Incoherent SSI Analysis of Reactor Building using 2007 Hard-Rock Coherency Model
International Nuclear Information System (INIS)
Kang, Joo-Hyung; Lee, Sang-Hoon
2008-01-01
Many strong earthquake recordings show the response motions at building foundations to be less intense than the corresponding free-field motions. To account for these phenomena, the concept of spatial variation, or wave incoherence was introduced. Several approaches for its application to practical analysis and design as part of soil-structure interaction (SSI) effect have been developed. However, conventional wave incoherency models didn't reflect the characteristics of earthquake data from hard-rock site, and their application to the practical nuclear structures on the hard-rock sites was not justified sufficiently. This paper is focused on the response impact of hard-rock coherency model proposed in 2007 on the incoherent SSI analysis results of nuclear power plant (NPP) structure. A typical reactor building of pressurized water reactor (PWR) type NPP is modeled classified into surface and embedded foundations. The model is also assumed to be located on medium-hard rock and hard-rock sites. The SSI analysis results are obtained and compared in case of coherent and incoherent input motions. The structural responses considering rocking and torsion effects are also investigated
International Nuclear Information System (INIS)
Elkhoraibi, T.; Hashemi, A.; Ostadan, F.
2014-01-01
Soil-structure interaction (SSI) is a major step for seismic design of massive and stiff structures typical of the nuclear facilities and civil infrastructures such as tunnels, underground stations, dams and lock head structures. Currently most SSI analyses are performed deterministically, incorporating limited range of variation in soil and structural properties and without consideration of the ground motion incoherency effects. This often leads to overestimation of the seismic response particularly the In-Structure-Response Spectra (ISRS) with significant impositions of design and equipment qualification costs, especially in the case of high-frequency sensitive equipment at stiff soil or rock sites. The reluctance to incorporate a more comprehensive probabilistic approach is mainly due to the fact that the computational cost of performing probabilistic SSI analysis even without incoherency function considerations has been prohibitive. As such, bounding deterministic approaches have been preferred by the industry and accepted by the regulatory agencies. However, given the recently available and growing computing capabilities, the need for a probabilistic-based approach to the SSI analysis is becoming clear with the advances in performance-based engineering and the utilization of fragility analysis in the decision making process whether by the owners or the regulatory agencies. This paper demonstrates the use of both probabilistic and deterministic SSI analysis techniques to identify important engineering demand parameters in the structure. A typical nuclear industry structure is used as an example for this study. The system is analyzed for two different site conditions: rock and deep soil. Both deterministic and probabilistic SSI analysis approaches are performed, using the program SASSI, with and without ground motion incoherency considerations. In both approaches, the analysis begins at the hard rock level using the low frequency and high frequency hard rock
Energy Technology Data Exchange (ETDEWEB)
Elkhoraibi, T., E-mail: telkhora@bechtel.com; Hashemi, A.; Ostadan, F.
2014-04-01
Soil-structure interaction (SSI) is a major step for seismic design of massive and stiff structures typical of the nuclear facilities and civil infrastructures such as tunnels, underground stations, dams and lock head structures. Currently most SSI analyses are performed deterministically, incorporating limited range of variation in soil and structural properties and without consideration of the ground motion incoherency effects. This often leads to overestimation of the seismic response particularly the In-Structure-Response Spectra (ISRS) with significant impositions of design and equipment qualification costs, especially in the case of high-frequency sensitive equipment at stiff soil or rock sites. The reluctance to incorporate a more comprehensive probabilistic approach is mainly due to the fact that the computational cost of performing probabilistic SSI analysis even without incoherency function considerations has been prohibitive. As such, bounding deterministic approaches have been preferred by the industry and accepted by the regulatory agencies. However, given the recently available and growing computing capabilities, the need for a probabilistic-based approach to the SSI analysis is becoming clear with the advances in performance-based engineering and the utilization of fragility analysis in the decision making process whether by the owners or the regulatory agencies. This paper demonstrates the use of both probabilistic and deterministic SSI analysis techniques to identify important engineering demand parameters in the structure. A typical nuclear industry structure is used as an example for this study. The system is analyzed for two different site conditions: rock and deep soil. Both deterministic and probabilistic SSI analysis approaches are performed, using the program SASSI, with and without ground motion incoherency considerations. In both approaches, the analysis begins at the hard rock level using the low frequency and high frequency hard rock
Influence of different boundary conditions on analysis of SSI
International Nuclear Information System (INIS)
Wang Jiachun
2005-01-01
In the discussions of structural response to earthquakes, it has been assumed that the foundation medium is very stiff and that the seismic motions applied at the structure support points are the same as the free-field earthquake motions at those locations; in other words, the effects of soil structure interaction (SSI) have been neglected. However, its effects can be significant when the structure supported on a soft soil. Structures on the ground are affected by ground motion when there is seismic loading. The inability of the foundation to resist to deformation of soil would cause huge damages on the structures. The different codes and boundary conditions affect on analysis results of SSI. A comparison of the reactor buildings response as predicted by CLASSI and FLUSH shows substantial differences. To absorb, rather than reflect, the outwardly radiated energy, transmitting boundary conditions and soil structure interface should be taken into consideration in analysis of SSI. The paper discusses influence of several different boundary conditions on analysis of SSI. (author)
FT4 Data Analysis Summary (SSI-ARC)
Isaacson, Douglas R.; Gong, Chester; Reardon, Scott Edward; Santiago, Confesor
2016-01-01
Standards for Unmanned Aircraft System (UAS) Detect-and-Avoid (DAA) systems are currently being developed under the auspices of the RTCA Special Committee 228 (SC-228). To support the development of these standards, a series of flight tests has been conducted at NASAs Armstrong Flight Research Center (NASA-AFRC). The fourth in this series of flight test activities (Flight Test 4, or simply FT4) was conducted during the Spring and Summer of 2016. FT4 supported the objectives of numerous organizations working toward UAS DAA Minimum Operational Performance Standards (MOPS) and UAS DAA Radar MOPS. The summary provided herein is limited to the objectives, analysis and conclusions of the NASA Ames Research Center (NASA-ARC) SSI team toward the refinement of UAS DAA MOPS. This document provides a high-level overview of FT4 and the SSI-ARC objectives, a summary of the data analysis methodology and recommendations for UAS DAA MOPS refinements based on the data analysis results. A total of 72 encounters were flown to support SSI-ARC objectives. Test results were generally consistent with acceptable UAS DAA system performance and will be considered in broader SC-228 requirements validation efforts. Observed alert lead times indicated acceptable UAS DAA alerting performance. Effective interoperability between the UAS DAA system and the Traffic Alert and Collision Avoidance System (TCAS) was observed with one notable exception: TCAS Resolutions Advisories (RA) were observed in the absence of any DAA alert on two occasions, indicating the need for alert parameter refinement. Findings further indicated the need for continued work in the areas of DAA Well Clear Recovery logic and alert stability for Mode-C-only intruders. Finally, results demonstrated a high level of compliance with a set of evaluation criteria designed to provide anecdotal evidence of acceptable UAS DAA system performance.
SSI analysis of a massive concrete structure based on a novel ...
Indian Academy of Sciences (India)
1Structural Engineering Research Centre, CSIR Campus, Taramani,. Chennai ... In the numerical analysis of an SSI problem, the main difficulty is in representation of the ... validated software tools to execute the task is considered as the main ...
Energy Technology Data Exchange (ETDEWEB)
Avila Moreno, R.; Barrdahl, R.; Haegg, C.
1995-05-01
The main objective of the present study was to carry out a screening and a sensitivity analysis of the SSI TOOLBOX source term model SOSIM. This model is a part of the SSI TOOLBOX for radiological impact assessment of the Swedish disposal concept for high-level waste KBS-3. The outputs of interest for this purpose were: the total released fraction, the time of total release, the time and value of maximum release rate, the dose rates after direct releases of the biosphere. The source term equations were derived and simple equations and methods were proposed for calculation of these. A literature survey has been performed in order to determine a characteristic variation range and a nominal value for each model parameter. In order to reduce the model uncertainties the authors recommend a change in the initial boundary condition for solution of the diffusion equation for highly soluble nuclides. 13 refs.
