite, calcite, dolomite, and phyllosilicates. They are morphologically and texturally diverse ranging from tabular covered by a cauliflower-like crust to columnar ones with a smooth surface. High-throughput sequencing of bacterial and archaeal 16S rRNA genes combined with confocal laser scanning microscopy (CLSM analysis revealed that the microbial composition of the mats associated with the stromatolites was clearly distinct from that of the Arthrospira-dominated lake water. Unicellular-colonial Cyanobacteria belonging to the Xenococcus genus of the Pleurocapsales order were detected in the cauliflower crust mats, whereas filamentous Cyanobacteria belonging to the Leptolyngbya genus were found in the smooth surface mats. Observations using CLSM, scanning electron microscopy (SEM and Raman spectroscopy indicated that the cauliflower texture consists of laminations of aragonite, magnesium-silicate phase and hydromagnesite. The associated microbial mat, as confirmed by laser microdissection and whole-genome amplification (WGA, is composed of Pleurocapsales coated by abundant filamentous and coccoid Alphaproteobacteria. These phototrophic Alphaproteobacteria promote the precipitation of aragonite in which they become incrusted. In contrast, the Pleurocapsales are not calcifying but instead accumulate silicon and magnesium in their sheaths, which may be responsible for the formation of the Mg-silicate phase found in the cauliflower crust. We therefore propose that Pleurocapsales and Alphaproteobacteria are involved in the formation of two distinct mineral phases present in the cauliflower texture: Mg-silicate and aragonite
3D DIGITAL CADASTRE JOURNEY IN VICTORIA, AUSTRALIA
Directory of Open Access Journals (Sweden)
D. Shojaei
2017-10-01
Full Text Available Land development processes today have an increasing demand to access three-dimensional (3D spatial information. Complex land development may need to have a 3D model and require some functions which are only possible using 3D data. Accordingly, the Intergovernmental Committee on Surveying and Mapping (ICSM, as a national body in Australia provides leadership, coordination and standards for surveying, mapping and national datasets has developed the Cadastre 2034 strategy in 2014. This strategy has a vision to develop a cadastral system that enables people to readily and confidently identify the location and extent of all rights, restrictions and responsibilities related to land and real property. In 2014, the land authority in the state of Victoria, Australia, namely Land Use Victoria (LUV, has entered the challenging area of designing and implementing a 3D digital cadastre focused on providing more efficient and effective services to the land and property industry. LUV has been following the ICSM 2034 strategy which requires developing various policies, standards, infrastructures, and tools. Over the past three years, LUV has mainly focused on investigating the technical aspect of a 3D digital cadastre. This paper provides an overview of the 3D digital cadastre investigation progress in Victoria and discusses the challenges that the team faced during this journey. It also addresses the future path to develop an integrated 3D digital cadastre in Victoria.
Victoria Land, Ross Sea, and Ross Ice Shelf, Antarctica
2002-01-01
On December 19, 2001, MODIS acquired data that produced this image of Antarctica's Victoria Land, Ross Ice Shelf, and the Ross Sea. The coastline that runs up and down along the left side of the image denotes where Victoria Land (left) meets the Ross Ice Shelf (right). The Ross Ice Shelf is the world's largest floating body of ice, approximately the same size as France. Credit: Jacques Descloitres, MODIS Land Rapid Response Team, NASA/GSFC
Spiraal : uus Victoria & Alberti muuseum Londonis
1998-01-01
Daniel Libeskindi projekt Victoria & Alberti Muuseumi laiendamiseks on põhjustanud konservatiivsete londonlaste pahameele, kuid kutsunud esile ka hulgaliselt toetusavaldusi. Muuseumi uus osa (kokkuvarisemise piiril näiva ehitisena) peaks külastajaile avatama 2004. a.
Informal waste harvesting in Victoria Falls town, Zimbabwe: Socio-economic benefits
Masocha, M.
2006-01-01
Waste harvesting, which occurs mostly but not exclusively at open waste dumps in Zimbabwe, constitutes one of the most important survival options for the urban poor. This paper analyses and discusses socio-economic benefits of informal waste harvesters in Victoria Falls town. Victoria Falls town has
Requirements for VICTORIA Class Fire Control System: Contact Management Function
2014-07-01
Requirements for VICTORIA Class Fire Control System Contact Management Function Tab Lamoureux CAE Integrated Enterprise Solutions...Contract Report DRDC-RDDC-2014-C190 July 2014 © Her Majesty the Queen in Right of Canada, as represented by the...i Abstract …….. The VICTORIA Class Submarines (VCS) are subject to a continuing program of technical upgrades. One such program is
Critical Comments on Brian Victoria's "Engaged Buddhism: Skeleton in the Closet?"
Directory of Open Access Journals (Sweden)
Koichi Miyata
2015-02-01
Full Text Available In "Engaged Buddhism: A Skeleton in the Closet?" (Vol. 2 Brian Daizen Victoria claims, among other things, that Tsunesaburo Makiguchi (1871-1944, founder of the Soka Kyoiku Gakkai (forebear of the Soka Gakkai and Soka Gakkai International, was an active supporter of the Japanese wars of aggression. In this response, Koichi Miyata argues that Victoria's claims rest on the highly selective use of quotes, and ignore key interpretative issues associated with Japanese imperial fascism and its underlying belief structures. Miyata discusses the significance of Makiguchi's arrest and imprisonment under a law specifically aimed at opponents of the war efforts, in his analysis of critical lapses in Victoria's article.
Stratigraphic architecture of bedrock reference section, Victoria Crater, Meridiani Planum, Mars
Edgar, Lauren A.; Grotzinger, John P.; Hayes, Alex G.; Rubin, David M.; Squyres, Steve W.; Bell, James F.; Herkenhoff, Ken E.
2012-01-01
The Mars Exploration Rover Opportunity has investigated bedrock outcrops exposed in several craters at Meridiani Planum, Mars, in an effort to better understand the role of surface processes in its geologic history. Opportunity has recently completed its observations of Victoria crater, which is 750 m in diameter and exposes cliffs up to ~15 m high. The plains surrounding Victoria crater are ~10 m higher in elevation than those surrounding the previously explored Endurance crater, indicating that the Victoria crater exposes a stratigraphically higher section than does the Endurance crater; however, Victoria strata overlap in elevation with the rocks exposed at the Erebus crater. Victoria crater has a well-developed geomorphic pattern of promontories and embayments that define the crater wall and that reveal thick bedsets (3–7m) of large-scale cross-bedding, interpreted as fossil eolian dunes. Opportunity was able to drive into the crater at Duck Bay, located on the western margin of Victoria crater. Data from the Microscopic Imager and Panoramic Camera reveal details about the structures, textures, and depositional and diagenetic events that influenced the Victoria bedrock. A lithostratigraphic subdivision of bedrock units was enabled by the presence of a light-toned band that lines much of the upper rim of the crater. In ascending order, three stratigraphic units are named Lyell, Smith, and Steno; Smith is the light-toned band. In the Reference Section exposed along the ingress path at Duck Bay, Smith is interpreted to represent a zone of diagenetic recrystallization; however, its upper contact also coincides with a primary erosional surface. Elsewhere in the crater the diagenetic band crosscuts the physical stratigraphy. Correlation with strata present at nearby promontory Cape Verde indicates that there is an erosional surface at the base of the cliff face that corresponds to the erosional contact below Steno. The erosional contact at the base of Cape Verde
Abaasa, Andrew; Asiki, Gershim; Mpendo, Juliet; Levin, Jonathan; Seeley, Janet; Nielsen, Leslie; Ssetaala, Ali; Nanvubya, Annet; De Bont, Jan; Kaleebu, Pontiano; Kamali, Anatoli
2015-12-24
Fishing communities are potentially suitable for Human immunodeficiency virus (HIV) efficacy trials due to their high risk profile. However, high mobility and attrition could decrease statistical power to detect the impact of a given intervention. We report dropout and associated factors in a fisher-folk observational cohort in Uganda. Human immunodeficiency virus-uninfected high-risk volunteers aged 13-49 years living in five fishing communities around Lake Victoria were enrolled and followed every 6 months for 18 months at clinics located within each community. Volunteers from two of the five communities had their follow-up periods extended to 30 months and were invited to attend clinics 10-40 km (km) away from their communities. Human immunodeficiency virus counseling and testing was provided, and data on sexual behaviour collected at all study visits. Study completion was defined as completion of 18 or 30 months or visits up to the date of sero-conversion and dropout as missing one or more visits. Discrete time survival models were fitted to find factors independently associated with dropout. A total of 1000 volunteers (55% men) were enrolled. Of these, 91.9% completed 6 months, 85.2% completed 12 months and 76.0% completed 18 months of follow-up. In the two communities with additional follow-up, 76.9% completed 30 months. In total 299 (29.9%) volunteers missed at least one visit (dropped out). Dropout was independently associated with age (volunteers aged 13-24 being most likely to dropout), gender [men being more likely to dropout than women [adjusted hazard ratio (aHR) 1.4; 95% confidence interval (CI) 1.1-1.8)], time spent in the fishing community (those who stayed dropout), History of marijuana use (users being more likely to dropout than non-users [1.7; (1.2-2.5)], ethnicity (non-Baganda being more likely to dropout than Baganda [1.5; (1.2-1.9)], dropout varied between the five fishing communities, having a new sexual partner in the previous 3 months [1
State Electricity Commission of Victoria. Annual report 1984-1985
Energy Technology Data Exchange (ETDEWEB)
1985-01-01
The State Electricity Commission of Victoria is a body corporate first constituted under the Electricity Commissioner's Act 1918. It now operates under the State Electricity Commission Act 1958. It generates, transmits and distributes electricity throughout Victoria's 228,000 square kilometres and supplies directly to 1.424 million customers. In addition 277,800 customers are supplied by eleven municipal authorities which purchase electricity in bulk from the Commission. The Commission also has a regulatory responsibility to ensure the safe use of electricity. It employs 22,518 people. The installed capacity of generators in the Commission's system, plus Victoria's share of Snowy and Hume generation, totalled 6603 MW at 30 June 1985 and the main transmission system comprises 500 kV, 300 kV and 220 kV lines. Corporate objectives have been developed in seven broad areas: customers,employee, finance, ntural resources, environment, conservationand community. These areas of activity are detailed in this report.
Nobert, Joel; Mugo, Margaret; Gadain, Hussein
Reliable estimation of flood magnitudes corresponding to required return periods, vital for structural design purposes, is impacted by lack of hydrological data in the study area of Lake Victoria Basin in Kenya. Use of regional information, derived from data at gauged sites and regionalized for use at any location within a homogenous region, would improve the reliability of the design flood estimation. Therefore, the regional index flood method has been applied. Based on data from 14 gauged sites, a delineation of the basin into two homogenous regions was achieved using elevation variation (90-m DEM), spatial annual rainfall pattern and Principal Component Analysis of seasonal rainfall patterns (from 94 rainfall stations). At site annual maximum series were modelled using the Log normal (LN) (3P), Log Logistic Distribution (LLG), Generalized Extreme Value (GEV) and Log Pearson Type 3 (LP3) distributions. The parameters of the distributions were estimated using the method of probability weighted moments. Goodness of fit tests were applied and the GEV was identified as the most appropriate model for each site. Based on the GEV model, flood quantiles were estimated and regional frequency curves derived from the averaged at site growth curves. Using the least squares regression method, relationships were developed between the index flood, which is defined as the Mean Annual Flood (MAF) and catchment characteristics. The relationships indicated area, mean annual rainfall and altitude were the three significant variables that greatly influence the index flood. Thereafter, estimates of flood magnitudes in ungauged catchments within a homogenous region were estimated from the derived equations for index flood and quantiles from the regional curves. These estimates will improve flood risk estimation and to support water management and engineering decisions and actions.
vVICTORIA Console Development: Design and Fabrication of VICTORIA Console Emulations
2011-07-01
successful set-up and readiness to conduct experimentation on facets of new Combat System concept development including equipment capabilities, system...émulateurs, faits de bois, de plastiques et de métaux légers, ont été fabriqués selon les données matérielles et les spécifications des consoles actuelles...mise sur pied du laboratoire d’évaluation de la capacité vVictoria et assureront que celui-ci est prêt pour les essais de nouveaux concepts de système
Arnaud, Fabien; Fanget, Bernard; Malet, Emmanuel; Poulenard, Jérôme; Støren, Eivind; Leloup, Anouk; Bakke, Jostein; Sabatier, Pierre
2016-04-01
Recent paleo-studies revealed climatic southern high latitude climate evolution patterns that are crucial to understand the global climate evolution(1,2). Among others the strength and north-south shifts of westerlies wind appeared to be a key parameter(3). However, virtually no lands are located south of the 45th South parallel between Southern Georgia (60°W) and New Zealand (170°E) precluding the establishment of paleoclimate records of past westerlies dynamics. Located around 50°S and 70°E, lost in the middle of the sub-Antarctic Indian Ocean, Kerguelen archipelago is a major, geomorphologically complex, land-mass that is covered by hundreds lakes of various sizes. It hence offers a unique opportunity to reconstruct past climate and environment dynamics in a region where virtually nothing is known about it, except the remarkable recent reconstructions based on a Lateglacial peatbog sequence(4). During the 2014-2015 austral summer, a French-Norwegian team led the very first extensive lake sediment coring survey on Kerguelen Archipelago under the umbrella of the PALAS program supported by the French Polar Institute (IPEV). Two main areas were investigated: i) the southwest of the mainland, so-called Golfe du Morbihan, where glaciers are currently absent and ii) the northernmost Kerguelen mainland peninsula so-called Loranchet, where cirque glaciers are still present. This double-target strategy aims at reconstructing various independent indirect records of precipitation (glacier advance, flood dynamics) and wind speed (marine spray chemical species, wind-borne terrigenous input) to tackle the Holocene climate variability. Despite particularly harsh climate conditions and difficult logistics matters, we were able to core 6 lake sediment sites: 5 in Golfe du Morbihan and one in Loranchet peninsula. Among them two sequences taken in the 4km-long Lake Armor using a UWITEC re-entry piston coring system by 20 and 100m water-depth (6 and 7m-long, respectively). One
Similar levels of diversity and population Structure in superflock and ...
African Journals Online (AJOL)
superflock cichlid fishes from Lake Victoria, Africa. ... Tropical Freshwater Biology ... We use DNA microsatellite loci to estimate neutral genetic diversity and the level of gene flow among populations of two cichlid species from southern Lake Victoria, ...
Mathematical Problems in Biology : Victoria Conference
1974-01-01
A conference on "Some Mathematical Problems in Biology" was held at the University of Victoria, Victoria, B. C. , Canada, from May 7 - 10, 1973. The participants and invited speakers were mathematicians interested in problems of a biological nature, and scientists actively engaged in developing mathematical models in biological fields. One aim of the conference was to attempt to assess what the recent rapid growth of mathematical interaction with the biosciences has accomplished and may accomplish in the near future. The conference also aimed to expose the problems of communication bet~",een mathematicians and biological scientists, and in doing so to stimulate the interchange of ideas. It was recognised that the topic spans an enormous breadth, and little attempt was made to balance the very diverse areas. Widespread active interest was shown in the conference, and just over one hundred people registered. The varied departments and institutions across North America from which the participants came made it bo...
No fixed place of birth: unplanned BBAs in Victoria, Australia.
McLelland, Gayle; McKenna, Lisa; Archer, Frank
2013-02-01
the primary objective-to present data on the incidence of unplanned births before arrival (BBAs) in Victoria between 1991 and 2008. The secondary objective-to provide an extensive literature review highlighting the issues surrounding an unplanned BBA. the incidence of BBAs in Victoria published in the relevant government reports. data were extracted from published government reports pertaining to perinatal statistics in Victoria-The Australian Institute of Health and Wellbeing and the Perinatal Data Collection Unit of Victoria. Data on place of birth for each year from both sources was identified and tabulated. Comparisons between the data sources were undertaken to provide a picture of the scope of out of hospital birth. the incidence and absolute numbers of unplanned birth before arrival (BBA) to hospital in Victoria, are low compared to the total births. However, this number is comparable to unplanned BBAs in other developed countries with similar health systems. The incidence of unplanned BBAs has slowly but steadily doubled since 1991-2008. The two data sources almost mirror each other except for 1999 when there was an unexplained difference in the reported incidence in unplanned BBAs. Maternal and neonatal outcomes are disproportionally much poorer after unplanned BBAs than either planned home births or in hospital births. Various maternal factors can increase the risk of an unplanned BBA. multiple approaches should be adopted to manage unplanned BBAs. Antenatal screening should be undertaken to identify the women most at risk. Strategies can be developed that will reduce poor neonatal and maternal outcomes, including education for women and their partners on immediate management of the newborn; ensuring paramedics have current knowledge on care during childbirth; and maternity and ambulance services should develop management plans for care of women having unplanned BBAs. Copyright © 2011 Elsevier Ltd. All rights reserved.
State Electricity Commission of Victoria annual report 1983-1984
Energy Technology Data Exchange (ETDEWEB)
1984-01-01
The State Electricity Commission of Victoria (SECV) generates, transmits and distributes electricity throughout Victoria's 228,000 square kilometres and supplies directly to 1.390 million customers. In addition, 278,500 customers are supplied by eleven municipal authorities which purchase electricity in bulk from the Commission. The Commission also has a responsibility to ensure the safe use of electricity. The Commission's mission statement is 'to provide cost effective energy and services and to act at all times in the best interests of the people of Victoria by being a responsible, adaptive, financially sound and efficient public utility'. The mission statement is the foundation for all activities and should provide the Commission with a sense of direction and unity of purpose. Corporate objectives have been developed in the following seven broad areas: customer, employee, finance, natural resources, environment, conservation and community. Each objective has been translated into a series of specific goals, the achievement of which will be monitored. Details relating to these areas of activity are detailed in this report.
Lifescience Database Archive (English)
Full Text Available ge structural protein OS=Lake Victoria marb... 30 6.5 sp|P14745|CD44_PAPHA CD44 antigen OS=Papio hamadryas G...5262|L_MABVP Large structural protein OS=Lake Victoria marburgvirus (strain Popp-
Directory of Open Access Journals (Sweden)
Rafael Maura Mijares
2004-01-01
Full Text Available Se recoge en este artículo nuestra reciente revisión del conjunto pictórico postpaleolítico de la cueva de la Victoria. A partir de una documentación exhaustiva de los motivos representados y del análisis de su iconografía se proponen hipótesis de carácter interpretativo.In this article we gather the recent revision of the postpalaeolithic pictorial collection in the cave of la Victoria. Starting from an exhaustive documentation of the motifs and the analysis of its iconography, we propose some interpretative hypothesis.
Seabed surveys of Victoria harbour, Mahe, Seychelles
Digital Repository Service at National Institute of Oceanography (India)
Hashimi, N.H.; Wagle, B.G.
The seabed surveys in the Victoria Harbour, Mahe, Seychelles shows that the prominent feature is the navigational channel aligned in the northeast-southwest direction with a width varying from 300 to 450m. The depth in the channel ranges from 14...
Directory of Open Access Journals (Sweden)
W James Cooper
2010-03-01
Full Text Available How particular changes in functional morphology can repeatedly promote ecological diversification is an active area of evolutionary investigation. The African rift-lake cichlids offer a calibrated time series of the most dramatic adaptive radiations of vertebrate trophic morphology yet described, and the replicate nature of these events provides a unique opportunity to test whether common changes in functional morphology have repeatedly facilitated their ecological success.Specimens from 87 genera of cichlid fishes endemic to Lakes Tanganyka, Malawi and Victoria were dissected in order to examine the functional morphology of cichlid feeding. We quantified shape using geometric morphometrics and compared patterns of morphological diversity using a series of analytical tests. The primary axes of divergence were conserved among all three radiations, and the most prevalent changes involved the size of the preorbital region of the skull. Even the fishes from the youngest of these lakes (Victoria, which exhibit the lowest amount of skull shape disparity, have undergone extensive preorbital evolution relative to other craniofacial traits. Such changes have large effects on feeding biomechanics, and can promote expansion into a wide array of niches along a bentho-pelagic ecomorphological axis.Here we show that specific changes in trophic anatomy have evolved repeatedly in the African rift lakes, and our results suggest that simple morphological alterations that have large ecological consequences are likely to constitute critical components of adaptive radiations in functional morphology. Such shifts may precede more complex shape changes as lineages diversify into unoccupied niches. The data presented here, combined with observations of other fish lineages, suggest that the preorbital region represents an evolutionary module that can respond quickly to natural selection when fishes colonize new lakes. Characterizing the changes in cichlid trophic
Dicty_cDB: Contig-U14564-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available |pid:none) Pseudomonas fluorescens SBW25 c... 32 9.8 DQ447651_7( DQ447651 |pid:none) Lake Victoria marburgv...uschii clone CDS3047 al... 32 9.8 DQ447650_7( DQ447650 |pid:none) Lake Victoria marburgvirus - DRC19... 32 9
Ferrara, Giuseppe; Gallotta, Alessandra; Pacucci, Carmela; Matarrese, Angela Maria Stella; Mazzeo, Andrea; Giancaspro, Angelica; Gadaleta, Agata; Piazzolla, Francesca; Colelli, Giancarlo
2017-12-01
Puglia is the most important region in Italy for table grape production. Since consumers look for new products, the number of table grape varieties has greatly increased in recent years. In a survey in the Puglia region, we identified several years ago a potential mutation of the cv. Victoria. We described this accession in comparison with the standard Victoria for some amphelographic traits. All the characteristics were very similar to the standard Victoria except for the berry shape, which was significantly more elongated. Moreover, the berry of the mutated Victoria showed higher firmness, lightness and chroma than the standard one, with a more intense yellow colour of the skin (appreciated by consumers). The molecular characterisation with 25 SSR markers showed that normal and mutant Victoria were genetically identical at all the analysed loci, thus suggesting that the two accessions could be considered as clones with the difference in berry shape probably due to a somatic mutation. This mutation of the cv. Victoria may have interesting perspective for the market since consumers are always attracted by different shape and colour of the fruits (consumers buy with eyes). This accession can be an alternative clone of the already known standard Victoria. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Energy Technology Data Exchange (ETDEWEB)
Hammerton, Richard [Funkwerk Information Technologies York Ltd., York (United Kingdom)
2010-07-01
Funkwerk IT is supplying a state-of-the-art timetable and fleet planning and management system to the Australian State of Victoria. Through its agency, the Department of Transport, Victoria is undertaking a once in a generation upgrade to key ICT systems that are used for operational control of the metropolitan and regional rail networks. The new system requires a tight coupling of both planning and real-time management systems. Using its products TrainPlan, ResourcePlan and ResourceManager Funkwerk IT provides an ideal platform to cover these requirements. (orig.)
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
A hydrological simulation of the water regime in two playa lakes located in southern Spain ... Response of bankfull discharge of the Inner Mongolia Yellow River to flow .... Forest cover change prediction using hybrid methodology of geoinformatics .... of deep-sea manganese nodules from the Central Indian Ocean Basin.
Eesti NATO Ühing juurutab demokraatlikke väärtusi / Victoria Punga ; interv. Aive Antsov
Punga, Victoria, 1977-
2007-01-01
Eesti NATO Ühingu tegevjuht organisatsiooni eesmärkidest, projektidest, koostööst teiste riikidega ning kaitsepoliitika ja majanduse seostest. Lisa: Väljavõte Victoria CVst; Eesti kaitsepoliitika viis plussi Victoria meelest
Influence of permafrost on lake terraces of Lake Heihai (NE Tibetan Plateau)
Lockot, Gregori; Hartmann, Kai; Wünnemann, Bernd
2013-04-01
The Tibetan Plateau (TP) is one of the key regions for climatic global change. Besides the poles the TP is the third highest storage of frozen water in glaciers. Here global warming is three times higher than in the rest of the world. Additionally the TP provides water for billions of people and influences the moisture availability from the Indian and East Asian monsoon systems. During the Holocene extent and intensity of the monsoonal systems changed. Hence, in the last decades, a lot of work was done to reconstruct timing and frequency of monsoonal moisture, to understand the past and give a better forecast for the future. Comparative workings often show very heterogeneous patterns of timing and frequency of the Holocene precipitation and temperature maximum, emphasizing the local importance of catchment dynamics. In this study we present first results of lake Heihai (36°N, 93°15'E, 4500m a.s.l.), situated at the north-eastern border of the TP. The lake is surrounded by a broad band of near-shore lake sediments, attesting a larger lake extent in the past. These sediments were uplifted by permafrost, reaching nowadays heights ca. +8 meters above present lake level. Due to the uplift one of the main inflows was blocked and the whole hydrology of the catchment changed. To quantify the uplift of permafrost Hot Spot Analysis were accomplished at a DEM of the near-shore area. As a result regions of high permafrost uplift and those which mirror the original height of lake ground were revealed. The most obvious uplift took place in the northern and western part of the lake, where the four uplift centers are located. In contrast the southern and eastern areas show a rather degraded pattern (probably by fluvial erosion, thermokarst, etc.). The ancient lake bottom, without permafrost uplift was estimated to be 4-6 meters above the modern lake level. For a better understanding of permafrost interaction inside the terrace bodies a 5m sediment profile was sampled and
Zhang, Yunlin; Yao, Xiaolong; Qin, Boqiang
2016-07-01
Lake Taihu, as the important drinking water source of the Yangtze River Delta urban agglomeration and the third largest freshwater lake in China, has experienced serious lake eutrophication and water quality deterioration in the past three decades. Growing scientific, political, and public attention has been given to the water quality of Lake Taihu. This study aimed to conduct a comparative quantitative and qualitative analysis of the development, current hotspots, and future directions of Lake Taihu research using a bibliometric analysis of eight well-studied lakes (Lake Taihu, Lake Baikal, Lake Biwa, Lake Erie, Lake Michigan, Lake Ontario, Lake Superior and Lake Victoria) around the world based on the Science Citation Index (SCI) database. A total of 1582 papers discussing Lake Taihu research were published in 322 journals in the past three decades. However, the first paper about Lake Taihu research was not found in the SCI database until 1989, and there were only zero, one, or two papers each year from 1989 to 1995. There had been rapid development in Lake Taihu research since 1996 and a sharp increase in papers since 2005. A keyword analysis showed that "sediment," "eutrophication", "Microcystis aeruginosa", "cyanobacterial blooms", and "remote sensing" were the most frequently used keywords of the study subject. Owing to its significant impact on aquatic ecosystems, a crucial emphasis has been placed on climate change recently. In addition, the future focuses of research directions, including (1) environmental effects of physical processes; (2) nutrient cycles and control and ecosystem responses; (3) cyanobacteria bloom monitoring, causes, forecast and management; (4) eutrophication and climate change interactions; and (5) ecosystem degradation mechanism and ecological practice of lake restoration, are presented based on the keyword analysis. Through multidisciplinary fields (physics, chemistry, and biology) cross and synthesis study of Lake Taihu, the
Understanding virtual water flows: A multiregion input-output case study of Victoria
Lenzen, Manfred
2009-09-01
This article explains and interprets virtual water flows from the well-established perspective of input-output analysis. Using a case study of the Australian state of Victoria, it demonstrates that input-output analysis can enumerate virtual water flows without systematic and unknown truncation errors, an issue which has been largely absent from the virtual water literature. Whereas a simplified flow analysis from a producer perspective would portray Victoria as a net virtual water importer, enumerating the water embodiments across the full supply chain using input-output analysis shows Victoria as a significant net virtual water exporter. This study has succeeded in informing government policy in Australia, which is an encouraging sign that input-output analysis will be able to contribute much value to other national and international applications.
Formula-Based Public School Funding System in Victoria: An Empirical Analysis of Equity
Bandaranayake, Bandara
2013-01-01
This article explores the formula-based school funding system in the state of Victoria, Australia, where state funds are directly allocated to schools based on a range of equity measures. The impact of Victoria' funding system for education in terms of alleviating inequality and disadvantage is contentious, to say the least. It is difficult to…
Kukovica, J.; Molnar, S.; Ghofrani, H.
2017-12-01
The Leech River fault is situated on Vancouver Island near the city of Victoria, British Columbia, Canada. The 60km transpressional reverse fault zone runs east to west along the southern tip of Vancouver Island, dividing the lithologic units of Jurassic-Cretaceous Leech River Complex schists to the north and Eocene Metchosin Formation basalts to the south. This fault system poses a considerable hazard due to its proximity to Victoria and 3 major hydroelectric dams. The Canadian seismic hazard model for the 2015 National Building Code of Canada (NBCC) considered the fault system to be inactive. However, recent paleoseismic evidence suggests there to be at least 2 surface-rupturing events to have exceeded a moment magnitude (M) of 6.5 within the last 15,000 years (Morell et al. 2017). We perform a Probabilistic Seismic Hazard Analysis (PSHA) for the city of Victoria with consideration of the Leech River fault as an active source. A PSHA for Victoria which replicates the 2015 NBCC estimates is accomplished to calibrate our PSHA procedure. The same seismic source zones, magnitude recurrence parameters, and Ground Motion Prediction Equations (GMPEs) are used. We replicate the uniform hazard spectrum for a probability of exceedance of 2% in 50 years for a 500 km radial area around Victoria. An active Leech River fault zone is then added; known length and dip. We are determining magnitude recurrence parameters based on a Gutenberg-Richter relationship for the Leech River fault from various catalogues of the recorded seismicity (M 2-3) within the fault's vicinity and the proposed paleoseismic events. We seek to understand whether inclusion of an active Leech River fault source will significantly increase the probabilistic seismic hazard for Victoria. Morell et al. 2017. Quaternary rupture of a crustal fault beneath Victoria, British Columbia, Canada. GSA Today, 27, doi: 10.1130/GSATG291A.1
Lifescience Database Archive (English)
Full Text Available ABVR Minor nucleoprotein VP30 OS=Lake Victoria m... 30 9.1 sp|A1AYS1|SELA_PARDP L...E 586 G H+ +G L +P M++ Sbjct: 498 GEVHHC-KGELARALPMMQQ 516 >sp|Q1PDC6|VP30_MABVR Minor nucleoprotein VP30 OS=Lake Victoria
Malaria and Chikungunya Detected Using Molecular Diagnostics Among Febrile Kenyan Children.
Waggoner, Jesse; Brichard, Julie; Mutuku, Francis; Ndenga, Bryson; Heath, Claire Jane; Mohamed-Hadley, Alisha; Sahoo, Malaya K; Vulule, John; Lefterova, Martina; Banaei, Niaz; Mukoko, Dunstan; Pinsky, Benjamin A; LaBeaud, A Desiree
2017-01-01
In sub-Saharan Africa, malaria is frequently overdiagnosed as the cause of an undifferentiated febrile illness, whereas arboviral illnesses are presumed to be underdiagnosed. Sera from 385 febrile Kenyan children, who presented to 1 of 4 clinical sites, were tested using microscopy and real-time molecular assays for dengue virus (DENV), chikungunya virus (CHIKV), malaria, and Leptospira . Malaria was the primary clinical diagnosis for 254 patients, and an arboviral infection (DENV or CHIKV) was the primary diagnosis for 93 patients. In total, 158 patients (41.0%) had malaria and 32 patients (8.3%) had CHIKV infections. Compared with real-time polymerase chain reaction, microscopy demonstrated a percent positive agreement of 49.7%. The percentage of malaria cases detected by microscopy varied significantly between clinical sites. Arboviral infections were the clinical diagnosis for patients on the Indian Ocean coast (91 of 238, 38.2%) significantly more often than patients in the Lake Victoria region (2 of 145, 1.4%; P < .001). However, detection of CHIKV infections was significantly higher in the Lake Victoria region (19 of 145 [13.1%] vs 13 of 239 [5.4%]; P = .012). The clinical diagnosis of patients with an acute febrile illness, even when aided by microscopy, remains inaccurate in malaria-endemic areas, contributing to inappropriate management decisions.
Mercury biomagnification in the food web of Lake Tanganyika (Tanzania, East Africa)
Energy Technology Data Exchange (ETDEWEB)
Campbell, L. [School of Environmental Studies and Department of Biology, Queen' s University, Kingston, Ontario, K7L-3N6 (Canada)], E-mail: linda.campbell@queensu.ca; Verburg, Piet [National Institute of Water and Atmospheric Research, PO Box 11-115, Hamilton 3251 (New Zealand); Dixon, D.G. [Department of Biology, University of Waterloo, 200 University Avenue, Waterloo (Canada); Hecky, R.E. [Large Lakes Observatory, University of Minnesota, Duluth, 10 University Drive 204 RLBDuluth, MN 55812-2496 (United States)
2008-09-01
Lake Tanganyika is a globally important lake with high endemic biodiversity. Millions of people in the lake basin depend on several fish species for consumption. Due to the importance of fish consumption as an exposure route of mercury to humans, we sampled Lake Tanganyika in 2000 to assess total mercury concentrations and biomagnification of total mercury through the food web. Stable nitrogen and carbon isotope analyses of food web structure indicate a complex food web with overlapping omnivory with some specialist fish species. Stable nitrogen isotope analyses further confirm that mercury is biomagnifying through the Tanganyika food web at rates similar to those seen in Lakes Malawi and Victoria, the other two African Great Lakes. Most collected fish species and all invertebrate species had mercury concentrations below 0.2 {mu}g Hg/g wet weight. However, several fish species, Ctenochromis horei (average 0.15 {mu}g/g ww), Neolamprologus boulengeri (0.2 {mu}g/g ww) , Bathybates spp.spp. (0.21 {mu}g/g ww), Mastacembelus cunningtoni (0.22 {mu}g/g ww) and Clarias theodorae (0.22 {mu}g/g ww) approached or slightly exceeded the World Health Organization (WHO)'s recommended guideline of 0.2 {mu}g Hg/g for vulnerable populations with high rates of fish consumption. Two individuals of the piscivorous fish species Lates microlepis (0.54, 0.78 {mu}g/g ww) and a Polypterus congicus (1.3 {mu}g/g ww) exceeded the international marketing limit value of 0.5 {mu}g/g ww. Because C. theodorae and L. microlepis are also important market fish species, there is a need to monitor mercury concentrations in internationally marketed fish from Lake Tanganikya to ensure that those fish do not present a risk to human consumers.
Mercury biomagnification in the food web of Lake Tanganyika (Tanzania, East Africa)
International Nuclear Information System (INIS)
Campbell, L.; Verburg, Piet; Dixon, D.G.; Hecky, R.E.
2008-01-01
Lake Tanganyika is a globally important lake with high endemic biodiversity. Millions of people in the lake basin depend on several fish species for consumption. Due to the importance of fish consumption as an exposure route of mercury to humans, we sampled Lake Tanganyika in 2000 to assess total mercury concentrations and biomagnification of total mercury through the food web. Stable nitrogen and carbon isotope analyses of food web structure indicate a complex food web with overlapping omnivory with some specialist fish species. Stable nitrogen isotope analyses further confirm that mercury is biomagnifying through the Tanganyika food web at rates similar to those seen in Lakes Malawi and Victoria, the other two African Great Lakes. Most collected fish species and all invertebrate species had mercury concentrations below 0.2 μg Hg/g wet weight. However, several fish species, Ctenochromis horei (average 0.15 μg/g ww), Neolamprologus boulengeri (0.2 μg/g ww) , Bathybates spp.spp. (0.21 μg/g ww), Mastacembelus cunningtoni (0.22 μg/g ww) and Clarias theodorae (0.22 μg/g ww) approached or slightly exceeded the World Health Organization (WHO)'s recommended guideline of 0.2 μg Hg/g for vulnerable populations with high rates of fish consumption. Two individuals of the piscivorous fish species Lates microlepis (0.54, 0.78 μg/g ww) and a Polypterus congicus (1.3 μg/g ww) exceeded the international marketing limit value of 0.5 μg/g ww. Because C. theodorae and L. microlepis are also important market fish species, there is a need to monitor mercury concentrations in internationally marketed fish from Lake Tanganikya to ensure that those fish do not present a risk to human consumers
Hospital capacity and management preparedness for pandemic influenza in Victoria.
Dewar, Ben; Barr, Ian; Robinson, Priscilla
2014-04-01
This study was designed to investigate acute hospital pandemic influenza preparedness in Victoria, Australia, particularly focussing on planning and management efforts. A prospective study was conducted by questionnaire and semi-structured interview of health managers across the Victorian hospital system from July to October 2011. Participants with responsibility for emergency management, planning and operations were selected from every hospital in Victoria with an emergency department to complete a questionnaire (response rate 22/43 = 51%). Each respondent was invited to participate in a phone-based semi-structured interview (response rate 11/22 = 50%). Rural/regional hospitals demonstrated higher levels of clinical (86%) and non-clinical (86%) staff contingency planning than metropolitan hospitals (60% and 40% respectively). Pandemic plans were not being sufficiently tested in exercises or drills, which is likely to undermine their effectiveness. All respondents reported hand hygiene and standard precautions programs in place, although only one-third (33%) of metropolitan respondents and no rural/regional respondents reported being able to meet patient needs with high levels of staff absenteeism. Almost half Victoria's healthcare workers were unvaccinated against influenza. Hospitals across Victoria demonstrated different levels of influenza pandemic preparedness and planning. If a more severe influenza pandemic than that of 2009 arose, Victorian hospitals would struggle with workforce and infrastructure problems, particularly in rural/regional areas. Staff absenteeism threatens to undermine hospital pandemic responses. Various strategies, including education and communication, should be included with in-service training to provide staff with confidence in their ability to work safely during a future pandemic. © 2014 The Authors. ANZJPH © 2014 Public Health Association of Australia.
Lake Roosevelt Rainbow Trout : Habitat/Passage Improvement Project Annual Report 2000.
Energy Technology Data Exchange (ETDEWEB)
Sear, Sheri
2001-02-01
Lake Franklin D. Roosevelt was created with the completion of the Grand Coulee Dam in 1942. The lake stretches 151 miles up-stream to the International border between the United States and Canada at the 49th parallel. Increased recreational use, subsistence and sport fishing has resulted in intense interest and possible exploitation of the resources within the lake. Previous studies of the lake and its fishery have been limited. Early studies indicate that natural reproduction within the lake and tributaries are not sufficient to support a rainbow trout (Onchoryhnchus mykiss) fishery (Scholz et. al., 1988). These studies indicate that the rainbow trout population may be limited by lack of suitable habitat for spawning and rearing (Scholz et. al., 1988). The initial phase of this project (Phase I, baseline data collection- 1990-91) was directed at the assessment of limiting factors such as quality and quantity of available spawning gravel, identification of passage barriers, and assessment of other limiting factors. Population estimates were conducted using the Seber/LeCren removal/depletion method. After the initial assessment of stream parameters, several streams were selected for habitat/passage improvement projects (Phase II, implementation-1992-96). At the completion of project habitat improvements, the final phase (Phase III, monitoring) began. This phase will assess changes and gauge the success achieved through the improvements. The objective of the project is to correct passage barriers and improve habitat conditions of selected tributaries to Lake Roosevelt for adfluvial rainbow trout that utilize tributary streams for spawning and rearing. Streams with restorable habitats were selected for improvements. Completion of improvement efforts should increase the adfluvial rainbow trout contribution to the resident fishery in Lake Roosevelt. Three co-operating agencies, the Confederated Tribes of the Colville Reservation (CCT), the Spokane Tribe of Indians (STI
Lake Roosevelt Rainbow Trout : Habitat/Passage Improvement Project Annual Report 1999.
Energy Technology Data Exchange (ETDEWEB)
Jones, Charles D.
2000-02-01
Lake Franklin D. Roosevelt was created with the completion of the Grand Coulee Dam in 1942. The lake stretches 151 miles up-stream to the International border between the United States and Canada at the 49th parallel. Increased recreational use, subsistence and sport fishing has resulted in intense interest and possible exploitation of the resources within the lake. Previous studies of the lake and its fishery have been limited. Early studies indicate that natural reproduction within the lake and tributaries are not sufficient to support a rainbow trout (Onchoryhnchus mykiss) fishery (Scholz et. al., 1988). These studies indicate that the rainbow trout population may be limited by lack of suitable habitat for spawning and rearing (Scholz et. al., 1988). The initial phase of this project (Phase I, baseline data collection- 1990-91) was directed at the assessment of limiting factors such as quality and quantity of available spawning gravel, identification of passage barriers, and assessment of other limiting factors. Population estimates were conducted using the Seber/LeCren removal/depletion method. After the initial assessment of stream parameters, several streams were selected for habitat/passage improvement projects (Phase II, implementation-1992-96). At the completion of project habitat improvements, the final phase (Phase III, monitoring) began. This phase will assess changes and gauge the success achieved through the improvements. The objective of the project is to correct passage barriers and improve habitat conditions of selected tributaries to Lake Roosevelt for adfluvial rainbow trout that utilize tributary streams for spawning and rearing. Streams with restorable habitats were selected for improvements. Completion of improvement efforts should increase the adfluvial rainbow trout contribution to the resident fishery in Lake Roosevelt. Three co-operating agencies, the Confederated Tribes of the Colville Reservation (CCT), the Spokane Tribe of Indians (STI
An Indian tribal view of the back end of the nuclear fuel cycle: historical and cultural lessons
International Nuclear Information System (INIS)
Tano, M.L.; Powankee, D.; Lester, A.D.
1995-01-01
The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation and the Yakama Indian Nation have entered into cooperative agreements with the US Department of Energy to oversee the cleanup of the Hanford Reservation. The Mescalero Apache Tribe and the Meadow Lake Tribal Council have come under severe criticism from some ''ideological pure'' Indians and non-Indians for aiding and abetting the violation of Mother Earth by permitting the land to be contaminated by radioactive wastes. This paper suggests that this view of the Indian relationship to nature and the environment is too narrow and describes aspects of Indian religion that support tribal involvement in radioactive waste management. (O.M.)
Lifescience Database Archive (English)
Full Text Available . 32 3.4 sp|Q1PDC4|L_MABVR Large structural protein OS=Lake Victoria marb... 30 9.8 >sp|Q56A10|ZN608_MOUSE Z...e structural protein OS=Lake Victoria marburgvirus (strain Ravn-87) GN=L PE=3 SV=1 Length = 2327 Score = 30.
Youth suicide in Victoria: a retrospective study.
Krupinski, J; Tiller, J W; Burrows, G D; Hallenstein, H
1994-02-07
To determine the trends in youth suicide in Victoria and Australia as a whole, and their relation to youth unemployment. We used Australian Bureau of Statistics data to analyse suicide trends between 1907 and 1990 in young people aged 15-24 years and made an in-depth study of youth suicides between 1980 and 1990, for which computerised data are available. There has been a steady increase in youth suicide both in Victoria and Australia as a whole since 1960 in males but not females. There were significant differences in age, sex and area of residence in both the rate and the method of suicide. The increase in youth suicide was not associated with the rise in unemployment. Male (not female) suicide rates were higher in non-metropolitan areas and areas of high youth unemployment. The reasons for the increase in youth suicide remain obscure. There is a need for a prospective in-depth study to determine factors in the aetiology of youth suicide, with particular reference to possible areas for prevention.
Increasing deaths involving oxycodone, Victoria, Australia, 2000-09.