Directory of Open Access Journals (Sweden)
A. Arifi
2016-07-01
Full Text Available Surgical site infection (SSI, is a preventable and devastating complication with significant morbidity after cardiac surgery. The reported SSI rate at our center, ranging from 3.4% to 11.2% (2007–2013. This rate is considered to be above the standardized rate recommended by the NHSN. Quality improvement project team to address the issue of SSI, (SCIP, where formed by the medical administration late 2014. The aim of the study was to identify SSI risk factors at our cardiac surgical unit, using evidence based practices while taking a local approach to problem solving. We performed Root Cause Analysis (RCA, and we applied other quality improvement tools to identify the area for potential improvement. Data include a Process Map of the pre-operative, intra-operative and post-operative factors that might contribute to SSI risk. We prospectively used the RCA form to investigate all the stages of the patient process map (pre, intra op, and post operatively. The data included the Patient related factors, the sterilization and the hygiene practice in the operating room, and the operating room traffic, and the compliance to the bundle of care. Figure represent the “Fishbone” diagram of the possible causes of SSI after cardiac surgery in our unit. Demographic features of patients with SSI were as follows: mean age-65 years; female 83%; time to infection (mean 101 days; range 1–36 days;. The root cause analysis identified a significant weakness in the compliance to the bundle of care to prevent SSI. Furthermore, the patient flow, the operating theatre cleaning and traffic was also identified as a contributing factor to SSI. Surgical site infection after cardiac surgery is a preventable complication. The application of the evidence based practice and structured way of thinking in problem solving, will help identify the potential risk factors. Focusing on solving the right patient process and visually represents the problem will help identifying the
Analysis of Ion Composition Estimation Accuracy for Incoherent Scatter Radars
Martínez Ledesma, M.; Diaz, M. A.
2017-12-01
The Incoherent Scatter Radar (ISR) is one of the most powerful sounding methods developed to estimate the Ionosphere. This radar system determines the plasma parameters by sending powerful electromagnetic pulses to the Ionosphere and analyzing the received backscatter. This analysis provides information about parameters such as electron and ion temperatures, electron densities, ion composition, and ion drift velocities. Nevertheless in some cases the ISR analysis has ambiguities in the determination of the plasma characteristics. It is of particular relevance the ion composition and temperature ambiguity obtained between the F1 and the lower F2 layers. In this case very similar signals are obtained with different mixtures of molecular ions (NO2+ and O2+) and atomic oxygen ions (O+), and consequently it is not possible to completely discriminate between them. The most common solution to solve this problem is the use of empirical or theoretical models of the ionosphere in the fitting of ambiguous data. More recent works take use of parameters estimated from the Plasma Line band of the radar to reduce the number of parameters to determine. In this work we propose to determine the error estimation of the ion composition ambiguity when using Plasma Line electron density measurements. The sensibility of the ion composition estimation has been also calculated depending on the accuracy of the ionospheric model, showing that the correct estimation is highly dependent on the capacity of the model to approximate the real values. Monte Carlo simulations of data fitting at different signal to noise (SNR) ratios have been done to obtain valid and invalid estimation probability curves. This analysis provides a method to determine the probability of erroneous estimation for different signal fluctuations. Also it can be used as an empirical method to compare the efficiency of the different algorithms and methods on when solving the ion composition ambiguity.
Absolute Bunch Length Measurements by Incoherent Radiation Fluctuation Analysis
International Nuclear Information System (INIS)
Sannibale, F.; Stupakov, G.V.; Zolotorev, M.S.; Filippetto, D.; Jagerhofer, L.
2009-01-01
By analyzing the pulse to pulse intensity fluctuations of the radiation emitted by a charge particle in the incoherent part of the spectrum, it is possible to extract information about the spatial distribution of the beam. At the Advanced Light Source (ALS) of the Lawrence Berkeley National Laboratory, we have developed and successfully tested a simple scheme based on this principle that allows for the absolute measurement of the rms bunch length. A description of the method and the experimental results are presented.
Energy Technology Data Exchange (ETDEWEB)
Magazù, S.; Migliardo, F. [Dipartimento di Fisica e di Scienze della Terra dell’, Università degli Studi di Messina, Viale F. S. D’Alcontres 31, 98166 Messina (Italy); Vertessy, B.G. [Institute of Enzymology, Hungarian Academy of Science, Budapest (Hungary); Caccamo, M.T., E-mail: maccamo@unime.it [Dipartimento di Fisica e di Scienze della Terra dell’, Università degli Studi di Messina, Viale F. S. D’Alcontres 31, 98166 Messina (Italy)
2013-10-16
Highlights: • Innovative multiresolution wavelet analysis of elastic incoherent neutron scattering. • Elastic Incoherent Neutron Scattering measurements on homologues disaccharides. • EINS wavevector analysis. • EINS temperature analysis. - Abstract: In the present paper the results of a wavevector and thermal analysis of Elastic Incoherent Neutron Scattering (EINS) data collected on water mixtures of three homologous disaccharides through a wavelet approach are reported. The wavelet analysis allows to compare both the spatial properties of the three systems in the wavevector range of Q = 0.27 Å{sup −1} ÷ 4.27 Å{sup −1}. It emerges that, differently from previous analyses, for trehalose the scalograms are constantly lower and sharper in respect to maltose and sucrose, giving rise to a global spectral density along the wavevector range markedly less extended. As far as the thermal analysis is concerned, the global scattered intensity profiles suggest a higher thermal restrain of trehalose in respect to the other two homologous disaccharides.
International Nuclear Information System (INIS)
Ermutlu, H.E.
1993-01-01
In order to fulfill the seismic safety requirements, in the frame of seismic requalification activities for NPP Muehleberg, Switzerland, detailed seismic analysis performed on the Reactor Building and the results are presented previously. The primary objective of the present investigation is to assess the seismic safety of the reinforced concrete structures of reactor building. To achieve this objective requires a rather detailed 3-D finite element modeling for the outer shell structures, the drywell, the reactor pools, the floor decks and finally, the basemat. This already is a complicated task, which enforces need for simplifications in modelling the reactor internals and the foundation soil. Accordingly, all internal parts are modelled by vertical sticks and the Soil Structure Interaction (SSI) effects are represented by sets of transitional and higher order rotational WINKLER springs, i.e. avoiding complicated finite element SSI analysis. As a matter of fact, the availability of the results of recent investigations carried out on the reactor building using diversive finite element SSI analysis methods allow to calibrate the WINKLER springs, ensuring that the overall SSI behaviour of the reactor building is maintained
Wamhoff, Steve; Wiseman, Michael
receiving benefits in TANF-related Separate State Programs (SSPs). SSPs are assistance programs that are administered by TANF agencies but are paid for wholly from state funds. When the programs are conducted in a manner consistent with federal regulations, the money states spend on SSPs counts toward federal maintenance-of-effort (MOE) requirements, under which states must sustain a certain level of contribution to the costs of TANF and approved related activities. SSPs are used for a variety of purposes, including support of families who are in the process of applying for SSI. Until very recently, families receiving cash benefits through SSPs were not subject to TANF's work participation requirements. This article contributes to analysis of the interaction between TANF and SSI by evaluating the financial consequences of TANF-to-SSI transfer and developing new estimates of both the prevalence of receipt of SSI benefits among families receiving cash assistance from TANF and the proportion of new SSI awards that go to adults and children residing in families receiving TANF or TANF-related benefits in SSPs. Using data from the Urban Institute's Welfare Rules Database, we find that by 2003 an SSI award for a child in a three-person family dependent on TANF increased family income by 103.5 percent on average across states; an award to the adult in such a family increased income by 115.4 percent. The gain from both child and adult transfers increased by about 6 percent between 1996 (the eve of the welfare reform that produced TANF) and 2003. Using data from the Department of Health and Human Services' TANF/SSP Recipient Family Characteristics Survey, we estimate that 16 percent of families receiving TANF/SSP support in federal fiscal year 2003 included an adult or child SSI recipient. This proportion has increased slightly since fiscal year 2000. The Social Security Administration's current procedures for tabulating characteristics of new SSI awardees do not recognize SSP
Directory of Open Access Journals (Sweden)
Antonio Granero-Gallegos
2013-03-01
Full Text Available O objetivo deste estudo foi analisar as propriedades psicométricas do Sport Satisfation Instrument (SSI adaptado para a Educação Física (EF por meio de uma análise fatorial exploratória da estrutura bidimensional do instrumento em uma amostra espanhola. Com isso, buscou-se determinar, de maneira preliminar, se o SSI constitui um instrumento válido e fiável para ser utilizado em futuras pesquisas. O instrumento foi elaborado em um modelo teórico de dois fatores: Satisfação/Diversão e Tédio. A amostra constituiu-se de um total de 224 alunos de secundária entre 12 e 19 anos. A versão [espanhola] do instrumento adaptado para a EF demonstrou níveis aceitáveis de consistência interna.The objective of this study was to analyze the psychometric properties of Sport Satisfaction Instrument (SSI adapted physical education (PE using exploratory factor analysis of the dimensional structure of the instrument in a Spanish sample. It was intended to determine, on a preliminary basis, whether it constitutes a valid and reliable for use in future research. Was administered to a total of 224 high school students 12 to 19 years. This analysis supports the hypothesized theoretical model of two factors (satisfaction / fun and boredom. The Spanish version of the instrument for PE showed acceptable levels of internal consistency.
A simulation experiment and analysis on the effects of in-coherence in fuel coolant interaction
International Nuclear Information System (INIS)
Kondo, S.; Togo, Y.; Iwamura, T.
1976-01-01
Experimental and analytical studies were conducted to investigate effects of incoherence (space time behavior of molten fuel) on molten fuel coolant interaction. In experiments, a 2 mm diameter molten tin jet was injected upward into the water in a slender tank. The results were analyzed based on the pressure records and high speed photographs. The pressure records indicated that there were two types of interaction between molten jet and water, intermittent explosion mode and continuous one. The explosion mode appeared when the temperature of molten tin was above 350 0 C or so and that of water was below 70 0 C or so. The high speed photograph indicated that an establishment of a stable jet column was necessary for an explosive interaction and that a bubble like region grew and collapsed at the root of the jet in accordance with the generation of pressure pulse. It was found that the mass of metal which contributed to the vapor explosion was only a small part of the injected metal in the case of jet injection type contact mode and this was the reason why the gross thermal to mechanical energy conversion ratio was around 0.03% in this type of contact mode, though this ratio was around 2% if only the part of record around the pressure pulse was taken into consideration. In the analysis part, a multi-channel FCI model was developed to evaluate the spatial incoherence effect on pressure at subassembly exit. The calculated pressure trace indicated that the spatial incoherence has considerable effects for an evaluation of structure response under FCI pressure loading. (auth.)
Zhou, Heng; Qiu, Kun; Wang, Leyang
2011-03-28
A novel wavelength-correlating receiver for incoherent Optical Code Division Multiple Access (OCDMA) system is proposed and demonstrated in this paper. Enabled by the wavelength conversion based scheme, the proposed receiver can support various code types including one-dimensional optical codes and time-spreading/wavelength-hopping two dimensional codes. Also, a synchronous detection scheme with time-to- wavelength based code acquisition is proposed, by which code acquisition time can be substantially reduced. Moreover, a novel data-validation methodology based on all-optical pulse-width monitoring is introduced for the wavelength-correlating receiver. Experimental demonstration of the new proposed receiver is presented and low bit error rate data-receiving is achieved without optical hard limiting and electronic power thresholding. For the first time, a detailed theoretical performance analysis specialized for the wavelength-correlating receiver is presented. Numerical results show that the overall performance of the proposed receiver prevails over conventional OCDMA receivers.
Gaing, Byron; Sigmund, Eric E; Huang, William C; Babb, James S; Parikh, Nainesh S; Stoffel, David; Chandarana, Hersh
2015-03-01
The aim of this study was to determine if voxel-based histogram analysis of intravoxel incoherent motion imaging (IVIM) parameters can differentiate various subtypes of renal tumors, including benign and malignant lesions. A total of 44 patients with renal tumors who underwent surgery and had histopathology available were included in this Health Insurance Portability and Accountability Act-compliant, institutional review board-approved, single-institution prospective study. In addition to routine renal magnetic resonance imaging examination performed on a 1.5-T system, all patients were imaged with axial diffusion-weighted imaging using 8 b values (range, 0-800 s/mm). A biexponential model was fitted to the diffusion signal data using a segmented algorithm to extract the IVIM parameters perfusion fraction (fp), tissue diffusivity (Dt), and pseudodiffusivity (Dp) for each voxel. Mean and histogram measures of heterogeneity (standard deviation, skewness, and kurtosis) of IVIM parameters were correlated with pathology results of tumor subtype using unequal variance t tests to compare subtypes in terms of each measure. Correction for multiple comparisons was accomplished using the Tukey honestly significant difference procedure. A total of 44 renal tumors including 23 clear cell (ccRCC), 4 papillary (pRCC), 5 chromophobe, and 5 cystic renal cell carcinomas, as well as benign lesions, 4 oncocytomas (Onc) and 3 angiomyolipomas (AMLs), were included in our analysis. Mean IVIM parameters fp and Dt differentiated 8 of 15 pairs of renal tumors. Histogram analysis of IVIM parameters differentiated 9 of 15 subtype pairs. One subtype pair (ccRCC vs pRCC) was differentiated by mean analysis but not by histogram analysis. However, 2 other subtype pairs (AML vs Onc and ccRCC vs Onc) were differentiated by histogram distribution parameters exclusively. The standard deviation of Dt [σ(Dt)] differentiated ccRCC (0.362 ± 0.136 × 10 mm/s) from AML (0.199 ± 0.043 × 10 mm/s) (P = 0
Investigation and analysis of SSI effects in seismic response of NPPs EMO and EBO
International Nuclear Information System (INIS)
Juhasova, E.
1996-01-01
This progress report outlines and describes the analysis and investigations of soil-structure interaction effects in seismic response of Bohunice and Mochovce nuclear power plants. The work carries out consists of theoretical-numerical analysis of soil-structure interaction and the description of the experimental results obtained so far. Investigations were performed for different soil conditions and recommendations were elaborated as to prepare and use long-term monitoring of vibration activity at the Bohunice NPP site
Spatially continuous approach to the description of incoherencies in fast reactor accident analysis
International Nuclear Information System (INIS)
Luck, L.B.
1976-12-01
A generalized cell-type approach is developed in which individual subassemblies are represented as a unit. By appropriate characterization of the results of separate detailed investigations, spatial variations within a cell are represented as a superposition. The advantage of this approach is that costly detailed cell-type information is generated only once or a very few times. Spatial information obtained by the cell treatment is properly condensed in order to drastically reduce the transient computation time. Approximate treatments of transient phenomena are developed based on the use of distributions of volume and reactivity worth with temperature and other reactor parameters. Incoherencies during transient are physically dependent on the detailed variations in the initial state. Therefore, stationary volumetric distributions which contain in condensed form the detailed initial incoherency information provides a proper basis for the transient treatment. Approximate transient volumetric distributions are generated by a suitable transformation of the stationary distribution to reflect the changes in the transient temperature field. Evaluation of transient changes is based on results of conventional uniform channel calculations and a superposition of lateral variations as they are derived from prior cell investigations. Specific formulations are developed for the treatment of reactivity feedback. Doppler and sodium expansion reactivity feedback is related to condensed temperature-worth distributions. Transient evaluation of the worth distribution is based on the relation between stationary and transient volumetric distributions, which contains the condensed temperature field information. Coolant voiding is similarly treated with proper distribution information. Results show that the treatments developed for the transient phase up to and including sodium boiling constitute a fast and effective simulation of inter- and intra-subassembly incoherence effects
Separation of coherent and incoherent scattering in liquid para-H{sub 2} by polarisation analysis
Energy Technology Data Exchange (ETDEWEB)
Garcia-Hernandez, M; Mompean, F J [Madrid Univ. (Spain); Schaerpf, O; Andersen, K H [Institut Max von Laue - Paul Langevin (ILL), 38 - Grenoble (France); Fak, B [CEA Centre d` Etudes de Grenoble, 38 (France)
1997-04-01
In the 1960 IAEA Symposium on Neutron Scattering, Sarma presented his theoretical study on the scattering of cold neutrons by liquid hydrogen and demonstrated how the intimate coupling between nuclear and rotational degrees of freedom finally results in the possibility of observing collective modes from this material, which to many neutron scatterers is synonymous with `incoherent`. This problem is investigated with polarised neutrons to gain access to a limited region of the (Q,E) space where the collective response from this liquid is found. (author).