Rintoul, Angela C; Dobbin, Malcolm D H; Drummer, Olaf H; Ozanne-Smith, Joan
2011-08-01
In light of an emerging epidemic identified in the United States and Canada, to identify trends in fatal drug toxicity involving oxycodone and the demographic characteristics and indicators of socioeconomic disadvantage of the deceased. Population-based observational study in Victoria, Australia. Decedents whose death was reported to the Victorian Coroner between 2000 and 2009 and where oxycodone was detected. Association between supply of oxycodone and deaths. Demographic characteristics of decedents. Rate ratios of the rural or metropolitan location and socioeconomic indicators of disadvantage of the deceased. Supply to Victoria has increased nine-fold from 7.5 mg per capita in 2000 to 67.5 mg per capita in 2009. Detection of oxycodone in deaths reported to the Victorian Coroner has increased from 4 (0.08/100,000 population) in 2000 to 97 (1.78/100,000 population) in 2009-a 21-fold increase in deaths. Of the 320 cases described, 53.8% (172) were the result of drug toxicity. Of these, 52.3% were unintentional and 19.8% intentional self-harm; the remaining 27.9% are either still under investigation by the coroner or intent is unknown. Drug toxicity deaths were overrepresented in both rural areas and areas indexed with high levels of disadvantage. The substantial increase in the number of deaths involving oxycodone is strongly and significantly associated with the increase in supply. Most drug toxicity deaths involving oxycodone were unintentional. This newly identified trend in fatalities in Victoria supports concerns that a pattern of increasing deaths involving oxycodone is emerging globally.
International Nuclear Information System (INIS)
Bell, W.T.
1991-01-01
During the Quaternary period in Australia large areas of western New South Wales and northern Victoria were covered by hundreds of lakes, both large and small. Nearly all are dry today but some may still be recognized by the long low dunes that follow the eastern shorelines. Many traces of early human occupation have been found along the shorelines of nearly all the major lakes and some of the best exposures have occurred on the lunette along the eastern shore of Lake Mungo. This lunette, has suffered massive erosion in recent times and this has uncovered the sites of many ancient fireplaces. Charcoal from some of these fireplaces has been dated by Barbetti and Polach (1973) using the radiocarbon method and the ages place the lakeside dwellers at Mungo in an area of Australian prehistory around 30 000 years ago. The baked sediment from below the fireplaces appears to have been heated to a temperature in excess of 400 o C according to archaeomagnetic studies carried out by Barbetti (1973) and this indicated that the fireplaces might lend themselves to the technique of thermoluminescence (TL) dating. The results of the TL dating programme are described elsewhere. (author)
Energy Technology Data Exchange (ETDEWEB)
Bell, W T [Australian National Univ., Canberra (Australia)
1991-02-01
During the Quaternary period in Australia large areas of western New South Wales and northern Victoria were covered by hundreds of lakes, both large and small. Nearly all are dry today but some may still be recognized by the long low dunes that follow the eastern shorelines. Many traces of early human occupation have been found along the shorelines of nearly all the major lakes and some of the best exposures have occurred on the lunette along the eastern shore of Lake Mungo. This lunette, has suffered massive erosion in recent times and this has uncovered the sites of many ancient fireplaces. Charcoal from some of these fireplaces has been dated by Barbetti and Polach (1973) using the radiocarbon method and the ages place the lakeside dwellers at Mungo in an area of Australian prehistory around 30 000 years ago. The baked sediment from below the fireplaces appears to have been heated to a temperature in excess of 400{sup o}C according to archaeomagnetic studies carried out by Barbetti (1973) and this indicated that the fireplaces might lend themselves to the technique of thermoluminescence (TL) dating. The results of the TL dating programme are described elsewhere. (author).
Victoria Stodden: Scholarly Communication in the Era of Big Data and Big Computation
Stodden, Victoria
2015-01-01
Victoria Stodden gave the keynote address for Open Access Week 2015. "Scholarly communication in the era of big data and big computation" was sponsored by the University Libraries, Computational Modeling and Data Analytics, the Department of Computer Science, the Department of Statistics, the Laboratory for Interdisciplinary Statistical Analysis (LISA), and the Virginia Bioinformatics Institute. Victoria Stodden is an associate professor in the Graduate School of Library and Information Scien...
An Investigation of the Hydroclimate Variability of Eastern Africa
Smith, K. A.; Semazzi, F. H. M.
2015-12-01
The flow of the Victoria Nile, and the productivity of the dams along it, is determined by the level of Lake Victoria, which is primarily dictated by the rainfall and temperature variability over the Lake Victoria Basin. Notwithstanding the indisputable decline of water resources over the lake basin during the Long Rains of March - May, there is a strong indication based on IPCC climate projections that this trend, which has persisted for several decades, will reverse in the next few decades. This phenomenon has come to be known as the Eastern-Central African climate change paradox and could have profound implications on sustainable development for the next few decades in Lake Victoria Basin. The purpose of this study is to investigate the climate variability associated with the East African Climate Change Paradox for the recent decades. This research analyzes observations to understand the sources of variability and potential physical mechanisms related to the decline in precipitation over Eastern Africa. We then investigate the hydrological factors involved in the decline of Lake Victoria levels in the context of the decline in rainfall. While East Africa has been experiencing persistent decline of the Long Rains for multiple decades, this same decline is not seen in annual rainfall. The remaining seasons show an increase in rainfall which is compensating for the decline of the Long Rains. It is possible that the Long Rains season is shifting in such a way that the season starts earlier, in February, and ending sooner. The corresponding annual Lake Victoria levels modeled using observed rainfall do not decline in the recent decades, except when the Long Rains seasonal variability is considered without variability from other seasons. This shift could impact hydroelectric power planning on a monthly or seasonal time scale, and could potentially have a large impact on agriculture, since it would shift the growing season in the region.
Wellness Circles: The Alkali Lake Model in Community Recovery Processes.
Ben, Leon W.; And Others
The case study described here was conducted as a doctoral research project at Northern Arizona University. The study documents the success of the Shuswop Indian Band of Alkali Lake, British Columbia (Canada), in their 15-year battle with alcoholism, once the people themselves decided on recovery. The study looks back at the 95 percent recovery…
Job-Sharing at the Greater Victoria Public Library.
Miller, Don
1978-01-01
Describes the problems associated with the management of part-time library employees and some solutions afforded by a job sharing arrangement in use at the Greater Victoria Public Library. This is a voluntary work arrangement, changing formerly full-time positions into multiple part-time positions. (JVP)
Validation of New Crack Monitoring Technique for Victoria Class High-Pressure Air Bottles
2014-06-01
Defence Research and Development Canada Recherche et développement pour la défense Canada Validation of new crack monitoring technique for Victoria ...Validation of new crack monitoring technique for Victoria class high-pressure air bottles Ian Thompson John R. MacKay Defence Research and Development...Canada Scientific Report DRDC-RDDC-2014-R81 June 2014 © Her Majesty the Queen in Right of Canada (Department of National Defence), 2014 © Sa Majesté
Kolding, J.; Zwieten, van P.A.M.; Mkumbo, O.; Silsbe, G.; Hecky, R.
2008-01-01
Lake Victoria’s ecosystem has shown fundamental changes over its past recorded history in terms of nutrient loadings, productivity, faunal composition and fisheries. As yet, however, no attempt has been made to link the driving processes of eutrophication and fisheries to understand the feedback
Directory of Open Access Journals (Sweden)
David Z. Munisi
2017-09-01
Full Text Available Abstract Background Globally school-age children, adolescents and young adults bear the highest burden of schistosomiasis. When developing a specific intervention to improve community’s knowledge, attitudes, and practices (KAPs, existing KAPs must be taken into account. Therefore, this study was designed to determine schoolchildren’s KAPs on schistosomiasis in the study area. Methods A cross-sectional study was conducted in Busanga and Kibuyi villages involving 513 schoolchildren. A pre-tested questionnaire was used to collect socio-demographic data and to assess KAP on schistosomiasis among primary schoolchildren in the study area. Results Of the 488 interviewed children, 391 (80.12% reported to have heard of schistosomiasis, with the majority 289 (73.91% citing school as the source of this knowledge. Swimming in the lake, worms, witchcraft, and mosquitoes were mentioned to be the cause for intestinal schistosomiasis. Fishing in the lake, drinking unboiled lake water, walking bare footed, and shaking hands were reported to be practices that may lead to contracting schistosomiasis. Only 156 (39.90% of the study respondents reported to know the signs of intestinal schistosomiasis. Avoiding swimming in the lake, drinking unboiled water and eating unwashed fruits were mentioned as preventive measures. Nearly 85% (412 reported understanding that there was a disease known as schistosomiasis; additionally, 419 (85.86% considered schistosomiasis as a dangerous disease and 418 (85.66% believed that schistosomiasis was treatable. Fishermen and schoolchildren were reported to be groups most at risk of schistosomiasis infection. Visiting the lake (for swimming and other gatherings was a common practice among study participants 471 (96.52%.Nearly 93% (451 of participants mentioned using lake water for domestic chores, and, although 407 (84.61% reported to own a toilet at home, only 229 (55.31% reported to always use a toilet for sanitation purposes
Energy Technology Data Exchange (ETDEWEB)
McLellan, Holly
2003-03-01
Lake Whatcom, Washington kokanee have been stocked in Lake Roosevelt since 1987 with the primary objective of creating a self-sustaining fishery. Success has been limited by low recruitment to the fishery, low adult returns to hatcheries, and a skewed sex ratio. It was hypothesized that a stock native to the upper Columbia River might perform better than the coastal Lake Whatcom stock. Kokanee from Meadow Creek, a tributary of Kootenay Lake, British Columbia were selected as an alternative stock. Post smolts from each stock were released from Sherman Creek Hatchery in late June 2000 and repeated in 2001. Stock performance was evaluated using three measures; (1) number of returns to Sherman Creek, the primary egg collection facility, (2) the number of returns to 86 tributaries sampled and, (3) the number of returns to the creel. In two repeated experiments, neither Meadow Creek or Lake Whatcom kokanee appeared to be capable of providing a run of three-year old spawners to sustain stocking efforts. Less than 10 three-years olds from either stock were collected during the study period. Chi-square analysis indicated age two Meadow Creek kokanee returned to Sherman Creek and to other tributaries in significantly higher numbers when compared to the Lake Whatcom stock in both 2000 and 2001. However, preliminary data from the Spokane Tribe of Indians indicated that a large number of both stocks were precocial before they were stocked. The small number of hatchery three-year olds collected indicated that the current hatchery rearing and stocking methods will continue to produce a limited jacking run largely composed of precocious males and a small number of three-year olds. No kokanee from the study were collected during standard lake wide creel surveys. Supplemental creel data, including fishing derbies, test fisheries, and angler diaries, indicated anglers harvested two-year-old hatchery kokanee a month after release. The majority of the two-year old kokanee harvested
Terai, Yohey; Takezaki, Naoko; Mayer, Werner E; Tichy, Herbert; Takahata, Naoyuki; Klein, Jan; Okada, Norihiro
2004-01-01
Genomic DNA libraries were prepared from two endemic species of Lake Victoria haplochromine (cichlid) fish and used to isolate and characterize a set of short interspersed elements (SINEs). The distribution and sequences of the SINEs were used to infer phylogenetic relationships among East African haplochromines. The SINE-based classification divides the fish into four groups, which, in order of their divergence from a stem lineage, are the endemic Lake Tanganyika flock (group 1); fish of the nonendemic, monotypic, widely distributed genus Astatoreochromis (group 2); the endemic Lake Malawi flock (group 3); and group 4, which contains fish from widely dispersed East African localities including Lakes Victoria, Edward, George, Albert, and Rukwa, as well as many rivers. The group 4 haplochromines are characterized by a subset of polymorphic SINEs, each of which is present in some individuals and absent in others of the same population at a given locality, the same morphologically defined species, and the same mtDNA-defined haplogroup. SINE-defined group 4 contains six of the seven previously described mtDNA haplogroups. One of the polymorphic SINEs appears to be fixed in the endemic Lake Victoria flock; four others display the presence-or-absence polymorphism within the species of this flock. These findings have implications for the origin of Lake Victoria cichlids and for their founding population sizes.
Queen Victoria, her physicians, and her cataracts.
Ravin, J G
1994-01-01
Decreasing vision due to cataracts became a significant problem for Queen Victoria toward the end of the 19th century. Her personal physician, Sir James Reid, obtained consultations with two eminent British ophthalmologists, George Lawson and Edward Nettleship. The Queen was not satisfied, and requested an opinion from the German professor Hermann Pagenstecher. All the doctors agreed on the diagnosis, but the Queen never underwent surgery.
A Wetland and a Lifeline: the Importance of Loktak Lake for Manipur, India
Directory of Open Access Journals (Sweden)
Konsam Nirmala Devi
2017-02-01
Full Text Available Wetlands are highly productive ecosystems which provide multiple-value ecosystem services. The Loktak Lake wetland is located in the Bishnupur district of the Indian state of Manipur, and is the largest freshwater wetland in Northeast India. The lake is used extensively by local people as a source of water for irrigation and domestic use and is an important wintering and staging area for water birds, particularly ducks. The Loktak Lake has a socioeconomic and cultural relationship with the people of Manipur. However, of late, the impacts of increase in population, urbanisation and the rapid pace of development have started being felt on Loktak Lake. The once over 266 sq. km large Loktak Lake is now showing signs of shrinking and reduction in wetland spread. The lake had a seasonal and pulsating characteristic which kept it clean and healthy. However, changes in its hydrology due to regulation of water flow for development purpose are now showing a detrimental effect on the health of this wetland. The following article is an attempt at putting greater focus on the lifeline of Manipur, the Loktak Lake and a floating island paradise where tourism is wanting.
Analyses of CsI aerosol deposition tests in WIND project with ART and VICTORIA codes
International Nuclear Information System (INIS)
Yuchi, Y.; Shibazaki, H.; Kudo, T.
2000-01-01
Deposition behavior of cesium iodide (CsI) was analyzed with ART and VICTORIA-92 codes for a test of the aerosol re-vaporization test series performed in WIND project at JAERI. In the test analyzed, CsI aerosol was injected into piping of test section where metaboric acid (HBO 2 ) was placed in advance on the floor area. It was confirmed in the present analysis that similar results on the CsI deposition were obtained between ART and VICTORIA when influences of chemical interactions were negligibly small. The analysis with VICTORIA agreed satisfactorily with the test results in analytical cases that cesium metaborate (CsBO 2 ) was injected into the test section instead of CsI to simulate the pre-existence of HBO 2 effect. (author)
Krupinski, J
1979-06-01
Australia is one of the most urbanized countries in the world with over 85% of the population living in metropolitan and other urban areas. More important, the change from a predominantly rural society to an urbanized society has occurred within the last 100 years. To assess the effects of urbanization on mental health, rates of admissions to psychiatric institutions, suicides and violent crime in Victoria have been analysed for the last hundred years. Data on admissions to psychiatric facilities in Victoria from metropolitan, other urban and rural areas, as well as results of community health surveys carried out in metropolitan and rural areas were compared to examine for evidence of urban-rural differences in psychiatric morbidity. The findings do not support the notion that the level of psychiatric and psychosocial disorders in Victoria are related to urbanization or to urban living.
2013-08-08
... pollution. Inclusion of Victoria County in 30 TAC Chapter 115 volatile organic compounds (VOC) rules for the... vessels, and marine vessels would be required to vent to a control device until the VOC concentration of... Victoria County in 30 TAC Chapter 114 rule for Texas Low Emission Diesel (TxLED) compliant marine diesel...
Energy Technology Data Exchange (ETDEWEB)
McGinnis and Associates LLC
2008-08-01
The Scotts Valley Band of Pomo Indians is located in Lake County in Northern California. Similar to the other five federally recognized Indian Tribes in Lake County participating in this project, Scotts Valley Band of Pomo Indians members are challenged by generally increasing energy costs and undeveloped local energy resources. Currently, Tribal decision makers lack sufficient information to make informed decisions about potential renewable energy resources. To meet this challenge efficiently, the Tribes have committed to the Lake County Tribal Energy Program, a multi Tribal program to be based at the Robinson Rancheria and including The Elem Indian Colony, Big Valley Rancheria, Middletown Rancheria, Habematolel Pomo of Upper Lake and the Scotts Valley Pomo Tribe. The mission of this program is to promote Tribal energy efficiency and create employment opportunities and economic opportunities on Tribal Lands through energy resource and energy efficiency development. This program will establish a comprehensive energy strategic plan for the Tribes based on Tribal specific plans that capture economic and environmental benefits while continuing to respect Tribal cultural practices and traditions. The goal is to understand current and future energy consumption and develop both regional and Tribe specific strategic energy plans, including action plans, to clearly identify the energy options for each Tribe.
Kinaro, Zachary Omambia; Xue, Liangyi; Volatiana, Josies Ancella
2016-07-01
The Cichlid fishes have played an important role in evolutionary biology, population studies and aquaculture industry with East African species representing a model suited for studying adaptive radiation and speciation for cichlid genome projects in which closely related genomes are fast emerging presenting questions on phenotype-genotype relations. The complete mitochondrial genomes presented here are for two closely related but eco-morphologically distinct Lake Victoria basin cichlids, Oreochromis variabilis, an endangered native species and Tilapia zilli, an invasive species, both of which are important economic fishes in local areas. The complete mitochondrial genomes determined for O. variabilis and T. zilli are 16 626 and 16,619 bp, respectively. Both the mitogenomes contain 13 protein-coding genes, 22 tRNAs, 2 rRNAs and a non-coding control region, which are typical of vertebrate mitogenomes. Phylogenetic analyses of the two species revealed that though both lie within family Cichlidae, they are remotely related.
Analysis of an Organisation: A University of the Third Age (U3A), Mornington, Victoria
Small, Michael
2017-01-01
The purpose of this paper is two fold: to look at Mornington U3A in organisational terms and then look at U3AM as a loosely coupled system. One outcome of the study would be to undertake further analyses of U3As in Victoria to determine the levels of bureaucracy under which each operates. Questions to be asked: are U3As in Victoria operating as…
Flach, Carl-Fredrik; Johnning, Anna; Nilsson, Ida; Smalla, Kornelia; Kristiansson, Erik; Larsson, D G Joakim
2015-10-01
Antibiotic-polluted environments may function as reservoirs for novel resistance plasmids not yet encountered in pathogens. The aims of this study were to assess the potential of resistance transfer between bacteria from such environments and Escherichia coli, and to characterize the conjugative elements involved. Sediment samples from Kazipally lake and Asanikunta tank, two Indian lakes with a history of severe pollution with fluoroquinolones, were investigated. Proportions of resistant bacteria were determined by selective cultivation, while horizontal gene transfer was studied using a GFP-tagged E. coli as recipient. Retrieved transconjugants were tested for susceptibility by Etest(®) and captured conjugative resistance elements were characterized by WGS. The polluted lakes harboured considerably higher proportions of ciprofloxacin-resistant and sulfamethoxazole-resistant bacteria than did other Indian and Swedish lakes included for comparison (52% versus 2% and 60% versus 7%, respectively). Resistance plasmids were captured from Kazipally lake, but not from any of the other lakes; in the case of Asanikunta tank because of high sediment toxicity. Eight unique IncA/C and IncN resistance plasmids were identified among 11 sequenced transconjugants. Five plasmids were fully assembled, and four of these carried the quinolone resistance gene qnrVC1, which has previously only been found on chromosomes. Acquired resistance genes, in the majority of cases associated with class 1 integrons, could be linked to decreased susceptibility to several different classes of antibiotics. Our study shows that environments heavily polluted with antibiotics contain novel multiresistance plasmids transferrable to E. coli. © The Author 2015. Published by Oxford University Press on behalf of the British Society for Antimicrobial Chemotherapy. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.
The heliothermic lake: a direct method of collecting and storing solar energy
Kirkland, Douglas W.; Bradbury, J. Platt; Dean, Walter E.
1980-01-01
Heliothermic lakes contain a sun-heated layer of warm, saline water beneath a surface layer of cooler, less saline water. The two layers are separated by a chemocline, a stratum in which salinity increases progressively with depth. The chemocline, the position of which varies from lake to lake, functions as a heat trap. Most sunlight that penetrates this stratum is transformed into heat, which cannot escape by radiation because water is opaque to infrared light, and which cannot escape by convection because the specific gravity of the dense water below the chemocline is not significantly decreased by the increasing temperature. Heat can escape only by conduction through the chemocline, and water or brine is a very poor conductor. As a result, the temperature within and commonly below the chemocline rises. Under ideal conditions of a clear solution, high isolation, and a suitable salinity distribution, the temperature of the chemocline will increase to the boiling point. The lower part of the chemocline in a shallow (0.8-m) manmade heliothermic lake at Sedom, Israel, for example, reached a temperature of 96°C (205°F) in spite of a brine with poor light transmissibility.About 30 natural heliothermic lakes have been reported. The best known, Lake Ursului, occurs in Transylvania, Romania (latitude, 46°35'N). During four consecutive summers, 1899 to 1902, this lake had temperatures of 60-70°C (140-158°F) at a depth of 1-2 m. Heliothermic conditions have persisted in this lake for at least 28 and probably for more than 77 years. The most unusual, Lake Vanda, Victoria Land, Antarctica (latitude, 77°35'S), has a temperature of 26°C near the base of the chemocline at a depth of 61 despite a mean atmospheric temperature of -20°C. Sunlight penetrates into the chemocline through 5 m of remarkably clear ice.Maintenance of the chemocline is the chief problem preventing commercial use of manmade heliothermic lakes for the collection and storage of solar energy. The most
International Nuclear Information System (INIS)
Heams, T.J.; Williams, D.A.; Johns, N.A.; Mason, A.; Bixler, N.E.; Grimley, A.J.; Wheatley, C.J.; Dickson, L.W.; Osborn-Lee, I.; Domagala, P.; Zawadzki, S.; Rest, J.; Alexander, C.A.; Lee, R.Y.
1992-12-01
The VICTORIA model of radionuclide behavior in the reactor coolant system (RCS) of a light water reactor during a severe accident is described. It has been developed by the USNRC to define the radionuclide phenomena and processes that must be considered in systems-level models used for integrated analyses of severe accident source terms. The VICTORIA code, based upon this model, predicts fission product release from the fuel, chemical reactions involving fission products, vapor and aerosol behavior, and fission product decay heating. Also included is a detailed description of how the model is implemented in VICTORIA, the numerical algorithms used, and the correlations and thermochemical data necessary for determining a solution. A description of the code structure, input and output, and a sample problem are provided
Aboriginal Students in Victoria. ACER Research Monograph No. 3.
de Lemos, Marion M.
An estimated 80%-90% of all Aboriginal students enrolled in the primary and secondary schools of Victoria, Australia, were tested and surveyed to determine their numbers, distribution, attendance, achievement, attitudes, and school leaving patterns. Most of the 1244 Aboriginals surveyed attended state schools and 75% were schooled in rural areas.…
Lake Roosevelt Fisheries Monitoring Program; 1988-1989 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Peone, Tim L.; Scholz, Allan T.; Griffith, James R.
1990-10-01
In the Northwest Power Planning Council's 1987 Columbia River Basin Fish and Wildlife Program (NPPC 1987), the Council directed the Bonneville Power Administration (BPA) to construct two kokanee salmon (Oncorhynchus nerka) hatcheries as partial mitigation for the loss of anadromous salmon and steelhead incurred by construction of Grand Coulee Dam [Section 903 (g)(l)(C)]. The hatcheries will produce kokanee salmon for outplanting into Lake Roosevelt as well as rainbow trout (Oncorhynchus mykiss) for the Lake Roosevelt net-pen program. In section 903 (g)(l)(E), the Council also directed BPA to fund a monitoring program to evaluate the effectiveness of the kokanee hatcheries. The monitoring program included the following components: (1) a year-round, reservoir-wide, creel survey to determine angler use, catch rates and composition, and growth and condition of fish; (2) assessment of kokanee, rainbow, and walleye (Stizostedion vitreum) feeding habits and densities of their preferred prey, and; (3) a mark and recapture study designed to assess the effectiveness of different locations where hatchery-raised kokanee and net pen reared rainbow trout are released. The above measures were adopted by the Council based on a management plan, developed by the Upper Columbia United Tribes Fisheries Center, Spokane Indian Tribe, Colville Confederated Tribes, Washington Department of Wildlife, and National Park Service, that examined the feasibility of restoring and enhancing Lake Roosevelt fisheries (Scholz et al. 1986). In July 1988, BPA entered into a contract with the Spokane Indian Tribe to initiate the monitoring program. The projected duration of the monitoring program is through 1995. This report contains the results of the monitoring program from August 1988 to December 1989.
Investigation of a steam generator tube rupture sequence using VICTORIA
International Nuclear Information System (INIS)
Bixler, N.E.; Erickson, C.M.; Schaperow, J.H.
1995-01-01
VICTORIA-92 is a mechanistic computer code for analyzing fission product behavior within the reactor coolant system (RCS) during a severe reactor accident. It provides detailed predictions of the release of radionuclides and nonradioactive materials from the core and transport of these materials within the RCS. The modeling accounts for the chemical and aerosol processes that affect radionuclide behavior. Coupling of detailed chemistry and aerosol packages is a unique feature of VICTORIA; it allows exploration of phenomena involving deposition, revaporization, and re-entrainment that cannot be resolved with other codes. The purpose of this work is to determine the attenuation of fission products in the RCS and on the secondary side of the steam generator in an accident initiated by a steam generator tube rupture (SGTR). As a class, bypass sequences have been identified in NUREG-1150 as being risk dominant for the Surry and Sequoyah pressurized water reactor (PWR) plants
A Baseline Air Quality Assessment Onboard a Victoria Class Submarine: HMCS Windsor
National Research Council Canada - National Science Library
Severs, Y. D
2006-01-01
.... This trial thus represents a baseline habitability evaluation of Canada's Victoria class submarines to confirm compliance with the current maximum permissible contaminant limits stipulated in the Air...
Yin, Kedong; Harrison, Paul J
2007-06-01
This study presents water quality parameters such as nutrients, phytoplankton biomass and dissolved oxygen based on 11 years of water quality data in Victoria Harbor and examined how the Pearl River estuary discharge in summer and year round sewage discharge influenced these parameters. Nutrients in Victoria Harbor were strongly influenced by both the Pearl River and sewage effluent, as indicated by the high NO(3) inputs from the Pearl River in summer and higher NH(4) and PO(4) in Victoria Harbor than both its sides. N:P ratios were low in the dry season, but increased to >16:1 in the wet season, suggesting that P is potentially the most limiting nutrient in this area during the critical period in the summer. Although there were generally high nutrients, the phytoplankton biomass was not as high as one would expect in Victoria Harbor. In fact, there were high concentrations of chl near the bottom well below the photic zone. Salinity near the bottom was lower in Victoria Harbor than at the two entrances to Victoria Harbor, suggesting strong vertical mixing within Victoria Harbor. Therefore, strong vertical mixing and horizontal advection appear to play an important role in significantly reducing eutrophication impacts in Victoria Harbor. Consequently, dissolved oxygen near the bottom was low in summer, but only occasionally dipped to 2 mgL(-1) despite the high organic loading from sewage effluent.
78 FR 55743 - Notice of Service Delivery Area Designation for the Shinnecock Indian Nation
2013-09-11
... the availability of funds, the person's relative medical priority, and the actual availability and..., Reservation, Wyoming. Sublette, WY. Aroostook Band of Micmac Indians of Aroostook, ME.\\3\\ Maine. Assiniboine..., Roosevelt, MT, Sheridan, MT, Valley, MT. Bad River Band of the Lake Superior Ashland, WI, Iron, WI. Tribe of...
Potentially avoidable hospitalisation for constipation in Victoria, Australia in 2010-11.
Ansari, Humaira; Ansari, Zahid; Hutson, John M; Southwell, Bridget R
2014-07-11
When primary care of constipation fails, the patient may need emergency hospitalisation for disimpaction. This study aimed to provide population-based data on the number of unplanned admissions and the cost to the healthcare system for constipation in Victoria, Australia in financial year 2010-11. The Victorian Admitted Episodes Dataset was examined to find the number of emergency hospital separations coded as constipation (ICD-10-AM Code K390). An estimate of costs was determined from the number of weighted inlier equivalent separations (WIES) multiplied by the WEIS price, used by the Victorian Government for funding purposes. There were 3978 emergency separations for constipation in Victoria in 2010-2011, 92% in public hospitals. Fifty-five percent were female and 38% > 75 years old. One third stayed overnight and 1/3 more than 1 day. The emergency bed day rate was 7.1 per 10,000 of population. The estimate of cost, based on WEIS, was approximately $8.3 million. Potential savings could be made by reducing the number of separations in 6 Local Government Areas (LGAs). This study shows that the burden (in number of admissions, emergency bed days and overall direct costs) in managing emergency admissions for constipation in Victoria, Australia, is very significant and likely to be similar in other developed countries. Improved primary healthcare and alternative ways to achieve faecal disimpaction without emergency admission could save the public health system a proportion of this $8.3 million.
78 FR 55737 - Notice of Service Delivery Area Designation for the Tejon Indian Tribe
2013-09-11
... on the availability of funds, the person's relative medical priority, and the actual availability and.... Sublette, WY. Aroostook Band of Micmac Indians of Aroostook, ME.\\3\\ Maine. Assiniboine and Sioux Tribes of..., Sheridan, MT, Valley, MT. Bad River Band of the Lake Superior Ashland, WI, Iron, WI. Tribe of Chippewa...
Lake Roosevelt Fisheries Monitoring Program; 1990 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Griffith, Janelle R.; Scholz, Allan T. (Eastern Washington University, Upper Columbia United Tribes Fisheries Research Center, Cheney, WA)
1991-09-01
As partial mitigation for the loss of anadromous salmon and steelhead incurred by construction of Grand Coulee Dam, the Northwest Power Planning Council directed Bonneville Power Administration (BPA) to construct two kokanee salmon (Oncorhynchus nerka) hatcheries on Lake Roosevelt (NPPC 1987 [Section 903 (g)(l)(C)]). The hatcheries are to produce 8 million kokanee salmon fry or 3.2 million adults for outplanting into Lake Roosevelt as well as 500,000 rainbow trout (Oncorhynchus mykiss) for the Lake Roosevelt net-pen programs. In section 903 (g)(l)(E), the Council also directed BPA to fund a monitoring program to evaluate the effectiveness of the kokanee hatcheries. The monitoring program included the following components: (1) conduction of a year-round creel census survey to determine angler pressure, catch rates and composition, growth and condition of fish caught by anglers, and economic value of the fishery. Comparisons will be made before and after hatcheries are on-line to determine hatchery effectiveness; (2) conduct an assessment of kokanee, rainbow trout, and walleye feeding habits, growth rates, and densities of their preferred prey at different locations in the reservoir and how reservoir operations affect population dynamics of preferred prey organisms. This information will be used to determine kokanee and rainbow trout stocking locations, stocking densities and stocking times; (3) conduct a mark-recapture study designed to assess effectiveness of various release times and locations for hatchery-raised kokanee and net-pen raised rainbow so fish-loss over Grand Coulee Dam will be minimized, homing to egg collection sites will be improved and angler harvest will be increased. The above measures were adopted by the Council based on a management plan developed by Upper Columbia United Tribes Fisheries Center, Spokane Indian Tribe, Colville Confederated Tribes, Washington Department of Wildlife, and the National Park Service. This plan examined the
medical recipients of the victoria cross during the anglo-boer war
African Journals Online (AJOL)
ofall orders ofchivalry - the most enviable order ofthe. Victoria Cross.' MEDICAL .... Major Babtie, a Scot by birth, obtained his Bachelor of Medicine in 1880 and entered the Army ..... a personality type that is given to this kind of action? Will one.
Study of genetic variation in population of Bipolaris victoriae, the ...
African Journals Online (AJOL)
STORAGESEVER
2008-11-19
Nov 19, 2008 ... Isolates of Bipolaris victoriae were analysed by random amplified polymorphic DNA (RAPD) techniques ... According to the protocol, samples ... and fungus species. But some of the isolates of fungus with high genetic similarity have the same origin (Figure. 1). Weikert et al. (2002) reported that species of ...
Coal Corporation of Victoria strategic plan
Energy Technology Data Exchange (ETDEWEB)
1987-01-01
The Coal Corporation has been established by the Victorian Parliament to plan for and to manage the responsible utilisation of the brown coal resource (Victoria's most abundant fossil resource) in order to underpin economic growth and job creation. For each of 5 issues, the Strategic Plan outlines the current situation, reviews recent factors which have affected or may affect the situation and outlines the goals, strategies and targets which have been set for the period 1985/1989. In each case, the achievements to date are also outlined. The issues addressed are: project development, marketing, resource planning and inter corporate relations, organisation of the Corporation, and finance.
Dam safety management in Victoria (Australia)
International Nuclear Information System (INIS)
Adem, J.
1996-01-01
The Victoria state government's decision to make dam owners accountable for safety and upkeep of their dams was reported. To give effect to this decision a series of guidelines have been developed which outline the required activities and skills to ensure that dams are properly managed within a framework of 'light-handed' regulation. The guidelines are also intended to ensure that dam management becomes an integral part of the business decision making process, not just a set of prescribed technical procedures. Details of the direction being taken and the proposed controls to ensure compliance with national and international standards were described. 4 refs., 2 figs
Hamilton, D G
1986-07-07
The contribution of doctors to the visual arts is being discussed in a series of six articles. Doctor-artists in New South Wales and Victoria, and doctors as collectors, donors, gallery supporters and writers in New South Wales, have been discussed in earlier articles. This, the fourth article, deals with doctors as supporters of art galleries and artists in Victoria.
Energy Technology Data Exchange (ETDEWEB)
Heams, T J [Science Applications International Corp., Albuquerque, NM (United States); Williams, D A; Johns, N A; Mason, A [UKAEA, Winfrith, (England); Bixler, N E; Grimley, A J [Sandia National Labs., Albuquerque, NM (United States); Wheatley, C J [UKAEA, Culcheth (England); Dickson, L W [Atomic Energy of Canada Ltd., Chalk River, ON (Canada); Osborn-Lee, I [Oak Ridge National Lab., TN (United States); Domagala, P; Zawadzki, S; Rest, J [Argonne National Lab., IL (United States); Alexander, C A [Battelle, Columbus, OH (United States); Lee, R Y [Nuclear Regulatory Commission, Washington, DC (United States)
1992-12-01
The VICTORIA model of radionuclide behavior in the reactor coolant system (RCS) of a light water reactor during a severe accident is described. It has been developed by the USNRC to define the radionuclide phenomena and processes that must be considered in systems-level models used for integrated analyses of severe accident source terms. The VICTORIA code, based upon this model, predicts fission product release from the fuel, chemical reactions involving fission products, vapor and aerosol behavior, and fission product decay heating. Also included is a detailed description of how the model is implemented in VICTORIA, the numerical algorithms used, and the correlations and thermochemical data necessary for determining a solution. A description of the code structure, input and output, and a sample problem are provided.
Vu, Trang; Day, Lesley; Finch, Caroline F
2014-04-01
To estimate the burden of hospitalised fall-related injury in community-dwelling older people in Victoria. We analysed fall-related, person-identifying hospital discharge data and patient-level hospital treatment costs for community-dwelling older people aged 65+ years from Victoria between 1 July 2005 and 30 June 2008, inclusive. Key outcomes of interest were length of stay (LOS)/episode, cumulative LOS (CLOS)/patient and inpatient costs. The burden of hospitalised fall-related injury in community-dwelling older people aged 65+ years in Victoria was 284,781 hospital bed days in 2005-06, rising to 310,031 hospital bed days in 2007-08. Seventy-one per cent of episodes were multiday. One in 15 acute care episodes was a high LOS outlier and 14% of patients had ≥1 episode classified as high LOS outlier. The median CLOS/patient was nine days (interquartile range 2-27). The annual costs of inpatient care, in June 2009 prices, for fall-related injury in community-dwelling people aged 65+ years in Victoria rose from $213 million in 2005-06 to $237 million in 2007-08. The burden of hospitalised fall-related injury in community-dwelling older women, people aged 85+ years and those with comorbidity was considerable. The burden of hospitalised fall-related injury in community-dwelling older people aged 65+ years in Victoria is significantly more than previously projected. Importantly, this study identifies that women, patients with comorbidity and those aged 85+ years account for a considerable proportion of this burden. A corresponding increase in falls prevention effort is required to ensure that the burden is properly addressed. © 2014 The Authors. ANZJPH © 2014 Public Health Association of Australia.
Directory of Open Access Journals (Sweden)
Sujatha Shanmugasundaram
2009-01-01
Full Text Available Background: The way that health care systems in developing countries like India care for dying patients, has an impact on the expectations of such care for those who migrate to other countries faces. At the end of life, cultural issues may impact on the quality of life remaining and for that reason, it is important that particular cultural practices are understood. This paper describes a study that investigated the cultural issues of access to palliative care services for Indian migrants in Australia. Purpose of the Study: To investigate the experiences of the family members of terminally ill Indian migrants in Victoria, Australia. Objective of the Study: To explore the issues related to accessing palliative care services for Indian migrants; to identify the effectiveness of palliative care in supporting the patient and family and to recommend strategies for improving this care. Materials and Methods: A qualitative descriptive design was utilized. Up to 6 family members were selected for in-depth interviews in understanding cultural issues related to the palliative care services for a family member. Results: Analysis of the interviews revealed that families of Indian patients experience difficulties whilst receiving palliative care services, which fell into three main categories: Indian support systems, cultural issues, and caring experiences. Although each of these issues had a direct influence on the experience of terminal care that their family member received, cultural issues and support systems also influenced the caring experiences. Conclusion: Despite the successful implementation of palliative care services across Australia, there are still problems in accessing and receiving the services among minority and disadvantaged groups like various cultural groups.
LIMNOLOGY, LAKE BASINS, LAKE WATERS
Directory of Open Access Journals (Sweden)
Petre GÂŞTESCU
2009-06-01
Full Text Available Limnology is a border discipline between geography, hydrology and biology, and is also closely connected with other sciences, from it borrows research methods. Physical limnology (the geography of lakes, studies lake biotopes, and biological limnology (the biology of lakes, studies lake biocoenoses. The father of limnology is the Swiss scientist F.A. Forel, the author of a three-volume entitled Le Leman: monographie limnologique (1892-1904, which focuses on the geology physics, chemistry and biology of lakes. He was also author of the first textbook of limnology, Handbuch der Seenkunde: allgemeine Limnologie,(1901. Since both the lake biotope and its biohydrocoenosis make up a single whole, the lake and lakes, respectively, represent the most typical systems in nature. They could be called limnosystems (lacustrine ecosystems, a microcosm in itself, as the American biologist St.A. Forbes put it (1887.
Habib, Shahid; Zaitchik, Benjamin; Alo, Clement; Ozdogan, Mutlu; Anderson, Martha; Policelli, Fritz
2011-01-01
The Nile basin River system spans 3 million km(exp 2) distributed over ten nations. The eight upstream riparian nations, Ethiopia, Eretria, Uganda, Rwanda, Burundi, Congo, Tanzania and Kenya are the source of approximately 86% of the water inputs to the Nile, while the two downstream riparian countries Sudan and Egypt, presently rely on the river's flow for most of the their needs. Both climate and agriculture contribute to the complicated nature of Nile River management: precipitation in the headwaters regions of Ethiopia and Lake Victoria is variable on a seasonal and inter-annual basis, while demand for irrigation water in the arid downstream region is consistently high. The Nile is, perhaps, one of the most difficult trans-boundary water issue in the world, and this study would be the first initiative to combine NASA satellite observations with the hydrologic models study the overall water balance in a to comprehensive manner. The cornerstone application of NASA's Earth Science Research Results under this project are the NASA Land Data Assimilation System (LDAS) and the USDA Atmosphere-land Exchange Inverse (ALEXI) model. These two complementary research results are methodologically independent methods for using NASA observations to support water resource analysis in data poor regions. Where an LDAS uses multiple sources of satellite data to inform prognostic simulations of hydrological process, ALEXI diagnoses evapotranspiration and water stress on the basis of thermal infrared satellite imagery. Specifically, this work integrates NASA Land Data Assimilation systems into the water management decision support systems that member countries of the Nile Basin Initiative (NBI) and Regional Center for Mapping of Resources for Development (RCMRD, located in Nairobi, Kenya) use in water resource analysis, agricultural planning, and acute drought response to support sustainable development of Nile Basin water resources. The project is motivated by the recognition that
Directory of Open Access Journals (Sweden)
Gorica Majstorovic
2014-12-01
Full Text Available El artículo trata de las construcciones americanistas del cosmopolitismo (entendido en relación a la geopolítica imperial en los textos de Victoria Ocampo y Alfonso Reyes de los años treinta. Al analizar su relación con los movimientos de inmigración y la subsiguiente revalorización de la nación, el artículo postula que en Alfonso Reyes la mediación cosmopolita es «des-jerarquizada», ubicada casi siempre en una «periferia», a diferencia de Victoria Ocampo cuyas visiones cosmopolitas son mediadas desde un «centro» —ya sea París o Buenos Aires— y relacionadas con una jerarquía de valores estéticos y políticos.The article deals with Americanist constructions of cosmopolitanism (understood in relation to the imperial geopolitics in the texts of Victoria Ocampo and Alfonso Reyes in the 1930’s. Upon analyzing its relationship with immigration movements and the subsequent revaluation of the nation, the article suggests that in Alfonso Reyes cosmopolitan mediation is «dis-hierarchized», almost always located in a periphery, unlike Victoria Ocampo whose cosmopolitan visions are mediated from a «center» —either Paris or Buenos Aires— and related to a hierarchy of aesthetic and political values.
Population dynamics of Glossina fuscipes fuscipes on Buvuma Island, Lake Victoria, Uganda
International Nuclear Information System (INIS)
Ogwal, L.M.; Kangwagye, T.N.