Analysis of the Spectral Efficiency of Frequency-Encoded OCDMA Systems With Incoherent Sources
Rochette, Martin; Ayotte, Simon; Rusch, Leslie A.
2005-04-01
This paper presents the spectral efficiency of frequency-encoded (FE) optical code-division multiple-access (OCDMA) systems with incoherent sources. The spectral efficiency of five code families compatible with FE-OCDMA is calculated as a function of the number of users. Analytical equations valid in the limiting case of Gaussian noise are also developed for the bit-error rate and the spectral efficiency. Among the code families considered, the modified quadratic congruence code leads to the maximum achievable spectral efficiency.
Dang, Ngoc T; Pham, Anh T
2010-05-10
In this paper, we comprehensively analyze the impact of four wave mixing (FWM) on the performance of incoherent multi-wavelength optical code-division multiple-access (MW-OCDMA) systems. We also consider many other interferences and noises, including multiple access interference, optical beating interference, and receiver noise, in the analysis. From the numerical results, we can find the power ranges of different MW-OCDMA systems, in which the impact of FWM is dominant and consequently results in an increase in the bit-error rate of the systems. We also find that the impact of FWM becomes more severe when the frequency spacing is small and/or dispersion-shifted fiber is used. In addition, we quantitatively discuss the impact of FWM on the number of supportable users and power penalty in the MW-OCDMA systems. (c) 2010 Optical Society of America.
Energy Technology Data Exchange (ETDEWEB)
Tseng, Wen S., E-mail: wen.tseng@rizzoassoc.com [Paul C. Rizzo Associates, Inc., Western Region, 2201 Broadway, Suite 400, Oakland, CA 94612 (United States); Lilhanand, Kiat; Hamasaki, Don; Garcia, Julio A. [Paul C. Rizzo Associates, Inc., Western Region, 2201 Broadway, Suite 400, Oakland, CA 94612 (United States); Srinivasan, Ram [AREVA, NP, Inc., 6399 San Ignacio Avenue, San Jose, CA 95119 (United States)
2014-04-01
This paper presents a case study of seismic soil-structure interaction (SSI) analysis with consideration of spatial incoherence of seismic input ground motions. The SSI analyses were performed using the SASSI computer program for the Auxiliary Control Building (ACB) structure of an existing nuclear power plant on a hard rock site located in the Center and Eastern United States (CEUS) region. The incoherent seismic input motions for the hard rock site used for the analyses were generated using the computer program INCOH that works together with SASSI. The objective of the analyses was to generate maximum seismic response parameters for assessment of potential impact of newly developed site-specific (ground motion) response spectra (SSRS) on the seismic design of the ACB and potential benefits that could be gained by considering spatial incoherence of seismic input motions. Maximum seismic response values for selected response parameters of interest were generated with both SSRS-compatible coherent and incoherent seismic input motions. Comparisons were made of the corresponding maximum response parameter values and in-structure (acceleration) response spectra (ISRS) generated for both the coherent and incoherent motion inputs. These comparisons indicate that, by incorporating incoherence of ground motions in the seismic input, the maximum response values reduces and the ISRS peak amplitudes in the high frequency range (>10 Hz) also reduce from the corresponding response values resulting from the coherent motion input. The amount of ISRS-amplitude reduction increases as the spectral frequency increases, as expected. Such reductions can be as much as 20–50%. This case study demonstrates that, for a CEUS hard rock site where relatively high high-frequency in the seismic input response spectra exist, consideration of spatial incoherence of input motions would result in substantial benefits in reducing the high-frequency seismic responses. Such benefits are especially
SSI's review of SKB's RDandD Program 2007
International Nuclear Information System (INIS)
Wiebert, Anders
2008-05-01
In this report, the Swedish Radiation Protection Authority (SSI) provides a review of the Swedish Nuclear Fuel and Waste Managements Company's (SKB) RDandD programme 2007. The report is a statement from SSI in the matter submitted earlier to SKI. In the review, SSI comments SKB's feedback to the continuous research and development program on the basis of the latest carried out safety analysis, SR-Can and the biosphere research. In the statement SSI points to a number of issues that need to be resolved before a licence application is handed in. SSI suggests that the Government asks for complements to the RDandD programme 2007. According to SSI, the programme concerning low and intermediate level waste and decommissioning of the nuclear power plants does not fulfil the requirements established by the Act on Nuclear Activities. Neither does the programme fulfil the expectations set by the Government decision regarding the RDandD programme 2004. SSI suggests that the programme should be complemented
International Nuclear Information System (INIS)
Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.
1987-01-01
This paper presents the latest results of the ongoing program entitled, Standard Problems for Structural Computer Codes, currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to cut-off depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils. Further, the paper presents some key aspects of the Soil-Structure Interaction Workshop (NUREG/CP-0054) which was held in Bethesda, MD on June 1, 1986. Finally, recent efforts related to the task on the structural benchmarks are described
Zhang, Yu-Dong; Wang, Qing; Wu, Chen-Jiang; Wang, Xiao-Ning; Zhang, Jing; Liu, Hui; Liu, Xi-Sheng; Shi, Hai-Bin
2015-04-01
To evaluate histogram analysis of intravoxel incoherent motion (IVIM) for discriminating the Gleason grade of prostate cancer (PCa). A total of 48 patients pathologically confirmed as having clinically significant PCa (size > 0.5 cm) underwent preoperative DW-MRI (b of 0-900 s/mm(2)). Data was post-processed by monoexponential and IVIM model for quantitation of apparent diffusion coefficients (ADCs), perfusion fraction f, diffusivity D and pseudo-diffusivity D*. Histogram analysis was performed by outlining entire-tumour regions of interest (ROIs) from histological-radiological correlation. The ability of imaging indices to differentiate low-grade (LG, Gleason score (GS) ≤6) from intermediate/high-grade (HG, GS > 6) PCa was analysed by ROC regression. Eleven patients had LG tumours (18 foci) and 37 patients had HG tumours (42 foci) on pathology examination. HG tumours had significantly lower ADCs and D in terms of mean, median, 10th and 75th percentiles, combined with higher histogram kurtosis and skewness for ADCs, D and f, than LG PCa (p Histogram D showed relatively higher correlations (ñ = 0.641-0.668 vs. ADCs: 0.544-0.574) with ordinal GS of PCa; and its mean, median and 10th percentile performed better than ADCs did in distinguishing LG from HG PCa. It is feasible to stratify the pathological grade of PCa by IVIM with histogram metrics. D performed better in distinguishing LG from HG tumour than conventional ADCs. • GS had relatively higher correlation with tumour D than ADCs. • Difference of histogram D among two-grade tumours was statistically significant. • D yielded better individual features in demonstrating tumour grade than ADC. • D* and f failed to determine tumour grade of PCa.
International Nuclear Information System (INIS)
Ikonen, K.
1993-07-01
The report describes the work performed for achieving readiness to calculate fracture toughness dependence on dimension effects and loading conditions in fracture test specimens and real structures. In the report two- and three-dimensional computer codes developed and calculational methods applied are described. One of the main goals is to converse fracture toughness from small scale three point bending test specimens to case of a depth crack in plane strain i.e. to small scale yielding state (SSY) by numerical elastic-plastic stress analysis. Thickness effect of a test specimens and effect of a crack depth are separately investigated. Tests of three point bending specimens with and without sidegrooves and curved crack front are numerically simulated and experimental and computed results are compared. J-integral is calculated along crack front and also from force-deflection dependence of the beam. For the analyses the computing system was thoroughly automatized. Measuring capacity of three point bending test specimens was tried to evaluate. (orig.) (7 refs., 54 figs.)
2010-10-01
... SSI. (a) Marking of paper records. In the case of paper records containing SSI, a covered person must... limitation statement on the bottom, of— (1) The outside of any front and back cover, including a binder cover... types of records. In the case of non-paper records that contain SSI, including motion picture films...
Science teachers teaching socioscientific issues (SSI): Four case studies
Lee, Hyunju
Socioscientific issues (SSI) are a class of issues that represent the social, ethical, and moral aspects of science in society. The need for the inclusion of SSI into science curricula has been generally accepted, but relatively few science teachers have incorporated SSI into their courses. Most science teachers feel that their most important task by far is to teach the principles of science, and any substantive pedagogical changes represent a burden. However, there are some teachers who address SSI out of personal initiatives. This dissertation study investigates four high school science teachers who address SSI out of their own initiative and explores their deeper inspirations, values, philosophies, and personal ideals that lead them to teach SSI. The overall approach is based on essentialist methodology (Witz, Goodwin, Hart, & Thomas, 2001; Witz, 2006a) with its focus on "the participant as ally" and "essentialist portraiture." The primary data source is four to six in-depth interviews with individual teachers (about 40-90 minutes for each interview). The interviews are complemented by extensive classroom observations of individual teachers' teaching SSI and by document analysis (including teaching materials, rubrics, student group projects and journals, etc.). There are two major findings. First, the teachers' deeper values and ideals are a source of larger inspiration that plays a significant role in changing their teaching practice. This inspiration may involve higher aspects (e.g., deep concern for students' development, unselfishness, caring, etc.) and commitment. Their teaching represents an integration of their personal experiences, values, concerns, and worldviews, which forms a larger inspiration for teaching. Teaching SSI is a part of this larger process. Second, the current curriculum reforms (STS, SSI, and NOS) only suggest theoretical ideals and do not effectively touch teachers' deeper values and ideals. Basically, the teachers are doing what they
Spectral long-range interaction of temporal incoherent solitons.
Xu, Gang; Garnier, Josselin; Picozzi, Antonio
2014-02-01
We study the interaction of temporal incoherent solitons sustained by a highly noninstantaneous (Raman-like) nonlinear response. The incoherent solitons exhibit a nonmutual interaction, which can be either attractive or repulsive depending on their relative initial distance. The analysis reveals that incoherent solitons exhibit a long-range interaction in frequency space, which is in contrast with the expected spectral short-range interaction described by the usual approach based on the Raman-like spectral gain curve. Both phenomena of anomalous interaction and spectral long-range behavior of incoherent solitons are described in detail by a long-range Vlasov equation.
Allé, M C; Gandolphe, M-C; Doba, K; Köber, C; Potheegadoo, J; Coutelle, R; Habermas, T; Nandrino, J-L; Danion, J-M; Berna, F
2016-08-01
Life narratives of patients with schizophrenia are characterized by impaired coherence so that the listener has often difficulties to grasp the life trajectory of the patients. In order to better understand what causes this reduced temporal coherence, we investigated the temporal structure of patients' life narratives through different temporal narrative elements (elaboration of beginnings and endings, local temporal indicators and temporal deviations from a linear order), across two complementary studies. Life narratives were collected by means of two different methods; a free recall in study 1 and a more structured protocol, aiming at reducing the cognitive task demands in study 2. All narratives from the two studies were analyzed using the same validated method. Both studies showed that global temporal coherence is significantly reduced in patients with schizophrenia (ps.02). This is mainly due to their stronger tendency to temporally deviate from a linear temporal order without marking the deviation as such. We also observed significant correlations in the patient groups between global temporal coherence and executive dysfunction (p=.008) or their higher tendency to temporally deviate from a linear temporal order in their life narratives (p<.001). These results shed light on narrative correlates of temporal narrative incoherence in schizophrenia and highlight the central role of executive dysfunction in this incoherence. Copyright © 2016 Elsevier Inc. All rights reserved.
Psychometric properties and clinical utility of the Scale for Suicidal Ideation (SSI in adolescents
Directory of Open Access Journals (Sweden)
Ruuttu Titta
2005-02-01
Full Text Available Abstract Background Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. Methods 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Results Cronbach's α for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. Conclusions SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.
Holi, Matti M; Pelkonen, Mirjami; Karlsson, Linnea; Kiviruusu, Olli; Ruuttu, Titta; Heilä, Hannele; Tuisku, Virpi; Marttunen, Mauri
2005-02-03
Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI) is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Cronbach's alpha for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC) curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.
SSI's review of SKB's RD and D programme 2001
Energy Technology Data Exchange (ETDEWEB)
Hedberg, Bjoern; Larsson, Carl-Magnus; Wiebert, Anders [and others
2002-08-01
In the report SSI's review of SKB's RD and D programme 2001 is presented. In the review SSI comments, among other things, the decision making process, the need for a strategy document, SKB's safety and system analysis and SKB's biosphere studies.
Impact parameter analysis of coherent and incoherent pion production on nuclei by 11.7GeV/c π+
International Nuclear Information System (INIS)
Arnold, R.; Barshay, S.; Riester, J.L.
1976-01-01
Using the complete momentum measurements for 2, 3, 4 and 5 pion final states. The impact parameter structure, with the following principal results has been studied. Evidence is presented for an empirical method that can help in the separation of coherent events on nuclei. Incoherent nuclear production exhibits lower-bound impact parameters which decrease systematically with an increasing number of produced pions. The experimental b-distributions can be very well fitted by a single simple scaled functional form, dsigmasub(N)(b)/d 2 bvector proportional to F(N/f(b)), this N-distribution yields a ratio (dispersion/average dispersion) of about 0.35 at any impact parameter [fr
Impact of a surgical site infection (SSI) surveillance program in orthopedics and traumatology.
Mabit, C; Marcheix, P S; Mounier, M; Dijoux, P; Pestourie, N; Bonnevialle, P; Bonnomet, F
2012-10-01
Surveillance of surgical site infections (SSI) is a priority. One of the fundamental principles for the surveillance of SSI is based on receiving effective field feedback (retro-information). The aim of this study was to report the results of a program of SSI surveillance and validate the hypothesis that there is a correlation between creating a SSI surveillance program and a reduction in SSI. The protocol was based on the weekly collection of surveillance data obtained directly from the different information systems in different departments. A delay of 3 months was established before extraction and analysis of data and information from the surgical teams. The NNIS index (National Nosocomial Infections Surveillance System) developed by the American surveillance system and the reduction of length of hospital stay index Journées d'hospitalisation évitées (JHE). Since the end of 2009, 7156 surgical procedures were evaluated (rate of inclusion 97.3%), and 84 SSI were registered with a significant decrease over time from 1.86% to 0.66%. A total of 418 days of hospitalization have been saved since the beginning of the surveillance system. Our surveillance system has three strong points: follow-up is continuous, specifically adapted to orthopedic traumatology and nearly exhaustive. The extraction of data directly from hospital information systems effectively improves the collection of data on surgical procedures. The implementation of a SSI surveillance protocol reduces SSI. Level III. Prospective study. Copyright © 2012 Elsevier Masson SAS. All rights reserved.
Cho, Gene Young; Moy, Linda; Kim, Sungheon G; Baete, Steven H; Moccaldi, Melanie; Babb, James S; Sodickson, Daniel K; Sigmund, Eric E
2016-08-01
To examine heterogeneous breast cancer through intravoxel incoherent motion (IVIM) histogram analysis. This HIPAA-compliant, IRB-approved retrospective study included 62 patients (age 48.44 ± 11.14 years, 50 malignant lesions and 12 benign) who underwent contrast-enhanced 3 T breast MRI and diffusion-weighted imaging. Apparent diffusion coefficient (ADC) and IVIM biomarkers of tissue diffusivity (Dt), perfusion fraction (fp), and pseudo-diffusivity (Dp) were calculated using voxel-based analysis for the whole lesion volume. Histogram analysis was performed to quantify tumour heterogeneity. Comparisons were made using Mann-Whitney tests between benign/malignant status, histological subtype, and molecular prognostic factor status while Spearman's rank correlation was used to characterize the association between imaging biomarkers and prognostic factor expression. The average values of the ADC and IVIM biomarkers, Dt and fp, showed significant differences between benign and malignant lesions. Additional significant differences were found in the histogram parameters among tumour subtypes and molecular prognostic factor status. IVIM histogram metrics, particularly fp and Dp, showed significant correlation with hormonal factor expression. Advanced diffusion imaging biomarkers show relationships with molecular prognostic factors and breast cancer malignancy. This analysis reveals novel diagnostic metrics that may explain some of the observed variability in treatment response among breast cancer patients. • Novel IVIM biomarkers characterize heterogeneous breast cancer. • Histogram analysis enables quantification of tumour heterogeneity. • IVIM biomarkers show relationships with breast cancer malignancy and molecular prognostic factors.