1990-01-01
A survey made of Buvuma Island to establish the incidence, distribution and population dynamics of tsetse flies showed that Glossina fuscipes fuscipes Newstead was the most abundant species. This species occurred in the southeastern, western and northern parts of the island. Although the fly is both riverine and peridomestic in its habits, the survey revealed that its population was concentrated mainly within a distance of about 2 km from the lake shores around houses, in banana plantations, at forest edges and roadsides, in fishing villages and ports of call, on grazing grounds and at water collection points. Studies of the population dynamics revealed seasonal variations in the abundance of the species, with a peak during the main dry season, i.e. in the months of January and February. The breeding peak was reached during the minor rainy season. Trap catches were highest in fishing villages and ports of call, followed in decreasing order by catches at forest edge and roadside locations, at water collection points, around houses, in banana plantations and on grazing grounds. It appears that the fishing villages and ports of call were possibly the most suitable breeding grounds. The efficiency of the traps was reflected in the fact that G. f. fuscipes populations were reduced by up to 95% in Tome and 90% in the Bulopa-Walwanda and Lwenyanja villages. Many puparia were also found on the sandy beaches around fishing villages and ports of call. There was evidence of fly movement between the islands and the mainland, indicating that, although geographically isolated, Buvuma Island is not isolated from the mainland in terms of tsetse fly movement. (author). 21 refs, 5 figs, 1 tab
Directory of Open Access Journals (Sweden)
Pamela Sosa
2011-06-01
Full Text Available El trabajo aborda la construcción de legitimidad del Frente para la Victoria (FV en el escenario político de Santa Cruz desde su nacimiento en 1988 hasta llegar a la gobernación en 1991. Se identifican tres fuentes de legitimidad construidas de manera alternativa al debilitamiento de la credibilidad de los partidos políticos tradicionales: la UCR, el PJ, el PI y el MID, entre otros. En este contexto, el Frente para la Victoria desplegó sus estrategias de legitimación apelando a la unidad de lo diverso y sumando referentes individuales de todo el arco político. Por otro lado, apeló a través de sus discursos y la conformación de los elencos y organizaciones a representar la fragmentación social propia de una sociedad compuesta por capas migratorias y, por último, construyó una novedosa oferta política a-partidaria acorde a las representaciones de la crisis estatal a mediados del '80 a partir de la reivindicación de los valores de la gestión, la eficiencia, el orden, el trabajo y la gobernabilidad. Sus estrategias de legitimación muestran cómo la primera etapa de construcción de poder político del FV fue efecto de su trayectoria en la frontera de los débiles grupos sociales y políticos.O trabalho aborda a construção de legitimidade do Frente para la Victoria (FV no cenário político de Santa Cruz desde seu nascimento em 1988 até chegar ao governo em 1991. Identificam-se três fontes de legitimidade construídas de maneira alternativa ao enfraquecimento da credibilidade dos partidos políticos tradicionais: a UCR, o PJ, o PI e o MID, entre outros. Neste contexto, o Frente para la Victoria desdobrou suas estratégias de legitimação apelando à unidade do que for diverso e somando referências individuais de todo o arco político. Por outro lado, apelou, através de seus discursos e a conformação dos elencos e organizações, a representar a fragmentação social própria de uma sociedade composta por camadas migrat
African Journals Online (AJOL)
User
Proximate compositions of five economically-important fish species from Lake Victoria and Lake. Tanganyika ... the fish species desirable for consumption during this period. These fish ..... Functional ... Journal of Animal Ecology, 40 : 633-652.
Directory of Open Access Journals (Sweden)
Hamed Olfat
2018-02-01
Full Text Available ePlan, as a digital cadastral data initiative, is a collaborative program between the land authorities and the surveying industry which aims to replace paper and PDF cadastral plans and surveys with digital data. ePlan is currently operational in Australia, New Zealand and Singapore. ePlan was introduced in the State of Victoria in 2011 and has been operational in this jurisdiction for 2D plans since 2013. On average, one ePlan application is currently submitted to a digital plan lodgment portal every two weeks. The low uptake of ePlan is caused by several technical and non-technical challenges. This paper provides an overview of cadastral information transitioning from paper to digital in Victoria. The research methodology to identify the challenges in Victoria for the adoption of ePlan is then described. This is followed by a discussion on the identified challenges. The paper then proposes a generic framework of strategic actions to increase the uptake of digital cadastral data based on the lessons learned from Victoria. The initiatives suggested by this framework to address the ePlan challenges in Victoria and increase its uptake are also introduced. The paper concludes with a direction for future research.
International Nuclear Information System (INIS)
Baccolo, G.; Maggi, V.; Baroni, C.; Clemenza, M.; Motta, A.; Nastasi, M.; Previtali, E.; University of Milano-Bicocca, Milan; Delmonte, B.; Salvatore, M.C.
2014-01-01
The elemental composition of 40 samples of mineral sediments collected in Victoria Land, Antarctica, in correspondence of ice-free sites, is presented. Concentration of 36 elements was determined by instrumental neutron activation analysis, INAA. The selection of 6 standard reference materials and the development of a specific analytical procedure allowed to reduce measurements uncertainties and to verify the reproducibility of the results. The decision to analyze sediment samples from Victoria Land ice-free areas is related to recent investigations regarding mineral dust content in the TALos Dome ICE core (159deg11'E; 72deg49'S, East Antarctica, Victoria Land), in which a coarse local fraction of dust was recognized. The characterization of Antarctic potential source areas of atmospheric mineral dust is the first step to identify the active sources of dust for the Talos Dome area and to reconstruct the atmospheric pathways followed by air masses in this region during different climatic periods. Principal components analysis was used to identify elements and samples correlations; attention was paid specially to rare earth elements (REE) and incompatible/compatible elements (ICE) in respect to iron, which proved to be the most discriminating elemental groups. The analysis of REE and ICE concentration profiles supported evidences of chemical weathering in ice-free areas of Victoria Land, whereas cold and dry climate conditions of the Talos Dome area and in general of East Antarctica. (author)
Directory of Open Access Journals (Sweden)
Belinda J Gabbe
Full Text Available BACKGROUND: Traumatic brain injury (TBI remains a leading cause of death and disability. The National Institute for Health and Clinical Excellence (NICE guidelines recommend transfer of severe TBI cases to neurosurgical centres, irrespective of the need for neurosurgery. This observational study investigated the risk-adjusted mortality of isolated TBI admissions in England/Wales, and Victoria, Australia, and the impact of neurosurgical centre management on outcomes. METHODS: Isolated TBI admissions (>15 years, July 2005-June 2006 were extracted from the hospital discharge datasets for both jurisdictions. Severe isolated TBI (AIS severity >3 admissions were provided by the Trauma Audit and Research Network (TARN and Victorian State Trauma Registry (VSTR for England/Wales, and Victoria, respectively. Multivariable logistic regression was used to compare risk-adjusted mortality between jurisdictions. FINDINGS: Mortality was 12% (749/6256 in England/Wales and 9% (91/1048 in Victoria for isolated TBI admissions. Adjusted odds of death in England/Wales were higher compared to Victoria overall (OR 2.0, 95% CI: 1.6, 2.5, and for cases <65 years (OR 2.36, 95% CI: 1.51, 3.69. For severe TBI, mortality was 23% (133/575 for TARN and 20% (68/346 for VSTR, with 72% of TARN and 86% of VSTR cases managed at a neurosurgical centre. The adjusted mortality odds for severe TBI cases in TARN were higher compared to the VSTR (OR 1.45, 95% CI: 0.96, 2.19, but particularly for cases <65 years (OR 2.04, 95% CI: 1.07, 3.90. Neurosurgical centre management modified the effect overall (OR 1.12, 95% CI: 0.73, 1.74 and for cases <65 years (OR 1.53, 95% CI: 0.77, 3.03. CONCLUSION: The risk-adjusted odds of mortality for all isolated TBI admissions, and severe TBI cases, were higher in England/Wales when compared to Victoria. The lower percentage of cases managed at neurosurgical centres in England and Wales was an explanatory factor, supporting the changes made to the NICE
Employment Shifts in the Technical and Further Education Workforce in Victoria.
Shah, Chandra
2003-01-01
Analyzes changes in Technical and Further Education (TAFE) work force in Victoria, Australia, that occurred during the period 1993-98. Main changes include increased participation of women, significant growth in part-time employment, decline in full-time (mainly male) employment, and an increased use of seasonal teachers. (Includes 10 figures and…
Royal Ageing: The Queen Mother and Queen Victoria
Mike Hepworth
2002-01-01
This paper is a reflection on the contribution of the image of the Queen Mother to the cultural construction of role models of positive ageing. The interest lies in the Queen Mother's performance in public of her roles as woman and royal personage particularly as she grew older. It is suggested that cultural analysis of the icon of the Queen Mother as a blend of gender and power suggests certain significant parallels with the imagery cultivated around the career of Queen Victoria in the later...
Measuring the cost of leaving care in Victoria
Catherine Forbes; Brett Inder; Sunitha Raman
2006-01-01
On any given night in Victoria, around 4,000 children and young people live under the care and protection of the State. For many young people, this care extends over a long period of time, sometimes until their 18th birthday. It is well documented that young people leaving State care often lack the social and economic resources to assist them in making the transition into independent living. As a consequence, the long-term life outcomes from this group are frequently very poor. A recent repor...
Directory of Open Access Journals (Sweden)
C. Darrin Hulsey
2017-09-01
Full Text Available The independent evolution of the two toothed jaws of cichlid fishes is thought to have promoted their unparalleled ecological divergence and species richness. However, dental divergence in cichlids could exhibit substantial genetic covariance and this could dictate how traits like tooth numbers evolve in different African Lakes and on their two jaws. To test this hypothesis, we used a hybrid mapping cross of two trophically divergent Lake Victoria species (Haplochromis chilotes × Haplochromis nyererei to examine genomic regions associated with cichlid tooth diversity. Surprisingly, a similar genomic region was found to be associated with oral jaw tooth numbers in cichlids from both Lake Malawi and Lake Victoria. Likewise, this same genomic location was associated with variation in pharyngeal jaw tooth numbers. Similar relationships between tooth numbers on the two jaws in both our Victoria hybrid population and across the phylogenetic diversity of Malawi cichlids additionally suggests that tooth numbers on the two jaws of haplochromine cichlids might generally coevolve owing to shared genetic underpinnings. Integrated, rather than independent, genomic architectures could be key to the incomparable evolutionary divergence and convergence in cichlid tooth numbers.
Australian doctors and the visual arts. Part 3. Doctor-artists in Victoria.
Hamilton, D G
1986-06-09
The contribution of doctors to the visual arts is being discussed in a series of six articles. The first two articles dealt with doctors and the visual arts in New South Wales. In this, the third, doctor-artists in Victoria are discussed.
Cyril, Sheila; Nicholson, Jan M; Agho, Kingsley; Polonsky, Michael; Renzaho, Andre M
2017-06-01
Childhood obesity is rising among culturally and linguistically diverse (CALD) groups who show poor engagement in obesity prevention initiatives. We examined the barriers and facilitators to the engagement of CALD communities in obesity prevention initiatives. We used the nominal group technique to collect data from 39 participants from Vietnamese, Burmese, African, Afghani and Indian origins living in disadvantaged areas of Victoria, Australia. Data analysis revealed ranked priorities for barriers and facilitators for CALD community engagement in obesity prevention initiatives. CALD parents identified key barriers as being: competing priorities in the post-migration settlement phase; language, cultural and program accessibility barriers; low levels of food and health literacy; junk food advertisement targeting children; and lack of mandatory weight checks for schoolchildren. Key facilitators emerged as: bicultural playgroup leaders; ethnic community groups; and school-based healthy lunch box initiatives. This study has identified several policy recommendations including: the implementation of robust food taxation policies; consistent control of food advertising targeting children; improving CALD health literacy using bicultural workers; and matching health promotional materials with CALD community literacy levels. Implications for Public Health: These recommendations can directly influence public health policy to improve the engagement of CALD communities in obesity prevention services and ultimately reduce the widening obesity disparities in Australia. © 2017 The Authors.
Zanutta, A.; Negusini, M.; Vittuari, L.; Cianfarra, P.; Salvini, F.; Mancini, F.; Sterzai, P.; Dubbini, M.; Galeandro, A.; Capra, A.
2017-10-01
GNSS networks in Antarctica are a fundamental tool to define actual crustal displacements due to geological and geophysical processes and to constrain the glacial isostatic models (GIA). A large network devoted to the detection and monitoring of crustal deformations in the Northern Victoria Land (Victoria Land Network for DEFormation control - VLNDEF), was monumented during the 1999-2000 and 2000-2001 field campaigns, as part of Italian National Program for Antarctic Research and surveyed periodically during the Southern summer seasons. In this paper, GPS observations of VLNDEF collected over a more than 15-year span, together with various selected POLENET sites and more than 70 IGS stations, were processed with Bernese Software, using a classical double difference approach. A solution was obtained combining NEQs by means of ADDNEQ2/FODITS tools embedded in Bernese Software. All the Antarctic sites were kept free and a subset of 50 IGS stations were used to frame VLNDEF into ITRF2008. New evidence provided by analysis of GPS time series for the VLNDEF network is presented; also displacements along the vertical component are compared with the recently published GIA models. The absolute velocities indicate an overall displacement of the northern Victoria Land region along the south-east direction (Ve = 10.6 mm/yr, Vn = -11.5 mm/yr) and an average uplift rate of Vu = 0.5 mm/yr. Two GIA models have been analyzed: ICE-6G_C-VM5a proposed by Argus et al. (2014), Peltier et al. (2015) and W12A_v1 by Whitehouse et al. (2012a,b). Up rates, predicted over the VLNDEF sites by the mentioned GIA models, have been extracted and compared with those observed. A preliminary comparison with GPS-derived vertical rates shows that the Victoria Land ICE-6G_C-VM5 and W12A_v1 GIA models predict overestimated uplift rates of 0.7 and 0.9 mm/yr weighted mean residuals respectively. The mean horizontal relative motions within the Victoria Land (VL) area are in most cases negligible, while only
Potentially avoidable hospitalisation for constipation in Victoria, Australia in 2010–11
2014-01-01
Background When primary care of constipation fails, the patient may need emergency hospitalisation for disimpaction. This study aimed to provide population-based data on the number of unplanned admissions and the cost to the healthcare system for constipation in Victoria, Australia in financial year 2010–11. Methods The Victorian Admitted Episodes Dataset was examined to find the number of emergency hospital separations coded as constipation (ICD-10-AM Code K390). An estimate of costs was determined from the number of weighted inlier equivalent separations (WIES) multiplied by the WEIS price, used by the Victorian Government for funding purposes. Results There were 3978 emergency separations for constipation in Victoria in 2010–2011, 92% in public hospitals. Fifty-five percent were female and 38% > 75 years old. One third stayed overnight and 1/3 more than 1 day. The emergency bed day rate was 7.1 per 10,000 of population. The estimate of cost, based on WEIS, was approximately $8.3 million. Potential savings could be made by reducing the number of separations in 6 Local Government Areas (LGAs). Conclusions This study shows that the burden (in number of admissions, emergency bed days and overall direct costs) in managing emergency admissions for constipation in Victoria, Australia, is very significant and likely to be similar in other developed countries. Improved primary healthcare and alternative ways to achieve faecal disimpaction without emergency admission could save the public health system a proportion of this $8.3 million. PMID:25015386
Preliminary gut content and dentition analysis reveal subtle resource ...
African Journals Online (AJOL)
The trophic relationships between six haplochromine cichlids of Lake Kanyaboli, a satellite lake of Lake Victoria that has not been infested by the Nile perch (Lates niloticus), were studied as a first step towards understanding the cichlid community structure in this threatened wetland ecosystem. Coefficient of similarity ...
Radon in an underground cave system in Victoria
International Nuclear Information System (INIS)
Hedt, J.C.; Boal, T.J.
1998-01-01
Radon levels in a cave system in Victoria have been measured. The variation of radon and radon progeny levels with time, position throughout the cave and season have been determined. The radiation exposure of tour guides were estimated. The data is being used to develop a radiation management plan for the tour guides. Radon concentration within a cave system was proven to be dependent to a large extent upon the rate of air exchange with outside. Cave ventilation is the single most important factor in determining if there is diurnal variation in the radon concentration
Fischer, Elke Kerstin; Paglialonga, Lisa; Czech, Elisa; Tamminga, Matthias
2016-06-01
Rivers and effluents have been identified as major pathways for microplastics of terrestrial sources. Moreover, lakes of different dimensions and even in remote locations contain microplastics in striking abundances. This study investigates concentrations of microplastic particles at two lakes in central Italy (Lake Bolsena, Lake Chiusi). A total number of six Manta Trawls have been carried out, two of them one day after heavy winds occurred on Lake Bolsena showing effects on particle distribution of fragments and fibers of varying size categories. Additionally, 36 sediment samples from lakeshores were analyzed for microplastic content. In the surface waters 2.68 to 3.36 particles/m(3) (Lake Chiusi) and 0.82 to 4.42 particles/m(3) (Lake Bolsena) were detected, respectively. Main differences between the lakes are attributed to lake characteristics such as surface and catchment area, depth and the presence of local wind patterns and tide range at Lake Bolsena. An event of heavy winds and moderate rainfall prior to one sampling led to an increase of concentrations at Lake Bolsena which is most probable related to lateral land-based and sewage effluent inputs. The abundances of microplastic particles in sediments vary from mean values of 112 (Lake Bolsena) to 234 particles/kg dry weight (Lake Chiusi). Lake Chiusi results reveal elevated fiber concentrations compared to those of Lake Bolsena what might be a result of higher organic content and a shift in grain size distribution towards the silt and clay fraction at the shallow and highly eutrophic Lake Chiusi. The distribution of particles along different beach levels revealed no significant differences. Copyright © 2016 Elsevier Ltd. All rights reserved.
Preliminary results of the analysis of the population structure of the ...
African Journals Online (AJOL)
STORAGESEVER
2008-08-18
Aug 18, 2008 ... the lake based on a small founder population, which though slow in establishing later exploded to become ... was conducted by the Lake Victoria Research Project funded by .... The matrix of pairwise distances obtained was.
International Nuclear Information System (INIS)
Ikingura, Justinian R.
2001-01-01
The catchment areas of Lake Victoria in Tanzania are impacted by mercury contamination from small-scale gold mining activities. A preliminary survey of the mercury contamination has indicated in some cases mercury concentrations that are higher than background levels in soil and river sediment downstream of the mining areas. Average mercury concentration in contaminated soil is in the order of 3.4 mg/kg whereas in river sediment the concentration is about 4.9 mg/kg. Mercury concentrations in fish from a few areas of the Lake Victoria close to gold mining areas are in the range of 2-20 ppb. These fish mercury concentrations are surprisingly low considering the extent of mercury contamination in the Lake Victoria catchment. The dynamics of mercury cycling and their long-term impact on mercury levels in fish and other aquatic organisms in the Lake Victoria gold fields still need to be clarified. Research activities for the first year (2000) will concentrate on the determination of total mercury distribution patterns among soil, river water, sediment, and biota (fish, and other aquatic biota) in two areas (Mugusu-Nungwe Bay and Imweru-Bukombe Bay) of the Lake Victoria gold fields. The relationships between local tropical soil-sediment- and water-chemistry and the distribution of mercury in the contaminated areas will be investigated. Data from this work will be used in the identification and selection of suitable bio-monitors for mercury contamination and human health risk assessment in the study areas. In the second year, the project will focus mainly on methylmercury production and partition between sediment, water and biota in contaminated local tropical sediments. The main factors influencing the methylation and distribution of mercury species will be evaluated in laboratory experiments and extrapolated to environmental conditions. The results of the project will have important implications in mercury pollution monitoring, mitigation, and health risk assessment not
Journal of Biosciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
2007-05-10
May 10, 2007 ... Annual Meetings · Mid Year Meetings · Discussion Meetings · Public Lectures ... Prior to the contribution of genetics or the modern evolutionary ... Imanishi Kinji's personal library and his scientific notes and papers ... School of Environmental Studies, University of Victoria, Victoria, BC V8W 2Y2, Canada ...
Use of regionalisation approach to develop fire frequency curves for Victoria, Australia
Khastagir, Anirban; Jayasuriya, Niranjali; Bhuyian, Muhammed A.
2017-11-01
It is important to perform fire frequency analysis to obtain fire frequency curves (FFC) based on fire intensity at different parts of Victoria. In this paper fire frequency curves (FFCs) were derived based on forest fire danger index (FFDI). FFDI is a measure related to fire initiation, spreading speed and containment difficulty. The mean temperature (T), relative humidity (RH) and areal extent of open water (LC2) during summer months (Dec-Feb) were identified as the most important parameters for assessing the risk of occurrence of bushfire. Based on these parameters, Andrews' curve equation was applied to 40 selected meteorological stations to identify homogenous stations to form unique clusters. A methodology using peak FFDI from cluster averaged FFDIs was developed by applying Log Pearson Type III (LPIII) distribution to generate FFCs. A total of nine homogeneous clusters across Victoria were identified, and subsequently their FFC's were developed in order to estimate the regionalised fire occurrence characteristics.
O'Connor, Siobhán; Hitchens, Peta L; Fortington, Lauren V
2018-01-01
The most recent report on hospital-treated horse-riding injuries in Victoria was published 20 years ago. Since then, injury countermeasures and new technology have aimed to make horse riding safer for participants. This study provides an update of horse-riding injuries that required hospital treatment in Victoria and examines changes in injury patterns compared with the earlier study. Horse-riding injuries that required hospital treatment (hospital admission (HA) or emergency department (ED) presentations) were extracted from routinely collected data from public and private hospitals in Victoria from 2002-2003 to 2015-2016. Injury incidence rates per 100 000 Victorian population per financial year and age-stratified and sex-stratified injury incidence rates are presented. Poisson regression was used to examine trends in injury rates over the study period. ED presentation and HA rates were 31.1 and 6.6 per 100 000 person-years, increasing by 28.8% and 47.6% from 2002 to 2016, respectively. Female riders (47.3 ED and 10.1 HA per 100 000 person-years) and those aged between 10 and 14 years (87.8 ED and 15.7 HA per 100 000 person-years) had the highest incidence rates. Fractures (ED 29.4%; HA 56.5%) and head injuries (ED 15.4%; HA 18.9%) were the most common injuries. HA had a mean stay of 2.6±4.1 days, and the mean cost per HA was $A5096±8345. Horse-riding injuries have remained similar in their pattern (eg, types of injuries) since last reported in Victoria. HA and ED incidence rates have increased over the last 14 years. Refocusing on injury prevention countermeasures is recommended along with a clear plan for implementation and evaluation of their effectiveness in reducing injury.
Tumwesigye, Nazarius M; Atuyambe, Lynn; Wanyenze, Rhoda K; Kibira, Simon Ps; Li, Qing; Wabwire-Mangen, Fred; Wagner, Glenn
2012-12-11
The fishing communities are among population groups that are most at risk of HIV infection, with some studies putting the HIV prevalence at 5 to 10 times higher than in the general population. Alcohol consumption has been identified as one of the major drivers of the sexual risk behaviour in the fishing communities. This paper investigates the relationship between alcohol consumption patterns and risky behaviour in two fishing communities on Lake Victoria. Face-to-face interviews were conducted among 303 men and 172 women at the fish landing sites; categorised into fishermen, traders of fish or fish products and other merchandise, and service providers such as casual labourers and waitresses in bars and hotels, including 12 female sexual workers. Stratified random sampling methodology was used to select study units. Multivariable analysis was conducted to assess independent relationship between alcohol consumption and sexual risky behaviour. Measures of alcohol consumption included the alcohol use disorder test score (AUDIT), having gotten drunk in previous 30 days, drinking at least 2 times a week while measures for risky behaviour included engaging in transactional sex, inconsistent condom use, having sex with non-regular partner and having multiple sexual partners. The level of harmful use of alcohol in the two fishing communities was quite high as 62% of the male and 52% of the female drinkers had got drunk in previous 30 days. The level of risky sexual behaviour was equally high as 63% of the men and 59% of the women had unprotected sex at last sexual event. Of the 3 occupations fishermen had the highest levels of harmful use of alcohol and risky sexual behaviour followed by service providers judging from values of most indicators. The kind of alcohol consumption variables correlated with risky sexual behaviour variables, varied by occupation. Frequent alcohol consumption, higher AUDIT score, having got drunk, longer drinking hours and drinking any day of
Directory of Open Access Journals (Sweden)
Tumwesigye Nazarius M
2012-12-01
Full Text Available Abstract Background The fishing communities are among population groups that are most at risk of HIV infection, with some studies putting the HIV prevalence at 5 to 10 times higher than in the general population. Alcohol consumption has been identified as one of the major drivers of the sexual risk behaviour in the fishing communities. This paper investigates the relationship between alcohol consumption patterns and risky behaviour in two fishing communities on Lake Victoria. Methods Face-to-face interviews were conducted among 303 men and 172 women at the fish landing sites; categorised into fishermen, traders of fish or fish products and other merchandise, and service providers such as casual labourers and waitresses in bars and hotels, including 12 female sexual workers. Stratified random sampling methodology was used to select study units. Multivariable analysis was conducted to assess independent relationship between alcohol consumption and sexual risky behaviour. Measures of alcohol consumption included the alcohol use disorder test score (AUDIT, having gotten drunk in previous 30 days, drinking at least 2 times a week while measures for risky behaviour included engaging in transactional sex, inconsistent condom use, having sex with non-regular partner and having multiple sexual partners. Results The level of harmful use of alcohol in the two fishing communities was quite high as 62% of the male and 52% of the female drinkers had got drunk in previous 30 days. The level of risky sexual behaviour was equally high as 63% of the men and 59% of the women had unprotected sex at last sexual event. Of the 3 occupations fishermen had the highest levels of harmful use of alcohol and risky sexual behaviour followed by service providers judging from values of most indicators. The kind of alcohol consumption variables correlated with risky sexual behaviour variables, varied by occupation. Frequent alcohol consumption, higher AUDIT score, having
Sharpe, D M T; Langerhans, R B; Low-Décarie, E; Chapman, L J
2015-11-01
Human activities, such as species introductions, are dramatically and rapidly altering natural ecological processes and often result in novel selection regimes. To date, we still have a limited understanding of the extent to which such anthropogenic selection may be driving contemporary phenotypic change in natural populations. Here, we test whether the introduction of the piscivorous Nile perch, Lates niloticus, into East Africa's Lake Victoria and nearby lakes coincided with morphological change in one resilient native prey species, the cyprinid fish Rastrineobola argentea. Drawing on prior ecomorphological research, we predicted that this novel predator would select for increased allocation to the caudal region in R. argentea to enhance burst-swimming performance and hence escape ability. To test this prediction, we compared body morphology of R. argentea across space (nine Ugandan lakes differing in Nile perch invasion history) and through time (before and after establishment of Nile perch in Lake Victoria). Spatial comparisons of contemporary populations only partially supported our predictions, with R. argentea from some invaded lakes having larger caudal regions and smaller heads compared to R. argentea from uninvaded lakes. There was no clear evidence of predator-associated change in body shape over time in Lake Victoria. We conclude that R. argentea have not responded to the presence of Nile perch with consistent morphological changes and that other factors are driving observed patterns of body shape variation in R. argentea. © 2015 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2015 European Society For Evolutionary Biology.
Carter, Janet M.; Thompson, Ryan F.
2016-05-04
During July 2015, water samples were collected from 18 wetlands on the Lake Traverse Indian Reservation in northeastern South Dakota and southeastern North Dakota and analyzed for physical properties and 54 pesticides. This study by the U.S. Geological Survey in cooperation with the Sisseton-Wahpeton Oyate was designed to provide an update on pesticide concentrations of the same 18 wetlands that were sampled for a reconnaissance-level assessment during July 2006. The purpose of this report is to present the results of the assessment of pesticide concentrations in selected Lake Traverse Indian Reservation wetlands during July 2015 and provide a comparison of pesticide concentrations between 2006 and 2015.Of the 54 pesticides that were analyzed for in the samples collected during July 2015, 47 pesticides were not detected in any samples. Seven pesticides—2-chloro-4-isopropylamino-6-amino-s-triazine (CIAT); 2,4–D; acetachlor; atrazine; glyphosate; metolachlor; and prometon—were detected in the 2015 samples with estimated concentrations or concentrations greater than the laboratory reporting level, and most pesticides were detected at low concentrations in only a few samples. Samples from all wetlands contained at least one detected pesticide. The maximum number of pesticides detected in a wetland sample was six, and the median number of pesticides detected was three.The most commonly detected pesticides in the 2015 samples were atrazine and the atrazine degradate CIAT (also known as deethylatrazine), which were detected in 14 and 13 of the wetlands sampled, respectively. Glyphosate was detected in samples from 11 wetlands, and metolachlor was detected in samples from 10 wetlands. The other detected pesticides were 2,4–D (4 wetlands), acetochlor (3 wetlands), and prometon (1 wetland).The same pesticides that were detected in the 2006 samples were detected in the 2015 samples, with the exception of simazine, which was detected only in one sample in 2006
Can a Skin Cancer Control Program make a Difference? A Profile of the SUNSMART Programme in Victoria
International Nuclear Information System (INIS)
Sinclair, C.; Dobbinson, S.; Montague, M.
2000-01-01
SunSmart is a programme of the Anti-Cancer Council of Victoria. It is an evidence-based health promotion programme where decisions about the form and content of the programme are influenced by available evidence and community consultation processes. A systematic evaluation and research strategy is in place to ensure that as much information as possible is available on process, impact and outcomes. Over the past 19 years the Anti-Cancer Council of Victoria has made a substantial impact in Victoria in relation to sun protection. It is one of the very few campaigns that has been able to demonstrate substantial changes not only in behaviour and attitudes but also in the downturn of skin cancer rates. Substantial sustainable changes have also occurred in the physical landscape as public authorities and commercial operators design their environment to be as sun protective as possible. This paper focuses on the key strategies that have encouraged positive change in the behaviour and attitudes of the Victorian population and the research that has documented the outcomes. (author)
Marketing System and Efficiency of Indian Major Carps in India
Kumar, B. Ganesh; Datta, K.K.; Reddy, G. Vidya Sagar; Menon, Muktha
2010-01-01
The Kolleru Lake area (KLA) in Andhra Pradesh being a predominant centre for carp culture is known as the ‘Carp Pocket of India’. This paper has described the highly efficient fish marketing system prevalent in the KLA and has compared it with the marketing of Indian Major Carps (IMC) in other major aquaculture states like West Bengal and Orissa and marine states like Maharashtra and Tamil Nadu. The marketing channels, market intermediaries, price spread and marketing efficiency have been...
Directory of Open Access Journals (Sweden)
Laura Ester Donadío
2016-07-01
Full Text Available This article aims to explain from a theoretical conceptual approach the particularities that exist in Victoria, San Fernando, Buenos Aires, from its urban production. Through a series of field works, semi-structured interviews and observations, it was possible to perceive that in this locality, there are three logics of city production, market, state and necessity, according to Abramo, P. (2002. The post-development cities of Latin America, a space in which constant tensions are generated that alter the harmonious development of daily life and the interaction of those who inhabit the area. On the other hand, it is also perceived that the inhabitants naturalize that way of life, their spatial disposition, the progressive privatization of public areas and the proliferation of closed housing estates. Here is a quote that we have heard repeatedly in interviews with the neighbors: "No one in Victoria gives a ball to anyone." At the moment of understanding Victoria from the theory, we take into account such concepts as the "heterotopy" of Foucault M. (1967 - understood as the juxtaposition of spaces that would be incompatible -the term "com-fusa city" (Abramo P. - as an urban structure that interweaves two traditional models (the Mediterranean compact and the Anglo-Saxon diffused, the notion of "privatopia" by I.Rodriguez Chumillas (2005 and E. Mckenzie (1994 as private spatial consolidation, and finally the concepts: informative and dual cities of R Castells (1995 terms that emerge from the process of globalization, which may be useful to think about the reality of Victoria .
Genetic analyses of resistance against Leptopilina victoriae in Drosophila bipectinata.
Takigahira, Tomohiro; Kohyama, Tetsuo I; Suwito, Awit; Kimura, Masahito T
2015-06-01
Drosophila bipectinata from Iriomote-jima (IR) is susceptible to the endoparasitoid Leptopilina victoriae from Kota Kinabalu (L. victoriae KK), but D. bipectinata from Kota Kinabalu (KK) and Bogor (BG) is resistant. The cross experiments between the resistant (KK) and susceptible (IR) populations of D. bipectinata suggested that the resistance to this parasitoid is a dominant trait and controlled by a single locus or few linked loci on an autosome. In the AFLP analysis using the IR, KK and BG populations of D. bipectinata and the resistant and susceptible populations derived from a mixed population of these three geographic populations, a DNA fragment almost specific to susceptible flies was detected. It also revealed that genes from the IR population were more frequently maintained in the mixed population compared with those from the KK and BG populations, suggesting that at least a number of genes from the IR population are more advantageous under the laboratory conditions. This explains our previous results that the resistance was lowered in the mixed population although the resistance itself is suggested to incur only low costs; i.e., the resistance gene(s) from the KK and BG populations would have been linked with some genes that are disadvantageous under the laboratory conditions.
Surviving neoliberalism, maintaining values: Community health mergers in Victoria, Australia.
Roussy, Véronique; Livingstone, Charles
2018-04-01
Independent, not-for-profit community health services in the state of Victoria, Australia, provide one of that country's few models of comprehensive primary health care (PHC). Recent amalgamations among some such agencies created regional-sized community health organisations, in a departure from this sector's traditionally small local structure. This study explored the motivations, desired outcomes, and decision-making process behind these mergers. Qualitative exploratory study was based on 26 semistructured interviews with key informants associated with 2 community health mergers, which took place in 2014 in Victoria, Australia. Thematic data analysis was influenced by concepts derived from institutional theory. Becoming bigger by merging was viewed as the best way to respond to mounting external pressures, such as increasingly neoliberal funding mechanisms, perceived as threatening survival. Desired outcomes were driven by comprehensive PHC values, and related to creating organisational capacity to continue providing quality services to disadvantaged communities. This study offers insights into decision-making processes geared towards protecting the comprehensiveness of PHC service delivery for disadvantaged communities, ensuring financial viability, and surviving neoliberal economic policy whilst preserving communitarian values. These are relevant to an international audience, within a global context of rising health inequities, increasingly tight fiscal environments, and growing neoliberal influences on health policymaking and funding. Copyright © 2018 John Wiley & Sons, Ltd.
Layers of 'Cabo Frio' in 'Victoria Crater'
2006-01-01
This view of 'Victoria crater' is looking southeast from 'Duck Bay' towards the dramatic promontory called 'Cabo Frio.' The small crater in the right foreground, informally known as 'Sputnik,' is about 20 meters (about 65 feet) away from the rover, the tip of the spectacular, layered, Cabo Frio promontory itself is about 200 meters (about 650 feet) away from the rover, and the exposed rock layers are about 15 meters (about 50 feet) tall. This is an approximately true color rendering of images taken by the panoramic camera (Pancam) on NASA's Mars Exploration Rover Opportunity during the rover's 952nd sol, or Martian day, (Sept. 28, 2006) using the camera's 750-nanometer, 530-nanometer and 430-nanometer filters.
Terrestrial CDOM in Lakes of Yamal Peninsula: Connection to Lake and Lake Catchment Properties
Directory of Open Access Journals (Sweden)
Yury Dvornikov
2018-01-01
Full Text Available In this study, we analyze interactions in lake and lake catchment systems of a continuous permafrost area. We assessed colored dissolved organic matter (CDOM absorption at 440 nm (a(440CDOM and absorption slope (S300–500 in lakes using field sampling and optical remote sensing data for an area of 350 km2 in Central Yamal, Siberia. Applying a CDOM algorithm (ratio of green and red band reflectance for two high spatial resolution multispectral GeoEye-1 and Worldview-2 satellite images, we were able to extrapolate the a(λCDOM data from 18 lakes sampled in the field to 356 lakes in the study area (model R2 = 0.79. Values of a(440CDOM in 356 lakes varied from 0.48 to 8.35 m−1 with a median of 1.43 m−1. This a(λCDOM dataset was used to relate lake CDOM to 17 lake and lake catchment parameters derived from optical and radar remote sensing data and from digital elevation model analysis in order to establish the parameters controlling CDOM in lakes on the Yamal Peninsula. Regression tree model and boosted regression tree analysis showed that the activity of cryogenic processes (thermocirques in the lake shores and lake water level were the two most important controls, explaining 48.4% and 28.4% of lake CDOM, respectively (R2 = 0.61. Activation of thermocirques led to a large input of terrestrial organic matter and sediments from catchments and thawed permafrost to lakes (n = 15, mean a(440CDOM = 5.3 m−1. Large lakes on the floodplain with a connection to Mordy-Yakha River received more CDOM (n = 7, mean a(440CDOM = 3.8 m−1 compared to lakes located on higher terraces.
Forman, S. L.; Wright, D.
2015-12-01
Relict beaches adjacent to Lake Turkana provide a record of water level variability for the Late Quaternary. This study focused on deciphering the geomorphology, sedimentology, stratigraphy and 14C chronology of strand plain sequences in the Kalokol and Lothagam areas. Nine >30 m oscillations in water level were documented between ca. 15 and 4 ka. The earliest oscillation between ca. 14.5 and 13 ka is not well constrained with water level to at least 70 m above the present surface and subsequently fell to at least 50 m. Lake level increased to ~ 90 m between ca. 11.2 and 10.4 ka, post Younger Dryas cooling. Water level fell by >30 m by 10.2 ka, with another potential rise at ca. 8.5 ka to >70 m above current level. Lake level regressed by > 40 m at 8.2 ka coincident with cooling in the equatorial Eastern Atlantic Ocean. Two major >70 m lake level oscillations centered at 6.6 and 5.2 ka may reflect enhanced convection with warmer sea surface temperatures in the Western Indian Ocean. The end of the African Humid Period occurred from ca. 8.0 to 4.5 ka and was characterized by variable lake level (± > 40 m), rather than one monotonic fall in water level. This lake level variability reflects a complex response to variations in the extent and intensity of the East and West African Monsoons near geographic and topographic limits within the catchment of Lake Turkana. Also, for this closed lake basin excess and deficits in water input are amplified with a cascading lake effect in the East Rift Valley and through the Chew Bahir Basin. The final regression from a high stand of > 90 m began at. 5.2 ka and water level was below 20 m by 4.5 ka; and for the remainder of the Holocene. This sustained low stand is associated with weakening of the West African Monsoon, a shift of the mean position of Congo Air Boundary west of the Lake Turkana catchment and with meter-scale variability in lake level linked to Walker circulation across the Indian Ocean. A surprising observation is
Effects of Hypolimnetic Oxygenation on Mercury Cycling in Twin Lake, Washington
Beutel, M.; Dent, S.; Reed, B.; Moore, B.; Yonge, D.; Shallenberger, E.
2010-12-01
The accumulation of mercury in freshwater aquatic food webs is a widespread health concern. Nearly one-third of US lakes have fish consumption advisories in place due to elevated concentrations of mercury in fish tissue. Mercury, primarily from fossil fuel combustion, is widely deposited across the landscape in the form of ionic mercury. The deposited ionic mercury can be transformed to toxic methylmercury by anaerobic bacteria in anoxic waters and sediments. Once produced, methylmercury is taken up by algae and seston, and then biomagnified up the aquatic food web with levels increasing in successive trophic levels. This presentation summarizes three years (2008-2010) of mercury monitoring at North and South Twin Lakes, moderately deep (maximum depth ~15 m) meso-eutrophic lakes located on the Colville Indian Reservation in eastern Washington State. The objective of the study was to evaluate spatial and temporal patterns of the total and methyl mercury in the water column and zooplankton before and after the implementation of hypolimnetic oxygenation in North Twin Lake in 2009. The working hypothesis was that maintenance of an oxic hypolimnion would repress methylmercury enrichment in bottom waters, and subsequent uptake into zooplankton. Initial results confirm that oxygenation repressed hypolimnetic enrichment of methylmercury. In 2008, prior to oxygenation, peak levels of methylmercury in anaerobic bottom waters of North and South Twin Lakes were 0.4-0.6 ng/L. In 2009 levels were less than 0.05 ng/L in oxygenated North Twin Lake, but were again elevated in anaerobic bottom waters of South Twin Lake. Interestingly, during a two-week oxygenation test in North Twin Lake in the fall of 2008, bottom waters exhibited a short-term and reversible loss of methylmercury that correlated with a decrease in dissolved iron and manganese. Regarding zooplankton, total mercury was higher in zooplankton from oxygenated North Twin Lake relative to non-oxygenated South Twin Lake
Kaufman, M H
2011-08-01
Since the Victoria Cross was introduced in January 1856 by Queen Victoria to reward acts of valour in the face of the enemy, initially during the Crimean War, over 1350 medals have been awarded. Of these, three were awarded to medical officers who had previously gained the Licentiate Diploma of the Royal College of Surgeons of Edinburgh (LRCS Edin) - Valentine Munbee McMaster on 25 September 1857, Henry Thomas Sylvester on 20 November 1857 (although the acts of valour for which he was awarded his VC occurred on two occasions in September 1855) and Campbell Mellis (or Millis) Douglas on 7 May 1867.
Allen, Simon; Rastner, Philipp; Arora, Manohar; Huggel, Christian; Stoffel, Markus
2015-04-01
Heavy rainfall in early June 2013 triggered flash flooding and landslides throughout the Indian Himalayan state of Uttarakhand, killing more than 6000 people. The destruction of roads and trekking routes left around 100,000 pilgrims and tourists stranded. Most fatalities and damages resulted directly from a lake outburst and debris flow disaster originating from above the village of Kedarnath on June 16 and 17. Here we provide a first systematic analysis of the contributing factors leading to the Kedarnath disaster, both in terms of hydro-meteorological triggering (rainfall, snowmelt, and temperature) and topographic predisposition. Specifically, the topographic characteristics of the Charobari lake watershed above Kedarnath are compared with other glacial lakes across the northwestern Indian Himalayan states of Uttarakhand and Himachal Pradesh, and implications for glacier lake outburst hazard assessment in a changing climate are discussed. Our analysis suggests that the early onset of heavy monsoon rainfall (390 mm, June 10 - 17) immediately following a prolonged four week period of unusually rapid snow cover depletion and elevated streamflow is the crucial hydro-meteorological factor, resulting in slope saturation and significant runoff into the small seasonal glacial lake. Over a four week period the MODIS-derived snow covered area above Kedarnath decreased nearly 50%, from above average coverage in mid-May to well below average coverage by the second week of June. Such a rapid decrease has not been observed in the previous 13-year record, where the average decrease in snow covered area over the same four week window is only 15%. The unusual situation of the lake being dammed in a steep, unstable paraglacial environment, but fed entirely from snow-melt and rainfall within a fluvial dominated watershed is important in the context of this disaster. A simple scheme enabling large-scale recognition of such an unfavorable topographic setting is presented, and on the
The Lake Turkana wind farm project
Energy Technology Data Exchange (ETDEWEB)
Burlando, M.; Durante, F. [DEWI GmbH, Genoa (Italy); Claveri, L. [DEWI GmbH, Oldenburg (Germany)
2010-08-15
The Lake Turkana wind farm is one of the largest wind farm projects to be realised in the African Continent, and the first of its kind in Kenya. After its full commissioning in 2012, the wind farm will be generating 300 MW of clean power almost steadily thanks to the very peculiar characteristics of the wind climate of north-western Kenya. Until now, only northern African countries such as Morocco and Egypt had used wind power for commercial purposes on the continent. Projects are now beginning to bloom south of the Sahara as governments realise that harnessing the vast wind potential can efficiently meet the growing demand of electric power. With the Lake Turkana wind farm project and other minor projects, Kenya is trying to lead the way. The project consists of building 365 wind turbines Vestas V52 of hub height 45 m and nominal power 850 kW, corresponding to about 30% of Kenya's current installed power. The project includes also reinforcing 200 km of roads and bridges to transport the wind turbines from the Indian Ocean port of Mombasa to the northwestern Kenya, and adding more than 400 km of transmission lines and several substations to connect the wind farm and supply power to the national electric grid. (orig.)
Did the use of chloroform by Queen Victoria influence its acceptance in obstetric practice?
Connor, H; Connor, T
1996-10-01
Examination of contemporaneous publications suggests that the use of chloroform by Queen Victoria in 1853 did not result in the major breakthrough in the acceptability of obstetric anaesthesia with which the event has been credited by some later writers.