Incoherences of Brazilian labour laws face to present radioprotection concepts
International Nuclear Information System (INIS)
Borges, J.C.
1996-01-01
The Brazilian labour legislation establishes, since 1950, some privileges for people working in activities which imply exposure to ionizing radiations. Comparing the present legal framework with technical radioprotection knowledge, one can detect several incoherences covering: classification of such activities; additional payments; reduced labour journey; more vacations; medical surveillance; early retirements; special norms for women. An analysis of these incoherences lead us to propose a new frame of labour rights and radioprotection norms, coupling Brazilian juridical principles and modern radioprotection knowledge. (author)
Modeling Incoherent Electron Cloud Effects
International Nuclear Information System (INIS)
Vay, Jean-Luc; Benedetto, E.; Fischer, W.; Franchetti, G.; Ohmi, K.; Schulte, D.; Sonnad, K.; Tomas, R.; Vay, J.-L.; Zimmermann, F.; Rumolo, G.; Pivi, M.; Raubenheimer, T.
2007-01-01
Incoherent electron effects could seriously limit the beam lifetime in proton or ion storage rings, such as LHC, SPS, or RHIC, or blow up the vertical emittance of positron beams, e.g., at the B factories or in linear-collider damping rings. Different approaches to modeling these effects each have their own merits and drawbacks. We describe several simulation codes which simplify the descriptions of the beam-electron interaction and of the accelerator structure in various different ways, and present results for a toy model of the SPS. In addition, we present evidence that for positron beams the interplay of incoherent electron-cloud effects and synchrotron radiation can lead to a significant increase in vertical equilibrium emittance. The magnitude of a few incoherent e+e- scattering processes is also estimated. Options for future code development are reviewed
Galileo SSI Observations of Volcanic Activity at Tvashtar Catena, Io
Milazzo, M. P.; Keszthely, L. P.; Radebaugh, J.; Davies, A. G.; Turtle, E. P.; Geissler, P.; Klaasen, K. P.; McEwen, A. S.
2005-01-01
Introduction: We report on the analysis of the Galileo SSI's observations of the volcanic activity at Tvashtar Catena, Io as discussed by Milazzo et al. Galileo's Solid State Imager (SSI) observed Tvashtar Catena (63 deg N, 120 deg W) four times between November 1999 and October 2001, providing a unique look at the distinctive high latitude volcanism on Io. The November 1999 observation spatially resolved, for the first time, an active extraterrestrial fissure eruption. The brightness temperature of the lavas at the November 1999 fissure eruption was 1300 K. The second observation (orbit I27, February 2000) showed a large (approx. 500 sq km) region with many, small spots of hot, active lava. The third observation was taken in conjunction with a Cassini observation in December 2000 and showed a Pele-like plume deposition ring, while the Cassini images revealed a 400 km high Pele-type plume above the Catena. The final Galileo SSI observation of Tvashtar was acquired in October 2001, and all obvious (to SSI) activity had ceased, although data from Galileo's Near Infrared Mapping Spectrometer (NIMS) indicated that there was still significant thermal emission from the Tvashtar region. We have concentrated on analyzing the style of eruption during orbit I27 (February 2000). Comparison with a lava flow cooling model indicates that the behavior of the Tvashtar eruption during I27 does not match that of "simple" advancing lava flows. Instead, it may be an active lava lake or a complex set of lava flows with episodic, overlapping (in time and space) eruptions.
Acoustic Holography With Incoherent Sources
Druyvesteyn, W.F.; Raangs, R.
2005-01-01
In near field acoustic holography the sound field is scanned near the surface of the vibrating object; from these measurements the vibration of the structure can be calculated. In the case of correlated sources one reference signal is sufficient. When incoherent sources are present the separation of
Yes, The Precautionary Principle Is Incoherent.
Peterson, Martin
2017-11-01
This article is a reply to Thomas Boyer-Kassem's discussion of my criticism of the precautionary principle published in this journal about a decade ago. Boyer-Kassem does not question the logical validity of the theorem proved in my original article, but he brings up important questions about its scope. He also challenges the plausibility of some of the assumptions on which it is based. In this comment, I argue that each objection can be adequately dealt with. As a decision rule, the precautionary principle is (still) incoherent. © 2017 Society for Risk Analysis.
2010-10-01
... SECURITY INFORMATION § 1520.13 Marking SSI. (a) Marking of paper records. In the case of paper records... back cover, including a binder cover or folder, if the document has a front and back cover; (2) Any.... 552 and 49 CFR parts 15 and 1520. (d) Other types of records. In the case of non-paper records that...
SSI's review of ASAR Oskarshamn 1
International Nuclear Information System (INIS)
Godaas, T.
1995-11-01
Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Oskarshamn 1. The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs
SSI's Review of RD and D Programme 98
International Nuclear Information System (INIS)
1999-06-01
The report contains SSI's review of SKB's research programme and SSI's background review PM. In the interest of transparency of the site selection process, SSI has made requirements concerning additional reporting from SKB, prior to the next step in the site selection process, and advice to the government regarding the need for clarification on a number of issues
International Nuclear Information System (INIS)
Llambias, J.M.
1993-01-01
The seismic loading information for use in the seismic design of equipment and minor structures within a nuclear power plant is determined from a dynamic response analysis of the building in which they are located. This dynamic response analysis needs to capture the global response of both the building structure and adjacent soil and is commonly referred to as a soil structure interaction (SSI) analysis. NNC have developed a simple and cost effective methodology for the seismic SSI analysis of buildings in a PWR nuclear power station at a UK soft site. This paper outlines the NNC methodology and describes the approach adopted for its validation
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI473 (Link to dictyBase) - - - - SSI473Z (Link to Original s...ite) - - SSI473Z 416 - - - - Show SSI473 Library SS (Link to library) Clone ID SSI473 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...uences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyost...Hdk03092 Head kidney cDNA library Ictalurus punctatus cDNA 5' similar to Dual specificity phosphatase 10 (DU
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY
Hirave, Vivek; Kalyanshetti, Mahesh
2018-02-01
Conventional fixed-base analysis ignoring the effect of soil-flexibility may result in unsafe design. Therefore, to evaluate the realistic behavior of structure the soil structure interaction (SSI) effect shall be incorporated in the analysis. In seismic analysis, provision of bracing system is one of the important option for the structure to have sufficient strength with adequate stiffness to resist lateral forces. The different configuration of these bracing systems alters the response of buildings, and therefore, it is important to evaluate the most effective bracing systems in view point of stability against SSI effect. In present study, three RC building frames, G+3, G+5 and G+7 and their respective scaled down steel model with two types of steel bracing system incorporating the effect of soil flexibility is considered for experimental and analytical study. The analytical study is carried out using Elastic continuum approach and the experimental study is carried out using Shake Table. The influence of SSI on various seismic parameters is presented. The study reveals that, steel bracing system is beneficial to control SSI effect and it is observed that V bracing is more effective, in resisting seismic load considering SSI.
The Precautionary Principle Has Not Been Shown to Be Incoherent: A Reply to Peterson.
Boyer-Kassem, Thomas
2017-11-01
In this journal, I have objected to Peterson's 2006 claim that the precautionary principle is an incoherent decision rule. I defend my objections to Peterson's recent replies, and I still claim that the precautionary principle has not been shown to be incoherent. © 2017 Society for Risk Analysis.