The Killing of the Workers' Educational Association of Victoria: A Myth Challenged
Dadswell, Gordon
2004-01-01
On 21 March 1941, the Council of the Workers' Educational Association of Victoria, Australia, (the Association) voted the organisation out of existence. The demise was in no way contemplated, and there was no practical reason why the Council acted in the way it did. This paper is the story of the destruction of a successful adult education…
Evolution of alkaline lakes - Lake Van case study
Tillman Meyer, Felix; Viehberg, Finn; Bahroun, Sonya; Wolf, Annabel; Immenhauser, Adrian; Kwiecien, Ola
2017-04-01
Lake Van in Eastern Anatolia (Turkey) is the largest terminal soda lake on Earth. The lake sedimentary profile covers ca. 600 ka (Stockhecke et al. 2014) Based on lithological changes, the presence of freshwater microfossils and close-to-freshwater pH value in the pore water, members of ICDP PALEOVAN concluded that Lake Van might have started as an open lake. Here we show paleontological and geochemical evidence in favour of this idea and constrain the time, when Lake Van likely transformed into a closed lake. Additionally we provide the first conceptual model of how this closure may have happened. Our archives of choice are inorganic and biogenic carbonates, separated by wet sieving. We identified microfossil assemblages (fraction > 125 µm) and performed high-resolution oxygen isotope (delta18O) and elemental (Mg/Ca, Sr/Ca) analyses of the fraction plants growing in the photic zone as food supply. These two aspects point to an increasing salinity in a shallowing lake. The delta18O values of inorganic carbonates are relatively low during the initial phase of Lake Van and increase abruptly (ca. 7‰) after 530 ka BP. At approximately the same time combination of Sr/Ca and Mg/Ca data suggest first occurrence of aragonite. Again, these findings suggest geochemical changes of the lake water concurrent with transition documented by microfossils. Comparison between Lake Van and Lake Ohrid (Lacey et al. 2016) delta18O data, precludes regional climate change (e.g.: increased evaporation) as the main driver of observed changes. With no evidence for increased volcanic or tectonic activity (e.g.: tephra layers, deformation structures, slumping) in the Lake Van sedimentary profile around 530 ka, it seems unlikely that a pyroclastic flow blocked the outflow of the lake. Alternatively, a portion of inflow has been diverged which might have caused a change in the hydrological balance and lake level falling below its outlet. However, as no geomorphological data confirming this
Isotopic character of Cambro-Ordovician plutonism, southern Victoria Land
International Nuclear Information System (INIS)
Cox, S.C.; Parkinson, D.L.; Allibone, A.H.; Cooper, A.F.
2000-01-01
Previous mapping of granitoid rocks in the Dry Valleys area of southern Victoria Land, Antarctica, identified the calc-alkaline (DV1a), adakitic (DV1b), and monzonitic (DV2) suites. A fourth older suite comprising alkaline gabbro, syenite, and A-type granite occurs in the Mt Dromedary area c. 80 km to the south. U-Pb zircon dating of Bonney Pluton, the largest calc-alkaline DV1a intrusion, indicates emplacement of this regional-scale body at 505 +/- 2 Ma. Pb-loss and inherited zircon were common to Bonney Pluton analyses of this study. U-Pb dating of monazite from Valhalla Pluton, a principal DV1b suite adakitic intrusion, indicates emplacement at 488 +/- 2 Ma. The Bonney Pluton age constrains the peak of calc-alkaline plutonism at 505 Ma and the Valhalla Pluton age records the major pulse of adakitic plutonism that is inferred to mark the final stages of subduction c. 490 Ma along this section of the East Antarctic margin. Nd and Sr isotope data for the calc-alkaline DV1a suite and adakitic DV1b suite define distinct ranges for each suite, supporting their subdivision on the basis of field relationships, petrography, and whole-rock geochemistry. Calc-alkaline DV1a suite granite magmas have eNd(T) = -4.2 to -6.1 and Sri = 0.7071-0.7079, whereas the adakitic DV1b suite rocks have a wider range of eNd(T) = -1.9 to -7.2 and Sri = 0.7065-0.7097. The isotopic data suggest a significant mantle component and subordinate crustal component in the source region of both suites. Time-dependent variations in the isotopic ratios of DV1a and DV1b suites imply a progressive increase in the proportion of more radiogenic material in the source region of the granitoid rocks, either mantle- or crust-derived material. Larger adakitic DV1b plutons are more 'evolved' than equivalent, smaller plutons of the same DV1b suite. Vanda Dikes and monzonitic DV2 suite intrusions are characterised by particularly low Sri = 0.7044-0.7067 and near-constant eNd(T) = -4.8 to -5.3, which indicate a
Bathymetry of Lake Erie and Lake Saint Clair
National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Erie and Lake Saint Clair has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and...
A recovery-based outreach program in rural Victoria.
Prabhu, Radha; Browne, Mark Oakley
2007-04-01
A recovery-based outreach program for people with severe mental illness in regional Victoria is described. The paper covers a description of the program, the services provided and outcomes achieved. The program emphasized active collaboration between patients and clinicians as outlined in the collaborative recovery model and recognized that recovery from mental illness is an individual, personal process. The program provided service to 108 people over 3 years and had a positive impact on clinicians, patients and carers. The benefits of recovery orientation, multidisciplinary teams, collaborative relationships and carer involvement are discussed. The paper highlights the need for a focus on recovery and comprehensive care for people with severe mental illness.
Directory of Open Access Journals (Sweden)
A. S. Kiem
2010-03-01
Full Text Available Since the mid-1990s the majority of Victoria, Australia, has experienced severe drought conditions (i.e. the "Big Dry" characterized by streamflow that is the lowest in approximately 80 years of record. While decreases in annual and seasonal rainfall totals have also been observed, this alone does not seem to explain the observed reduction in flow. In this study, we investigate the large-scale climate drivers for Victoria and demonstrate how these modulate the regional scale synoptic patterns, which in turn alter the way seasonal rainfall totals are compiled and the amount of runoff per unit rainfall that is produced. The hydrological implications are significant and illustrate the need for robust hydrological modelling, that takes into account insights into physical mechanisms that drive regional hydroclimatology, in order to properly understand and quantify the impacts of climate change (natural and/or anthropogenic on water resources.
Herbst, Seth J.; Marsden, J. Ellen; Lantry, Brian F.
2013-01-01
Lake Whitefish Coregonus clupeaformis support some of the most valuable commercial freshwater fisheries in North America. Recent growth and condition decreases in Lake Whitefish populations in the Great Lakes have been attributed to the invasion of the dreissenid mussels, zebra mussels Dreissena polymorpha and quagga mussels D. bugensis, and the subsequent collapse of the amphipod, Diporeia, a once-abundant high energy prey source. Since 1993, Lake Champlain has also experienced the invasion and proliferation of zebra mussels, but in contrast to the Great Lakes, Diporeia were not historically abundant. We compared the diet, condition, and energy density of Lake Whitefish from Lake Champlain after the dreissenid mussel invasion to values for those of Lake Whitefish from Lakes Michigan, Huron, Erie, and Ontario. Lake Whitefish were collected using gill nets and bottom trawls, and their diets were quantified seasonally. Condition was estimated using Fulton's condition factor (K) and by determining energy density. In contrast to Lake Whitefish from some of the Great Lakes, those from Lake Champlain Lake Whitefish did not show a dietary shift towards dreissenid mussels, but instead fed primarily on fish eggs in spring, Mysis diluviana in summer, and gastropods and sphaeriids in fall and winter. Along with these dietary differences, the condition and energy density of Lake Whitefish from Lake Champlain were high compared with those of Lake Whitefish from Lakes Michigan, Huron, and Ontario after the dreissenid invasion, and were similar to Lake Whitefish from Lake Erie; fish from Lakes Michigan, Huron, and Ontario consumed dreissenids, whereas fish from Lake Erie did not. Our comparisons of Lake Whitefish populations in Lake Champlain to those in the Great Lakes indicate that diet and condition of Lake Champlain Lake Whitefish were not negatively affected by the dreissenid mussel invasion.
Marla R. Emery; Alexandra Wrobel; Mark H. Hansen; Michael Dockry; W. Keith Moser; Kekek Jason Stark; Jonathan H. Gilbert
2014-01-01
Traditional ecological knowledge (TEK) has been proposed as a basis for enhanced understanding of ecological systems and their management. TEK also can contribute to targeted inventories of resources not included in standard mensuration. We discuss the results of a cooperative effort between the Great Lakes Indian Fish and Wildlife Commission (GLIFWC) and USDA Forest...
Critical influences on succession management for non-commissioned ranks within Victoria police
Owbridge, Lynne Michelle
2017-01-01
This thesis examines issues affecting succession management within noncommissioned ranks (NCRs) of policing services. Using Victoria Police (VicPol) as a case study, this research explored the organisation's capacity to build individual and organisational capability through adequate recruitment of new police, professional learning, and retaining talent within NCRs. A grounded theory approach was used to explore VicPol's recruitment, foundation training, transfer, promotion, ...
Glacial lake inventory and lake outburst potential in Uzbekistan.
Petrov, Maxim A; Sabitov, Timur Y; Tomashevskaya, Irina G; Glazirin, Gleb E; Chernomorets, Sergey S; Savernyuk, Elena A; Tutubalina, Olga V; Petrakov, Dmitriy A; Sokolov, Leonid S; Dokukin, Mikhail D; Mountrakis, Giorgos; Ruiz-Villanueva, Virginia; Stoffel, Markus
2017-08-15
Climate change has been shown to increase the number of mountain lakes across various mountain ranges in the World. In Central Asia, and in particular on the territory of Uzbekistan, a detailed assessment of glacier lakes and their evolution over time is, however lacking. For this reason we created the first detailed inventory of mountain lakes of Uzbekistan based on recent (2002-2014) satellite observations using WorldView-2, SPOT5, and IKONOS imagery with a spatial resolution from 2 to 10m. This record was complemented with data from field studies of the last 50years. The previous data were mostly in the form of inventories of lakes, available in Soviet archives, and primarily included localized in-situ data. The inventory of mountain lakes presented here, by contrast, includes an overview of all lakes of the territory of Uzbekistan. Lakes were considered if they were located at altitudes above 1500m and if lakes had an area exceeding 100m 2 . As in other mountain regions of the World, the ongoing increase of air temperatures has led to an increase in lake number and area. Moreover, the frequency and overall number of lake outburst events have been on the rise as well. Therefore, we also present the first outburst assessment with an updated version of well-known approaches considering local climate features and event histories. As a result, out of the 242 lakes identified on the territory of Uzbekistan, 15% are considered prone to outburst, 10% of these lakes have been assigned low outburst potential and the remainder of the lakes have an average level of outburst potential. We conclude that the distribution of lakes by elevation shows a significant influence on lake area and hazard potential. No significant differences, by contrast, exist between the distribution of lake area, outburst potential, and lake location with respect to glaciers by regions. Copyright © 2017 Elsevier B.V. All rights reserved.
Leadership Preferences of Indian and Non-Indian Athletes.
Malloy, D. C.; Nilson, R. N.
1991-01-01
Among 86 Indian and non-Indian volleyball competitors, non-Indian players indicated significantly greater preferences for leadership that involved democratic behavior, autocratic behavior, or social support. Indians may adapt their behavior by participating in non-Indian games, without changing their traditional value orientations. Contains 22…
International Nuclear Information System (INIS)
Mountain, Bruce; Littlechild, Stephen
2010-01-01
A decade ago, electricity distribution network revenues per customer in New South Wales (NSW) were twice those in Great Britain (GB). Recent price controls imply that by 2014 they will be nearly four times as high. This paper examines possible reasons for this. The main reason does not seem to be geography, operating environment or industry structure. GB and Victoria have managed to accommodate increasing demand at broadly constant or even declining costs and revenues while delivering higher quality of service, while NSW has not. The regulatory framework and the practice of the regulatory body within that framework seem relevant. Australian regulators have not used benchmarking techniques as the GB regulator has. Perhaps the most important explanatory factor is private ownership in GB and Victoria compared to state ownership in NSW. This could also impact on the nature and effectiveness of regulation. (author)
Paediatric doses from diagnostic radiology in Victoria
International Nuclear Information System (INIS)
Boal, T.J.; Cardillo, I.; Einsiedel, P.F.
1998-01-01
This study examines doses to paediatric patients from diagnostic radiology. Measurements were made at 29 hospitals and private radiology practices in the state of Victoria. Entrance skin doses in air were measured for the exposure factors used by hospital radiology departments and private radiology practices for a standard size 1, 5, 10 and 15 year old child, for the following procedures: chest AP/PA, lat; abdomen AP; pelvis AP; lumbar spine AP, lat; and skull AP, lat. There was a large range of doses for each particular procedure and age group. Factors contributing to the range of doses were identified. Guidance levels for paediatric radiology based on the third quartile value of the skin entrance doses have been recommended and are compared with guidance levels. Copyright (1998) Australasian Physical and Engineering Sciences in Medicine
Lake-level frequency analysis for Devils Lake, North Dakota
Wiche, Gregg J.; Vecchia, Aldo V.
1996-01-01
Two approaches were used to estimate future lake-level probabilities for Devils Lake. The first approach is based on an annual lake-volume model, and the second approach is based on a statistical water mass-balance model that generates seasonal lake volumes on the basis of seasonal precipitation, evaporation, and inflow. Autoregressive moving average models were used to model the annual mean lake volume and the difference between the annual maximum lake volume and the annual mean lake volume. Residuals from both models were determined to be uncorrelated with zero mean and constant variance. However, a nonlinear relation between the residuals of the two models was included in the final annual lakevolume model.Because of high autocorrelation in the annual lake levels of Devils Lake, the annual lake-volume model was verified using annual lake-level changes. The annual lake-volume model closely reproduced the statistics of the recorded lake-level changes for 1901-93 except for the skewness coefficient. However, the model output is less skewed than the data indicate because of some unrealistically large lake-level declines. The statistical water mass-balance model requires as inputs seasonal precipitation, evaporation, and inflow data for Devils Lake. Analysis of annual precipitation, evaporation, and inflow data for 1950-93 revealed no significant trends or long-range dependence so the input time series were assumed to be stationary and short-range dependent.Normality transformations were used to approximately maintain the marginal probability distributions; and a multivariate, periodic autoregressive model was used to reproduce the correlation structure. Each of the coefficients in the model is significantly different from zero at the 5-percent significance level. Coefficients relating spring inflow from one year to spring and fall inflows from the previous year had the largest effect on the lake-level frequency analysis.Inclusion of parameter uncertainty in the model
Lake trout in northern Lake Huron spawn on submerged drumlins
Riley, Stephen C.; Binder, Thomas; Wattrus, Nigel J.; Faust, Matthew D.; Janssen, John; Menzies, John; Marsden, J. Ellen; Ebener, Mark P.; Bronte, Charles R.; He, Ji X.; Tucker, Taaja R.; Hansen, Michael J.; Thompson, Henry T.; Muir, Andrew M.; Krueger, Charles C.
2014-01-01
Recent observations of spawning lake trout Salvelinus namaycush near Drummond Island in northern Lake Huron indicate that lake trout use drumlins, landforms created in subglacial environments by the action of ice sheets, as a primary spawning habitat. From these observations, we generated a hypothesis that may in part explain locations chosen by lake trout for spawning. Most salmonines spawn in streams where they rely on streamflows to sort and clean sediments to create good spawning habitat. Flows sufficient to sort larger sediment sizes are generally lacking in lakes, but some glacial bedforms contain large pockets of sorted sediments that can provide the interstitial spaces necessary for lake trout egg incubation, particularly if these bedforms are situated such that lake currents can penetrate these sediments. We hypothesize that sediment inclusions from glacial scavenging and sediment sorting that occurred during the creation of bedforms such as drumlins, end moraines, and eskers create suitable conditions for lake trout egg incubation, particularly where these bedforms interact with lake currents to remove fine sediments. Further, these bedforms may provide high-quality lake trout spawning habitat at many locations in the Great Lakes and may be especially important along the southern edge of the range of the species. A better understanding of the role of glacially-derived bedforms in the creation of lake trout spawning habitat may help develop powerful predictors of lake trout spawning locations, provide insight into the evolution of unique spawning behaviors by lake trout, and aid in lake trout restoration in the Great Lakes.
Thielking, Monica; Moore, Susan; Jimerson, Shane R.
2006-01-01
This study examined the supervision arrangements and job satisfaction among school psychologists in Victoria, Australia. Participation in professional supervision was explored in relation to the type of employment and job satisfaction. The results revealed that the frequency of participation in supervision activities was less than optimal, with…
Poética de la autotraducción: María Victoria Atencia
Directory of Open Access Journals (Sweden)
López Martínez, María Isabel
2015-12-01
Full Text Available Self-translation is an ancient but poorly researched practice. This article analyses an exceptional case: the reflection on self-translation as exposed in poetry. A case in point is the poem «Voz traducida», from the poetry collection De la llama en que arde (1988. Indeed, the poem selected for examination was written by M.ª Victoria Atencia (Málaga, 1931, an expert both in writing poetry and in translating literature. Her book of poems also contains an original text, «Rosas», in Galician, and its corresponding Spanish translation. Both translation and reflection are complementary in her compositions. These poetic creations attest to the fact that artfulness works as a depiction of the next creation. Furthermore, this study will deeply explore the poet’s most important literary thoughts.La autotraducción es una práctica antigua, pero poco estudiada. El presente artículo analiza un caso excepcional: la reflexión sobre la autotraducción expuesta en la lírica. Para ello, se analiza el poema de M.ª Victoria Atencia «Voz traducida», perteneciente al libro titulado De la llama en que arde (1988. Es un ejemplo de que la tarea de traducir funciona como un motivo que origina una nueva creación. Además, permite que el lector conozca facetas importantes del pensamiento literario de la escritora. M.ª Victoria Atencia, además de poeta, es una experta traductora. El libro contiene también dos versiones del poema «Rosas», en gallego y en español, pruebas de la dimensión práctica de los planteamientos teóricos de la autora y de su coherencia estética. Ambas facetas, la traducción y la reflexión, son complementarias en la obra de la autora.
Lake sturgeon population characteristics in Rainy Lake, Minnesota and Ontario
Adams, W.E.; Kallemeyn, L.W.; Willis, D.W.
2006-01-01
Rainy Lake contains a native population of lake sturgeon Acipenser fulvescens that has been largely unstudied. The aims of this study were to document the population characteristics of lake sturgeon in Rainy Lake and to relate environmental factors to year-class strength for this population. Gill-netting efforts throughout the study resulted in the capture of 322 lake sturgeon, including 50 recaptures. Lake sturgeon in Rainy Lake was relatively plump and fast growing compared with a 32-population summary. Population samples were dominated by lake sturgeon between 110 and 150 cm total length. Age–structure analysis of the samples indicated few younger (<10 years) lake sturgeon, but the smallest gill net mesh size used for sampling was 102 mm (bar measure) and would not retain small sturgeon. Few lake sturgeon older than age 50 years were captured, and maximum age of sampled fish was 59 years. Few correlations existed between lake sturgeon year-class indices and both annual and monthly climate variables, except that mean June air temperature was positively correlated with year-class strength. Analysis of Rainy Lake water elevation and resulting lake sturgeon year-class strength indices across years yielded consistent but weak negative correlations between late April and early June, when spawning of lake sturgeon occurs. The baseline data collected in this study should allow Rainy Lake biologists to establish more specific research questions in the future.
Focus on Form and Corrective Feedback Research at the University of Victoria, Canada
Chen, Sibo; Nassaji, Hossein
2018-01-01
The Department of Linguistics at University of Victoria (UVic) in Canada has a long-standing tradition of empirical approaches to the study of theoretical and applied linguistics. As part of the Faculty of Humanities, the department caters to students with a wide range of backgrounds and interests, and provides crucial language teaching support in…
Layers of 'Cabo Frio' in 'Victoria Crater' (Stereo)
2006-01-01
This view of 'Victoria crater' is looking southeast from 'Duck Bay' towards the dramatic promontory called 'Cabo Frio.' The small crater in the right foreground, informally known as 'Sputnik,' is about 20 meters (about 65 feet) away from the rover, the tip of the spectacular, layered, Cabo Frio promontory itself is about 200 meters (about 650 feet) away from the rover, and the exposed rock layers are about 15 meters (about 50 feet) tall. This is a red-blue stereo anaglyph generated from images taken by the panoramic camera (Pancam) on NASA's Mars Exploration Rover Opportunity during the rover's 952nd sol, or Martian day, (Sept. 28, 2006) using the camera's 430-nanometer filters.
Directory of Open Access Journals (Sweden)
Gerhard MAIER
2005-08-01
Full Text Available The zooplankton communities of two basins of a large lake, Lake Constance, were compared during the years 2002 and 2003. The two basins differ in morphology, physical and chemical conditions. The Upper Lake basin has a surface area of 470 km2, a mean depth of 100 and a maximum depth of 250 m; the Lower Lake basin has a surface area of 62 km2, a mean depth of only 13 and a maximum depth of 40 m. Nutrient, chlorophyll-a concentrations and mean temperatures are somewhat higher in the Lower than in the Upper Lake. Total abundance of rotifers (number per m2 lake surface was higher and rotifer development started earlier in the year in the Lower than in the Upper Lake. Total abundance of crustaceans was higher in the Upper Lake in the year 2002; in the year 2003 no difference in abundance could be detected between the lake basins, although in summer crustacean abundance was higher in the Lower than in the Upper Lake. Crustacean communities differed significantly between lake basins while there was no apparent difference in rotifer communities. In the Lower Lake small crustaceans, like Bosmina spp., Ceriodaphnia pulchella and Thermocyclops oithonoides prevailed. Abundance (number per m2 lake surface of predatory cladocerans, large daphnids and large copepods was much lower in the Lower than in the Upper Lake, in particular during the summer months. Ordination with nonmetric multidimensional scaling (NMS separated communities of both lakes along gradients that correlated with temperature and chlorophyll a concentration. Clutches of copepods were larger in the Lower than in the Upper Lake. No difference could be detected in clutch size of large daphnids between lake basins. Our results show that zooplankton communities in different basins of Lake Constance can be very different. They further suggest that the lack of large crustaceans in particular the lack of large predatory cladocerans in the Lower Lake can have negative effects on growth and
Development of a water quality index (WQI) for the Loktak Lake in India
Das Kangabam, Rajiv; Bhoominathan, Sarojini Devi; Kanagaraj, Suganthi; Govindaraju, Munisamy
2017-10-01
The present work was carried out to assess a water quality index (WQI) of the Loktak Lake, an important wetland which has been under pressure due to the increasing anthropogenic activities. Physicochemical parameters like temperature (Tem), potential hydrogen (pH), electrical conductivity (EC), turbidity (T), dissolved oxygen (DO), total hardness (TH), calcium (Ca), chloride (Cl), fluoride (F), sulphate ({SO}4^{2-}), magnesium (Mg), phosphate ({PO}4^{3-}), sodium (Na), potassium (K), nitrite (NO2), nitrate (NO3), total dissolved solids (TDS), total carbon (TC), biochemical oxygen demand (BOD), and chemical oxygen demand (COD) were analyzed using standard procedures. The values obtained were compared with the guidelines for drinking purpose suggested by the World Health Organization and Bureau of Indian Standard. The result shows the higher concentration of nitrite in all the location which is beyond the permissible limit. Eleven parameters were selected to derive the WQI for the estimation of water potential for five sampling sites. A relative weight was assigned to each parameter range from 1.46 to 4.09 based on its importance. The WQI values range from 64 to 77 indicating that the Loktak Lake water is not fit for drinking, including both human and animals, even though the people living inside the Lake are using it for drinking purposes. The implementation of WQI is necessary for proper management of the Loktak Lake and it will be a very helpful tool for the public and decision makers to evaluate the water quality of the Loktak Lake for sustainable management.
Distribution and abundance of the West Indian manatee (Trichechus manatus) in the Panama Canal
Vianna, Juliana; Muschett, Giselle
2015-01-01
The present study was carried out to assess the distribution and current status of the West-Indian manatee Trichechus manatus, in Lake Gatun, the main body of water in the Panama Canal. We used four different methodologies: interviews, revision review of documents, aquatic and aerial surveys. Forty-four interviews carried out between March and July 2007 revealed 59 manatee sightings. Official documents revealed 19 manatee deaths between 1995 and 2008, while three aerial surveys yielded a tota...
Directory of Open Access Journals (Sweden)
Arpit Aggarwal
2016-01-01
Full Text Available A great number of glacial lakes have appeared in many mountain regions across the world during the last half-century due to receding of glaciers and global warming. In the present study, glacial lake outburst flood (GLOF risk assessment has been carried out in the Teesta river basin located in the Sikkim state of India. First, the study focuses on accurate mapping of the glaciers and glacial lakes using multispectral satellite images of Landsat and Indian Remote Sensing satellites. For glacier mapping, normalized difference snow index (NDSI image and slope map of the area have been utilized. NDSI approach can identify glaciers covered with clean snow but debris-covered glaciers cannot be mapped using NDSI method alone. For the present study, slope map has been utilized along with the NDSI approach to delineate glaciers manually. Glacial lakes have been mapped by supervised maximum likelihood classification and normalized difference water index followed by manual editing afterwards using Google Earth images. Second, the first proper inventory of glacial lakes for Teesta basin has been compiled containing information of 143 glacial lakes. Third, analysis of these lakes has been carried out for identification of potentially dangerous lakes. Vulnerable lakes have been identified on the basis of parameters like surface area, position with respect to parent glacier, growth since 2009, slope, distance from the outlet of the basin, presence of supraglacial lakes, presence of other lakes in downstream, condition of moraine, condition of the terrain around them, etc. From these criterions, in total, 18 lakes have been identified as potentially dangerous glacial lakes. Out of these 18 lakes, further analysis has been carried out for the identification of the most vulnerable lake. Lake 140 comes out to be the most vulnerable for a GLOF event. Lastly, for this potentially dangerous lake, different dam break parameters have been generated using satellite data
Lake trout rehabilitation in Lake Erie: a case history
Cornelius, Floyd C.; Muth, Kenneth M.; Kenyon, Roger
1995-01-01
Native lake trout (Salvelinus namaycush) once thrived in the deep waters of eastern Lake Erie. The impact of nearly 70 years of unregulated exploitation and over 100 years of progressively severe cultural eutrophication resulted in the elimination of lake trout stocks by 1950. Early attempts to restore lake trout by stocking were unsuccessful in establishing a self-sustaining population. In the early 1980s, New York's Department of Environmental Conservation, Pennsylvania's Fish and Boat Commission, and the U.S. Fish and Wildlife Service entered into a cooperative program to rehabilitate lake trout in the eastern basin of Lake Erie. After 11 years of stocking selected strains of lake trout in U.S. waters, followed by effective sea lamprey control, lake trout appear to be successfully recolonizing their native habitat. Adult stocks have built up significantly and are expanding their range in the lake. Preliminary investigations suggest that lake trout reproductive habitat is still adequate for natural reproduction, but natural recruitment has not been documented. Future assessments will be directed toward evaluation of spawning success and tracking age-class cohorts as they move through the fishery.
Microbiology of Lonar Lake and other soda lakes
Paul Antony, Chakkiath; Kumaresan, Deepak; Hunger, Sindy; Drake, Harold L; Murrell, J Colin; Shouche, Yogesh S
2013-01-01
Soda lakes are saline and alkaline ecosystems that are believed to have existed throughout the geological record of Earth. They are widely distributed across the globe, but are highly abundant in terrestrial biomes such as deserts and steppes and in geologically interesting regions such as the East African Rift valley. The unusual geochemistry of these lakes supports the growth of an impressive array of microorganisms that are of ecological and economic importance. Haloalkaliphilic Bacteria and Archaea belonging to all major trophic groups have been described from many soda lakes, including lakes with exceptionally high levels of heavy metals. Lonar Lake is a soda lake that is centered at an unusual meteorite impact structure in the Deccan basalts in India and its key physicochemical and microbiological characteristics are highlighted in this article. The occurrence of diverse functional groups of microbes, such as methanogens, methanotrophs, phototrophs, denitrifiers, sulfur oxidizers, sulfate reducers and syntrophs in soda lakes, suggests that these habitats harbor complex microbial food webs that (a) interconnect various biological cycles via redox coupling and (b) impact on the production and consumption of greenhouse gases. Soda lake microorganisms harbor several biotechnologically relevant enzymes and biomolecules (for example, cellulases, amylases, ectoine) and there is the need to augment bioprospecting efforts in soda lake environments with new integrated approaches. Importantly, some saline and alkaline lake ecosystems around the world need to be protected from anthropogenic pressures that threaten their long-term existence. PMID:23178675
Directory of Open Access Journals (Sweden)
Cleopas Njerekai
2014-01-01
Full Text Available This paper is a documentation of the tangible economic benefits that accrued to the town of Victoria Falls, Zimbabwe, by co-hosting with Zambia, the 20th session of the United Nations World Tourism Organisation (UNWTO General Assembly (GA in 2013. The paper intends to offset speculations, half-truths and exaggerations on the tangible economic benefits of the event to the town and to contribute significantly to the scanty existing literature on the impact of these events to developing countries. A single case study research design focusing on the town was adopted for this study. The study participants to the research included tourism and hospitality organizations, the Victoria Falls municipality authorities, service providers and Victoria Falls town residents. Researcher administered questionnaires, semi-structured interviews and observation check lists were used to collect the data. In general, although the GA brought some significant transformative effects to the town of Victoria Falls in terms of employment creation, infrastructural development, revenue generation and the country's image, future host cities and countries to this event should mobilize adequate funds for the event, time it appropriately, ensure a fair spread of the benefits to various sectors and put up structures that do not turn into white elephants soon after the event.
Groundwater quality in the Indian Wells Valley, California
Dawson, Barbara J. Milby; Belitz, Kenneth
2012-01-01
Groundwater provides more than 40 percent of California’s drinking water. To protect this vital resource, the State of California created the Groundwater Ambient Monitoring and Assessment (GAMA) Program. The Priority Basin Project of the GAMA Program provides a comprehensive assessment of the State’s groundwater quality and increases public access to groundwater-quality information. Indian Wells Valley is one of the study areas being evaluated. The Indian Wells study area is approximately 600 square miles (1,554 square kilometers) and includes the Indian Wells Valley groundwater basin (California Department of Water Resources, 2003). Indian Wells Valley has an arid climate and is part of the Mojave Desert. Average annual rainfall is about 6 inches (15 centimeters). The study area has internal drainage, with runoff from the surrounding mountains draining towards dry lake beds in the lower parts of the valley. Land use in the study area is approximately 97.0 percent (%) natural, 0.4% agricultural, and 2.6% urban. The primary natural land cover is shrubland. The largest urban area is the city of Ridgecrest (2010 population of 28,000). Groundwater in this basin is used for public and domestic water supply and for irrigation. The main water-bearing units are gravel, sand, silt, and clay derived from the Sierra Nevada to the west and from the other surrounding mountains. Recharge to the groundwater system is primarily runoff from the Sierra Nevada and to the west and from the other surrounding mountains. Recharge to the groundwater system is primarily runoff from the Sierra Nevada and direct infiltration from irrigation and septic systems. The primary sources of discharge are pumping wells and evapotranspiration near the dry lakebeds. The primary aquifers in the Indian Wells study area are defined as those parts of the aquifers corresponding to the perforated intervals of wells listed in the California Department of Public Health database. Public-supply wells in
Water resources of the Prairie Island Indian Reservation, Minnesota, 1994-97
Cowdery, Timothy K.
1999-01-01
This evaluation of the water resources on the Prairie Island Indian Reservation includes data collected from 8 surface-water sites and 22 wells during 1994–97 and historical data. The Mississippi River and the lakes and wetlands connected to it are separated from the Vermillion River and the lakes and wetlands connected to it by the surficial aquifer on Prairie Island and by Lock and Dam Number 3. These surface-water groups form hydrologic boundaries of the surficial aquifer. The aquifer is 130–200 feet thick, extends to bedrock (the Franconia Formation, which is also an aquifer), and is composed primarily of sand and gravel, but also contains thin, isolated lenses of finer-grained material. Flow in the surficial aquifer is normally from the Mississippi River to the Vermillion River (southwest). During spring snowmelt or heavy rains, a ground-water mound forms in the center of the study area and causes radial ground-water flow toward the surrounding surface waters.
Lane, Courtney R; Sutton, Brett; Valcanis, Mary; Kirk, Martyn; Walker, Cathryn; Lalor, Karin; Stephens, Nicola
2016-03-15
Knowledge of relationships between antibiotic susceptibility of Shigella isolates and travel destination or other risk factors can assist clinicians in determining appropriate antibiotic therapy prior to susceptibility testing. We describe relationships between resistance patterns and risk factors for acquisition in Shigella isolates using routinely collected data for notified cases of shigellosis between 2008 and 2012 in Victoria, Australia. We included all shigellosis patients notified during the study period, where Shigella isolates were tested for antimicrobial sensitivity using Clinical and Laboratory Standards Institute breakpoints. Cases were interviewed to collect data on risk factors, including recent travel. Data were analyzed using Stata 13.1 to examine associations between risk factors and resistant strains. Of the 500 cases of shigellosis, 249 were associated with overseas travel and 210 were locally acquired. Forty-six of 51 isolates of Indian origin displayed decreased susceptibility or resistance to ciprofloxacin. All isolates of Indonesian origin were susceptible to ciprofloxacin. Twenty-six travel-related isolates were resistant to all tested oral antimicrobials. Male-to-male sexual contact was the primary risk factor for 80% (120/150) of locally acquired infections among adult males, characterized by distinct periodic Shigella sonnei outbreaks. Clinicians should consider travel destination as a marker for resistance to common antimicrobials in returning travelers, where severe disease requires empirical treatment prior to receipt of individual sensitivity testing results. Repeated outbreaks of locally acquired shigellosis among men who have sex with men highlight the importance of prevention and control measures in this high-risk group. © The Author 2015. Published by Oxford University Press for the Infectious Diseases Society of America. All rights reserved. For permissions, e-mail journals.permissions@oup.com.
NAPLAN Scores as Predictors of Access to Higher Education in Victoria
Brendan Houng; Moshe Justman
2014-01-01
This paper examines the extent to which year-9 performance on the National Assessment Program—Language Arts and Numeracy (NAPLAN) predicts access to higher education as determined by subsequent achievement on year-12 Victoria Certificate of Education (VCE) exams. VCE performance is measured via three binary indicators: achieving an Australian tertiary admission rank (ATAR) above 50 ("ATAR50"), above 70 ("ATAR70"), and above 90 ("ATAR90"); and two continuous indicators: ATAR and the Tertiary E...
Directory of Open Access Journals (Sweden)
Fredrick Argwenge Odede
2014-01-01
Full Text Available Many countries in the world exploit cultural heritage to reduce poverty, enhance livelihood and transform of the community and support local livelihood. This paper focuses of ecotourism transformation, namely, nature (Simbi as unique Crater Lake and the mythology associated with the lake depicting the curse of a village of a strange old woman by the name Simbi. These two constellations have been used to preserve the site and needs to be used in the planning, conservation and management of this unique heritage. Stakeholder participation should use the two concepts in planning and conservation. The study aimed at mapping the site, examining its cultural identity, assessing the values and potential of the site, identifying the challenges facing the site and developing appropriate strategies for ecotourism promotion. The study used ethnographic and phenomenological modes of data collection using purposive sampling method. The data was qualitatively analysed and yielded themes with respect to research objectives. The documented the location, nature and mythology of the site as planning, conservation and branding tools, established the level of community participation in its planning, conservation and branding, identified its potential and challenges for ecotourism promotion, and proposed appropriate strategies for planning management and conservation of Simbi Nyaima for upscaling ecotourism in the study area.
Holocene Lake-Level Fluctuations of Lake Aricota, Southern Peru
Placzek, Christa; Quade, Jay; Betancourt, Julio L.
2001-09-01
Lacustrine deposits exposed around Lake Aricota, Peru (17° 22‧S), a 7.5-km2 lake dammed by debris flows, provide a middle to late Holocene record of lake-level fluctuations. Chronological context for shoreline deposits was obtained from radiocarbon dating of vascular plant remains and other datable material with minimal 14C reservoir effects (<350 yr). Diatomites associated with highstands several meters above the modern lake level indicate wet episodes. Maximum Holocene lake level was attained before 6100 14C yr B.P. and ended ∼2700 14C yr B.P. Moderately high lake levels occurred at 1700 and 1300 14C yr B.P. The highstand at Lake Aricota during the middle Holocene is coeval with a major lowstand at Lake Titicaca (16°S), which is only 130 km to the northeast and shares a similar climatology. Comparisons with other marine and terrestrial records highlight emerging contradictions over the nature of mid-Holocene climate in the central Andes.
Awal, Sadiqul; Christie, Andrew; Watson, Matthew; Hannadige, Asanka G. T.
2012-01-01
Purpose: The central aim of this study was to determine the perception of aquaculture educational provisions in the state of Victoria, and whether they are sufficient to ultimately support further growth of the industry. Design/methodology/approach: Questionnaires were formulated and distributed to participants in a variety of ways, including via…
Legione, Alistair R; Amery-Gale, Jemima; Lynch, Michael; Haynes, Leesa; Gilkerson, James R; Sansom, Fiona M; Devlin, Joanne M
2016-04-28
We detected Chlamydia pecorum in two koalas ( Phascolarctos cinereus ) from a closed island population in Victoria, Australia, previously free of Chlamydia infection. The ompA and multilocus sequence type were most closely related to published isolates of livestock rather than koala origin, suggesting potential cross-species transmission of C. pecorum .
Mara River and Associated Wetland as a Refuge of Threatened ...
African Journals Online (AJOL)
A study was carried out in Mara River and Lake Kirumi in January/February, 2005 to investigate the importance oJ. the wetland as a refuge site for indigenous cichlids particularly tilapiines which have either disappeared from Lake Victoria or threatened. Fish samples were obtained using experimental gillnets whose ...
Chironomidae (Insecta: Diptera) Collected from Hydrilla Verticillata ...
African Journals Online (AJOL)
A survey of the aquatic weed Hydrilla verticillata was conducted in selected Kenyan and Ugandan lakes, and emerging chironomid adults were collected from samples of Hydrilla and seven other aquatic macrophytes. Hydrilla was absent from Lake Victoria, in sites where it previously occurred. Hydrilla was found in four of ...
Integrated Water, Sanitation and Solid Waste Management in Small ...
International Development Research Centre (IDRC) Digital Library (Canada)
Inadequate water and sanitation services are having an negative effect on human health and polluting Lake Victoria in East Africa. At the request of the governments of Kenya, Tanzania and Uganda, UN-Habitat has undertaken an initiative to provide water and sanitation services in the region and protect the Lake basin.
Ansari, Humaira; Ansari, Zahid; Lim, Tracy; Hutson, John M; Southwell, Bridget R
2014-12-01
Constipation is common, with severe symptoms requiring hospitalisation. Constipation can be a primary (present at admission and requires treatment or investigation) or principal (first listed) diagnosis for hospitalisation. In the USA, constipation is the second most common ambulatory care digestive diagnosis with total costs >US$1.7 billion/year. Incidence of hospitalisation for constipation in children peaks at toilet-training age. This study determined the burden of paediatric constipation to hospital care in Victoria, Australia. The Victorian Admitted Episodes Dataset was analysed retrospectively, examining hospital admissions with a primary diagnosis of constipation in the 7-year period 2002/2003 to 2008/2009. For children, constipation was recorded as a primary diagnosis in 8688 admissions (3.6/1000 of population). In-hospital prevalence was ∼1.0%. Mean length of stay was 4.4 days (median 1.0, range 0-993, standard deviation 16.7). There were 1121 readmissions in 668 children. Average treatment cost was A$4235/admission (median A$1461, range A$0-$278 816), with annual costs of ∼A$5 505 500. Children in the highest socio-economic area had ∼50% fewer admissions (P disadvantage, public hospital, planned admission, longer length of stay and association with other medical conditions. This study identified that constipation in children is a significant cost burden in Victoria (costing public hospitals ∼A$5.5 million/year). Hospitalisation in Victoria is 10-fold higher than in the USA with 10% readmissions within a month. We conclude that strategies aimed at reducing hospitalisation for constipation could result in significant savings for the paediatric public health system in Victoria, Australia. © 2014 The Authors. Journal of Paediatrics and Child Health © 2014 Paediatrics and Child Health Division (Royal Australasian College of Physicians).
Lake Morphometry for NHD Lakes in Great Lakes Region 4 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
Fusilli, L.; Collins, M. O.; Laneve, G.; Palombo, A.; Pignatti, S.; Santini, F.
2013-02-01
The objective of this research study is to assess the capability of time-series of MODIS imagery to provide information suitable for enhancing the understanding of the temporal cycles shown by the abnormal growth of the floating macrophytes in order to support monitoring and management action of Lake Victoria water resources. The proliferation of invasive plants and aquatic weeds is of growing concern. Starting from 1989, Lake Victoria has been interested by the high infestation of water hyacinth with significant socio-economic impact on riparian populations. In this paper, we describe an approach based on the time-series of MODIS to derive the temporal behaviour, the abundance and distribution of the floating macrophytes in the Winam Gulf (Kenyan portion of the Lake Victoria) and its possible links to the concentrations of the main water constituencies. To this end, we consider the NDVI values computed from the MODIS imagery time-series from 2000 to 2009 to identify the floating macrophytes cover and an appropriate bio-optical model to retrieve, by means of an inverse procedure, the concentrations of chlorophyll a, coloured dissolved organic matter and total suspended solid. The maps of the floating vegetation based on the NDVI values allow us to assess the spatial and temporal dynamics of the weeds with high time resolution. A floating vegetation index (FVI) has been introduced for describing the weeds pollution level. The results of the analysis show a consistent temporal relation between the water constituent concentrations within the Winam Gulf and the FVI, especially in the proximity of the greatest proliferation of floating vegetation in the last 10 years that occurred between the second half of 2006 and the first half of 2007.The adopted approach will be useful to implement an automatic system for monitoring and predicting the floating macrophytes proliferation in Lake Victoria.
The radiocarbon dating project at Aboriginal Affairs, Victoria
International Nuclear Information System (INIS)
Godfrey, M.C.S.
1997-01-01
The purpose of this project has been to publish a complete list of the age estimates relating to the archaeological sites in the State of Victoria from 1951 to 1995, and to assess the value and the limitations of this information for interpreting the prehistory of this region. This project has recorded 476 dates coming from 14 laboratories, and ranging in age from the time of European settlement to the limit of the technique at around 40,000 years BP. However, the available evidence indicates that large discrepancies may exist in these results, and this has lead to the recommendation that this data should not be used in research projects requiring dating accuracies of less than a few hundred years
Stott, Wendylee; Ebener, Mark P.; Mohr, Lloyd; Hartman, Travis; Johnson, Jim; Roseman, Edward F.
2013-01-01
Lake whitefish (Coregonus clupeaformis (Mitchill)) are important commercially, culturally, and ecologically in the Laurentian Great Lakes. Stocks of lake whitefish in the Great Lakes have recovered from low levels of abundance in the 1960s. Reductions in abundance, loss of habitat and environmental degradation can be accompanied by losses of genetic diversity and overall fitness that may persist even as populations recover demographically. Therefore, it is important to be able to identify stocks that have reduced levels of genetic diversity. In this study, we investigated patterns of genetic diversity at microsatellite DNA loci in lake whitefish collected between 1927 and 1929 (historical period) and between 1997 and 2005 (contemporary period) from Lake Huron and Lake Erie. Genetic analysis of lake whitefish from Lakes Huron and Erie shows that the amount of population structuring varies from lake to lake. Greater genetic divergences among collections from Lake Huron may be the result of sampling scale, migration patterns and demographic processes. Fluctuations in abundance of lake whitefish populations may have resulted in periods of increased genetic drift that have resulted in changes in allele frequencies over time, but periodic genetic drift was not severe enough to result in a significant loss of genetic diversity. Migration among stocks may have decreased levels of genetic differentiation while not completely obscuring stock boundaries. Recent changes in spatial boundaries to stocks, the number of stocks and life history characteristics of stocks further demonstrate the potential of coregonids for a swift and varied response to environmental change and emphasise the importance of incorporating both spatial and temporal considerations into management plans to ensure that diversity is preserved.
75 FR 58427 - Notice of Inventory Completion: Office of the State Archaeologist, Lansing, MI
2010-09-24
... Tribe of Indians of Oklahoma; Bad River Band of the Lake Superior Tribe of Chippewa Indians of the Bad... Absentee-Shawnee Tribe of Indians of Oklahoma; Bad River Band of the Lake Superior Tribe of Chippewa Indians of the Bad River Reservation, Wisconsin; Bay Mills Indian Community, Michigan; Bois Forte Band...
2013-06-06
...; Bad River Band of the Lake Superior Tribe of Chippewa Indians of the Bad River Reservation, Wisconsin... removed is the aboriginal land of the Bad River Band of the Lake Superior Tribe of Chippewa Indians of the Bad River Reservation, Wisconsin; Bay Mills Indian Community, Michigan; Bois Forte Band (Nett Lake) of...
Conflicts of Shared Resources: A Case Study of River Nile
2012-03-22
the source of water for the Mesopotamian basin, pose a similar problem between Syria and Iraq. There is therefore, need to...open water. Apart of having a big share of Lake Victoria, Uganda is also the home to Lake George and Lake Kyoga, and parts of Albert and Edward. The ...forge co-operation amongst its countries, in areas of infrastructure, environmental co- operation, culture and trade. The group held sixty-six
Energy density of lake whitefish Coregonus clupeaformis in Lakes Huron and Michigan
Pothoven, S.A.; Nalepa, T.F.; Madenjian, C.P.; Rediske, R.R.; Schneeberger, P.J.; He, J.X.
2006-01-01
We collected lake whitefish Coregonus clupeaformis off Alpena and Tawas City, Michigan, USA in Lake Huron and off Muskegon, Michigan USA in Lake Michigan during 2002–2004. We determined energy density and percent dry weight for lake whitefish from both lakes and lipid content for Lake Michigan fish. Energy density increased with increasing fish weight up to 800 g, and then remained relatively constant with further increases in fish weight. Energy density, adjusted for weight, was lower in Lake Huron than in Lake Michigan for both small (≤800 g) and large fish (>800 g). Energy density did not differ seasonally for small or large lake whitefish or between adult male and female fish. Energy density was strongly correlated with percent dry weight and percent lipid content. Based on data from commercially caught lake whitefish, body condition was lower in Lake Huron than Lake Michigan during 1981–2003, indicating that the dissimilarity in body condition between the lakes could be long standing. Energy density and lipid content in 2002–2004 in Lake Michigan were lower than data for comparable sized fish collected in 1969–1971. Differences in energy density between lakes were attributed to variation in diet and prey energy content as well as factors that affect feeding rates such as lake whitefish density and prey abundance.
Zuccarino-Crowe , Chiara M.; Taylor, William W.; Hansen, Michael J.; Seider, Michael J.; Krueger, Charles C.
2016-01-01
Lake trout refuges in the Apostle Islands region of Lake Superior are analogous to the concept of marine protected areas. These refuges, established specifically for lake trout (Salvelinus namaycush) and closed to most forms of recreational and commercial fishing, were implicated as one of several management actions leading to successful rehabilitation of Lake Superior lake trout. To investigate the potential significance of Gull Island Shoal and Devils Island Shoal refuges for populations of not only lake trout but also other fish species, relative abundances of lake trout, lake whitefish (Coregonus clupeaformis), and cisco (Coregonus artedi) were compared between areas sampled inside versus outside of refuge boundaries. During 1982–2010, lake trout relative abundance was higher and increased faster inside the refuges, where lake trout fishing was prohibited, than outside the refuges. Over the same period, lake whitefish relative abundance increased faster inside than outside the refuges. Both evaluations provided clear evidence that refuges protected these species. In contrast, trends in relative abundance of cisco, a prey item of lake trout, did not differ significantly between areas inside and outside the refuges. This result did not suggest indirect or cascading refuge effects due to changes in predator levels. Overall, this study highlights the potential of species-specific refuges to benefit other fish species beyond those that were the refuges' original target. Improved understanding of refuge effects on multiple species of Great Lakes fishes can be valuable for developing rationales for refuge establishment and predicting associated fish community-level effects.
‘A token of their love’: Queen Victoria Memorials in New Zealand
Stocker, Mark
2016-01-01
This article provides an overview of the four metropolitan sculptural memorials to Queen Victoria in late-colonial New Zealand, which all immediately precede the colony’s Dominion status (1907). In chronological order, they were erected in Auckland, Christchurch, Wellington, and Dunedin. While the Auckland memorial was unveiled within the Queen’s lifetime, her death in 1901 catalysed the commission of more ambitious counterparts in Wellington and Dunedin, and a degree of intercity rivalry was...
A real-options analysis of wine grape farming in north west Victoria
Seyoum, Emayenesh; Chan, Chris
2012-01-01
This paper reports a use of a real-options valuation methodology to analyse wine grape farm investment under price and yield uncertainty. Revenue levels to incentivise entry and exit were calculated for three different sizes of wine grape farms in North West Victoria. The modelling identified lower exit and higher entry triggers than indicated by conventional net present value calculation. The wide gap of estimated indeterminacy in farm investment highlights the intertwined influence of numer...
The origins of the Frente para la Victoria in Argentina (1988-2003
Directory of Open Access Journals (Sweden)
Pamela SOSA
2017-10-01
Full Text Available The article reconstructs the trajectory of the Frente para la Victoria in the Argentinean province of Santa Cruz between 1988 y 2003. Period during which this political force was formed, forged its main attributes and amass the political capital that allow it to reach the presidency of the Nation in 2003, position that holds to December 2015. This organization was built outside the dominant structures and groups of the provincial politics.
Hazards of volcanic lakes: analysis of Lakes Quilotoa and Cuicocha, Ecuador
Directory of Open Access Journals (Sweden)
G. Gunkel
2008-01-01
Full Text Available Volcanic lakes within calderas should be viewed as high-risk systems, and an intensive lake monitoring must be carried out to evaluate the hazard of potential limnic or phreatic-magmatic eruptions. In Ecuador, two caldera lakes – Lakes Quilotoa and Cuicocha, located in the high Andean region >3000 a.s.l. – have been the focus of these investigations. Both volcanoes are geologically young or historically active, and have formed large and deep calderas with lakes of 2 to 3 km in diameter, and 248 and 148 m in depth, respectively. In both lakes, visible gas emissions of CO2 occur, and an accumulation of CO2 in the deep water body must be taken into account.
Investigations were carried out to evaluate the hazards of these volcanic lakes, and in Lake Cuicocha intensive monitoring was carried out for the evaluation of possible renewed volcanic activities. At Lake Quilotoa, a limnic eruption and diffuse CO2 degassing at the lake surface are to be expected, while at Lake Cuicocha, an increased risk of a phreatic-magmatic eruption exists.
Reforming Victoria's primary health and community service sector: rural implications.
Alford, K
2000-01-01
In 1999 the Victorian primary care and community support system began a process of substantial reform, involving purchasing reforms and a contested selection process between providers in large catchment areas across the State. The Liberal Government's electoral defeat in September 1999 led to a review of these reforms. This paper questions the reforms from a rural perspective. They were based on a generic template that did not consider rural-urban differences in health needs or other differences including socio-economic status, and may have reinforced if not aggravated rural-urban differences in the quality of and access to primary health care in Victoria.
Characterization of dissolved organic material in the interstitial brine of Lake Vida, Antarctica
Cawley, Kaelin M.; Murray, Alison E.; Doran, Peter T.; Kenig, Fabien; Stubbins, Aron; Chen, Hongmei; Hatcher, Patrick G.; McKnight, Diane M.
2016-06-01
Lake Vida (LV) is located in the McMurdo Dry Valleys (Victoria Valley, East Antarctica) and has no inflows, outflows, or connectivity to the atmosphere due to a thick (16 m), turbid ice surface and cold (organic carbon concentration (DOC; 580 mg-C L-1 or greater); the study of which provides a unique opportunity to better understand biological and/or abiotic processes taking place in an isolated saline ecosystem with no external inputs. We isolated two sub-fractions of LV dissolved organic matter (DOM) by chemical separation using XAD-8 and XAD-4 resins in series. This separation was followed by physical separation using ultrafiltration to isolate a higher molecular weight (HMW) fraction that was retained by the membrane and a salty, dilute low molecular weight fraction. This analytical path resulted in three, low salt sub-fractions and allowed comparison to other Antarctic lake DOM samples isolated using similar procedures. Compared to other Antarctic lakes, a lower portion of the DOC was retained by XAD-8 (∼10% vs. 16-24%) resin, while the portions retained by XAD-4 (∼8%) resin and the 1 kDa ultrafiltration membrane (∼50%) were similar. The 14C radiocarbon ages of the XAD-8 (mean 3940 ybp), XAD-4 (mean 4048 ybp) and HMW (mean 3270 ybp) fractions are all older than the apparent age of ice-cover formation (2800 ybp). Ultrahigh resolution mass spectrometry showed that compounds with two and three nitrogen atoms in the molecular formulas were common in both the LV-XAD8 and LV-XAD4 fractions, consistent with microbial production and processing. The long-term oxidation of LVBr DOM by abiotic oxidants including perchlorate and chlorate may explain the low portion in the XAD8 fraction and the lack of aromatic carbon, as measured by 13C NMR spectroscopy, found for all but the most hydrophobic fraction, LV-XAD8. Overall, the chemical characteristics of Lake Vida brine DOM suggest that legacy DOM sealed and concentrated within the brine has been altered due to a
A study of the degree of Pollution in Nakivubo Channel, Kampala ...
African Journals Online (AJOL)
Nakivubo channel traverses highly populated Kampala slums, markets, industrial areas and a wetland. It discharges its water at Murchison bay in Lake Victoria. The degree of pollution in the channel has a direct effect on the aquatic life in the lake, the health of communities along the channel, and the cost of water treatment ...
Review Paper Variations and changes in habitat, productivity ...
African Journals Online (AJOL)
The Kyoga lake system, which is c. 4 m deep, originally had a diverse fish fauna, extensive macrophytes and wetlands. Most (82%) of its water comes from Lake Victoria, is controlled through three dams and has a short residence time of c. 3 months. Physical and chemical factors, plankton productivity and composition vary ...
Consumption, indigeneous knowledge and cultural values of the ...
African Journals Online (AJOL)
Of the edible insects, lakeflies (Chaoborus and Chironomus sp) are least documented as items of human consumption. They are eaten by the Luo communities living within the Lake Victoria basin. The purpose of this study was to evaluate the importance of lake flies as a source of food and its role in cultural practices.
A decreasing trend in fall-related hip fracture incidence in Victoria, Australia.
Cassell, E; Clapperton, A
2013-01-01
In Victoria, Australia, the age-standardised incidence of fall-related hip fracture hospitalisations decreased significantly by 25% over the period 1998/1999-2008/2009. Significant decreases in fall-related hip fractures were observed in males and females, across all 5-year age groups, in Australian-born and overseas-born Victorians, in all socio-economic quintiles and in community-dwelling older people. The study aim was to investigate trends in the incidence of fall-related and hip fracture hospitalisations among Victorians aged 65 years and older overall and by age, gender, country of birth, socio-economic status (SES) and location of the event (home, residential care institution, etc.) over the 11-year period 1998/1999 to 2008/2009. Annual counts and age-standardised rates for fall-related hospitalisations among people aged 65 years and older were estimated using Victorian hospital admissions data. The statistical significance of changes in trends over time were analysed using a log-linear regression model of the rate data assuming a Poisson distribution of cases. Although the age-standardised incidence of fall-related hospitalisations increased significantly by 13% (95% confidence interval [CI], 9% to 18%) in Victoria, the age-standardised incidence of fall-related hip fracture hospitalisations decreased from 600/100,000 in 1998/1999 to 467/100,000 in 2008/2009 - an estimated overall reduction of 25% (95% CI, -29% to -22%). By contrast, the age-standardised incidence of fall-related hospitalisations for fractures at other body sites either increased significantly or showed no significant change. Significant decreases in fall-related hip fractures were observed in both males and females, across all 5-year age groups, in both Australian-born and overseas-born Victorians, in all socio-economic quintiles and in community-dwelling older people but not in people living in residential care facilities. Despite the downward trend in the age-standardised incidence of
Layers of 'Cabo Frio' in 'Victoria Crater' (False Color)
2006-01-01
This view of 'Victoria crater' is looking southeast from 'Duck Bay' towards the dramatic promontory called 'Cabo Frio.' The small crater in the right foreground, informally known as 'Sputnik,' is about 20 meters (about 65 feet) away from the rover, the tip of the spectacular, layered, Cabo Frio promontory itself is about 200 meters (about 650 feet) away from the rover, and the exposed rock layers are about 15 meters (about 50 feet) tall. This is an enhanced false color rendering of images taken by the panoramic camera (Pancam) on NASA's Mars Exploration Rover Opportunity during the rover's 952nd sol, or Martian day, (Sept. 28, 2006) using the camera's 750-nanometer, 530-nanometer and 430-nanometer filters.
Principles of lake sedimentology
International Nuclear Information System (INIS)
Janasson, L.
1983-01-01
This book presents a comprehensive outline on the basic sedimentological principles for lakes, and focuses on environmental aspects and matters related to lake management and control-on lake ecology rather than lake geology. This is a guide for those who plan, perform and evaluate lake sedimentological investigations. Contents abridged: Lake types and sediment types. Sedimentation in lakes and water dynamics. Lake bottom dynamics. Sediment dynamics and sediment age. Sediments in aquatic pollution control programmes. Subject index
2012-01-01
Background The genus Dunaliella (Class – Chlorophyceae) is widely studied for its tolerance to extreme habitat conditions, physiological aspects and many biotechnological applications, such as a source of carotenoids and many other bioactive compounds. Biochemical and molecular characterization is very much essential to fully explore the properties and possibilities of the new isolates of Dunaliella. In India, hyper saline lakes and salt pans were reported to bloom with Dunaliella spp. However, except for the economically important D. salina, other species are rarely characterized taxonomically from India. Present study was conducted to describe Dunaliella strains from Indian salinas using a combined morphological, physiological and molecular approach with an aim to have a better understanding on the taxonomy and diversity of this genus from India. Results Comparative phenotypic and genetic studies revealed high level of diversity within the Indian Dunaliella isolates. Species level identification using morphological characteristics clearly delineated two strains of D. salina with considerable β-carotene content (>20 pg/cell). The variation in 18S rRNA gene size, amplified with MA1-MA2 primers, ranged between ~1800 and ~2650 base pairs, and together with the phylogeny based on ITS gene sequence provided a pattern, forming five different groups within Indian Dunaliella isolates. Superficial congruency was observed between ITS and rbcL gene phylogenetic trees with consistent formation of major clades separating Indian isolates into two distinct clusters, one with D. salina and allied strains, and another one with D. viridis and allied strains. Further in both the trees, few isolates showed high level of genetic divergence than reported previously for Dunaliella spp. This indicates the scope of more numbers of clearly defined/unidentified species/sub-species within Indian Dunaliella isolates. Conclusion Present work illustrates Indian Dunaliella strains
Marrone, John; Fairley, Christopher K; Saville, Marian; Bradshaw, Catriona; Bowden, Francis J; Horvath, Leonie B; Donovan, Basil; Chen, Marcus; Hocking, Jane S
2008-06-01
To investigate the temporal associations between Trichomonas vaginalis (TV) diagnoses in women at a large urban sexual health clinic and a major Papanicolaou (Pap) smear screening laboratory in Victoria, Australia with Pap smear screening rates and the introduction of nitroimidazole treatments. An ecological analysis of TV diagnosis rates at the Melbourne Sexual Health Centre and the Victorian Cytology Service, Pap smear screening rates and nitroimidazole prescription data. Diagnoses of TV at the Melbourne Sexual Health Centre peaked in the 1950s at 20% to 30% and then rapidly declined through the 1960s and 1970s to below 1% in 1990. A similar pattern was observed at the Victorian Cytology Service. Metronidazole prescribing and opportunistic Pap smear screening began in Victoria in the 1960s coinciding with declining TV. The availability of tinidazole in 1976 led to further declines in TV in the late 1970s. A national cervical screening program introduced in 1991 was temporally associated with further declines in TV. Our analyses suggest that the introduction of metronidazole was associated with a large reduction in TV among Victorian women in the 1960s. The subsequent availability of tinidazole and increased Pap smear screening may have contributed to the current low TV prevalence in Victoria.
Lake Afdera: a threatened saline lake in Ethiopia | Getahun | SINET ...
African Journals Online (AJOL)
Lake Afdera is a saline lake located in the Afar region, Northern Ethiopia. Because of its inaccessibility it is one of the least studied lakes of the country. It supports life including three species of fish of which two are endemic. Recently, reports are coming out that this lake is used for salt extraction. This paper gives some ...
Water quality of Lake Austin and Town Lake, Austin, Texas
Andrews, Freeman L.; Wells, Frank C.; Shelby, Wanda J.; McPherson, Emma
1988-01-01
Lake Austin and Town Lake are located on the Colorado River in Travis County, central Texas, and serve as a source of water for municipal and industrial water supplies, electrical-power generation, and recreation for more than 500,000 people in the Austin metropolitan area. Lake Austin, located immediately downstream of Lake Travis, extends for more than 20 miles into the western edge of the city of Austin. Town Lake extends through the downtown area of the city of Austin for nearly 6 miles where the Colorado River is impounded by Longhorn Dam.
Refuge Lake Reclassification in 620 Minnesota Cisco Lakes under Future Climate Scenarios
Directory of Open Access Journals (Sweden)
Liping Jiang
2017-09-01
Full Text Available Cisco (Coregonus artedi is the most common coldwater stenothermal fish in Minnesota lakes. Water temperature (T and dissolved oxygen (DO in lakes are important controls of fish growth and reproduction and likely change with future climate warming. Built upon a previous study, this study uses a modified method to identify which of 620 cisco lakes in Minnesota can still support cisco populations under future climate and therefore be classified as cisco refuge lakes. The previous study used oxythermal stress parameter TDO3, the temperature at DO of 3 mg/L, simulated only from deep virtual lakes to classify 620 cisco lakes. Using four categories of virtual but representative cisco lakes in modified method, a one-dimensional water quality model MINLAKE2012 was used to simulate daily T and DO profiles in 82 virtual lakes under the past (1961–2008 and two future climate scenarios. A multiyear average of 31-day largest TDO3 over variable benchmark (VB periods, AvgATDO3VB, was calculated from simulated T and DO profiles using FishHabitat2013. Contour plots of AvgATDO3VB for four categories of virtual lakes were then developed to reclassify 620 cisco lakes into Tier 1 (AvgATDO3VB < 11 °C or Tier 2 refuge lakes, and Tier 3 non-refuge lakes (AvgATDO3VB > 17 °C. About 20% of 620 cisco lakes are projected to be refuge lakes under future climate scenarios, which is a more accurate projection (improving the prediction accuracy by ~6.5% from the previous study since AvgATDO3VB was found to vary by lake categories.
Xiao, M.
2016-12-01
Under the background of climate change, extensive attentions have been paid on the increased extreme precipitation from the public and government. To analyze the influences of large-scale climate indices on the precipitation extremes, the spatiotemporal patterns of precipitation extremes in the Poyang Lake basin have been investigated using the Bayesian hierarchical method. The seasonal maximum one-day precipitation amount (Rx1day) was used to represent the seasonal precipitation extremes. Results indicated that spring Rx1day was affected by El Niño/Southern Oscillation (ENSO) and North Atlantic Oscillation (NAO), a positive ENSO event in the same year tends to decrease the spring Rx1day in the northern part of Poyang Lake Basin while increase the spring Rx1day in southeastern Poyang Lake Basin, a positive NAO events in the same year tends to increase the spring Rx1day in the southwest and northwest part of Poyang Lake basin while decrease the spring Rx1day in the eastern part of Poyang Lake basin; summer Rx1day was affected by Indian Ocean Dipole (IOD), positive IOD events in the same year tend to increase the summer Rx1day of northern Poyang Lake basin while decrease summer Rx1day of southern Poyang Lake basin; autumn Rx1day was affected by ENSO, positive ENSO events in the same year tend to mainly increase the autumn Rx1day in the west part of Poyang Lake basin; winter Rx1day was mainly affected by the NAO, positive NAO events in the same year tend to mainly increase the winter Rx1day of southern Poyang Lake basin, while positive NAO events in the previous year tend to mainly increase the winter Rx1day in the central and northeast part of Poyang Lake basin. It is considered that the region with the negative vertical velocity is dominated by more precipitation and vice versa. Furthermore, field patterns of 500 hPa vertical velocity anomalies related to each climate index have further corroborated the influences of climate indices on the seasonal Rx1day, and
Watershed vs. within-lake drivers of nitrogen: phosphorus dynamics in shallow lakes.
Ginger, Luke J; Zimmer, Kyle D; Herwig, Brian R; Hanson, Mark A; Hobbs, William O; Small, Gaston E; Cotner, James B
2017-10-01
Research on lake eutrophication often identifies variables affecting amounts of phosphorus (P) and nitrogen (N) in lakes, but understanding factors influencing N:P ratios is important given its influence on species composition and toxin production by cyanobacteria. We sampled 80 shallow lakes in Minnesota (USA) for three years to assess effects of watershed size, proportion of watershed as both row crop and natural area, fish biomass, and lake alternative state (turbid vs. clear) on total N : total P (TN : TP), ammonium, total dissolved phosphorus (TDP), and seston stoichiometry. We also examined N:P stoichiometry in 20 additional lakes that shifted states during the study. Last, we assessed the importance of denitrification by measuring denitrification rates in sediment cores from a subset of 34 lakes, and by measuring seston δ 15 N in four additional experimental lakes before and after they were experimentally manipulated from turbid to clear states. Results showed alternative state had the largest influence on overall N:P stoichiometry in these systems, as it had the strongest relationship with TN : TP, seston C:N:P, ammonium, and TDP. Turbid lakes had higher N at given levels of P than clear lakes, with TN and ammonium 2-fold and 1.4-fold higher in turbid lakes, respectively. In lakes that shifted states, TN was 3-fold higher in turbid lakes, while TP was only 2-fold higher, supporting the notion N is more responsive to state shifts than is P. Seston δ 15 N increased after lakes shifted to clear states, suggesting higher denitrification rates may be important for reducing N levels in clear states, and potential denitrification rates in sediment cores were among the highest recorded in the literature. Overall, our results indicate lake state was a primary driver of N:P dynamics in shallow lakes, and lakes in clear states had much lower N at a given level of P relative to turbid lakes, likely due to higher denitrification rates. Shallow lakes are often
Changes in Rongbuk lake and Imja lake in the Everest region of Himalaya
Chen, W.; Doko, T.; Liu, C.; Ichinose, T.; Fukui, H.; Feng, Q.; Gou, P.
2014-12-01
The Himalaya holds the world record in terms of range and elevation. It is one of the most extensively glacierized regions in the world except the Polar Regions. The Himalaya is a region sensitive to climate change. Changes in the glacial regime are indicators of global climate changes. Since the second half of the last century, most Himalayan glaciers have melted due to climate change. These changes directly affected the changes of glacial lakes in the Himalayan region due to the glacier retreat. New glacial lakes are formed, and a number of them have expanded in the Everest region of the Himalayas. This paper focuses on the two glacial lakes which are Imja Lake, located at the southern slope, and Rongbuk Lake, located at the northern slope in the Mt. Everest region, Himalaya to present the spatio-temporal changes from 1976 to 2008. Topographical conditions between two lakes were different (Kruskal-Wallis test, p < 0.05). Rongbuk Lake was located at 623 m higher than Imja Lake, and radiation of Rongbuk Lake was higher than the Imja Lake. Although size of Imja Lake was larger than the Rongbuk Lake in 2008, the growth speed of Rongbuk Lake was accelerating since 2000 and exceeds Imja Lake in 2000-2008. This trend of expansion of Rongbuk Lake is anticipated to be continued in the 21st century. Rongbuk Lake would be the biggest potential risk of glacial lake outburst flood (GLOF) at the Everest region of Himalaya in the future.
Lake-wide distribution of Dreissena in Lake Michigan, 1999
Fleischer, Guy W.; DeSorcie, Timothy J.; Holuszko, Jeffrey D.
2001-01-01
The Great Lakes Science Center has conducted lake-wide bottom trawl surveys of the fish community in Lake Michigan each fall since 1973. These systematic surveys are performed at depths of 9 to 110 m at each of seven index sites around Lake Michigan. Zebra mussel (Dreissena polymorpha) populations have expanded to all survey locations and at a level to sufficiently contribute to the bottom trawl catches. The quagga (Dreissena bugensis), recently reported in Lake Michigan, was likely in the catches though not recognized. Dreissena spp. biomass ranged from about 0.6 to 15 kg/ha at the various sites in 1999. Dreissenid mussels were found at depths of 9 to 82 m, with their peak biomass at 27 to 46 m. The colonization of these exotic mussels has ecological implications as well as potential ramifications on the ability to sample fish consistently and effectively with bottom trawls in Lake Michigan.
Large Lakes Dominate CO2 Evasion From Lakes in an Arctic Catchment
Rocher-Ros, Gerard; Giesler, Reiner; Lundin, Erik; Salimi, Shokoufeh; Jonsson, Anders; Karlsson, Jan
2017-12-01
CO2 evasion from freshwater lakes is an important component of the carbon cycle. However, the relative contribution from different lake sizes may vary, since several parameters underlying CO2 flux are size dependent. Here we estimated the annual lake CO2 evasion from a catchment in northern Sweden encompassing about 30,000 differently sized lakes. We show that areal CO2 fluxes decreased rapidly with lake size, but this was counteracted by the greater overall coverage of larger lakes. As a result, total efflux increased with lake size and the single largest lake in the catchment dominated the CO2 evasion (53% of all CO2 evaded). By contrast, the contribution from the smallest ponds (about 27,000) was minor (evasion at the landscape scale.
Lake Michigan lake trout PCB model forecast post audit
Scenario forecasts for total PCBs in Lake Michigan (LM) lake trout were conducted using the linked LM2-Toxics and LM Food Chain models, supported by a suite of additional LM models. Efforts were conducted under the Lake Michigan Mass Balance Study and the post audit represents th...
Using Satellite Imagery to Monitor the Major Lakes; Case Study Lake Hamun
Norouzi, H.; Islam, R.; Bah, A.; AghaKouchak, A.
2015-12-01
Proper lakes function can ease the impact of floods and drought especially in arid and semi-arid regions. They are important environmentally and can directly affect human lives. Better understanding of the effect of climate change and human-driven changes on lakes would provide invaluable information for policy-makers and local people. As part of a comprehensive study, we aim to monitor the land-cover/ land-use changes in the world's major lakes using satellite observations. As a case study, Hamun Lake which is a pluvial Lake, also known as shallow Lake, located on the south-east of Iran and adjacent to Afghanistan, and Pakistan borders is investigated. The Lake is the main source of resources (agriculture, fishing and hunting) for the people around it and politically important in the region since it is shared among three different countries. The purpose of the research is to find the Lake's area from 1972 to 2015 and to see if any drought or water resources management has affected the lake. Analyzing satellites imagery from Landsat shows that the area of the Lake changes seasonally and intra-annually. Significant seasonal effects are found in 1975,1977, 1987, 1993, 1996, 1998, 2000, 2009 and 2011, as well as, substantial amount of shallow water is found throughout the years. The precipitation records as well as drought historical records are studied for the lake's basin. Meteorological studies suggest that the drought, decrease of rainfalls in the province and the improper management of the Lake have caused environmental, economic and geographical consequences. The results reveal that lake has experienced at least two prolong dryings since 1972 which drought cannot solely be blamed as main forcing factor.Proper lakes function can ease the impact of floods and drought especially in arid and semi-arid regions. They are important environmentally and can directly affect human lives. Better understanding of the effect of climate change and human-driven changes on lakes
Dallat, Clare
2009-01-01
This paper examines the risk communication strategies currently being employed by seven outdoor education co-ordinators in Government schools in Victoria, Australia. Of particular interest are the beliefs and assumptions held by these co-ordinators in relation to communicating risk with parents. Current policy stipulates that parents must be…
Adverse events in surgical inpatients: A comparative analysis of public hospitals in Victoria
Katharina Hauck; Xueyan Zhao; Terri Jackson
2010-01-01
We compare adverse event rates for surgical inpatients across 36 public hospitals in the state of Victoria, Australia, conditioning on differences in patient complexity across hospitals. We estimate separate models for elective and emergency patients which stay at least one night in hospitals, using fixed effects complementary log-log models to estimate AEs as a function of patient and episode characteristics, and hospital effects. We use 4 years of patient level administrative hospital data ...
McLachlan, Helen L; Forster, Della A; Yelland, Jane; Rayner, Joanne; Lumley, Judith
2008-09-01
to describe the structure and organisation of hospital postnatal care in Victoria, Australia. postal survey sent to all public hospitals in Victoria (n=71) and key-informant interviews with midwives and medical practitioners (n=38). Victoria, Australia. providers of postnatal care in Victorian public hospitals. there is significant diversity across Victoria in the way postnatal units are structured and organised and in the way care is provided. There are differences in numerous practices, including maternal and neonatal observations and the length of time women spend in hospital after giving birth. Although the benefits of continuity of care are recognised by health care providers, continuity is difficult to provide in the postnatal period. Postnatal care is provided in busy, sometimes chaotic environments, with many barriers to providing effective care and few opportunities for women to rest and recover after childbirth. The findings in this study can, in part, be explained by the lack of evidence that has been available to guide early postnatal care. current structures such as standard postnatal documentation (clinical pathways) and fixed length of stay, may inhibit rather than support individualised care for women after childbirth. There is a need to move towards greater flexibility in providing of early postnatal care, including alternative models of service delivery; choice and flexibility in the length of stay after birth; a focus on the individual with far less emphasis on care being structured around organisational requirements; and building an evidence base to guide care.
Speight, K N; Whiteley, P L; Woolford, L; Duignan, P J; Bacci, B; Lathe, S; Boardman, W; Scheelings, T F; Funnell, O; Underwood, G; Stevenson, M A
2017-07-01
To describe outbreaks of sarcoptic mange caused by Sarcoptes scabiei in free-ranging koalas in Victoria (December 2008 to November 2015) and South Australia (October 2011 to September 2014). Koalas affected by mange-like lesions were reported by wildlife carers, veterinary practitioners or State Government personnel to the Faculty of Veterinary and Agricultural Sciences at The University of Melbourne and the School of Animal and Veterinary Sciences at The University of Adelaide. Skin scrapings were taken from live and dead koalas and S. scabiei mites were identified. Tissues from necropsied koalas were examined histologically. Outbreaks of sarcoptic mange were found to occur in koalas from both Victoria (n = 29) and South Australia (n = 29) for the first time. The gross pathological and histopathological changes are described. We present the first reported cases of sarcoptic mange outbreaks in free-ranging koalas. © 2017 Australian Veterinary Association.
International Nuclear Information System (INIS)
Cole, C.; Bonin, H.
2005-01-01
A small, inherently safe nuclear reactor that will provide enough power to maintain the hotel load of the Victoria Class Submarine and extend her operational envelope, has been conceptually designed. The final reactor concept, named the Near Boiling (NB) Reactor, employs TRISO fuel particles in Zirconium cladded fuel rods. The reactor is light water moderated and cooled. The core life is specifically designed to coincide with the refit cycle of the Victoria Class Submarine. The reactor employs a simple and reliable control and shut down system that requires little intervention on the part of the submarine's crew. Also, a kinetic model is developed that demonstrates the inherent safety features of the reactor during several accident scenarios. (author)
Energy Technology Data Exchange (ETDEWEB)
Cole, C.; Bonin, H. [Royal Military College of Canada, Dept. of Chemistry and Chemical Engineering, Kingston, Ontario (Canada)]. E-mail: chris.cole@rmc.ca; bonin-h@rmc.ca
2005-07-01
A small, inherently safe nuclear reactor that will provide enough power to maintain the hotel load of the Victoria Class Submarine and extend her operational envelope, has been conceptually designed. The final reactor concept, named the Near Boiling (NB) Reactor, employs TRISO fuel particles in Zirconium cladded fuel rods. The reactor is light water moderated and cooled. The core life is specifically designed to coincide with the refit cycle of the Victoria Class Submarine. The reactor employs a simple and reliable control and shut down system that requires little intervention on the part of the submarine's crew. Also, a kinetic model is developed that demonstrates the inherent safety features of the reactor during several accident scenarios. (author)
Water Budgets of the Walker River Basin and Walker Lake, California and Nevada
Lopes, Thomas J.; Allander, Kip K.
2009-01-01
of 3.8 ft/yr. The average corrected total evapotranspiration rate for alfalfa is 3.2 ft/yr so about 0.6 ft/yr (15 percent) flushes salts from the soil. The diversion rate in Bridgeport Valley was estimated to be 1.1 ft/yr and precipitation is 1.3 ft/yr. The total applied-water rate of 2.4 ft/yr is used to irrigate pasture grass. The total applied water rate in the East Fork of the Walker River and Mason Valley was estimated to be 4.8 ft/yr in each valley. The higher rate likely is due to appreciable infiltration, riparian evapotranspiration, or both. Assuming a diversion rate of 3.0 ft/yr, stream loss due to infiltration and riparian evapotranspiration is about 3,000 acre-ft/yr along the East Fork of the Walker River and 14,000 acre-ft/yr in Mason Valley. In the lower Walker River basin, overall and groundwater budgets were calculated for Wabuska to Schurz, Nev., and Schurz to Walker Lake. An overall water budget was calculated for the combined reaches. Imbalances in the water budgets range from 1 to 7 percent, which are insignificant statistically, so the water budgets balance. Total inflow to the Wabuska-Walker Lake reach from the river and others sources is 140,000 acre-ft/yr. Stream and subsurface discharge into the northern end of Walker Lake totals 110,000 acre-ft/yr. About 30,000 acre-ft/yr is lost on the Walker River Indian Reservation from agricultural evapotranspiration, evapotranspiration by native and invasive vegetation, domestic pumpage, and subsurface outflow from the basin through Double Spring and the Wabuska lineament. Alfalfa fields in the upper Walker River basin are lush and have an average corrected total evapotranspiration rate of 3.2 ft/yr. Alfalfa fields on the Walker River Indian Reservation are not as lush and have a total corrected evapotranspiration rate of 1.6-2.1 ft/yr, which partly could be due to alkaline soils that were submerged by Pleistocene Lake Lahontan. The total applied-water rate is 7.0 ft/yr, almost twice the
Spatial distribution of seepage at a flow-through lake: Lake Hampen, Western Denmark
DEFF Research Database (Denmark)
Kidmose, Jacob Baarstrøm; Engesgaard, Peter Knudegaard; Nilsson, Bertel
2011-01-01
recharge patiern of the lake and relating these to the geologic history of the lake. Recharge of the surrounding aquifer by lake water occurs off shore in a narrow zone, as measured from lake–groundwater gradients. A 33-m-deep d18O profi le at the recharge side shows a lake d18O plume at depths...... that corroborates the interpretation of lake water recharging off shore and moving down gradient. Inclusion of lake bed heterogeneity in the model improved the comparison of simulated and observed discharge to the lake. The apparent age of the discharging groundwater to the lake was determined by CFCs, resulting...
Sir James Reid and the Death of Queen Victoria: An Early Model for End-of-Life Care.
Abrams, Robert C
2015-12-01
An appraisal of the last ten days of Queen Victoria's life, viewed primarily from the perspective of her personal physician, Sir James Reid, is presented. Sir James' clinical encounters with his patient and the Royal Family are examined to reveal his strategic and medical thinking and gauge his level of success in basic palliative aims. It was found that the lack of effective medical interventions, tensions within the Royal Family, the importance of his post to Sir James' professional career, and the political ramifications unavoidably connected with the illness of a head of state, all presented challenges to Reid's efforts to ease the physical and emotional pain of Queen Victoria's dying. Key features of Sir James' approach included reliance on physician-patient and physician-family relationships, emphasis on emotional support for the patient, and the careful selection of interventions for the family. In the first years of the 20th century, an era when the contemporary concepts of palliative care, hospice, and family dynamics did not exist, Sir James' management of the Queen's final illness suggested an early model for end-of-life care. By the end of Queen Victoria's life, Sir James was seen to have preserved his patient's comfort and dignity, at the same time advancing family and societal acceptance of the death of this matriarchal figure. © The Author 2014. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Chambers, Lynda E.; Loyn, Richard H.
2006-05-01
Seasonal and annual movements of Australian waterbirds are generally more complex than those of their Northern Hemisphere counterparts, and long-term data are needed to understand their relationships with climatic variables. This paper explores a long-term (1973 2002) set of waterbird counts from coastal Victoria and relates them to climatic data at local and continental scales. Three species (Black Swan Cygnus atratus, White-faced Heron Egretta novaehollandiae and Grey Teal Anas gracilis) were chosen for this analysis. Black Swans have large local breeding populations near the study region; White-faced Herons have smaller local breeding populations and Grey Teal breed extensively in ephemeral inland floodplains, such as those in the Murray-Darling Basin. All showed significant relationships with streamflow, regional rainfall and the Southern Oscillation Index (SOI) at appropriate scales and time-lags, with streamflow explaining the most variance. Black Swans showed a strong seasonal cycle in abundance and local climate variables had the greatest influence on the counts. Numbers were positively correlated with streamflow in southern Victoria three to six seasons before each count. Broader-scale climatic patterns were more important for the other two species. Numbers of White-faced Herons were positively correlated with streamflow or rainfall over various parts of Australia seven to nine seasons before each count. Numbers of Grey Teal showed weak seasonal cycles, and were negatively correlated with rainfall in Victoria or the Murray-Darling Basin in the seasons before or during each count, and positively with streamflow in the Murray-Darling Basin 15 18 months before each count.
Lake Victoria water resources management challenges and ...
African Journals Online (AJOL)
... governing management measures capable of meeting the needs of riparian states and ensuring sustainability within the basin is highlighted. Keywords: biodiversity loss; East Africa; eutrophication; heavy metal pollution; international treaties; Nile Basin; shared water resources. African Journal of Aquatic Science 2008, ...
Bak, Tao
2018-01-01
Education in Victoria, Australia not only underwent significant change in the 1970s, but was witness to a widespread educational reform project. Whilst exploration of the more widespread alternatives has been of some interest, the smaller progressive traditions that emerged in some ways "alongside" the broader reforms have rarely been…
Directory of Open Access Journals (Sweden)
Bettina Pacheco
2011-11-01
Full Text Available Resumo: Este artigo realiza uma breve análise de três obras de testemunhos do exílio escritas por mulheres: Victoria Kent, destacada advogada socialista cromprometida com o governo da República Espanhola; Dolores Ibárruri, a mítica Pasionária; e Carmen Parga, republicana exilada na Rússia e México. As três dão sua visão, a sua maneira e através da escrita, sobre o drama vivido oferecendo sua concepção particular do exílio. Antes de entrar nas obras aludidas, examina-se brevemente as duas concepções sobre a dramática experiência do exilado que Cláudio Guillén reconheceu na escrita dos clássicos: Ovídio e Plutarco.Palavras-chave: Literatura comparada; literatura espanhola; Victoria Kent; Dolores Ibárruri; Carmen Parga; literatura latina; Ovídio; Plutarco; exílio.Resumen: Este artículo realiza um somero análisis de três obras testimoniales del exílio escritas por mujeres: Victoria Kent, destacada abogada socialista comprometida com el gobierno de la República Española; Dolores Ibárruri, la mítica Pasionaria; y Carmen Parga, republicana exiliada en Rusía y México. Las tres dan su visión, a su manera y a través de la escritura, sobre el drama vivido ofreciendo su concepción particular del exílio. Antes de entrar en las obras aludidas, se examina brevemente las dos concepiones sobre la dramática experiencia del exilado que Cláudio Guillén há reconocido em la escritura de dos clássicos: Ovídio y Plutarco.Palabras-clave: Literatura comparada; literatura española; Victoria Kent; Dolores Ibárruri; Carmen Parga; literatura latina; Ovídio; Plutarco; exílio.Keywords: Comparative literature; Spanish literature; Victoria Kent; Dolores Ibárruri; Carmen Parga; latin literature; Ovid; Plutarch; exile.
Red Women, White Policy: American Indian Women and Indian Education.
Warner, Linda Sue
This paper discusses American Indian educational policies and implications for educational leadership by Indian women. The paper begins with an overview of federal Indian educational policies from 1802 to the 1970s. As the tribes have moved toward self-determination in recent years, a growing number of American Indian women have assumed leadership…
Sandell, P.
1999-01-01
Parks Victoria and the Department of Natural Resources & Environment (NRE) are collaborating with agencies from the other States and the Commonwealth of Australia in a national program of detailed monitoring and surveillance of the effects of Rabbit Calicivirus Disease (RCD). A component of the
Aquatic macrophyte richness in Danish lakes in relation to alkalinity, transparency, and lake area
DEFF Research Database (Denmark)
Vestergaard, Ole Skafte; Sand-Jensen, Kaj
2000-01-01
We examined the relationship between environmental factors and the richness of submerged macrophytes species in 73 Danish lakes, which are mainly small, shallow, and have mesotrophic to hypertrophic conditions. We found that mean species richness per lake was only 4.5 in acid lakes of low...... alkalinity but 12.3 in lakes of high alkalinity due to a greater occurrence of the species-rich group of elodeids. Mean species richness per lake also increased significantly with increasing Secchi depth. No significant relationship between species richness and lake surface area was observed among the entire...... group of lakes or a subset of eutrophic lakes, as the growth of submerged macrophytes in large lakes may be restricted by wave action in shallow water and light restriction in deep water. In contrast, macrophyte species richness increased with lake surface area in transparent lakes, presumably due...