Towards sub-{Angstrom} resolution through incoherent imaging
Energy Technology Data Exchange (ETDEWEB)
Pennycook, S.J.; Chisholm, M.F. [Oak Ridge National Lab., TN (United States); Nellist, P.D. [Cavendish Lab., Cambridge, (United Kingdom)
1997-04-01
As first pointed out by Lord Rayleigh a century ago, incoherent imaging offers a substantial resolution enhancement compared to coherent imaging, together with freedom from phase contrast interference effects and contrast oscillations. In the STEM configuration, with a high angle annular detector to provide the transverse incoherence, the image also shows strong Z-contrast, sufficient in the case of a 300 kV STEM to image single Pt and Rh atoms on a {gamma}-alumina support. The annular detector provides complementarity to a bright field detector of the same size. For weakly scattering specimens, it shows greater contrast than the incoherent bright field image, and also facilitates EELS analysis at atomic resolution, using the Z-contrast image to locate the probe with sub-{angstrom} precision. The inner radius of the annular detector can be chosen to reduce the transverse coherence length to well below the spacings needed to resolve the object, a significant advantage compared to light microscopy.
SSI response of a typical shear wall structure. Volume 1
International Nuclear Information System (INIS)
Johnson, J.J.; Schewe, E.C.; Maslenikov, O.R.
1984-04-01
The Simplified Methods project of the US NRC-funded Seismic Safety Margins Research Program (SSMRP) has as its goal the development of a methodology to perform routine seismic probabilistic risk assessments of commercial nuclear power plants. The study reported here develops calibration factors to relate best estimate response to design values accounting for approximations and simplifications in SSI analysis procedures. Nineteen cases were analyzed and in-structure response compared. The structure of interest was a typical shear wall structure. 6 references, 44 figures, 22 tables
Kimura, Koji; Sawa, Akihiro; Akagi, Shinji; Kihira, Kenji
2007-06-01
We have developed an original system to conduct surgical site infection (SSI) surveillance. This system accumulates SSI surveillance information based on the National Nosocomial Infections Surveillance (NNIS) System and the Japanese Nosocomial Infections Surveillance (JNIS) System. The features of this system are as follows: easy input of data, high generality, data accuracy, SSI rate by operative procedure and risk index category (RIC) can be promptly calculated and compared with the current NNIS SSI rate, and the SSI rates and accumulated data can be exported electronically. Using this system, we monitored 798 patients in 24 operative procedure categories in the Digestive Organs Surgery Department of Mazda Hospital, Mazda Motor Corporation, from January 2004 through December 2005. The total number and rate of SSI were 47 and 5.89%, respectively. The SSI rates of 777 patients were calculated based on 15 operative procedure categories and Risk Index Categories (RIC). The highest SSI rate was observed in the rectum surgery of RIC 1 (30%), followed by the colon surgery of RIC3 (28.57%). About 30% of the isolated infecting bacteria were Enterococcus faecalis, Staphylococcus aureus, Klebsiella pneumoniae, Pseudomonas aeruginosa, and Escherichia coli. Using quantification theory type 2, the American Society of Anesthesiology score (4.531), volume of hemorrhage under operation (3.075), wound classification (1.76), operation time (1.352), and history of diabetes (0.989) increased to higher ranks as factors for SSI. Therefore, we evaluated this system as a useful tool in safety control for operative procedures.
Preoperative antiseptic skin preparations and reducing SSI.
Al Maqbali, Mohammed Abdullah
Surgical site infection (SSI) can affect the quality of care and increase the morbidity and mortality rate in after-surgical procedure. The use of an antiseptic skin preparation agent before the procedure can reduce the pathogens in the skin surface around the incision. Indicating the type of skin antiseptic preparation could prevent the infection and contamination of the wound. The most commonly used types of skin preparations are chlorhexidine and povidone iodine. However, the antiseptic solutions of both agents are strengthened with alcohol to prevent postoperative wound infection. The aim of this paper is to identify the best antiseptic agent in terms of skin preparation by evaluating the evidence in the literature. The factors associated with choosing the antiseptic skin agent, such as patients' allergies, skin condition and environmental risk, are also taken into account. This review suggests that cholorhexdine with alcohol may be the most effective in terms of reducing SSI.
Is the Precautionary Principle Really Incoherent?
Boyer-Kassem, Thomas
2017-11-01
The Precautionary Principle has been an increasingly important principle in international treaties since the 1980s. Through varying formulations, it states that when an activity can lead to a catastrophe for human health or the environment, measures should be taken to prevent it even if the cause-and-effect relationship is not fully established scientifically. The Precautionary Principle has been critically discussed from many sides. This article concentrates on a theoretical argument by Peterson (2006) according to which the Precautionary Principle is incoherent with other desiderata of rational decision making, and thus cannot be used as a decision rule that selects an action among several ones. I claim here that Peterson's argument fails to establish the incoherence of the Precautionary Principle, by attacking three of its premises. I argue (i) that Peterson's treatment of uncertainties lacks generality, (ii) that his Archimedian condition is problematic for incommensurability reasons, and (iii) that his explication of the Precautionary Principle is not adequate. This leads me to conjecture that the Precautionary Principle can be envisaged as a coherent decision rule, again. © 2017 Society for Risk Analysis.
Incoherent control of locally controllable quantum systems
International Nuclear Information System (INIS)
Dong Daoyi; Zhang Chenbin; Rabitz, Herschel; Pechen, Alexander; Tarn, T.-J.
2008-01-01
An incoherent control scheme for state control of locally controllable quantum systems is proposed. This scheme includes three steps: (1) amplitude amplification of the initial state by a suitable unitary transformation, (2) projective measurement of the amplified state, and (3) final optimization by a unitary controlled transformation. The first step increases the amplitudes of some desired eigenstates and the corresponding probability of observing these eigenstates, the second step projects, with high probability, the amplified state into a desired eigenstate, and the last step steers this eigenstate into the target state. Within this scheme, two control algorithms are presented for two classes of quantum systems. As an example, the incoherent control scheme is applied to the control of a hydrogen atom by an external field. The results support the suggestion that projective measurements can serve as an effective control and local controllability information can be used to design control laws for quantum systems. Thus, this scheme establishes a subtle connection between control design and controllability analysis of quantum systems and provides an effective engineering approach in controlling quantum systems with partial controllability information.
SSI's review of ASAR Ringhals 2, 1994
International Nuclear Information System (INIS)
Hofvander, P.