Directory of Open Access Journals (Sweden)
WIM Thiery
2014-02-01
Full Text Available The African great lakes are of utmost importance for the local economy (fishing, as well as being essential to the survival of the local people. During the past decades, these lakes experienced fast changes in ecosystem structure and functioning, and their future evolution is a major concern. In this study, for the first time a set of one-dimensional lake models are evaluated for Lake Kivu (2.28°S; 28.98°E, East Africa. The unique limnology of this meromictic lake, with the importance of salinity and subsurface springs in a tropical high-altitude climate, presents a worthy challenge to the seven models involved in the Lake Model Intercomparison Project (LakeMIP. Meteorological observations from two automatic weather stations are used to drive the models, whereas a unique dataset, containing over 150 temperature profiles recorded since 2002, is used to assess the model's performance. Simulations are performed over the freshwater layer only (60 m and over the average lake depth (240 m, since salinity increases with depth below 60 m in Lake Kivu and some lake models do not account for the influence of salinity upon lake stratification. All models are able to reproduce the mixing seasonality in Lake Kivu, as well as the magnitude and seasonal cycle of the lake enthalpy change. Differences between the models can be ascribed to variations in the treatment of the radiative forcing and the computation of the turbulent heat fluxes. Fluctuations in wind velocity and solar radiation explain inter-annual variability of observed water column temperatures. The good agreement between the deep simulations and the observed meromictic stratification also shows that a subset of models is able to account for the salinity- and geothermal-induced effects upon deep-water stratification. Finally, based on the strengths and weaknesses discerned in this study, an informed choice of a one-dimensional lake model for a given research purpose becomes possible.
A Review of the Taxation of Property: Local Government Rates in Victoria 1
Johnson, David T.
1993-01-01
The paper reviews the taxation of property in Victoria and in particular the method of raising revenue for local government from rural landowners. A major contradiction between the apparent philosophical basis and its application is identified. A modification to the existing method of calculation is suggested based on the use value of rural land. The advantages and disadvantages of the use value modification are discussed and compared to the system of property taxes presently used. The use me...
The Socio-economics and Alternative Livelihood Options of Fishers ...
African Journals Online (AJOL)
The Socio-economics and Alternative Livelihood Options of Fishers of Lake Victoria, ... PROMOTING ACCESS TO AFRICAN RESEARCH ... Most fishers were males aged 29-38yrs while women were involved in processing and marketing.
Methane emissions from permafrost thaw lakes limited by lake drainage.
van Huissteden, J.; Berrittella, C.; Parmentier, F.J.W.; Mi, Y.; Maximov, T.C.; Dolman, A.J.
2011-01-01
Thaw lakes in permafrost areas are sources of the strong greenhouse gas methane. They develop mostly in sedimentary lowlands with permafrost and a high excess ground ice volume, resulting in large areas covered with lakes and drained thaw-lake basins (DTLBs; refs,). Their expansion is enhanced by
The reduction of the intrapartum still birth rate at the Queen Victoria Memorial Hospital.
Anderson, I; Chang, A; Renou, P; Wood, C
1977-06-18
A significant reduction in intrapartum anoxic fetal deaths has occurred at the Queen Victoria Memorial Hospital over the last ten years. The possible explanations for this include a variety of factors, which may either improve the health of the population presenting to the hospital, or improve obstetric care. Epidemiological evidence suggests that the use of fetal diagnostic techniques has contributed to the reduction of intrapartum anoxic still births.
National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lakes Michigan, Erie, Saint Clair, Ontario and Huron has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and...
Lake and lake-related drainage area parameters for site investigation program
Energy Technology Data Exchange (ETDEWEB)
Blomqvist, P.; Brunberg, A.K. [Uppsala Univ. (Sweden). Dept. of Limnology; Brydsten, L [Umeaa Univ. (Sweden). Dept. of Ecology and Environmental Science
2000-09-01
In this paper, a number of parameters of importance to a preliminary determination of the ecological function of lakes are presented. The choice of parameters have been made with respect to a model for the determination of the nature conservation values of lakes which is currently being developed by the authors of this report, but is also well suited for a general description of the lake type and the functioning of the inherent ecosystem. The parameters have been divided into five groups: (1) The location of the object relative important gradients in the surrounding nature; (2) The lake catchment area and its major constituents; (3) The lake morphometry; (4) The lake ecosystem; (5) Human-induced damages to the lake ecosystem. The first two groups, principally based on the climate, hydrology, geology and vegetation of the catchment area represent parameters that can be used to establish the rarity and representativity of the lake, and will in the context of site investigation program be used as a basis for generalisation of the results. The third group, the lake morphometry parameters, are standard parameters for the outline of sampling programmes and for calculations of the physical extension of different key habitats in the system. The fourth group, the ecosystem of the lake, includes physical, chemical and biological parameters required for determination of the stratification pattern, light climate, influence from the terrestrial ecosystem of the catchment area, trophic status, distribution of key habitats, and presence of fish and rare fauna and flora in the lake. In the context of site investigation program, the parameters in these two groups will be used for budget calculations of the flow of energy and material in the system. The fifth group, finally, describes the degree on anthropogenic influence on the ecosystem and will in the context of site investigation programmes be used to judge eventual malfunctioning within the entire, or parts of, the lake
Lake and lake-related drainage area parameters for site investigation program
International Nuclear Information System (INIS)
Blomqvist, P.; Brunberg, A.K.; Brydsten, L
2000-09-01
In this paper, a number of parameters of importance to a preliminary determination of the ecological function of lakes are presented. The choice of parameters have been made with respect to a model for the determination of the nature conservation values of lakes which is currently being developed by the authors of this report, but is also well suited for a general description of the lake type and the functioning of the inherent ecosystem. The parameters have been divided into five groups: 1) The location of the object relative important gradients in the surrounding nature; 2) The lake catchment area and its major constituents; 3) The lake morphometry; 4) The lake ecosystem; 5) Human-induced damages to the lake ecosystem. The first two groups, principally based on the climate, hydrology, geology and vegetation of the catchment area represent parameters that can be used to establish the rarity and representativity of the lake, and will in the context of site investigation program be used as a basis for generalisation of the results. The third group, the lake morphometry parameters, are standard parameters for the outline of sampling programmes and for calculations of the physical extension of different key habitats in the system. The fourth group, the ecosystem of the lake, includes physical, chemical and biological parameters required for determination of the stratification pattern, light climate, influence from the terrestrial ecosystem of the catchment area, trophic status, distribution of key habitats, and presence of fish and rare fauna and flora in the lake. In the context of site investigation program, the parameters in these two groups will be used for budget calculations of the flow of energy and material in the system. The fifth group, finally, describes the degree on anthropogenic influence on the ecosystem and will in the context of site investigation programmes be used to judge eventual malfunctioning within the entire, or parts of, the lake ecosystem
Habitat Evaluation Procedures (HEP) Report : West Beaver Lake, 2004-2005 Technical Report.
Energy Technology Data Exchange (ETDEWEB)
Entz, Ray
2005-02-01
On September 7, 2004, the Habitat Evaluation Procedure (HEP) was used to determine baseline habitat suitability on the West Beaver Lake property, an acquisition completed by the Kalispel Tribe of Indians in September 2004. Evaluation species and appropriate models include bald eagle, black-capped chickadee, mallard, muskrat, and white-tailed deer. Habitat Suitability Index (HSI) values were visually estimated and agreed upon by all HEP team members. The West Beaver Lake Project provides a total of 103.08 Habitat Units (HUs) for the species evaluated. Emergent wetland habitat provides 7.17 HUs for mallard and muskrat. Conifer forest habitat provides 95.91 HUs for bald eagle, black-capped chickadee, mallard, and white-tailed deer. The objective of using HEP at the West Beaver Lake Project and other protected properties is to document the quality and quantity of available habitat for selected wildlife species. In this way, HEP provides information on the relative value of the same area at future points in time so that the effect of management activities on wildlife habitat can be quantified. When combined with other tools, the baseline HEP will be used to determine the most effective on-site management, restoration, and enhancement actions to increase habitat suitability for targeted species. The same process will be replicated every five years to quantitatively evaluate the effectiveness of management strategies in improving and maintaining habitat conditions while providing additional crediting to BPA for enhanced habitat values.
Health (Radiation Safety) Act 1983 (Victoria) No. 9889 of 17 May 1983
International Nuclear Information System (INIS)
1983-01-01
This Act amends the Health Act 1958 by adding a new Section entitled ''Radiation Safety''. In addition to establishing guidelines for the registration and licensing of certain radiation apparatus and sealed radioactive sources, this new Section authorises the Governor in Council to make regulations concerning, inter alia, transport and disposal of radioactive substances and public health and safety. The Act also sets up a Radiation Advisory Committee and a Radiographers and Radiation Technologists Registration Board of Victoria and amends the Nuclear Activities (Prohibitions) Act 1983 in respect of certain licensing provisions. (NEA) [fr
Birth centre confinement at the Queen Victoria Medical Centre: four years' experience.
Morris, N; Campbell, J; Biro, M A; Lumley, J; Rao, J; Spensley, J
1986-06-09
A review of the first four years of the functioning of the birth centre at the Queen Victoria Medical Centre is presented. In that time, 1040 pregnant women were accepted for confinement there. Of these, 52 withdrew for non-obstetric reasons, while 470 were transferred to alternative obstetrical care--274 because of antepartum complications and 196 because of intrapartum problems. Therefore, 518 women were delivered in the birth centre. The care of the women is entrusted almost entirely to a team of midwives and this review demonstrates an enviable safety record.
Rubidium-strontium ages from the Oxford Lake-Knee Lake greenstone belt, northern Manitoba
International Nuclear Information System (INIS)
Clark, G.S.; Cheung, S.-P.
1980-01-01
Rb-Sr whole-rock ages have been determined for rocks from the Oxford Lake-Knee Lake-Gods Lake geenstone belt in the Superior Province of northeastern Manitoba. The age of the Magill Lake Pluton is 2455 +- 35 Ma(lambda 87 Rb = 1.42 x 10 -11 yr -1 ), with an initial 87 Sr/ 86 Sr ratio of 0.7078 +- 0.0043. This granite stock intrudes the Oxford Lake Group, so it is post-tectonic and probably related to the second, weaker stage of metamorphism. The age of the Bayly Lake Pluton is 2424 +- 74 Ma, with an initial 87 Sr/ 86 Sr ratio of 0.7029 +- 0.0001. This granodioritic batholith complex does not intrude the Oxford Lake Group. It is syn-tectonic and metamorphosed. The age of volcanic rocks of the Hayes River Group, from Goose Lake (30 km south of Gods Lake Narrows), is 2680 +- 125 Ma, with an initial 87 Sr/ 86 Sr ratio of 0.7014 +- 0.0009. The age for the Magill Lake and Bayly Lake Plutons can be interpreted as the minimum ages of granite intrusion in the area. The age for the Hayes River Group volcanic rocks is consistent with Rb-Sr ages of volcanic rocks from other Archean greenstone belts within the northwestern Superior Province. (auth)
Socioeconomic constraints to sustainable cocoyam production in the ...
African Journals Online (AJOL)
AGHOGHO A
Full Length Research Paper ... 4Makerere University, Department of Crop Science, P. O. Box 7062, ... Cocoyam production, social and economic constraints, Lake Victoria region. .... available throughout the year and is also a stable source.
Chilcoat, George W.
1990-01-01
Offers an innovative way to teach mid-nineteenth century North American Indian history by having students create their own Indian Ledger art. Purposes of the project are: to understand the role played by American Indians, to reveal American Indian stereotypes, and to identify relationships between cultures and environments. Background and…
Turning attention to clinician engagement in Victoria.
Jorm, Christine; Hudson, Robyn; Wallace, Euan
2017-11-16
The engagement of clinicians with employing organisations and with the broader health system results in better safer care for patients. Concerns about the adequacy of clinician engagement in the state of Victoria led the Victorian Department of Health and Human Services to commission a scoping study. During this investigation more than 100 clinicians were spoken with and 1800 responded to surveys. The result was creation of a clear picture of what engagement and disengagement looked like at all levels - from the clinical microsystem to state health policy making. Multiple interventions are possible to enhance clinician engagement and thus the care of future patients. A framework was developed to guide future Victorian work with four elements: setting the agenda, informing, involving and empowering clinicians. Concepts of work or employee engagement that are used in other industries don't directly translate to healthcare and thus the definition of engagement chosen for use centred on involvement. This was designed to encourage system managers to ensure clinicians are full participants in design, planning and evaluation and in all decisions that affect them and their patients.
A Dynamical Downscaling study over the Great Lakes Region Using WRF-Lake: Historical Simulation
Xiao, C.; Lofgren, B. M.
2014-12-01
As the largest group of fresh water bodies on Earth, the Laurentian Great Lakes have significant influence on local and regional weather and climate through their unique physical features compared with the surrounding land. Due to the limited spatial resolution and computational efficiency of general circulation models (GCMs), the Great Lakes are geometrically ignored or idealized into several grid cells in GCMs. Thus, the nested regional climate modeling (RCM) technique, known as dynamical downscaling, serves as a feasible solution to fill the gap. The latest Weather Research and Forecasting model (WRF) is employed to dynamically downscale the historical simulation produced by the Geophysical Fluid Dynamics Laboratory-Coupled Model (GFDL-CM3) from 1970-2005. An updated lake scheme originated from the Community Land Model is implemented in the latest WRF version 3.6. It is a one-dimensional mass and energy balance scheme with 20-25 model layers, including up to 5 snow layers on the lake ice, 10 water layers, and 10 soil layers on the lake bottom. The lake scheme is used with actual lake points and lake depth. The preliminary results show that WRF-Lake model, with a fine horizontal resolution and realistic lake representation, provides significantly improved hydroclimates, in terms of lake surface temperature, annual cycle of precipitation, ice content, and lake-effect snowfall. Those improvements suggest that better resolution of the lakes and the mesoscale process of lake-atmosphere interaction are crucial to understanding the climate and climate change in the Great Lakes region.
Zhou, Yong-Qiang; Zhang, Yun-Lin; Niu, Cheng; Wang, Ming-Zhu
2013-12-01
Little is known about DOM characteristics in medium to large sized lakes located in the middle and lower reaches of Yangtze River, like Lake Honghu, Lake Donghu and Lake Liangzihu. Absorption, fluorescence and composition characteristics of chromophoric dissolved organic matter (CDOM) are presented using the absorption spectroscopy, the excitation-emission ma trices (EEMs) fluorescence and parallel factor analysis (PARAFAC) model based on the data collected in Sep-Oct. 2007 including 15, 9 and 10 samplings in Lake Honghu, Lake Donghu and Lake Liangzihu, respectively. CDOM absorption coefficient at 350 nm a(350) coefficient in Lake Honghu was significantly higher than those in Lake Donghu and Lake Liangzihu (t-test, pCDOM spectral slope in the wavelength range of 280-500 nm (S280-500) and a(350) (R2 =0. 781, p<0. 001). The mean value of S280-500 in Lake Honghu was significantly lower than those in Lake Donghu (t-test, p
Deglaciation, lake levels, and meltwater discharge in the Lake Michigan basin
Colman, Steven M.; Clark, J.A.; Clayton, L.; Hansel, A.K.; Larsen, C.E.
1994-01-01
The deglacial history of the Lake Michigan basin, including discharge and routing of meltwater, is complex because of the interaction among (1) glacial retreats and re-advances in the basin (2) the timing of occupation and the isostatic adjustment of lake outlets and (3) the depositional and erosional processes that left evidence of past lake levels. In the southern part of the basin, a restricted area little affected by differential isostasy, new studies of onshore and offshore areas allow refinement of a lake-level history that has evolved over 100 years. Important new data include the recognition of two periods of influx of meltwater from Lake Agassiz into the basin and details of the highstands gleaned from sedimentological evidence. Major disagreements still persist concerning the exact timing and lake-level changes associated with the Algonquin phase, approximately 11,000 BP. A wide variety of independent data suggests that the Lake Michigan Lobe was thin, unstable, and subject to rapid advances and retreats. Consequently, lake-level changes were commonly abrupt and stable shorelines were short-lived. The long-held beliefs that the southern part of the basin was stable and separated from deformed northern areas by a hinge-line discontinuity are becoming difficult to maintain. Numerical modeling of the ice-earth system and empirical modeling of shoreline deformation are both consistent with observed shoreline tilting in the north and with the amount and pattern of modern deformation shown by lake-level gauges. New studies of subaerial lacustrine features suggest the presence of deformed shorelines higher than those originally ascribed to the supposed horizontal Glenwood level. Finally, the Lake Michigan region as a whole appears to behave in a similar manner to other areas, both local (other Great Lakes) and regional (U.S. east coast), that have experienced major isostatic changes. Detailed sedimentological and dating studies of field sites and additional
Edsall, Thomas A.; Mac, Michael J.; Opler, Paul A.; Puckett Haecker, Catherine E.; Doran, Peter D.
1998-01-01
The Great Lakes region, as defined here, includes the Great Lakes and their drainage basins in Minnesota, Wisconsin, Illinois, Indiana, Ohio, Pennsylvania, and New York. The region also includes the portions of Minnesota, Wisconsin, and the 21 northernmost counties of Illinois that lie in the Mississippi River drainage basin, outside the floodplain of the river. The region spans about 9º of latitude and 20º of longitude and lies roughly halfway between the equator and the North Pole in a lowland corridor that extends from the Gulf of Mexico to the Arctic Ocean.The Great Lakes are the most prominent natural feature of the region (Fig. 1). They have a combined surface area of about 245,000 square kilometers and are among the largest, deepest lakes in the world. They are the largest single aggregation of fresh water on the planet (excluding the polar ice caps) and are the only glacial feature on Earth visible from the surface of the moon (The Nature Conservancy 1994a).The Great Lakes moderate the region’s climate, which presently ranges from subarctic in the north to humid continental warm in the south (Fig. 2), reflecting the movement of major weather masses from the north and south (U.S. Department of the Interior 1970; Eichenlaub 1979). The lakes act as heat sinks in summer and heat sources in winter and are major reservoirs that help humidify much of the region. They also create local precipitation belts in areas where air masses are pushed across the lakes by prevailing winds, pick up moisture from the lake surface, and then drop that moisture over land on the other side of the lake. The mean annual frost-free period—a general measure of the growing-season length for plants and some cold-blooded animals—varies from 60 days at higher elevations in the north to 160 days in lakeshore areas in the south. The climate influences the general distribution of wild plants and animals in the region and also influences the activities and distribution of the human
Lakes, Lagerstaetten, and Evolution
Kordesch, E. G.; Park, L. E.
2001-12-01
The diversity of terrestrial systems is estimated to be greater than in the marine realm. However no hard data yet exists to substantiate this claim. Ancient lacustrine deposits may preserve an exceptionally diverse fossil fauna and aid in determining continental faunal diversities. Fossils preserved in lake deposits, especially those with exceptional preservation (i.e. Konservat Lagerstaetten), may represent a dependable method for determining species diversity changes in the terrestrial environment because of their faunal completeness. Important Konservat Lagerstaetten, such as the Green River Formation (US) and Messel (Germany), both Eocene in age, are found in lake sediments and show a remarkable faunal diversity for both vertebrates and invertebrates. To date information from nearly 25 lake lagerstaetten derived from different types of lake basins from the Carboniferous to the Miocene have been collected and described. Carboniferous sites derive from the cyclothems of Midcontinent of the US while many Cenozoic sites have been described from North and South America as well as Europe and Australia. Asian sites contain fossils from the Mesozoic and Cenozoic. With this data, insight into the evolutionary processes associated with lake systems can be examined. Do lakes act as unique evolutionary crucibles in contrast to marine systems? The speciation of cichlid fishes in present-day African lakes appears to be very high and is attributed to the diversity of environments found in large rift lakes. Is this true of all ancient lakes or just large rift lakes? The longevity of a lake system may be an important factor in allowing speciation and evolutionary processes to occur; marine systems are limited only in the existence of environments as controlled by tectonics and sea level changes, on the order of tens of millions of years. Rift lakes are normally the longest lived in the millions of years. Perhaps there are only certain types of lakes in which speciation of
The Meaning of ‘General Paralysis of the Insane’ in Victoria, Australia; 1886 to 1906
Directory of Open Access Journals (Sweden)
Roberts, Phillip
2014-06-01
Full Text Available This paper presents a conclusion to the meaning of the historical diagnosis “general paralysis of the insane” in nineteenth century Victorian Registrar General”s reports. Most studies suggest that in the past the diagnosis refers to neuro-syphilis, and while after 1906 this is not disputed, this paper will show that the diagnosis had a much broader meaning incorporating many forms of degenerative brain disease during the study period (Victoria 1886 to 1906. It is acknowledged, however, that the use of this diagnosis may have varied dramatically in the past based on a doctor’s education and/or background. This conclusion has been arrived at by analysing both government and general hospital records on the Australian, Victorian population. This paper also presents methods for determining the meaning of obsolete medical diagnoses where the definition is poorly understood.En este trabajo presenta una conclusión sobre el significado de la “parálisis general de los locos” como diagnóstico en los informes del Victorian Registrar General durante el siglo XIX. La mayoría de los estudios sugieren que en el pasado el diagnóstico se refiere a la neuro-sífilis, y aunque después de 1906 no se discute, este trabajo mostrará que el diagnóstico tiene un significado mucho más amplio e incorpora muchas formas de enfermedad degenerativa del cerebro durante el período de estudio (Victoria 1886 a 1906. Se reconoce, sin embargo, que el uso de este diagnóstico puede haber variado drásticamente en el pasado dependiendo de la formación y del ambiente médico. Se ha llegado a esta conclusión mediante el análisis de los registros hospitalarios de la población de Victoria, Australia. Este documento también presenta métodos para determinar el significado de los diagnósticos médicos obsoletos cuya definición es confusa.
Habitat Evaluation Procedures (HEP) Report; Gamblin Lake, Technical Report 2005.
Energy Technology Data Exchange (ETDEWEB)
Entz, Ray
2005-05-01
On August 12, 2003, the Habitat Evaluation Procedure (HEP) was used to determine baseline habitat suitability on the Gamblin Lake property, an acquisition completed by the Kalispel Tribe of Indians in December 2002. Evaluation species and appropriate models include bald eagle, black-capped chickadee, mallard, muskrat, and white-tailed deer. Habitat Suitability Index (HSI) values were visually estimated and agreed upon by all HEP team members. The Gamblin Lake Project provides a total of 273.28 Habitat Units (HUs) for the species evaluated. Conifer forest habitat provides 127.92 HUs for bald eagle, black-capped chickadee, mallard, and white-tailed deer. Forested wetland habitat provides 21.06 HUs for bald eagle, black-caped chickadee, mallard, and white-tailed deer. Wet meadow provides 78.05 HUs for Canada goose and mallard. Emergent wetland habitat provides 46.25 HUs for mallard, muskrat, and Canada goose. The objective of using HEP at the Gamblin Lake Project and other protected properties is to document the quality and quantity of available habitat for selected wildlife species. In this way, HEP provides information on the relative value of the same area at future points in time so that the effect of management activities on wildlife habitat can be quantified. When combined with other tools, the baseline HEP will be used to determine the most effective on-site management, restoration, and enhancement actions to increase habitat suitability for targeted species. The same process will be replicated every five years to quantitatively evaluate the effectiveness of management strategies in improving and maintaining habitat conditions while providing additional crediting to BPA for enhanced habitat values.
Schrader, David L.; Holmes, Robert R.
2000-01-01
The Fox Chain of Lakes is a glacial lake system in McHenry and Lake Counties in northern Illinois and southern Wisconsin. Sedimentation and nutrient overloading have occurred in the lake system since the first dam was built (1907) in McHenry to raise water levels in the lake system. Using data collected from December 1, 1997, to June 1, 1999, suspended-sediment budgets were constructed for the most upstream lake in the system, Grass Lake, and for the lakes downstream from Grass Lake. A total of 64,900 tons of suspended sediment entered Grass Lake during the study, whereas a total of 70,600 tons of suspended sediment exited the lake, indicating a net scour of 5,700 tons of sediment. A total of 44,100 tons of suspended sediment was measured exiting the Fox Chain of Lakes at Johnsburg, whereas 85,600 tons entered the system downstream from Grass Lake. These suspended-sediment loads indicate a net deposition of 41,500 tons downstream from Grass Lake, which represents a trapping efficiency of 48.5 percent. A large amount of recreational boating takes place on the Fox Chain of Lakes during summer months, and suspended-sediment load was observed to rise from 110 tons per day to 339 tons per day during the 1999 Memorial Day weekend (May 26 ?31, 1999). Presumably, this rise was the result of the boating traffic because no other hydrologic event is known to have occurred that might have caused the rise. This study covers a relatively short period and may not represent the long-term processes of the Fox Chain of Lakes system, although the sediment transport was probably higher than an average year. The bed sediments found on the bottom of the lakes are composed of mainly fine particles in the silt-clay range. The Grass Lake sediments were characterized as black peat with an organic content of between 9 and 18 percent, and the median particle size ranged from 0.000811 to 0.0013976 inches. Other bed material samples were collected at streamflow-gaging stations on the
Myxomatosis in the Mallee region of Victoria, Australia.
Shepherd, R C; Edmonds, J W; Nolan, I F; Gocs, A
1978-10-01
Sharp reductions in the wild rabbit (Oryctolagus cuniculus (L.)) population in the Mallee are associated with annual myxomatosis epizootics. The extent to which the population reductions are the direct result of the epizootics varies with time of epizootic occurrence. All grazing animals in the Mallee are under nutritional stress each summer and autumn. When the epizootic occurs during the early summer heavy losses occur in a previously healthy population. Similar losses which occur in the late summer and autumn are the result of a nutritional stress - epizootic complex. The end result in each case is a population reduction of about 80%. This reduction occurs in a population which is the most resistant to myxomatosis known in Victoria and in association with epizootics caused by field strains of myxoma virus of moderate virulence only. The earlier summer epizootics are of considerable economic importance because they sharply reduce the pressure on the limited food available for other grazing animals.
33 CFR 162.220 - Hoover Dam, Lake Mead, and Lake Mohave (Colorado River), Ariz.-Nev.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hoover Dam, Lake Mead, and Lake... REGULATIONS § 162.220 Hoover Dam, Lake Mead, and Lake Mohave (Colorado River), Ariz.-Nev. (a) Lake Mead and... the axis of Hoover Dam and that portion of Lake Mohave (Colorado River) extending 4,500 feet...
First evidence of successful natural reproduction by planted lake trout in Lake Huron
Nester, Robert T.; Poe, Thomas P.
1984-01-01
Twenty-two lake trout (Salvelinus namaycush) swim-up fry, 24-27 mm long, were captured with emergent fry traps and a tow net in northwestern Lake Huron on a small nearshore reef off Alpena, Michigan, between May 10 and June 1, 1982. These catches represent the first evidence of successful production of swim-up fry by planted, hatchery-reared lake trout in Lake Huron since the lake trout rehabilitation program began in 1973.
Seebach, Anne; Dietz, Severine; Lessmann, Dieter; Knoeller, Kay
2008-03-01
A method is presented to assess lake water-groundwater interactions by modelling isotope signatures of lake water using meteorological parameters and field data. The modelling of delta(18)O and deltaD variations offers information about the groundwater influx into a meromictic Lusatian mining lake. Therefore, a water balance model is combined with an isotope water balance model to estimate analogies between simulated and measured isotope signatures within the lake water body. The model is operated with different evaporation rates to predict delta(18)O and deltaD values in a lake that is only controlled by weather conditions with neither groundwater inflow nor outflow. Comparisons between modelled and measured isotope values show whether the lake is fed by the groundwater or not. Furthermore, our investigations show that an adaptation of the Craig and Gordon model [H. Craig, L.I. Gordon. Deuterium and oxygen-18 variations in the ocean and the marine atmosphere. In Stable Isotopes in Oceanographic Studies and Paleotemperature, Spoleto, E. Tongiorgi (Ed.), pp. 9-130, Consiglio Nazionale delle Ricerche, Laboratorio di Geologia Nucleare, Pisa (1965).] to specific conditions in temperate regions seems necessary.
Lake Sturgeon, Acipenser fulvescens, movements in Rainy Lake, Minnesota and Ontario
Adams, W.E.; Kallemeyn, L.W.; Willis, D.W.
2006-01-01
Rainy Lake, Minnesota-Ontario, contains a native population of Lake Sturgeon (Acipenser fulvescens) that has gone largely unstudied. The objective of this descriptive study was to summarize generalized Lake Sturgeon movement patterns through the use of biotelemetry. Telemetry data reinforced the high utilization of the Squirrel Falls geographic location by Lake Sturgeon, with 37% of the re-locations occurring in that area. Other spring aggregations occurred in areas associated with Kettle Falls, the Pipestone River, and the Rat River, which could indicate spawning activity. Movement of Lake Sturgeon between the Seine River and the South Arm of Rainy Lake indicates the likelihood of one integrated population on the east end of the South Arm. The lack of re-locations in the Seine River during the months of September and October may have been due to Lake Sturgeon moving into deeper water areas of the Seine River and out of the range of radio telemetry gear or simply moving back into the South Arm. Due to the movements between Minnesota and Ontario, coordination of management efforts among provincial, state, and federal agencies will be important.
African Journals Online (AJOL)
EJIRO
source pollutants in Lake Victoria: A case study of. Gaba Landing ... 2004) have documented pollution as one of the major problems .... loaded with ions that conduct an electric current. .... sediments by Energy Dispersive X-Ray Fluorescence.
Indianization of psychiatry utilizing Indian mental concepts
Avasthi, Ajit; Kate, Natasha; Grover, Sandeep
2013-01-01
Most of the psychiatry practice in India is guided by the western concepts of mental health and illness, which have largely ignored the role of religion, family, eastern philosophy, and medicine in understanding and managing the psychiatric disorders. India comprises of diverse cultures, languages, ethnicities, and religious affiliations. However, besides these diversities, there are certain commonalities, which include Hinduism as a religion which is spread across the country, the traditional family system, ancient Indian system of medicine and emphasis on use of traditional methods like Yoga and Meditation for controlling mind. This article discusses as to how mind and mental health are understood from the point of view of Hinduism, Indian traditions and Indian systems of medicine. Further, the article focuses on as to how these Indian concepts can be incorporated in the practice of contemporary psychiatry. PMID:23858244
Layden, Aisling; MacCallum, Stuart N.; Merchant, Christopher J.
2016-06-01
A tuning method for FLake, a one-dimensional (1-D) freshwater lake model, is applied for the individual tuning of 244 globally distributed large lakes using observed lake surface water temperatures (LSWTs) derived from along-track scanning radiometers (ATSRs). The model, which was tuned using only three lake properties (lake depth, snow and ice albedo and light extinction coefficient), substantially improves the measured mean differences in various features of the LSWT annual cycle, including the LSWTs of saline and high altitude lakes, when compared to the observed LSWTs. Lakes whose lake-mean LSWT persists below 1 °C for part of the annual cycle are considered to be seasonally ice-covered. For trial seasonally ice-covered lakes (21 lakes), the daily mean and standard deviation (2σ) of absolute differences between the modelled and observed LSWTs are reduced from 3.07 °C ± 2.25 °C to 0.84 °C ± 0.51 °C by tuning the model. For all other trial lakes (14 non-ice-covered lakes), the improvement is from 3.55 °C ± 3.20 °C to 0.96 °C ± 0.63 °C. The post tuning results for the 35 trial lakes (21 seasonally ice-covered lakes and 14 non-ice-covered lakes) are highly representative of the post-tuning results of the 244 lakes. For the 21 seasonally ice-covered lakes, the modelled response of the summer LSWTs to changes in snow and ice albedo is found to be statistically related to lake depth and latitude, which together explain 0.50 (R2adj, p = 0.001) of the inter-lake variance in summer LSWTs. Lake depth alone explains 0.35 (p = 0.003) of the variance. Lake characteristic information (snow and ice albedo and light extinction coefficient) is not available for many lakes. The approach taken to tune the model, bypasses the need to acquire detailed lake characteristic values. Furthermore, the tuned values for lake depth, snow and ice albedo and light extinction coefficient for the 244 lakes provide some guidance on improving FLake LSWT modelling.
Cardboard Boxes and Invisible Fences: Homelessness and Public Space in City of Victoria v. Adams
Directory of Open Access Journals (Sweden)
Sarah Buhler
2009-02-01
Full Text Available This paper analyzes the recent decision of the British Columbia Supreme Court in City of Victoria v. Adams. Specifically, the paper considers three interlocking themes that emerge from the decision: (1 the nature of “public space” in the context of homelessness; (2 the autonomy of homeless individuals; and (3 the meaning and value of the “homeless body.” With reference to each theme, the paper explores how the judgment in Adams grapples with the purportedly normative “Law and Economics”- type arguments put forth by the City of Victoria. By drawing on insights from Critical Legal Studies theory and feminist jurisprudence, the paper shows that Adams subverts and destabilizes certain “normative” perspectives about public space and homelessness. However, the paper goes on to argue that in its conflation of “cardboard box” shelters with the “invisible fences” envisioned by Justice Wilson in Morgentaler, Adams presents an ambiguous victory for anti-poverty advocates. The paper argues that the decision may serve to increase barriers for a broader and more progressive understanding of section 7 in the future. Dans cet article, on analyse le jugement récent de la Cour Suprême de la Colombie Britannique dans City of Victoria v. Adams. Plus précisément, on considère trois thèmes qui ressortent du jugement et qui s’entrecroisent : (1 la nature d’«espace public» dans le contexte de l’itinérance; (2 l’autonomie des sans-abri; et (3 la signification et la valeur du «corps sans abri». En rapport avec chaque thème, on explore comment l’arrêt Adams compose avec les arguments supposément normatifs du genre «La Loi et l’Économie» avancés par la ville de Victoria. En s’inspirant de perceptions tirées de la théorie des Critical Legal Studies et de la jurisprudence féministe, l’auteure démontre que l’arrêt Adams subvertit et déséquilibre certaines perspectives «normatives» au sujet de l
2010-08-25
... member Indian tribes (Bad River Band of the Lake Superior Tribe of Chippewa Indians of the Bad River... Alliance and the Wisconsin Inter-tribal Repatriation Committee indicated that the Bad River Band of the Lake Superior Tribe of Chippewa Indians of the Bad River Reservation, Wisconsin, and Red Cliff Band of...
Geochemical monitoring of volcanic lakes. A generalized box model for active crater lakes
Directory of Open Access Journals (Sweden)
Franco Tassi
2011-06-01
Full Text Available
In the past, variations in the chemical contents (SO42−, Cl−, cations of crater lake water have not systematically demonstrated any relationships with eruptive activity. Intensive parameters (i.e., concentrations, temperature, pH, salinity should be converted into extensive parameters (i.e., fluxes, changes with time of mass and solutes, taking into account all the internal and external chemical–physical factors that affect the crater lake system. This study presents a generalized box model approach that can be useful for geochemical monitoring of active crater lakes, as highly dynamic natural systems. The mass budget of a lake is based on observations of physical variations over a certain period of time: lake volume (level, surface area, lake water temperature, meteorological precipitation, air humidity, wind velocity, input of spring water, and overflow of the lake. This first approach leads to quantification of the input and output fluxes that contribute to the actual crater lake volume. Estimating the input flux of the "volcanic" fluid (Qf- kg/s –– an unmeasurable subsurface parameter –– and tracing its variations with time is the major focus during crater lake monitoring. Through expanding the mass budget into an isotope and chemical budget of the lake, the box model helps to qualitatively characterize the fluids involved. The (calculated Cl− content and dD ratio of the rising "volcanic" fluid defines its origin. With reference to continuous monitoring of crater lakes, the present study provides tips that allow better calculation of Qf in the future. At present, this study offers the most comprehensive and up-to-date literature review on active crater lakes.
The State Electricity Commission of Victoria and the greenhouse effect
International Nuclear Information System (INIS)
Hoy, R.D.
1990-01-01
The State Electricity Commission of Victoria is examining how the greenhouse issue may affect its electricity supply system in the future. Possible generation scenarios for 2005 are presented in order to show how the Toronto goal of a 20% reduction on 1988 levels of CO 2 emissions could be achieved. The main approaches to achieving these emission reductions include energy conservation and cogeneration, new gas-fired plant, use of renewable energy, reduction of energy system losses, retirement of older brown coal plant and an extensive tree planting program. It is estimated that achieving the Toronto goal would require electricity prices to rise by 1% to 1.5%, on average, each year by more than they otherwise would have, for the next 15 years. 12 refs., 3 tabs
Water-quality and lake-stage data for Wisconsin lakes, water year 2014
Manteufel, S. Bridgett; Robertson, Dale M.
2017-05-25
IntroductionThe U.S. Geological Survey (USGS), in cooperation with local and other agencies, collects data at selected lakes throughout Wisconsin. These data, accumulated over many years, provide a database for developing an improved understanding of the water quality of lakes. To make these data available to interested parties outside the USGS, the data are published annually in this report series. The locations of water-quality and lake-stage stations in Wisconsin for water year 2014 are shown in figure 1. A water year is the 12-month period from October 1 through September 30. It is designated by the calendar year in which it ends. Thus, the periodOctober 1, 2013, through September 30, 2014, is called “water year 2014.”The purpose of this report is to provide information about the chemical and physical characteristics of Wisconsin lakes. Data that have been collected at specific lakes, and information to aid in the interpretation of those data, are included in this report. Data collected include measurements of in-lake water quality and lake stage. Time series of Secchi depths, surface total phosphorus, and chlorophyll a concentrations collected during nonfrozen periods are included for many lakes. Graphs of vertical profiles of temperature, dissolved oxygen, pH, and specific conductance are included for sites where these parameters were measured. Descriptive information for each lake includes the location of the lake, area of the lake’s watershed, period for which data are available, revisions to previously published records, and pertinent remarks. Additional data, such as streamflow and water quality in tributary and outlet streams of some of the lakes, are published online at http://nwis.waterdata.usgs.gov/wi/nwis.Water-resources data, including stage and discharge data at most streamflow-gaging stations, are available online. The Wisconsin Water Science Center’s home page is at https://www.usgs.gov/centers/wisconsin-water-science-center. Information
Water and waste water management Generation Victoria - Latrobe Valley
Energy Technology Data Exchange (ETDEWEB)
Longmore, G. [Hazelwood Power Corporation, VIC (Australia); Pacific Power (International) Pty. Ltd., Sydney, NSW (Australia)
1995-12-31
Water is a necessary resource for coal fired power plant and waste water is generated. The efficient management of water and waste water systems becomes an important operational environmental factor. This paper describes the development and implementation of a ten year water and waste water management strategy for the Latrobe Valley Group of brown coal fired power stations in Victoria. In early 1991, a team was put together of representatives from each power site to develop the strategy entitled `SECV Latrobe Valley Water and Wastewater Management Strategy`. The strategy was developed with extensive public consultation, which was a factor in protracting the process such that the final document was not promulgated until late 1992. However, the final comprehensive document endorsed and agreed by management, has since attracted favourable comment as a model of its type. (author). 2 figs.
Water and waste water management Generation Victoria - Latrobe Valley
International Nuclear Information System (INIS)
Longmore, G.
1995-01-01
Water is a necessary resource for coal fired power plant and waste water is generated. The efficient management of water and waste water systems becomes an important operational environmental factor. This paper describes the development and implementation of a ten year water and waste water management strategy for the Latrobe Valley Group of brown coal fired power stations in Victoria. In early 1991, a team was put together of representatives from each power site to develop the strategy entitled 'SECV Latrobe Valley Water and Wastewater Management Strategy'. The strategy was developed with extensive public consultation, which was a factor in protracting the process such that the final document was not promulgated until late 1992. However, the final comprehensive document endorsed and agreed by management, has since attracted favourable comment as a model of its type. (author). 2 figs
Lake Michigan lake trout PCB model forecast post audit (oral presentation)
Scenario forecasts for total PCBs in Lake Michigan (LM) lake trout were conducted using the linked LM2-Toxics and LM Food Chain models, supported by a suite of additional LM models. Efforts were conducted under the Lake Michigan Mass Balance Study and the post audit represents an...
Virdi, M. L.; Lee, T. M.
2009-12-01
The volume and extent of a lake within the topo-bathymetry of a watershed can change substantially during wetter and drier climate cycles, altering the interaction of the lake with the groundwater flow system. Lake Starr and other seepage lakes in the permeable sandhills of central Florida are vulnerable to climate changes as they rely exclusively on rainfall and groundwater for inflows in a setting where annual rainfall and recharge vary widely. The groundwater inflow typically arrives from a small catchment area bordering the lake. The sinkhole origin of these lakes combined with groundwater pumping from underlying aquifers further complicate groundwater interactions. Understanding the lake-groundwater interactions and their effects on lake stage over multi-decadal climate cycles is needed to manage groundwater pumping and public expectation about future lake levels. The interdependence between climate, recharge, changing lake area and the groundwater catchment pose unique challenges to simulating lake-groundwater interactions. During the 10-year study period, Lake Starr stage fluctuated more than 13 feet and the lake surface area receded and expanded from 96 acres to 148 acres over drier and wetter years that included hurricanes, two El Nino events and a La Nina event. The recently developed Unsaturated Zone Flow (UZF1) and Lake (LAK7) packages for MODFLOW-2005 were used to simulate the changing lake sizes and the extent of the groundwater catchment contributing flow to the lake. The lake area was discretized to occupy the largest surface area at the highest observed stage and then allowed to change size. Lake cells convert to land cells and receive infiltration as receding lake area exposes the underlying unsaturated zone to rainfall and recharge. The unique model conceptualization also made it possible to capture the dynamic size of the groundwater catchment contributing to lake inflows, as the surface area and volume of the lake changed during the study
Lake Granbury and Lake Whitney Assessment Initiative Final Scientific/Technical Report Summary
Energy Technology Data Exchange (ETDEWEB)
Harris, B. L. [Texas AgriLife Research, College Station, TX (United States); Roelke, Daniel [Texas AgriLife Research, College Station, TX (United States); Brooks, Bryan [Texas AgriLife Research, College Station, TX (United States); Grover, James [Texas AgriLife Research, College Station, TX (United States)
2010-10-11
A team of Texas AgriLife Research, Baylor University and University of Texas at Arlington researchers studied the biology and ecology of Prymnesium parvum (golden algae) in Texas lakes using a three-fold approach that involved system-wide monitoring, experimentation at the microcosm and mesocosm scales, and mathematical modeling. The following are conclusions, to date, regarding this organism's ecology and potential strategies for mitigation of blooms by this organism. In-lake monitoring revealed that golden algae are present throughout the year, even in lakes where blooms do not occur. Compilation of our field monitoring data with data collected by Texas Parks and Wildlife and Brazos River Authority (a period spanning a decade) revealed that inflow and salinity variables affect bloom formations. Thresholds for algae populations vary per lake, likely due to adaptations to local conditions, and also to variations in lake-basin morphometry, especially the presence of coves that may serve as hydraulic storage zones for P. parvum populations. More specifically, our in-lake monitoring showed that the highly toxic bloom that occurred in Lake Granbury in the winter of 2006/2007 was eliminated by increased river inflow events. The bloom was flushed from the system. The lower salinities that resulted contributed to golden algae not blooming in the following years. However, flushing is not an absolute requirement for bloom termination. Laboratory experiments have shown that growth of golden algae can occur at salinities ~1-2 psu but only when temperatures are also low. This helps to explain why blooms are possible during winter months in Texas lakes. Our in-lake experiments in Lake Whitney and Lake Waco, as well as our laboratory experiments, revealed that cyanobacteria, or some other bacteria capable of producing algicides, were able to prevent golden algae from blooming. Identification of this organism is a high priority as it may be a key to managing golden algae
Geophysical investigation of sentinel lakes in Lake, Seminole, Orange, and Volusia Counties, Florida
Reich, Christopher; Flocks, James; Davis, Jeffrey
2012-01-01
This study was initiated in cooperation with the St. Johns River Water Management District (SJRWMD) to investigate groundwater and surface-water interaction in designated sentinel lakes in central Florida. Sentinel lakes are a SJRWMD established set of priority water bodies (lakes) for which minimum flows and levels (MFLs) are determined. Understanding both the structure and lithology beneath these lakes can ultimately lead to a better understanding of the MFLs and why water levels fluctuate in certain lakes more so than in other lakes. These sentinel lakes have become important water bodies to use as water-fluctuation indicators in the SJRWMD Minimum Flows and Levels program and will be used to define long-term hydrologic and ecologic performance measures. Geologic control on lake hydrology remains poorly understood in this study area. Therefore, the U.S. Geological Survey investigated 16 of the 21 water bodies on the SJRWMD priority list. Geologic information was obtained by the tandem use of high-resolution seismic profiling (HRSP) and direct-current (DC) resistivity profiling to isolate both the geologic framework (structure) and composition (lithology). Previous HRSP surveys from various lakes in the study area have been successful in identifying karst features, such as subsidence sinkholes. However, by using this method only, it is difficult to image highly irregular or chaotic surfaces, such as collapse sinkholes. Resistivity profiling was used to complement HRSP by detecting porosity change within fractured or collapsed structures and increase the ability to fully characterize the subsurface. Lake Saunders (Lake County) is an example of a lake composed of a series of north-south-trending sinkholes that have joined to form one lake body. HRSP shows surface depressions and deformation in the substrate. Resistivity data likewise show areas in the southern part of the lake where resistivity shifts abruptly from approximately 400 ohm meters (ohm-m) along the
Great Lakes Literacy Principles
Fortner, Rosanne W.; Manzo, Lyndsey
2011-03-01
Lakes Superior, Huron, Michigan, Ontario, and Erie together form North America's Great Lakes, a region that contains 20% of the world's fresh surface water and is home to roughly one quarter of the U.S. population (Figure 1). Supporting a $4 billion sport fishing industry, plus $16 billion annually in boating, 1.5 million U.S. jobs, and $62 billion in annual wages directly, the Great Lakes form the backbone of a regional economy that is vital to the United States as a whole (see http://www.miseagrant.umich.edu/downloads/economy/11-708-Great-Lakes-Jobs.pdf). Yet the grandeur and importance of this freshwater resource are little understood, not only by people in the rest of the country but also by many in the region itself. To help address this lack of knowledge, the Centers for Ocean Sciences Education Excellence (COSEE) Great Lakes, supported by the U.S. National Science Foundation and the National Oceanic and Atmospheric Administration, developed literacy principles for the Great Lakes to serve as a guide for education of students and the public. These “Great Lakes Literacy Principles” represent an understanding of the Great Lakes' influences on society and society's influences on the Great Lakes.
Identification of indigenous tree and shrub fodder species in the ...
African Journals Online (AJOL)
Mo
intensive livestock systems in the Lake Victoria shore region of Uganda. It recommends further .... in some cases is sold. Goats and pigs are kept for sale and ..... techniques that optimize multiple products rather than maximize one product.
Prevalence of Schistosoma mansoni and soil transmitted helminths ...
African Journals Online (AJOL)
Perennial rivers and streams run in the basin towards Lake. Victoria. ... The topographical map of ... Multivariable logistic regression was done to identify the independent ... A p –value lower than 0.05 was considered as statistically significant.
African Journal of Environmental Science and Technology - Vol 5 ...
African Journals Online (AJOL)
Sustainable development in Cameroon's forestry sector: Progress, ... and their dispersion in Lake Victoria: A case study of Gaba landing site in Uganda ... Study on the changes in the levels of membrane-bound ATPases activity and some ...
Gambling revenues as a public administration issue: electronic gaming machines in Victoria.
Pickernell, David; Keast, Robyn; Brown, Kerry; Yousefpour, Nina; Miller, Chris
2013-12-01
Gambling activities and the revenues derived have been seen as a way to increase economic development in deprived areas. There are also, however, concerns about the effects of gambling in general and electronic gaming machines (EGMs) in particular, on the resources available to the localities in which they are situated. This paper focuses on the factors that determine the extent and spending of community benefit-related EGM-generated resources within Victoria, Australia, focusing in particular on the relationships between EGM activity and socio-economic and social capital indicators, and how this relates to the community benefit resources generated by gaming.
Directory of Open Access Journals (Sweden)
Rebecca Ritte
2017-04-01
This is the first time that the VPDC and RBDM birth data were linked in Victoria. The matched birth information established a more complete population profile of Aboriginal and/or Torres Strait Islander births. These data will provide a more accurate baseline to enhance the Victorian and Australian governments’ ability to plan services, allocate resources and evaluate funded activities aimed at eliminating disparity experienced by Aboriginal and/or Torres Strait Islander peoples. Importantly, it has established a more accurate denominator from which to calculate Aboriginal infant mortality rates for Victoria, Australia. *Until 2009, the mother’s Indigenous identification only was recorded in the VPDC
Human impact on lake ecosystems: the case of Lake Naivasha, Kenya
African Journals Online (AJOL)
Lake Naivasha is a wetland of national and international importance. However, it is under constant anthropogenic pressures, which include the quest for socioeconomic development within the lake ecosystem itself as well as other activities within the catchment. The lake is an important source of fresh water in an otherwise ...
Lake whitefish and Diporeia spp. in the Great lakes: an overview
Nalepa, Thomas F.; Mohr, Lloyd C.; Henderson, Bryan A.; Madenjian, Charles P.; Schneeberger, Philip J.
2005-01-01
Because of growing concern in the Great Lakes over declines in abundance and growth of lake whitefish (Coregonus clupeaformis) and declines in abundance of the benthic amphipod Diporeia spp., a workshop was held to examine past and current trends, to explore trophic links, and to discuss the latest research results and needs. The workshop was divided into sessions on the status of populations in each of the lakes, bioenergetics and trophic dynamics, and exploitation and management. Abundance, growth, and condition of whitefish populations in Lakes Superior and Erie are stable and within the range of historical means, but these variables are declining in Lakes Michigan and Ontario and parts of Lake Huron. The loss of Diporeia spp., a major food item of whitefish, has been a factor in observed declines, particularly in Lake Ontario, but density-dependent factors also likely played a role in Lakes Michigan and Huron. The loss of Diporeia spp. is temporally linked to the introduction and proliferation of dreissenid mussels, but a direct cause for the negative response of Diporeia spp. has not been established. Given changes in whitefish populations, age-structured models need to be re-evaluated. Other whitefish research needs to include a better understanding of what environmental conditions lead to strong year-classes, improved aging techniques, and better information on individual population (stock) structure. Further collaborations between assessment biologists and researchers studying the lower food web would enhance an understanding of links between trophic levels.
International Nuclear Information System (INIS)
Ochiel, G.R.S.
2002-01-01
The paper presents recent results from an ongoing classical biological control programme for water hyacinth, implemented by Kenya Agricultural Research Institute Under the Lake Environmental Project. After the successful control of the weed, a re-inversion in the lake was experienced in August 2000 in Nyakach Bay. Between november 2000 and June 2001, approximately 5600 adults Neochetina spp. (coleoptera: Curculionidae) weevils, biological control agents for water hyacinth Eichhornia crassipes (Liliales: Ponteridaceae) were harvested, from the Kibos rearing facility, Namba-Okana 'field security' and community weevil rearing units. Weevils were released on water hyacinth at thirteen sites in Berkeley, Nyakach, Osodo, Kendu, Homa and Karungu and Muhuru Bays, at Kuja-Migori river tributaries and upstream of Nzoia, Yala and Sondu-Miriu rivers. In general, reproductive and growth potential (number of daughter plants, petiole length and laminar area) and fresh weight of the weed was suppressed. there was a gradual increase in insect population levels (number of weevils plant -1 ) and damage to plants by weevil larvae. there is need to carry out an aerial survey to verify the visual estimates of water hyacinth cover and intensify mass rearing and releases of weevils in hotspot areas and to concentrate releases in riverine systems
Zhu, L.; Wang, J.; Daut, G.; Spiess, V.; Haberzettl, T.; Schulze, N.; Ju, J.; Lü, X.; Bergmann, F.; Haberkern, J.; Schwalb, A.; Mäusbacher, R.
2017-12-01
Lake Nam Co (ca. 2000 km2, 4718 m a.s.l., maximum depth: 100 m) is located at the interaction zone of the Westerlies and the Indian monsoon on the central Tibetan Plateau. It was part of a mega-lake during Marine Isotope Stage (MIS) 3 before the Last Glacial Maximum. A long term sedimentary record from Nam Co could therefore provide an excellent paleo-environmental sequence for regional and global comparative studies. This will to deepen our understanding of large scale atmospheric circulation shifts and the environmental links between the Tibetan Plateau at low latitudes and the North Atlantic region at high latitudes. A Nam Co deep drilling will fill the gap in two large scale ICDP/IODP drilling transects (N-S: Lake Baikal, Lake Qinghai, Bay of Bengal; W-E: Lake Van, Lake Issyk-Kul, South China Sea, Lake Towuti), which will show the great significance of monsoon dynamics on a long-term scale. Multidisciplinary researches have been conducted since 2005 by a Sino-German cooperative team. The progresses during the last decade are: 1) Detailed bathymetric surveying, including a shallow sediment profiler investigation (Innomar SES 2000 light, ca. 30 m sediment penetration); 2) Paleo-environmental reconstructions covering the past 24 ka; 3) Modern sediment distribution covering the entire lake; 4) Monitoring including water temperature profiles, sediment traps, seasonal airborne pollen collection; 5) Deep seismic survey penetrating up to 800 meters of lake sediments. Based on sediment rates from reference core NC08/01, seismic results show that an age of 500 ka may be reached at 500 m, and >1 Ma at the observed base. Faulting can be clearly detected in the seismic profiles, especially from MIS 5 to early Holocene, and shows the characteristics of normal faults or strike-slip faults. Both rotation of the layers and the close spacing, along with negative and positive offsets of the faults make a transtensional origin of the basin likely. An ICDP workshop proposal was
Sources and distribution of microplastics in China's largest inland lake - Qinghai Lake.
Xiong, Xiong; Zhang, Kai; Chen, Xianchuan; Shi, Huahong; Luo, Ze; Wu, Chenxi
2018-04-01
Microplastic pollution was studied in China's largest inland lake - Qinghai Lake in this work. Microplastics were detected with abundance varies from 0.05 × 10 5 to 7.58 × 10 5 items km -2 in the lake surface water, 0.03 × 10 5 to 0.31 × 10 5 items km -2 in the inflowing rivers, 50 to 1292 items m -2 in the lakeshore sediment, and 2 to 15 items per individual in the fish samples, respectively. Small microplastics (0.1-0.5 mm) dominated in the lake surface water while large microplastics (1-5 mm) are more abundant in the river samples. Microplastics were predominantly in sheet and fiber shapes in the lake and river water samples but were more diverse in the lakeshore sediment samples. Polymer types of microplastics were mainly polyethylene (PE) and polypropylene (PP) as identified using Raman Spectroscopy. Spatially, microplastic abundance was the highest in the central part of the lake, likely due to the transport of lake current. Based on the higher abundance of microplastics near the tourist access points, plastic wastes from tourism are considered as an important source of microplastics in Qinghai Lake. As an important area for wildlife conservation, better waste management practice should be implemented, and waste disposal and recycling infrastructures should be improved for the protection of Qinghai Lake. Copyright © 2018 Elsevier Ltd. All rights reserved.
Cryopreservation of Indian red jungle fowl (Gallus gallus murghi) semen.
Rakha, B A; Ansari, M S; Akhter, S; Hussain, I; Blesbois, E
2016-11-01
The population of red jungle fowl is declining and needs special attention for its conservation with suitable approaches. For ex situ in vitro conservation of Indian red jungle fowl, establishment of semen cryobank is an appropriate option, for which an extender with adequate retrieval capacity for functional spermatozoa is required. Therefore, studies were designed to evaluate a wide range of extenders for cryopreservation of Indian red jungle fowl (Gallus gallus murghi) sperm to achieve maximal post-thawed semen quality and fertility. For this purpose, semen from eight mature cocks were collected, initially evaluated (percent sperm motility, volume and concentration), pooled, assessed for motility, plasma membrane integrity, viability and acrosome integrity, and divided into six aliquots for dilution (1:5; 37°C) in Beltsville poultry, red fowl extender, Lake, EK, Tselutin poultry and chicken semen extenders. Diluted semen was cooled from 37°C to 4°C @ -0.275°C/min. Glycerol (20%) was added to chilled semen, equilibrated for 10min, filled in 0.5mL French straws, kept over LN 2 vapours for 10min and plunged into LN 2 and stored at -196°C. Percentages of motility, plasma membrane integrity, viability and acrosome integrity were higher (Psemen extender. Copyright © 2016 Elsevier B.V. All rights reserved.
Out of the ashes: the new bachelor of midwifery curriculum at Victoria University.
Carolan, Mary; Kruger, Gina; Brown, Vera
2007-09-01
In the past decade, midwifery education has changed significantly in Australia. Previously, a nursing qualification (division 1) was required for entry into midwifery programs and on completion, graduands obtained a postgraduate diploma of midwifery. More recently, bachelor of midwifery programs have also been offered in Australia and currently, a considerable percentage of midwives are prepared for practice in this way. In Victoria, the bachelor of midwifery has been available since 2002, and at this time the third group of graduands are poised to enter the field. Implementation of the bachelor of midwifery program has given rise to many concerns about the development and applicability of this course. Concerns include: complexities of registration with a regulatory board set up primarily for nursing registration; concerns about readiness for practice among bachelor of midwifery graduands; escalating requirements within midwifery courses; and difficulties with meeting course requirements. As this course comes of age in Victoria, it is useful to reflect on some of the challenges encountered along the way. Thus, this paper reports on the journey of one university as it approaches the end of a first year of implementing an independent bachelor of midwifery program, following 5 years involvement as a consortium partner. In particular, it addresses concerns and difficulties encountered during early implementation of the program and then outlines strategies used to improve and strengthen the course. The basic premise of the paper is lessons learnt along the way.
Straney, Lahn D; Bray, Janet E; Beck, Ben; Finn, Judith; Bernard, Stephen; Dyson, Kylie; Lijovic, Marijana; Smith, Karen
2015-01-01
Out-of-hospital cardiac arrest (OHCA) remains a major public health issue and research has shown that large regional variation in outcomes exists. Of the interventions associated with survival, the provision of bystander CPR is one of the most important modifiable factors. The aim of this study is to identify census areas with high incidence of OHCA and low rates of bystander CPR in Victoria, Australia. We conducted an observational study using prospectively collected population-based OHCA data from the state of Victoria in Australia. Using ArcGIS (ArcMap 10.0), we linked the location of the arrest using the dispatch coordinates (longitude and latitude) to Victorian Local Government Areas (LGAs). We used Bayesian hierarchical models with random effects on each LGA to provide shrunken estimates of the rates of bystander CPR and the incidence rates. Over the study period there were 31,019 adult OHCA attended, of which 21,436 (69.1%) cases were of presumed cardiac etiology. Significant variation in the incidence of OHCA among LGAs was observed. There was a 3 fold difference in the incidence rate between the lowest and highest LGAs, ranging from 38.5 to 115.1 cases per 100,000 person-years. The overall rate of bystander CPR for bystander witnessed OHCAs was 62.4%, with the rate increasing from 56.4% in 2008-2010 to 68.6% in 2010-2013. There was a 25.1% absolute difference in bystander CPR rates between the highest and lowest LGAs. Significant regional variation in OHCA incidence and bystander CPR rates exists throughout Victoria. Regions with high incidence and low bystander CPR participation can be identified and would make suitable targets for interventions to improve CPR participation rates.
Outflows of groundwater in lakes: case study of Lake Raduńske Górne
Directory of Open Access Journals (Sweden)
Cieśliński Roman
2014-12-01
Full Text Available The aim of the study was to locate and describe groundwater outflows in a selected lake basin. The study hypothesis was based on the fact that, according to the specialist literature, one of the forms of lake water supply is through groundwater outflows. It was also assumed that the lakes of the Kashubian Lake District are characterised by such a form of lake water supply. The time scope of the work included the period from January 2011 to September 2012. The spatial scope of the work included the area of Lake Raduńskie Górne, located in the Kashubian Lake District in north Poland. The research plot was in the north-eastern part of the lake. Office works were aimed at gathering and studying source materials and maps. Cartographic materials were analysed with the use of the MapInfo Professional 9.5. The purpose of the field work was to find the groundwater outflows in the basin of Lake Raduńskie Górne. During the field research diving was carried out in the lake. During the dive audiovisual documentation was conducted using a Nikon D90 camera with Ikelite underwater housing for Nikon D90 and an Ikelite DS 161 movie substrobe, as well as a GoPro HD HERO 2 Outdoor camera. During the project, four groundwater outflows were found. In order to examine these springs audiovisual and photographic documentation was made. To systematise the typology of the discovered springs, new nomenclature was suggested, namely under-lake springs with subtypes: an under-lake slope spring and under-lake offshore spring
Directory of Open Access Journals (Sweden)
Cichoń Małgorzata
2017-12-01
Full Text Available Lake ecosystems, on the one hand, are affected by tourism, and on the other by development for tourism. Lake ecosystem services include: water with its self-cleaning processes, air with climate control processes, as well as flora and fauna. Utilisation of services leads to interventions in the structure of ecosystems and their processes. Only to a certain extent, this is specific to each type of environmental interference, remains within the limits of ecosystem resilience and does not lead to its degradation. One of the threats is bacteriological contamination, for which the most reliable sanitation indicator is Escherichia coli. In lake water quality studies it is assumed that the lakeshore cannot be a source of bacteria. It has been hypothesised that the problem of bacterial contamination can be serious for the places that do not have any infrastructure, especially sanitation. Consequently, the purpose of the study was to determine the extent to which lakeshore sanitation, in particular the level of bacteriological contamination, has an impact on the value of services provided by the selected lake ecosystems (Lake Trzesiecko and Lake Wielimie – Szczecinek Lake District. Five selected services related to lake ecosystems are: water, control over the spread of contagious diseases, aesthetic values, tourism and recreation, as well as the hydrological cycle with its self-cleaning function. Services, as well as the criteria adopted for evaluation, allow us to conclude that the services provided by the lake ecosystems are suitable to fulfill a recreation function. However, the inclusion of quality criteria for sanitary status has shown that the value of system services has dropped by as much as 50%. Value changes are visible primarily for water and aesthetic qualities. Such a significant decrease in the value of services clearly indicates the importance of the sanitary conditions of lakes and their appropriate infrastructure. In view of the
Resilience and Restoration of Lakes
Directory of Open Access Journals (Sweden)
Stephen R. Carpenter
1997-06-01
Full Text Available Lake water quality and ecosystem services are normally maintained by several feedbacks. Among these are nutrient retention and humic production by wetlands, nutrient retention and woody habitat production by riparian forests, food web structures that cha nnel phosphorus to consumers rather than phytoplankton, and biogeochemical mechanisms that inhibit phosphorus recycling from sediments. In degraded lakes, these resilience mechanisms are replaced by new ones that connect lakes to larger, regional economi c and social systems. New controls that maintain degraded lakes include runoff from agricultural and urban areas, absence of wetlands and riparian forests, and changes in lake food webs and biogeochemistry that channel phosphorus to blooms of nuisance al gae. Economic analyses show that degraded lakes are significantly less valuable than normal lakes. Because of this difference in value, the economic benefits of restoring lakes could be used to create incentives for lake restoration.
The Pleistocene archaeology and environments of the Wasiriya Beds, Rusinga Island, Kenya.
Tryon, Christian A; Tyler Faith, J; Peppe, Daniel J; Fox, David L; McNulty, Kieran P; Jenkins, Kirsten; Dunsworth, Holly; Harcourt-Smith, Will
2010-12-01
Western Kenya is well known for abundant early Miocene hominoid fossils. However, the Wasiriya Beds of Rusinga Island, Kenya, preserve a Pleistocene sedimentary archive with radiocarbon age estimates of >33-45 ka that contains Middle Stone Age artifacts and abundant, well-preserved fossil fauna: a co-occurrence rare in eastern Africa, particularly in the region bounding Lake Victoria. Artifacts and fossils are associated with distal volcanic ash deposits that occur at multiple localities in the Wasiriya Beds, correlated on the basis of geochemical composition as determined by electron probe microanalysis. Sediment lithology and the fossil ungulates suggest a local fluvial system and associated riparian wooded habitat within a predominantly arid grassland setting that differs substantially from the modern environment, where local climate is strongly affected by moisture availability from Lake Victoria. In particular, the presence of oryx (Oryx gazella) and Grevy's zebra (Equus grevyi) suggest a pre-Last Glacial Maximum expansion of arid grasslands, an environmental reconstruction further supported by the presence of several extinct specialized grazers (Pelorovis antiquus, Megalotragus sp., and a small alcelaphine) that are unknown from Holocene deposits in eastern Africa. The combination of artifacts, a rich fossil fauna, and volcaniclastic sediments makes the Wasiriya Beds a key site for examining the Lake Victoria basin, a biogeographically important area for understanding the diversification and dispersal of Homo sapiens from Africa, whose pre-Last Glacial Maximum history remains poorly understood. Copyright © 2010 Elsevier Ltd. All rights reserved.
Hepp, Johannes; Tuthorn, Mario; Zech, Roland; Mügler, Ines; Schlütz, Frank; Zech, Wolfgang; Zech, Michael
2015-10-01
Over the past decades, δ18O and δ2H analyses of lacustrine sediments became an invaluable tool in paleohydrology and paleolimnology for reconstructing the isotopic composition of past lake water and precipitation. However, based on δ18O or δ2H records alone, it can be challenging to distinguish between changes of the precipitation signal and changes caused by evaporation. Here we propose a coupled δ18O-δ2H biomarker approach that provides the possibility to disentangle between these two factors. The isotopic composition of long chain n-alkanes (n-C25, n-C27, n-C29, n-C31) were analyzed in order to establish a 16 ka Late Glacial and Holocene δ2H record for the sediment archive of Lake Panch Pokhari in High Himalaya, Nepal. The δ2Hn-alkane record generally corroborates a previously established δ18Osugar record reporting on high values characterizing the deglaciation and the Older and the Younger Dryas, and low values characterizing the Bølling and the Allerød periods. Since the investigated n-alkane and sugar biomarkers are considered to be primarily of aquatic origin, they were used to reconstruct the isotopic composition of lake water. The reconstructed deuterium excess of lake water ranges from +57‰ to -85‰ and is shown to serve as proxy for the evaporation history of Lake Panch Pokhari. Lake desiccation during the deglaciation, the Older Dryas and the Younger Dryas is affirmed by a multi-proxy approach using the Hydrogen Index (HI) and the carbon to nitrogen ratio (C/N) as additional proxies for lake sediment organic matter mineralization. Furthermore, the coupled δ18O and δ2H approach allows disentangling the lake water isotopic enrichment from variations of the isotopic composition of precipitation. The reconstructed 16 ka δ18Oprecipitation record of Lake Panch Pokhari is well in agreement with the δ18O records of Chinese speleothems and presumably reflects the Indian Summer Monsoon variability.
classification of plants according to their heavy metal content around
African Journals Online (AJOL)
Mgina
accumulated heavy metals around North Mara Gold Mine were not known. To study such ... heavy metal hyperaccumulator plants for possible future remediation of the study area. ... mine is about 100 kilometers east of Lake. Victoria and 20 ...
Habitat Evaluation Procedures (HEP) Report; West Beaver Lake Project, Technical Report 2005
Energy Technology Data Exchange (ETDEWEB)
Entz, Ray
2005-05-01
On September 7, 2004, the Habitat Evaluation Procedure (HEP) was used to determine baseline habitat suitability on the West Beaver Lake property, an acquisition completed by the Kalispel Tribe of Indians in September 2004. Evaluation species and appropriate models include bald eagle, black-capped chickadee, mallard, muskrat, and white-tailed deer. Habitat Suitability Index (HSI) values were visually estimated and agreed upon by all HEP team members. The West Beaver Lake Project provides a total of 82.69 Habitat Units (HUs) for the species evaluated. Emergent wetland habitat provides 8.80 HUs for mallard, muskrat, and Canada goose. Conifer forest habitat provides 70.33 HUs for bald eagle, black-capped chickadee, mallard, and white-tailed deer. Open water provides 3.30 HUs for mallard, muskrat, and Canada goose. The objective of using HEP at the West Beaver Lake Project and other protected properties is to document the quality and quantity of available habitat for selected wildlife species. In this way, HEP provides information on the relative value of the same area at future points in time so that the effect of management activities on wildlife habitat can be quantified. When combined with other tools, the baseline HEP will be used to determine the most effective on-site management, restoration, and enhancement actions to increase habitat suitability for targeted species. The same process will be replicated every five years to quantitatively evaluate the effectiveness of management strategies in improving and maintaining habitat conditions while providing additional crediting to BPA for enhanced habitat values.
Yellowstone Lake Nanoarchaeota
Directory of Open Access Journals (Sweden)
Scott eClingenpeel
2013-09-01
Full Text Available Considerable Nanoarchaeota novelty and diversity were encountered in Yellowstone Lake, Yellowstone National Park, where sampling targeted lake floor hydrothermal vent fluids, streamers and sediments associated with these vents, and in planktonic photic zones in three different regions of the lake. Significant homonucleotide repeats (HR were observed in pyrosequence reads and in near full-length Sanger sequences, averaging 112 HR per 1,349 bp clone and could confound diversity estimates derived from pyrosequencing, resulting in false nucleotide insertions or deletions (indels. However, Sanger sequencing of two different sets of PCR clones (110 bp, 1349 bp demonstrated that at least some of these indels are real. The majority of the Nanoarchaeota PCR amplicons were vent associated; however, curiously, one relatively small Nanoarchaeota OTU (70 pyrosequencing reads was only found in photic zone water samples obtained from a region of the lake furthest removed from the hydrothermal regions of the lake. Extensive pyrosequencing failed to demonstrate the presence of an Ignicoccus lineage in this lake, suggesting the Nanoarchaeota in this environment are associated with novel Archaea hosts. Defined phylogroups based on near full-length PCR clones document the significant Nanoarchaeota 16S rRNA gene diversity in this lake and firmly establish a terrestrial clade distinct from the marine Nanoarcheota as well as from other geographical locations.
Contaminant trends in lake trout and walleye from the Laurentian Great Lakes
DeVault, David S.; Hesselberg, Robert J.; Rodgers, Paul W.; Feist, Timothy J.
1996-01-01
Trends in PCBs, DDT, and other contaminants have been monitored in Great Lakes lake trout and walleye since the 1970s using composite samples of whole fish. Dramatic declines have been observed in concentrations of PCB, ΣDDT, dieldrin, and oxychlordane, with declines initially following first order loss kinetics. Mean PCB concentrations in Lake Michigan lake trout increased from 13 μg/g in 1972 to 23 μg/g in 1974, then declined to 2.6 μg/g by 1986. Between 1986 and 1992 there was little change in concentration, with 3.5 μg/g observed in 1992. ΣDDT in Lake Michigan trout followed a similar trend, decreasing from 19.2 μg/g in 1970 to 1.1 μg/g in 1986, and 1.2 μg/g in 1992. Similar trends were observed for PCBs and ΣDDT in lake trout from Lakes Superior, Huron and Ontario. Concentrations of both PCB and ΣDDT in Lake Erie walleye declined between 1977 and 1982, after which concentrations were relatively constant through 1990. When originally implemented it was assumed that trends in the mean contaminant concentrations in open-lake fish would serve as cost effective surrogates to trends in the water column. While water column data are still extremely limited it appears that for PCBs in lakes Michigan and Superior, trends in lake trout do reasonably mimic those in the water column over the long term. Hypotheses to explain the trends in contaminant concentrations are briefly reviewed. The original first order loss kinetics used to describe the initial decline do not explain the more recent leveling off of contaminant concentrations. Recent theories have examined the possibilities of multiple contaminant pools. We suggest another hypothesis, that changes in the food web may have resulted in increased bioaccumulation. However, a preliminary exploration of this hypothesis using a change point analysis was inconclusive.
International Nuclear Information System (INIS)
Cole, C.J.P.
2003-01-01
The purpose of this research is to conceptually design a small, inherently safe, quasi-homogeneous nuclear reactor that will provide enough power to maintain the hotel load of the Victoria Class Submarine and extend her operational envelope. This research is in its early stages. The purpose of this paper is to outline the background of the research, present results found to date, and indicate the direction of the research over the next two years. The Canadian Forces has recently acquired four U.K. built Upholder Class submarines to replace the ageing Oberon Class submarines purchased in the early 1960's. The Upholders, like the Oberons, are diesel-electric powered. The Upholders were renamed the Victoria Class upon commissioning in Canada. Submarines are strategic military weapons that have several roles including: intelligence gathering, inflicting surprise attacks, controlling shipping lanes and covert operations. For each of these roles the submarine must remain undetected. To remain undetected, it is imperative that the submarine remains submerged. To remain submerged and continue to function, a submarine requires an air-independent power generation system, such as a nuclear reactor. (author)
Energy Technology Data Exchange (ETDEWEB)
Tilson, Mary Beth; Galloway, Heather; Scholz, Allan T. (Eastern Washington University, Upper Columbia United Tribes Fisheries Research Center, Cheney, WA)
1994-06-01
In 1991, two hatcheries were built to provide a kokanee salmon and rainbow trout fishery for Lake Roosevelt as partial mitigation for the loss of anadromous salmon and steelhead caused by construction of Grand Coulee Dam. The Sherman Creek Hatchery, located on a tributary of Lake Roosevelt to provide an egg collection and imprinting site, is small with limited rearing capability. The second hatchery was located on the Spokane Indian Reservation because of a spring water source that supplied cold, pure water for incubating and rearing eggs.`The Spokane Tribal Hatchery thus serves as the production facility. Fish reared there are released into Sherman Creek and other tributary streams as 7-9 month old fry. However, to date, returns of adult fish to release sites has been poor. If hatchery reared kokanee imprint to the hatchery water at egg or swim up stages before 3 months of age, they may not be imprinting as 7-9 month old fry at the time of stocking. In addition, if these fish undergo a smolt phase in the reservoir when they are 1.5 years old, they could migrate below Grand Coulee Dam and out of the Lake Roosevelt system. In the present investigation, which is part of the Lake Roosevelt monitoring program to assess hatchery effectiveness, kokanee salmon were tested to determine if they experienced thyroxine-induced chemical imprinting and smoltification similar to anadromous salmonids. Determination of the critical period for olfactory imprinting was determined by exposing kokanee to different synthetic chemicals (morpholine or phenethyl alcohol) at different life stages, and then measuring the ability to discriminate the chemicals as sexually mature adults. Whole body thyroxine content and blood plasma thyroxine concentration was measured to determine if peak thyroid activity coincided with imprinting or other morphological, physiological or behavioral transitions associated with smoltification.
International Nuclear Information System (INIS)
Cottle, J.M.; Cooper, A.F.
2006-01-01
The Fontaine Pluton is a previously undescribed mafic intrusion outcropping at Fontaine Bluff on the south side of the Carlyon Glacier in southern Victoria Land, Antarctica. It is the southern-most member of a laterally extensive mafic suite emplaced at mid-crustal depths during the initial stages of the Ross Orogeny. The pluton comprises recrystallised hornblende-biotite gabbro, which in places shows well-defined centimetre to metre scale primary igneous layering. Recrystallised ultramafic enclaves composed of amphibole-chlorite-talc are inferred to be remnants of a chemically and mineralogically distinct cumulate fraction. The intrusion has a 87 Sr/ 86 Sr (i) ratio of 0.70679 and a 143 Nd/ 144 Nd (i) ratio of 0.51187 (εNd (i) = -1.2). This, coupled with other geochemical data, implies that the Fontaine Pluton was formed by c. 15% partial melting of a depleted mantle source that was subsequently contaminated by continental crust. Preliminary U-Pb geochronology on zircon suggests an emplacement age for the pluton of 546 ± 10 Ma. These new data indicate that Ross Orogeny magmatism in this area of southern Victoria Land was initiated in the late Neoproterozoic along a subducting plate margin. (author). 55 refs., 10 figs., 3 tabs
International Nuclear Information System (INIS)
Nour ElDin, H.; Halim, S. N.; Shalby, E.
2004-01-01
Lake Mariut, south Alexandria, Egypt suffered in the recent decades from intensive pollution as a result of a continuous discharge of huge amounts of agriculture wastewater that contains a large concentration of the washed pesticides and fertilizers in addition to domestic and industrial untreated wastewater. The over flow from the lake is discharged directly to the sea through El-Max pumping station via EI-Umum drain. Lake Mariout is surrounded by a huge number of different industrial activities and also the desert road is cutting the lake, this means that a huge number of various pollutants cycle through the air and settle down in the lake, by the time and during different seasons these pollutants after accumulation and different chemical interactions will release again from the lake to the surrounding area affecting the surrounding zone
Long-Term Variability of Satellite Lake Surface Water Temperatures in the Great Lakes
Gierach, M. M.; Matsumoto, K.; Holt, B.; McKinney, P. J.; Tokos, K.
2014-12-01
The Great Lakes are the largest group of freshwater lakes on Earth that approximately 37 million people depend upon for fresh drinking water, food, flood and drought mitigation, and natural resources that support industry, jobs, shipping and tourism. Recent reports have stated (e.g., the National Climate Assessment) that climate change can impact and exacerbate a range of risks to the Great Lakes, including changes in the range and distribution of certain fish species, increased invasive species and harmful algal blooms, declining beach health, and lengthened commercial navigation season. In this study, we will examine the impact of climate change on the Laurentian Great Lakes through investigation of long-term lake surface water temperatures (LSWT). We will use the ATSR Reprocessing for Climate: Lake Surface Water Temperature & Ice Cover (ARC-Lake) product over the period 1995-2012 to investigate individual and interlake variability. Specifically, we will quantify the seasonal amplitude of LSWTs, the first and last appearances of the 4°C isotherm (i.e., an important identifier of the seasonal evolution of the lakes denoting winter and summer stratification), and interpret these quantities in the context of global interannual climate variability such as ENSO.
DEFF Research Database (Denmark)
Tonolla, Mauro; Storelli, Nicola; Danza, Francesco
2017-01-01
Lake Cadagno (26 ha) is a crenogenic meromictic lake located in the Swiss Alps at 1921 m asl with a maximum depth of 21 m. The presence of crystalline rocks and a dolomite vein rich in gypsum in the catchment area makes the lake a typical “sulphuretum ” dominated by coupled carbon and sulphur...... cycles. The chemocline lies at about 12 m depth, stabilized by density differences of salt-rich water supplied by sub-aquatic springs to the monimolimnion and of electrolyte-poor surface water feeding the mixolimnion. Steep sulphide and light gradients in the chemocline support the growth of a large...... in the chemocline. Small-celled PSB together with the sulfate-reducing bacterium Desulfocapsa thiozymogenes sp. form stable aggregates in the lake, which represent small microenvironments with an internal sulphur cycle. Eukaryotic primary producers in the anoxic zones are dominated by Cryptomonas phaseolus...
Brown, P. Margaret; Byrnes, Linda J.
2014-01-01
This study investigated the Individual Learning Plans of eighty-eight students who were deaf and hard of hearing attending facilities and schools for the deaf in Victoria Australia. The students' assessment and planning portfolios were scrutinised for evidence of formal and informal assessment used to generate goals for the Individual Learning…
Recent lake ice-out phenology within and among lake districts of Alaska, U.S.A.
Arp, Christopher D.; Jones, Benjamin M.; Grosse, Guido
2013-01-01
The timing of ice-out in high latitudes is a fundamental threshold for lake ecosystems and an indicator of climate change. In lake-rich regions, the loss of ice cover also plays a key role in landscape and climatic processes. Thus, there is a need to understand lake ice phenology at multiple scales. In this study, we observed ice-out timing on 55 large lakes in 11 lake districts across Alaska from 2007 to 2012 using satellite imagery. Sensor networks in two lake districts validated satellite observations and provided comparison with smaller lakes. Over this 6 yr period, the mean lake ice-out for all lakes was 27 May and ranged from 07 May in Kenai to 06 July in Arctic Coastal Plain lake districts with relatively low inter-annual variability. Approximately 80% of the variation in ice-out timing was explained by the date of 0°C air temperature isotherm and lake area. Shoreline irregularity, watershed area, and river connectivity explained additional variation in some districts. Coherence in ice-out timing within the lakes of each district was consistently strong over this 6 yr period, ranging from r-values of 0.5 to 0.9. Inter-district analysis of coherence also showed synchronous ice-out patterns with the exception of the two arctic coastal districts where ice-out occurs later (June–July) and climatology is sea-ice influenced. These patterns of lake ice phenology provide a spatially extensive baseline describing short-term temporal variability, which will help decipher longer term trends in ice phenology and aid in representing the role of lake ice in land and climate models in northern landscapes.
33 CFR 162.132 - Connecting waters from Lake Huron to Lake Erie; communications rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; communications rules. 162.132 Section 162.132 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.132 Connecting waters from Lake Huron to Lake Erie; communications rules. (a...
33 CFR 162.140 - Connecting waters from Lake Huron to Lake Erie; miscellaneous rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. 162.140 Section 162.140 Navigation and Navigable Waters COAST... NAVIGATION REGULATIONS § 162.140 Connecting waters from Lake Huron to Lake Erie; miscellaneous rules. (a...
State Electricity Commission of Victoria annual report 1991/92
Energy Technology Data Exchange (ETDEWEB)
1992-01-01
The 73rd annual report of the State Electricity Commission (SEC) of Victoria covers the financial year ended 30 June 1992. A total revenue of 3,300 million dollars and a net profit of 155.7 million dollars was recorded. There was continued improvement in employee productivity. Progress was made on the Victorian Power Pool (VicPool) pooling arrangement in anticipation of open access to the power grid. A 3-year business plan was formulated and corporate strategy revised. The Strategic Research Program on brown coal technologies, aimed at reducing costs of electricity and emissions of CO[sub 2], continued. Environmental activities continued in the areas of renewable energy source development, air quality monitoring, acid rain, water management, land rehabilitation and improvements to powerlines. The report includes statistical data on customer statistics, electricity sales, power stations, brown coal and briquette production and financial sales.
Habitat Evaluation Procedures (HEP) Report; North Eaton Lake, Technical Report 2005.
Energy Technology Data Exchange (ETDEWEB)
Entz, Ray
2005-11-01
On July 6, 2005, the Habitat Evaluation Procedure (HEP) was used to determine baseline habitat suitability on the North Eaton Lake property, an acquisition completed by the Kalispel Tribe of Indians in November 2004. Evaluation species and appropriate models include bald eagle, black-capped chickadee, Canada goose, mallard, muskrat, and white-tailed deer. Habitat Suitability Index (HSI) values were visually estimated and agreed upon by all HEP team members. The North Eaton Lake Project provides a total of 235.05 Habitat Units (HUs) for the species evaluated. Open water habitat provides 9.38 HUs for Canada goose, mallard and muskrat. Emergent wetland habitat provides 11.36 HUs for Canada goose, mallard and muskrat. Forested wetland provides 10.97 HUs for bald eagle, black-capped chickadee, mallard and white-tailed deer. Conifer forest habitat provides 203.34 HUs for bald eagle, black-capped chickadee, mallard, and white-tailed deer. The objective of using HEP at the North Eaton Lake Project and other protected properties is to document the quality and quantity of available habitat for selected wildlife species. In this way, HEP provides information on the relative value of the same area at future points in time so that the effect of management activities on wildlife habitat can be quantified. When combined with other tools, the baseline HEP will be used to determine the most effective on-site management, restoration, and enhancement actions to increase habitat suitability for targeted species. The same process will be replicated every five years to quantitatively evaluate the effectiveness of management strategies in improving and maintaining habitat conditions while providing additional crediting to BPA for enhanced habitat values.
Rickert, David A.; Spieker, Andrew Maute
1971-01-01
Since the dawn of civilization waterfront land has been an irresistible attraction to man. Throughout history he has sought out locations fronting on oceans, rivers, and lakes. Originally sought for proximity .to water supply and transportation, such locations are now sought more for their esthetic qualities and for recreation. Usable natural waterfront property is limited, however, and the more desirable sites in many of our urban areas have already been taken. The lack of available waterfront sites has led to the creation of many artificial bodies of water. The rapid suburbanization that has characterized urban growth in America since the end of World War II, together with increasing affluence and le-isure time, has created a ready market for waterfront property. Accordingly, lake-centered subdivisions and developments dot the suburban landscape in many of our major urban areas. Literally thousands of lakes surrounded by homes have materialized during this period of rapid growth. Recently, several "new town" communities have been planned around this lake-centered concept. A lake can be either an asset or a liaoility to a community. A clean, clear, attractively landscaped lake is a definite asset, whereas a weed-choked, foul-smelling mudhole is a distinct liability. The urban environment poses both problems and imaginative opportunities in the development of lakes. Creation of a lake causes changes in all aspects of the environment. Hydrologic systems and ecological patterns are usually most severely altered. The developer should be aware of the potential changes; it is not sufficient merely to build a dam across a stream or to dig a hole in the ground. Development of Gl a successful lake requires careful planning for site selection and design, followed by thorough and cc ntinual management. The purpose of this report is to describe the characteristics of real-estate lakes, to pinpoint potential pmblems, and to suggest possible planning and management guidelines
Lake Morphometry for NHD Lakes in California Region 18 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
Lake Morphometry for NHD Lakes in Tennessee Region 6 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
Lake Morphometry for NHD Lakes in Ohio Region 5 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Ontario has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and make it more...
National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Michigan has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and make it more...
National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Superior has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and make it more...
National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry of Lake Huron has been compiled as a component of a NOAA project to rescue Great Lakes lake floor geological and geophysical data and make it more...
Circulation and sedimentation in a tidal-influenced fjord lake: Lake McKerrow, New Zealand
Pickrill, R. A.; Irwin, J.; Shakespeare, B. S.
1981-01-01
Lake McKerrow is a tide-influenced fjord lake, separated from the open sea by a Holocene barrier spit. Fresh, oxygenated waters of the epilimnion overlie saline, deoxygenated waters of the hypolimnion. During winter, water from the Upper Hollyford River interflows along the pycnocline, depositing coarse silt on the steep delta and transporting finer sediment down-lake. An extensive sub-lacustrine channel system on the foreset delta slope is possibly maintained by turbidity currents. Saline waters of the hypolimnion are periodically replenished. During high tides and low lake levels saline water flows into the lake and downslope into the lake basin as a density current in a well defined channel.
33 CFR 162.130 - Connecting waters from Lake Huron to Lake Erie; general rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; general rules. 162.130 Section 162.130 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.130 Connecting waters from Lake Huron to Lake Erie; general rules. (a) Purpose. The...
Menzel, P.; Gaye, B.; Wiesner, M.; Prasad, S.; Basavaiah, N.; Stebich, M.; Anoop, A.; Riedel, N.; Brauer, A.
2012-04-01
The DFG funded HIMPAC (Himalaya: Modern and Past Climates) programme aims to reconstruct Holocene Indian Monsoon climate using a multi-proxy and multi-archive approach. First investigations made on sediments from a ca. 10 m long core covering the whole Holocene taken from the lake Lonar in central India's state Maharashtra, Buldhana District, serve to identify changes in sedimentation, lake chemistry, local vegetation and regional to supra-regional climate patterns. Lake Lonar occupies the floor of an impact crater that formed on the ~ 65 Ma old basalt flows of the Deccan Traps. It covers an area of ca. 1 km2 and is situated in India's core monsoon area. The modern lake has a maximum depth of about 5 m, is highly alkaline, and hyposaline, grouped in the Na-Cl-CO3 subtype of saline lakes. No out-flowing stream is present and only three small streams feed the lake, resulting in a lake level highly sensitive to precipitation and evaporation. The lake is eutrophic and stratified throughout most of the year with sub- to anoxic waters below 2 m depth. In this study the core sediments were analysed for their total amino acid (AA) and amino sugar (AS) content, the amino acid bound C and N percentage of organic C and total N in the sediment and the distribution of individual amino acids. The results roughly show three zones within the core separated by distinct changes in their AA content and distribution. (i) The bottom part of the core from ca. 12000 cal a BP to 11400 cal a BP with very low AA and AS percentage indicating high lithogenic contribution, most probably related to dry conditions. (ii) From 11400 cal a BP to 1200 cal a BP the sediments show moderate AA and AS percentages and low values for the ratios of proteinogenic AAs to their non-proteinogenic degradation products (e.g. ASP/β-ALA; GLU/γ-ABA). (iii) The top part of the core (land use. This hypothesis is corroborated by the dating of more than 10 temple ruins surrounding the lake, which were built in the 12
Great Lakes Restoration Initiative Great Lakes Mussel Watch(2009-2014)
National Oceanic and Atmospheric Administration, Department of Commerce — Following the inception of the Great Lakes Restoration Initiative (GLRI) to address the significant environmental issues plaguing the Great Lakes region, the...
Occupational skin disease in Victoria, Australia.
Cahill, Jennifer L; Williams, Jason D; Matheson, Melanie C; Palmer, Amanda M; Burgess, John A; Dharmage, Shyamali C; Nixon, Rosemary L
2016-05-01
To describe the characteristics of patients with occupational skin disease (OSD) in a tertiary referral clinic in Victoria, Australia. A retrospective review was conducted of records from patients seen at the Occupational Dermatology Clinic in Melbourne, Australia between 1 January 1993 and 31 December 2010. Of the 2894 people assessed in the clinic during the 18-year period, 44% were women and 56% were men. In all, 2177 (75%) were diagnosed with occupational skin disease (OSD). Of the patients with a work-related skin condition, 45% (n = 979) were considered to be atopic. The most common diagnosis in those with OSD was irritant contact dermatitis (ICD) (44%), followed by allergic contact dermatitis (33%) and endogenous eczema (11%). Women were significantly more likely to have soaps and detergents (P Occupational groups with the highest incidence of OSD were the hair and beauty professions (70 per 100 000), followed by machine and plant operators (38 per 100 000) and health-care workers (21 per 100 000). We confirm the importance of occupational contact dermatitis as the most common cause of OSD, with ICD being the most common diagnosis. There are differences in the causes of ICD between our group of male and female workers. For the first time in Australia, rates of OSD in certain industries have been calculated. © 2015 The Australasian College of Dermatologists.
33 CFR 162.134 - Connecting waters from Lake Huron to Lake Erie; traffic rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; traffic rules. 162.134 Section 162.134 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.134 Connecting waters from Lake Huron to Lake Erie; traffic rules. (a) Detroit River. The...
33 CFR 162.138 - Connecting waters from Lake Huron to Lake Erie; speed rules.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; speed rules. 162.138 Section 162.138 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.138 Connecting waters from Lake Huron to Lake Erie; speed rules. (a) Maximum speed limit for...
33 CFR 162.136 - Connecting waters from Lake Huron to Lake Erie; anchorage grounds.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Connecting waters from Lake Huron to Lake Erie; anchorage grounds. 162.136 Section 162.136 Navigation and Navigable Waters COAST GUARD... REGULATIONS § 162.136 Connecting waters from Lake Huron to Lake Erie; anchorage grounds. (a) In the Detroit...
Habitat Evaluation Procedures (HEP) Report; Beaver Lake, Technical Report 2005.
Energy Technology Data Exchange (ETDEWEB)
Entz, Ray
2005-05-01
On August 14, 2003, the Habitat Evaluation Procedure (HEP) was used to determine baseline habitat suitability on the Beaver Lake property, an acquisition completed by the Kalispel Tribe of Indians in November 2002. Evaluation species and appropriate models include bald eagle, black-capped chickadee, Canada goose, mallard, muskrat, yellow warbler, and white-tailed deer. Habitat Suitability Index (HSI) values were visually estimated and agreed upon by all HEP team members. The Beaver Lake Project provides a total of 232.26 Habitat Units (HUs) for the species evaluated. Conifer forest habitat provides 136.58 HUs for bald eagle, black-capped chickadee, mallard, and white-tailed deer. Forested wetland habitat provides 20.02 HUs for bald eagle, black-caped chickadee, mallard, and white-tailed deer. Scrub-shrub wetland habitat provides 7.67 HUs for mallard, yellow warbler, and white-tailed deer. Grassland meadow provides 22.69 HUs for Canada goose and mallard. Emergent wetlands provide 35.04 HUs for Canada goose, mallard, and muskrat. Open water provided 10.26 HUs for Canada goose, mallard, and muskrat. The objective of using HEP at the Beaver Lake Project and other protected properties is to document the quality and quantity of available habitat for selected wildlife species. In this way, HEP provides information on the relative value of the same area at future points in time so that the effect of management activities on wildlife habitat can be quantified. When combined with other tools, the baseline HEP will be used to determine the most effective on-site management, restoration, and enhancement actions to increase habitat suitability for targeted species. The same process will be replicated every five years to quantitatively evaluate the effectiveness of management strategies in improving and maintaining habitat conditions while providing additional crediting to BPA for enhanced habitat values.
Limnology of Botos Lake, a tropical crater lake in Costa Rica.
Umaña, G
2001-12-01
Botos Lake, located at the Poas Volcano complex (Costa Rica) was sampled eight times from 1994 to 1996 for physicochemical conditions of the water column and phytoplanktonic community composition. Depth was measured at fixed intervals in several transects across the lake to determine its main morphometric characteristics. The lake has an outlet to the north. It is located 2580 m above sea level and is shallow, with a mean depth of 1.8 m and a relative depth of 2.42 (surface area 10.33 ha, estimated volume 47.3 hm3). The lake showed an isothermal water column in all occasions, but it heats and cools completely according to weather fluctuations. Water transparency reached the bottom on most occasions (> 9 m). The results support the idea that the lake is polymictic and oligotrophic. The lake has at least 23 species of planktonic algae, but it was always dominated by dinoflagellates, especially Peridinium inconspicuum. The shore line is populated by a sparse population of Isoetes sp. and Eleocharis sp. mainly in the northern shore where the bottom has a gentle slope and the forest does not reach the shore.
Abundance, composition and distribution of solid wastes in the ...
African Journals Online (AJOL)
... 2013 at 68 stations in six depth strata using the bottom trawl swept area method. ... (42%), longlines and hooks (7%), plastic bags (4%), floats (2%), and clothing (1%). ... solid waste pollution is not at present a major problem in Lake Victoria.
African Journals Online (AJOL)
Items 1 - 50 of 102 ... Journal of Civil Engineering Research and Practice. ... Economy: The Case of Inter-Regional Traffic Flow in the Lake Victoria Basin, ... Vol 7, No 1 (2010), Application of GIS-Based Spatially Distributed Hydrologic Model in ...
African Journals Online (AJOL)
Items 101 - 150 of 273 ... Vol 32 (2006):, Lead pollution in urban roadside environments of Dar es ... Vol 30 (2004): Special Issue on Lake Victoria, Levels of nitrate and ... of Tyrosine Hydroxylase Immunoreactive Cells in the Mouse Islets of ...
Search Results | Page 15 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 141 - 150 of 163 ... Neglect and demographic growth have made Tebbaneh district of Tripoli ... in closely constructed houses built right up to the edge of the Rimac River. ... effect on human health and polluting Lake Victoria in East Africa.
African Journals Online (AJOL)
Items 51 - 100 of 273 ... Vol 43, No 1 (2017), Design of a Small Scale Wind Generator for Low ... Seeding and Seedling Treatments on Plant Species Recovery in Kondoa ... size structure and distribution in non-Trawlable areas of Lake Victoria ...
2010-06-21
...-AA00 Safety Zone; Fireworks for the Virginia Lake Festival, Buggs Island Lake, Clarksville, VA AGENCY... Fireworks for the Virginia Lake Festival event. This action is intended to restrict vessel traffic movement... Virginia Lake Festival, Buggs Island Lake, Clarksville, VA (a) Regulated Area. The following area is a...
2010-10-05
... DEPARTMENT OF THE INTERIOR Bureau of Indian Affairs Indian Gaming AGENCY: Bureau of Indian Affairs.... FOR FURTHER INFORMATION CONTACT: Paula L. Hart, Director, Office of Indian Gaming, Office of the.... SUPPLEMENTARY INFORMATION: Under section 11 of the Indian Gaming Regulatory Act of 1988 (IGRA), Public Law 100...
2010-07-06
... DEPARTMENT OF THE INTERIOR Bureau of Indian Affairs Indian Gaming AGENCY: Bureau of Indian Affairs...: July 6, 2010. FOR FURTHER INFORMATION CONTACT: Paula L. Hart, Director, Office of Indian Gaming, Office...-4066. SUPPLEMENTARY INFORMATION: Under Section 11 of the Indian Gaming Regulatory Act of 1988 (IGRA...
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Editorial Board. Sadhana. Editor. N Viswanadham, Indian Institute of Science, Bengaluru. Senior Associate Editors. Arakeri J H, Indian Institute of Science, Bengaluru Hari K V S, Indian Institute of Science, Bengaluru Mujumdar P P, Indian Institute of Science, Bengaluru Manoj Kumar Tiwari, Indian Institute of Technology, ...
Multi-decadal modulation of the El Nino-Indian monsoon relationship by Indian Ocean variability
International Nuclear Information System (INIS)
Ummenhofer, Caroline C; Sen Gupta, Alexander; Li Yue; Taschetto, Andrea S; England, Matthew H
2011-01-01
The role of leading modes of Indo-Pacific climate variability is investigated for modulation of the strength of the Indian summer monsoon during the period 1877-2006. In particular, the effect of Indian Ocean conditions on the relationship between the El Nino-Southern Oscillation (ENSO) and the Indian monsoon is explored. Using an extended classification for ENSO and Indian Ocean dipole (IOD) events for the past 130 years and reanalyses, we have expanded previous interannual work to show that variations in Indian Ocean conditions modulate the ENSO-Indian monsoon relationship also on decadal timescales. El Nino events are frequently accompanied by a significantly reduced Indian monsoon and widespread drought conditions due to anomalous subsidence associated with a shift in the descending branch of the zonal Walker circulation. However, for El Nino events that co-occur with positive IOD (pIOD) events, Indian Ocean conditions act to counter El Nino's drought-inducing subsidence by enhancing moisture convergence over the Indian subcontinent, with an average monsoon season resulting. Decadal modulations of the frequency of independent and combined El Nino and pIOD events are consistent with a strengthened El Nino-Indian monsoon relationship observed at the start of the 20th century and the apparent recent weakening of the El Nino-Indian monsoon relationship.
Multi-decadal modulation of the El Nino-Indian monsoon relationship by Indian Ocean variability
Energy Technology Data Exchange (ETDEWEB)
Ummenhofer, Caroline C; Sen Gupta, Alexander; Li Yue; Taschetto, Andrea S; England, Matthew H, E-mail: c.ummenhofer@unsw.edu.au [Climate Change Research Centre, University of New South Wales, Sydney (Australia)
2011-07-15
The role of leading modes of Indo-Pacific climate variability is investigated for modulation of the strength of the Indian summer monsoon during the period 1877-2006. In particular, the effect of Indian Ocean conditions on the relationship between the El Nino-Southern Oscillation (ENSO) and the Indian monsoon is explored. Using an extended classification for ENSO and Indian Ocean dipole (IOD) events for the past 130 years and reanalyses, we have expanded previous interannual work to show that variations in Indian Ocean conditions modulate the ENSO-Indian monsoon relationship also on decadal timescales. El Nino events are frequently accompanied by a significantly reduced Indian monsoon and widespread drought conditions due to anomalous subsidence associated with a shift in the descending branch of the zonal Walker circulation. However, for El Nino events that co-occur with positive IOD (pIOD) events, Indian Ocean conditions act to counter El Nino's drought-inducing subsidence by enhancing moisture convergence over the Indian subcontinent, with an average monsoon season resulting. Decadal modulations of the frequency of independent and combined El Nino and pIOD events are consistent with a strengthened El Nino-Indian monsoon relationship observed at the start of the 20th century and the apparent recent weakening of the El Nino-Indian monsoon relationship.
Holocene lake-level fluctuations of Lake Aricota, Southern Peru
Placzek, C.; Quade, Jay; Betancourt, J.L.
2001-01-01
Lacustrine deposits exposed around Lake Aricota, Peru (17?? 22???S), a 7.5-km2 lake dammed by debris flows, provide a middle to late Holocene record of lake-level fluctuations. Chronological context for shoreline deposits was obtained from radiocarbon dating of vascular plant remains and other datable material with minimal 14C reservoir effects (Titicaca (16?? S), which is only 130 km to the northeast and shares a similar climatology. Comparisons with other marine and terrestrial records highlight emerging contradictions over the nature of mid-Holocene climate in the central Andes. ?? 2001 University of Washington.
Sand dune movement in the Victoria Valley, Antarctica
Bourke, Mary C.; Ewing, Ryan C.; Finnegan, David; McGowan, Hamish A.
2009-08-01
We use vertical aerial photographs and LiDAR topographic survey data to estimate dune migration rates in the Victoria Valley dunefield, Antarctica, between 1961 and 2001. Results confirm that the dunes migrated an average of 1.5 m/year. These values are consistent with other estimates of dune migration from cold climate deserts and are significantly lower than estimates from warm deserts. Dune migration rates are retarded by the presence of entrained ice, soil moisture and a reversing wind regime. Dune absorption, merging and limb extension are apparent from the time-series images and account for significant changes in dune form and the field-scale dune pattern. Dune-field pattern analysis shows an overall increase in dune-field organization with an increase in mean dune spacing and a reduction in total crest length and defect density. These data suggest that dunes in other cold desert environments on Earth, Mars or Titan, that may also have inter-bedded frozen laminae, still have the potential to migrate and organize, albeit at lower rates than dunes in warm deserts.
International Nuclear Information System (INIS)
Wand, U.; Hermichen, W.D.
1988-01-01
Beaver Lake and Radok Lake, the largest known epishelf lake and the deepest freshwater lake on the Antarctic continent, respectively, were isotopically (δ 2 H, δ 18 O) and hydrogeochemically studied. Radok Lake is an isothermal and nonstratified, i.e. homogeneous water body, while Beaver Lake is stratified with respect to temperature, salinity and isotopic composition. The results for the latter attest to freshwater (derived from snow and glacier melt) overlying seawater. (author)
Lake Generated Microseisms at Yellowstone Lake as a Record of Ice Phenology
Mohd Mokhdhari, A. A.; Koper, K. D.; Burlacu, R.
2017-12-01
It has recently been shown that wave action in lakes produces microseisms, which generate noise peaks in the period range of 0.8-1.2 s as recorded by nearby seismic stations. Such noise peaks have been observed at seven seismic stations (H17A, LKWY, B208, B944, YTP, YLA, and YLT) located within 2 km of the Yellowstone Lake shoreline. Initial work using 2016 data shows that the variations in the microseism signals at Yellowstone Lake correspond with the freezing and thawing of lake ice: the seismic noise occurs more frequently in the spring, summer, and fall, and less commonly in the winter. If this can be confirmed, then lake-generated microseisms could provide a consistent measure of the freezing and melting dates of high-latitude lakes in remote areas. The seismic data would then be useful in assessing the effects of climate change on the ice phenology of those lakes. In this work, we analyze continuous seismic data recorded by the seven seismic stations around Yellowstone Lake for the years of 1995 to 2016. We generate probability distribution functions of power spectral density for each station to observe the broad elevation of energy near a period of 1 s. The time dependence of this 1-s seismic noise energy is analyzed by extracting the power spectral density at 1 s from every processed hour. The seismic observations are compared to direct measurements of the dates of ice-out and freeze-up as reported by rangers at Yellowstone National Park. We examine how accurate the seismic data are in recording the freezing and melting of Yellowstone Lake, and how the accuracy changes as a function of the number of stations used. We also examine how sensitive the results are to the particular range of periods that are analyzed.
Monitoring climate signal transfer into the varved lake sediments of Lake Czechowskie, Poland
Groß-Schmölders, Miriam; Ott, Florian; Brykała, Dariusz; Gierszewski, Piotr; Kaszubski, Michał; Kienel, Ulrike; Brauer, Achim
2015-04-01
In 2012 we started a monitoring program at Lake Czechowskie, Poland, because the lake comprises a long Holocene time series of calcite varves until recent times. The aim of the program is to understand how environmental and climatic conditions influence the hydrological conditions and, ultimately, the sediment deposition processes of the lake. Lake Czechowskie is located in the north of Poland in the Pomeranian Lake District and is part of the national park Tuchola Forest. The landscape and the lake is formed by the glacier retreat after the last glaciation (Weichselian). Lake Czechowskie is a typical hardwater lake and has a length of 1.4 km, an average width of 600 m and a lake surface area of ca 4 km. The maximum depth of 32 m is reached in a rather small hollow in the eastern part of the lake. Two different types of sediment traps provide sediment samples with monthly resolution from different water depths (12m, 26m). In addition, hydrological data including water temperature in different depths, water inflow, throughflow and outflow and the depth of visibility are measured. These data allow to describe strength and duration of lake mixing in spring and autumn and its influence on sedimentation. The sediment samples were analyzed with respect to their dry weight (used to calculate mean daily sediment flux), their inorganic and organic carbon contents, the stable C- and O-isotopes of organic matter and calcite as well as N-isotopes of organic matter. For selected samples dominant diatom taxa are determined. Our first results demonstrate the strong influence of the long winter with ice cover until April in 2013 on the sedimentation. A rapid warming in only 9 days starting on April 9th from -0,3 C° to 15,2 C° resulted in fast ice break-up and a short but intensive lake mixing. In consequence of this short mixing period a strong algal bloom especially of Fragilaria and Crysophycea commenced in April and had its maximum in May. This bloom further induced biogenic
2011-07-19
... DEPARTMENT OF THE INTERIOR Bureau of Indian Affairs Indian Gaming AGENCY: Bureau of Indian Affairs... Date: July 19, 2011. FOR FURTHER INFORMATION CONTACT: Paula L. Hart, Director, Office of Indian Gaming... INFORMATION: Under section 11 of the Indian Gaming Regulatory Act of 1988 (IGRA), Public Law 100-497, 25 U.S.C...
Vadakkeyakath, Y.; Müller, R.; Dyment, J.; Bhattacharya, G.; Lister, G. S.; Kattoju, K. R.; Whittaker, J.; Shuhail, M.; Gibbons, A.; Jacob, J.; White, L. T.; Bissessur, P. D.; Kiranmai, S.
2012-12-01
The Indian Ocean formed as a result of the fragmentation and dispersal of East Gondwanaland since the Jurassic. The deep ocean basins in the Indian Ocean contain the imprints of this plate tectonic history, which is related with several major events such as the Kerguelen, Marion and Reunion hotspot inception and the Indo-Eurasian collision. A broad model for evolution of the Indian Ocean was proposed in the early 1980s. Subsequently, French scientists collected a large amount of magnetic data from the western and southern parts of the Indian Ocean while Indian and Australian scientists collected considerable volumes of magnetic data from the regions of Indian Ocean around their mainlands. Using these data, the Indian, French and Australian researchers independently carried out investigations over different parts of the Indian Ocean and provided improved models of plate kinematics at different sectoral plate boundaries. Under two Indo-French collaborative projects, detailed magnetic investigations were carried out in the Northwestern and Central Indian Ocean by combining the available magnetic data from conjugate regions. Those projects were complemented by additional area-specific studies in the Mascarene, Wharton, Laxmi and Gop basins, which are characterized by extinct spreading regimes. These Indo-French projects provided high resolution and improved plate tectonic models for the evolution of the conjugate Arabian and Eastern Somali basins that constrain the relative motion between the Indian-African (now Indian-Somalian) plate boundaries, and the conjugate Central Indian, Crozet and Madagascar basins that mainly constrain the relative motions of Indian-African (now Capricorn-Somalian) and Indian-Antarctic (now Capricorn-Antarctic) plate boundaries. During the same period, Australian scientists carried out investigations in the southeastern part of the Indian Ocean and provided an improved understanding of the plate tectonic evolution of the Indian
Indian Americans at Mille Lacs.
Holbert, Victoria L.; And Others
The Training Center for Community Programs prepared a report on the Mille Lacs (Chippewa) Reservation in Minnesota. Data for the report were from 2 separate sources: a survey conducted by the Training Center with the assistance of the Mille Lacs community action program (1967) and an attitudinal survey conducted by Victoria Holbert during 1969.…
Pellegrini, K.; Logan, J.; Esterlis, P.; Lew, A.; Nguyen, M.
2013-12-01
Introduction/Abstract: Lake Chabot is an integral part of the East Bay watershed that provides habitats for animals and recreation for humans year-round. Lake Chabot has been in danger of eutrophication due to excessive dumping of phosphorous and nitrogen into the water from the fertilizers of nearby golf courses and neighboring houses. If the lake turned out to be eutrophified, it could seriously impact what is currently the standby emergency water supply for many Castro Valley residents. Eutrophication is the excessive richness of nutrients such as nitrogen and phosphorus in a lake, usually as a result of runoff. This buildup of nutrients causes algal blooms. The algae uses up most of the oxygen in the water, and when it dies, it causes the lake to hypoxify. The fish in the lake can't breathe, and consequently suffocate. Other oxygen-dependant aquatic creatures die off as well. Needless to say, the eutrophication of a lake is bad news for the wildlife that lives in or around it. The level of eutrophication in our area in Northern California tends to increase during the late spring/early summer months, so our crew went out and took samples of Lake Chabot on June 2. We focused on the area of the lake where the water enters, known on the map as Honker Bay. We also took readings a ways down in deeper water for comparison's sake. Visually, the lake looked in bad shape. The water was a murky green that glimmered with particulate matter that swirled around the boat as we went by. In the Honker Bay region where we focused our testing, there were reeds bathed in algae that coated the surface of the lake in thick, swirling patterns. Surprisingly enough, however, our test results didn't reveal any extreme levels of phosphorous or nitrogen. They were slightly higher than usual, but not by any significant amount. The levels we found were high enough to stimulate plant and algae growth and promote eutrophication, but not enough to do any severe damage. After a briefing with a
Wang, Junbo; Qiao, Baojin; Huang, Lei; Zhu, Liping
2016-04-01
water and river water is much higher during Indian summer monsoon (ISM) period than the pre-monsoon period. The TDS concentration of lake water shows a rapid increase from early August and reaches 2.5 times of pre-monsoon period within one month indicating that due to the rise of temperature and increase of rainfall, rock weathering is enhanced, thus the runoff could take much more chemical composition into the river and the lake. During the post-monsoon period, the TDS of lake water is still keeping in a high level as in monsoon period, probably resulting from the balance between concentration of ions due to lake water loss and decrease of terrestrial ion input. K+ and Cl- of rainfall may originate from evaporation of lake water and mineral aerosols, and the dissolved carbonates are responsible for the chemical composition of rainfall water.
National Research Council Canada - National Science Library
Scharf, Burkhard W; Björk, Sven
1992-01-01
... & morphometry - Physical & chemical characteristics - Calcite precipitation & solution in Lake Laacher See - Investigations using sediment traps in Lake Gemundener Maar - Phytoplankton of Lake Weinfelder Maar...
Directory of Open Access Journals (Sweden)
Yunliang Li
2015-04-01
Full Text Available Most biochemical processes and associated water quality in lakes depends on their flushing abilities. The main objective of this study was to investigate the transport time scale in a large floodplain lake, Poyang Lake (China. A 2D hydrodynamic model (MIKE 21 was combined with dye tracer simulations to determine residence and travel times of the lake for various water level variation periods. The results indicate that Poyang Lake exhibits strong but spatially heterogeneous residence times that vary with its highly seasonal water level dynamics. Generally, the average residence times are less than 10 days along the lake’s main flow channels due to the prevailing northward flow pattern; whereas approximately 30 days were estimated during high water level conditions in the summer. The local topographically controlled flow patterns substantially increase the residence time in some bays with high spatial values of six months to one year during all water level variation periods. Depending on changes in the water level regime, the travel times from the pollution sources to the lake outlet during the high and falling water level periods (up to 32 days are four times greater than those under the rising and low water level periods (approximately seven days.
Sexual difference in PCB concentrations of lake trout (Salvelinus namaycush) from Lake Ontario
Madenjian, Charles P.; Keir, Michael J.; Whittle, D. Michael; Noguchi, George E.
2010-01-01
We determined polychlorinated biphenyl (PCB) concentrations in 61 female lake trout (Salvelinus namaycush) and 71 male lake trout from Lake Ontario (Ontario, Canada and New York, United States). To estimate the expected change in PCB concentration due to spawning, PCB concentrations in gonads and in somatic tissue of lake trout were also determined. In addition, bioenergetics modeling was applied to investigate whether gross growth efficiency (GGE) differed between the sexes. Results showed that, on average, males were 22% higher in PCB concentration than females in Lake Ontario. Results from the PCB determinations of the gonads and somatic tissues revealed that shedding of the gametes led to 3% and 14% increases in PCB concentration for males and females, respectively. Therefore, shedding of the gametes could not explain the higher PCB concentration in male lake trout. According to the bioenergetics modeling results, GGE of males was about 2% higher than adult female GGE, on average. Thus, bioenergetics modeling could not explain the higher PCB concentrations exhibited by the males. Nevertheless, a sexual difference in GGE remained a plausible explanation for the sexual difference in PCB concentrations of the lake trout.
L-Lake macroinvertebrate community
International Nuclear Information System (INIS)
Specht, W.L.
1996-06-01
To characterize the present benthic macroinvertebrate community of L-Lake, Regions 5 and 7 of the reservoir were sampled in September 1995 at the same locations sampled in 1988 and 1989 during the L-Lake monitoring program. The macroinvertebrate community of 1995 is compared to that of 1988 and 1989. The species composition of L-Lake's macroinvertebrate community has changed considerably since 1988-1989, due primarily to maturation of the reservoir ecosystem. L-Lake contains a reasonably diverse macroinvertebrate community that is capable of supporting higher trophic levels, including a diverse assemblage of fish species. The L-Lake macroinvertebrate community is similar to those of many other southeastern reservoirs, and there is no indication that the macroinvertebrate community is perturbed by chemical or physical stressors
L-Lake macroinvertebrate community
Energy Technology Data Exchange (ETDEWEB)
Specht, W.L.
1996-06-01
To characterize the present benthic macroinvertebrate community of L-Lake, Regions 5 and 7 of the reservoir were sampled in September 1995 at the same locations sampled in 1988 and 1989 during the L-Lake monitoring program. The macroinvertebrate community of 1995 is compared to that of 1988 and 1989. The species composition of L-Lake`s macroinvertebrate community has changed considerably since 1988-1989, due primarily to maturation of the reservoir ecosystem. L-Lake contains a reasonably diverse macroinvertebrate community that is capable of supporting higher trophic levels, including a diverse assemblage of fish species. The L-Lake macroinvertebrate community is similar to those of many other southeastern reservoirs, and there is no indication that the macroinvertebrate community is perturbed by chemical or physical stressors.
Productivity changes in the Gas and Fuel Corporation of Victoria
International Nuclear Information System (INIS)
Rushdi, A.
1994-01-01
The study reveals that the total factor productivity in the Gas and Fuel Corporation of Victoria (GFCV) continued to increase throughout the study period except for a brief period between 1983-84 and 1984-85 which was mainly the result of the decline in the industrial demand for gas and a decelerated growth rate in residential demand. The productivity gains were found to be highly sensitive to the rates of depreciation and discount rates assumed. The estimated terms of trade suggest that the increase in gas prices was lower that the increase in the aggregate input prices the GFCV paid, particularly to capital and labour. However, while the price index of reticulated gas increased to 2.17, the purchase price declined to 0.96 over the study period. The productivity gains by GFCV seem to have been shared with its customers. (Author)
Water-quality and lake-stage data for Wisconsin lakes, water years 2012–2013
Manteufel, S. Bridgett; Robertson, Dale M.
2017-05-25
IntroductionThe U.S. Geological Survey (USGS), in cooperation with local and other agencies, collects data at selected lakes throughout Wisconsin. These data, accumulated over many years, provide a data base for developing an improved understanding of the water quality of lakes. To make these data available to interested parties outside the USGS, the data are published annually in this report series. The locations of water-quality and lake-stage stations in Wisconsin for water year 2012 are shown in figure 1. A water year is the 12-month period from October 1 through September 30. It is designated by the calendar year in which it ends. Thus, the period October 1, 2011 through September 30, 2012, is called “water year 2012.”The purpose of this report is to provide information about the chemical and physical characteristics of Wisconsin lakes. Data that have been collected at specific lakes, and information to aid in the interpretation of those data, are included in this report. Data collected include measurements of in-lake water quality and lake stage. Time series of Secchi depths, surface total phosphorus and chlorophyll a concentrations collected during non-frozen periods are included for all lakes. Graphs of vertical profiles of temperature, dissolved oxygen, pH, and specific conductance are included for sites where these parameters were measured. Descriptive information for each lake includes: location of the lake, area of the lake’s watershed, period for which data are available, revisions to previously published records, and pertinent remarks. Additional data, such as streamflow and water quality in tributary and outlet streams of some of the lakes, are published online at http://nwis.waterdata.usgs.gov/wi/nwis.Water-resources data, including stage and discharge data at most streamflow-gaging stations, are available online. The Wisconsin Water Science Center’s home page is at https://www.usgs.gov/centers/wisconsin-water-science-center. Information on
Directory of Open Access Journals (Sweden)
Claire Archer
2016-12-01
Full Text Available Lake Lungo and Lake Ripasottile are two shallow (4-5 m lakes located in the Rieti Basin, central Italy, that have been described previously as surface outcroppings of the groundwater table. In this work, the two lakes as well as springs and rivers that represent their potential source waters are characterized physio-chemically and isotopically, using a combination of environmental tracers. Temperature and pH were measured and water samples were analyzed for alkalinity, major ion concentration, and stable isotope (δ2H, δ18O, δ13C of dissolved inorganic carbon, and δ34S and δ18O of sulfate composition. Chemical data were also investigated in terms of local meteorological data (air temperature, precipitation to determine the sensitivity of lake parameters to changes in the surrounding environment. Groundwater represented by samples taken from Santa Susanna Spring was shown to be distinct with SO42- and Mg2+ content of 270 and 29 mg/L, respectively, and heavy sulfate isotopic composition (δ34S=15.2 ‰ and δ18O=10‰. Outflow from the Santa Susanna Spring enters Lake Ripasottile via a canal and both spring and lake water exhibits the same chemical distinctions and comparatively low seasonal variability. Major ion concentrations in Lake Lungo are similar to the Vicenna Riara Spring and are interpreted to represent the groundwater locally recharged within the plain. The δ13CDIC exhibit the same groupings as the other chemical parameters, providing supporting evidence of the source relationships. Lake Lungo exhibited exceptional ranges of δ13CDIC (±5 ‰ and δ2H, δ18O (±5 ‰ and ±7 ‰, respectively, attributed to sensitivity to seasonal changes. The hydrochemistry results, particularly major ion data, highlight how the two lakes, though geographically and morphologically similar, represent distinct hydrochemical facies. These data also show a different response in each lake to temperature and precipitation patterns in the basin that
African Journals Online (AJOL)
Items 251 - 300 of 763 ... ... A Vision of Lake Victoria Basin as an Environmental Observatory ... Vol 4, No 8 (2010), Effect of leaching on heavy metals concentration of soil in some ... Vol 7, No 2 (2013), Effect of remediation on growth parameters, ...
New Fellows and Honorary Fellow
Indian Academy of Sciences (India)
Home; Fellowship. Fellow Profile. Elected: 1957 Section: Plant Sciences. Desikachary, Prof. Thamarapu Vedantha D.Sc. (Madras), FNA. Date of birth: 18 September 1919. Date of death: 5 November 2005. Specialization: Phycology Last known address: 67, Palm Beach Dr., Patterson Lakes, Victoria 3197, Australia.
Hansen, Michael J.; Hansen, Barry S; Beauchamp, David A.
2016-01-01
Non-native lake trout Salvelinus namaycush displaced native bull trout Salvelinus confluentus in Flathead Lake, Montana, USA, after 1984, when Mysis diluviana became abundant following its introduction in upstream lakes in 1968–1976. We developed a simulation model to determine the fishing mortality rate on lake trout that would enable bull trout recovery. Model simulations indicated that suppression of adult lake trout by 75% from current abundance would reduce predation on bull trout by 90%. Current removals of lake trout through incentivized fishing contests has not been sufficient to suppress lake trout abundance estimated by mark-recapture or indexed by stratified-random gill netting. In contrast, size structure, body condition, mortality, and maturity are changing consistent with a density-dependent reduction in lake trout abundance. Population modeling indicated total fishing effort would need to increase 3-fold to reduce adult lake trout population density by 75%. We conclude that increased fishing effort would suppress lake trout population density and predation on juvenile bull trout, and thereby enable higher abundance of adult bull trout in Flathead Lake and its tributaries.
The Living Indian Critical Tradition
Directory of Open Access Journals (Sweden)
Vivek Kumar Dwivedi
2010-11-01
Full Text Available This paper attempts to establish the identity of something that is often considered to be missing – a living Indian critical tradition. I refer to the tradition that arises out of the work of those Indians who write in English. The chief architects of this tradition are Sri Aurobindo, C.D. Narasimhaiah, Gayatri Chakravorty Spivak and Homi K. Bhabha. It is possible to believe that Indian literary theories derive almost solely from ancient Sanskrit poetics. Or, alternatively, one can be concerned about the sad state of affairs regarding Indian literary theories or criticism in English. There have been scholars who have raised the question of the pathetic state of Indian scholarship in English and have even come up with some positive suggestions. But these scholars are those who are ignorant about the living Indian critical tradition. The significance of the Indian critical tradition lies in the fact that it provides the real focus to the Indian critical scene. Without an awareness of this tradition Indian literary scholarship (which is quite a different thing from Indian literary criticism and theory as it does not have the same impact as the latter two do can easily fail to see who the real Indian literary critics and theorists are.
de Bres, Julia; Holmes, Janet; Joe, Angela; Marra, Meredith; Newton, Jonathan; Riddiford Nicky; Vine, Bernadette
2009-01-01
The School of Linguistics and Applied Language Studies (LALS) at Victoria University of Wellington conducts research and teaching in Linguistics, Applied Linguistics, Writing and Deaf Studies. It incorporates a Deaf Studies Research Unit, which undertakes research on topics relating to deaf people and their language in New Zealand, and the New…
Fusaro, R M; Johnson, J A
1996-04-01
Hereditary polymorphic light eruption (HPLE) occurs unique ly in the American Indian and Inuit and exhibits autosomal dominant transmission. Because the cutaneous expression of HPLE resembles that of polymorphic light eruption (PLE) and because many non-Indians in the United States have American Indian heritage, some instances of PLE may actually be HPLE. Our purpose was to determine whether non-Indian patients with PLE have characteristics suggestive of HPLE. We surveyed in Nebraska 25 European-Caucasian and 36 African-American patients with PLE for American Indian heritage and photosensitive relatives. Nonphotosensitive subjects (52 Caucasians and 40 African Americans) were surveyed for American Indian heritage. American Indian heritage occurred in 11 Caucasian patients (44%); of those, seven (64%) had photosensitive relatives. Likewise, 29 African Americans (81%) had American Indian heritage; 19 (66%) of those had photosensitive relatives. American Indian heritage occurred in 10 Caucasian control subjects (19%) and in 34 African-American control subjects (85%). If American Indian heritage and a family history of photosensitivity are definitive for HPLE, seven (28%) of our Caucasian patients and 19 (53%) of our African-American patients have HPLE rather than PLE. We urge physicians who suspect PLE in non-Indians to ask about American Indian heritage and photosensitive relatives and to screen their present patients with PLE for such characteristics.
Lake Morphometry for NHD Lakes in Upper Colorado Region 14 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
Lake Morphometry for NHD Lakes in North East Region 1 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
Lake Morphometry for NHD Lakes in Lower Colorado Region 15 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
Lake Morphometry for NHD Lakes in Upper Mississippi Region 7 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
Lake Morphometry for NHD Lakes in Rio Grande Region 13 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
Lake Morphometry for NHD Lakes in Pacific Northwest Region 17 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
Lake Morphometry for NHD Lakes in Lower Mississippi Region 8 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
Lake Morphometry for NHD Lakes in Texas-Gulf Region 12 HUC
U.S. Environmental Protection Agency — Lake morphometry metrics are known to influence productivity in lakes and are important for building various types of ecological and environmental models of lentic...
2010-04-29
...] Upper Klamath, Lower Klamath, Tule Lake, Bear Valley, and Clear Lake National Wildlife Refuges, Klamath..., Bear Valley, and Clear Lake National Wildlife Refuges (Refuges) located in Klamath County, Oregon, and..., Tule Lake, Bear Valley, and Clear Lake Refuges located in Klamath County, Oregon, and Siskiyou and...
International Nuclear Information System (INIS)
1991-01-01
Key Lake is located in the Athabasca sand stone basin, 640 kilometers north of Saskatoon, Saskatchewan, Canada. The three sources of ore at Key Lake contain 70 100 tonnes of uranium. Features of the Key Lake Project were described under the key headings: work force, mining, mill process, tailings storage, permanent camp, environmental features, worker health and safety, and economic benefits. Appendices covering the historical background, construction projects, comparisons of western world mines, mining statistics, Northern Saskatchewan surface lease, and Key Lake development and regulatory agencies were included
Birth centre confinement at the Queen Victoria Medical Centre. I. Obstetric and neonatal outcome.
Campbell, J; Hudson, H; Lumley, J; Morris, N; Rao, J; Spensley, J
1981-10-03
A review of hte first 175 confinements at the Queen Victoria Medical Centre Birth Centre is presented. The design, structure and function of hte Birth Centre is described and the safety of the programme demonstrated. Seventy-four pregnancies (42%) accepted for Birth Centre confinement required transfer because of antepartum or intrapartum complications. There were satisfactory obstetric and neonatal outcomes in all pregnancies. The first year's experience has allowed a reassessment of the risk factors, which will permit greater use of the Birth Centre without any increases risk to mothers or babies.
Thayer Lake Hydropower Development -- Final Report
Energy Technology Data Exchange (ETDEWEB)
Matousek, Mark [ORENCO Hydropower, Palo Alto, CA (United States)
2017-06-30
The Thayer Lake Hydropower Development (THLD) has been under study since the late 1970’s as Angoon explored opportunities to provide lower cost renewable power to the Community and avoid the high cost of diesel generation. Kootznoowoo Inc. (Kootznoowoo), the tribal corporation for Angoon’s current and past residents, was provided the rights by Congress to develop a hydropower project within the Admiralty Island National Monument. This grant (DE-EE0002504) by the Department of Energy’s (DOE’s) Office of Indian Energy and a matching grant from the Alaska Energy Authority (AEA) were provided to Kootznoowoo to enable the design, engineering and permitting of this hydropower project on Thayer Creek. Prior to the grant, the USFS had performed a final environmental impact statement (FEIS) and issued a Record of Decision (ROD) in 2009 for a 1.2 MW hydropower project on Thayer Creek that would Angoon’s needs with substantial excess capacity for growth. Kootznoowoo hired Alaska Power & Telephone (AP&T) in 2013 to manage this project and oversee its development. AP&T and its subcontractors under Kootznoowoo’s guidance performed several activities, aligned with the task plan defined in the grant.
Preparation and Consumer Acceptance of Indian Mango Leather and Osmo - Dehyrated Indian Mango
Directory of Open Access Journals (Sweden)
Cyril John A. Domingo
2017-05-01
Full Text Available Indian mangoes are considered highly perishable products due to high moisture content which resulted in high postharvest losses in Pangasinan, Philippines. This study exploits the potential of underutilized indian mango to value - added products. The developed i ndian mango leather and osmo - dehyrated indian mango are deh ydrated fruit products can be eaten as snacks or desserts. Indian mango leathe r was prepared by mixing fruit puree and other additives like sugar, citric acid, and sodium met abisulphite and then dehydrated them at 55 °C for 15 hours under convective oven. Osmo - dehydrated indian mang o was prepared by immer sing h alves of deseeded and deskinned pulps in 50 % (w/w sucrose solution for 20 hours f ollowed by drying initially at 50 °C then aft er one hour at 60 °C for 15 hours. Thirty - three member untrained panels were involved in consumer a ccep tance evaluation . Panelists evaluated the colo r, sweetness, sourness, texture, and overall acceptability of the osmotically - treated indian mango and indian mango leather using seven - point h edonic scale . Over - all, the indian mango leather and osmo - dehy drated indian mango developed in this study seemed to be acceptable for all the sensory parameters as indicated by high scores of greater than five (>5 .
Perceptions of prescribed burning in a local forest community in Victoria, Australia.
Bell, Tina; Oliveras, Immaculada
2006-11-01
The general perceptions of prescribed burning were elicited from forest users for an area that has been subject to this form of land management for at least 20 years. The largest group consisted of local residents living in and around the Wombat State Forest with two smaller groups of students from a nearby university campus and local professional land managers. A questionnaire was given to each participant in order to explore how the forest was used, to determine the level of knowledge of burning in the targeted forest and Victoria and the perception of the appearance, effectiveness of protection, and accessibility to the forest after prescribed burning. Generally all groups had similar responses with community members having stronger views on the effectiveness and practicalities of prescribed burning, whereas students were more neutral in their opinions. All participants claimed knowledge of prescribed burning activities within Victoria, but fewer had experience of planned fires in the Wombat State Forest. All groups agreed that areas that had not been recently burned had a better appearance than those that had, but this result may have included a range of value judgments. Land managers had a greater understanding of the ecological importance of season and timing of burning; however, some students and community members were equally knowledgeable. Prescribed burning did not impede access to the forest, nor did smoke from prescribed burns pose any great problem. The majority of the participants felt that the amount of prescribed burning done in the forest was adequate for engendering a feeling of protection to life and property, yet many were still suspicious of this management practice. These initial findings indicate several areas in which further research would be useful including the efficacy of education programs for community members and improved communication of burn plans by land managers.