1995-11-01
Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Ringhals 2, 1994 . The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs
Compensation for incoherent ground motion
International Nuclear Information System (INIS)
Shigeru, Takeda; Hiroshi, Matsumoto; Masakazu, Yoshioka; Yasunori, Takeuchi; Kikuo, Kudo; Tsuneya, Tsubokawa; Mitsuaki, Nozaki; Kiyotomo, Kawagoe
1999-01-01
The power spectrum density and coherence function for ground motions are studied for the construction of the next generation electron-positron linear collider. It should provide a center of mass energy between 500 GeV-1 TeV with luminosity as high as 10 33 to 10 34 cm -2 sec -1 . Since the linear collider has a relatively slow repetition rate, large number of particles and small sizes of the beam should be generated and preserved in the machine to obtain the required high luminosity. One of the most critical parameters is the extremely small vertical beam size at the interaction point, thus a proper alignment system for the focusing and accelerating elements of the machine is necessary to achieve the luminosity. We describe recent observed incoherent ground motions and an alignment system to compensate the distortion by the ground motions. (authors)
"Jazz Ruuler" toob dzhässi Rock Cafesse
2008-01-01
Muhu tulevikumuusika festival "Ju jääb" ja Rock Cafe avavad uue dzhässiürituste sarja "Jazz Ruuler", mille raames soovitakse igal kuul Eesti publiku ette tuua mõni maailma dzhässi tuntud artist. Kontserdist 24. jaan. Rock Cafés
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI527 (Link to dictyBase) - - - Contig-U16209-1 SSI527F (Link... to Original site) SSI527F 685 - - - - - - Show SSI527 Library SS (Link to library) Clone ID SSI527 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...N BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDNA 5' ...6357825 5' similar to SW:RSP4_CHICK P50890 40S RIBOSOMAL PROTEIN SA ;, mRNA sequence. 46 4e-06 2 BQ096846 |BQ096846.1 IfHdk00487 Ict
Lifescience Database Archive (English)
Full Text Available ate cortex cDNA, RIKEN full-length enriched library, clone:A830088K09, 3' end partial sequence. 42 5.7 1 AC068663 |AC068663.4 Mus mu...SS (Link to library) SSI485 (Link to dictyBase) - - - Contig-U14077-1 SSI485F (Link... to Original site) SSI485F 438 - - - - - - Show SSI485 Library SS (Link to library) Clone ID SSI485 (Link to dic...cia MC0-3 ... 115 4e-25 EF100191_35( EF100191 |pid:none) Uncultured marine bacterium HF10_... 115 5e-25 AP00...9385_2657( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 114 1e-24 BC056
Sensitivity Study of Poisson's Ratio Used in Soil Structure Interaction (SSI) Analyses
International Nuclear Information System (INIS)
Han, Seung-ju; You, Dong-Hyun; Jang, Jung-bum; Yun, Kwan-hee
2016-01-01
The preliminary review for Design Certification (DC) of APR1400 was accepted by NRC on March 4, 2015. After the acceptance of the application for standard DC of APR1400, KHNP has responded the Request for Additional Information (RAI) raised by NRC to undertake a full design certification review. Design certification is achieved through the NRC's rulemaking process, and is founded on the staff's review of the application, which addresses the various safety issues associated with the proposed nuclear power plant design, independent of a specific site. The USNRC issued RAIs pertain to Design Control Document (DCD) Ch.3.7 'Seismic Design' is DCD Tables 3.7A-1 and 3.7A-2 show Poisson’s ratios in the S1 and S2 soil profiles used for SSI analysis as great as 0.47 and 0.48 respectively. Based on staff experience, use of Poisson's ratio approaching these values may result in numerical instability of the SSI analysis results. Sensitivity study is performed using the ACS SASSI NI model of APR1400 with S1 and S2 soil profiles to demonstrate that the Poisson’s ratio values used in the SSI analyses of S1 and S2 soil profile cases do not produce numerical instabilities in the SSI analysis results. No abrupt changes or spurious peaks, which tend to indicate existence of numerical sensitivities in the SASSI solutions, appear in the computed transfer functions of the original SSI analyses that have the maximum dynamic Poisson’s ratio values of 0.47 and 0.48 as well as in the re-computed transfer functions that have the maximum dynamic Poisson’s ratio values limited to 0.42 and 0.45
Han, Chang Wan; Ortalan, Volkan
2015-09-01
We have demonstrated a new electron tomography technique utilizing the secondary signals (secondary electrons and backscattered electrons) for ultra thick (a few μm) specimens. The Monte Carlo electron scattering simulations reveal that the amount of backscattered electrons generated by 200 and 300keV incident electrons is a monotonic function of the sample thickness and this causes the thickness contrast satisfying the projection requirement for the tomographic reconstruction. Additional contribution of the secondary electrons emitted from the edges of the specimens enhances the visibility of the surface features. The acquired SSI tilt series of the specimen having mesoscopic dimensions are successfully reconstructed verifying that this new technique, so called the secondary signal imaging electron tomography (SSI-ET), can directly be utilized for 3D structural analysis of mesoscale structures. Published by Elsevier Ltd.
Neutron scattering in disordered alloys: coherent and incoherent intensities
International Nuclear Information System (INIS)
Mookerjee, A.; Yussouff, M.
1985-02-01
A priori it is not clear how to split the total intensity of thermal neutron scattering from disordered alloys into a coherent and an incoherent part. We present here a formalism to do this. The formalism is based on the augmented space technique introduced earlier by one of the authors. It includes disorder in mass, force constants and scattering lengths. A self-consistent CCPA which is tractable for realistic calculations is presented for the coherent and incoherent intensities. This is expected to prove useful in theoretically analysis data for alloys (e.g. Nisub(x)Ptsub(1-x), Nisub(x)Pdsub(1-x), Nisub(x)Crsub(1-x)) for which it is necessary to go beyond the usual single site CPAs for reliable accuracy. (author)
The SSI reviews of the SKB research programs 1992
International Nuclear Information System (INIS)
Jensen, Mikael.
1993-02-01
The Swedish Radiation Protection Institute (SSI) has scrutinized the research programs 1992 of the Swedish Nuclear Fuel and Waste Management Co (SKB). The judgement is that SKB has both the competence and resources to perform the presented research programs
Biological growth in bodies with incoherent interfaces
Swain, Digendranath; Gupta, Anurag
2018-01-01
A general theory of thermodynamically consistent biomechanical-biochemical growth in a body, considering mass addition in the bulk and at an incoherent interface, is developed. The incoherency arises due to incompatibility of growth and elastic distortion tensors at the interface. The incoherent interface therefore acts as an additional source of internal stress besides allowing for rich growth kinematics. All the biochemicals in the model are essentially represented in terms of nutrient concentration fields, in the bulk and at the interface. A nutrient balance law is postulated which, combined with mechanical balances and kinetic laws, yields an initial-boundary-value problem coupling the evolution of bulk and interfacial growth, on the one hand, and the evolution of growth and nutrient concentration on the other. The problem is solved, and discussed in detail, for two distinct examples: annual ring formation during tree growth and healing of cutaneous wounds in animals.
Directory of Open Access Journals (Sweden)
A. Cahyarini
2016-11-01
Full Text Available The aim of this study was to investigate the effect of 5E learning cycle instructional model using socioscientific issues (SSI learning context on students’ critical thinking skills of acid-base. This study used quasi-experimental posttest only control group design. The sample consisted of three classes, which were XI MIA-4class (n = 32 that learned using 5E LC model, XI MIA-5 class (n = 33 that learned using 5E LC+SSI, and XI MIA-6 class (n = 32 that learned using conventional method. The samples were choosen by convenience sampling technique. The test instrument consisted of 15 multiple choice items which were valid and reliable (r = 0.806. The data were analyzed using one way ANOVA test and LSD posthoc test. The results of this study indicated that the students who learned using 5E LC+SSI model showed greater levels of critical thinking skills ( = 74,95 than both the student who learned using 5E LC model ( = 74,17 and the student who learned using conventional method ( = 68,96. Based on statistics analysis, there was significant differences on students’ critical thinkings between students taught using conventional method and students taught either using 5E LC+SSI model and 5E LC model. However, there was no significant differences on students’ critical thinking skills between students taught using 5E LC+SSI model and the students taught using 5E LC model.
Multi-equilibrium property of metabolic networks: SSI module
Directory of Open Access Journals (Sweden)
Chen Luonan
2011-06-01
Full Text Available Abstract Background Revealing the multi-equilibrium property of a metabolic network is a fundamental and important topic in systems biology. Due to the complexity of the metabolic network, it is generally a difficult task to study the problem as a whole from both analytical and numerical viewpoint. On the other hand, the structure-oriented modularization idea is a good choice to overcome such a difficulty, i.e. decomposing the network into several basic building blocks and then studying the whole network through investigating the dynamical characteristics of the basic building blocks and their interactions. Single substrate and single product with inhibition (SSI metabolic module is one type of the basic building blocks of metabolic networks, and its multi-equilibrium property has important influence on that of the whole metabolic networks. Results In this paper, we describe what the SSI metabolic module is, characterize the rates of the metabolic reactions by Hill kinetics and give a unified model for SSI modules by using a set of nonlinear ordinary differential equations with multi-variables. Specifically, a sufficient and necessary condition is first given to describe the injectivity of a class of nonlinear systems, and then, the sufficient condition is used to study the multi-equilibrium property of SSI modules. As a main theoretical result, for the SSI modules in which each reaction has no more than one inhibitor, a sufficient condition is derived to rule out multiple equilibria, i.e. the Jacobian matrix of its rate function is nonsingular everywhere. Conclusions In summary, we describe SSI modules and give a general modeling framework based on Hill kinetics, and provide a sufficient condition for ruling out multiple equilibria of a key type of SSI module.
Whole-body intravoxel incoherent motion imaging
Energy Technology Data Exchange (ETDEWEB)
Filli, Lukas; Wurnig, Moritz C.; Eberhardt, Christian; Guggenberger, Roman; Boss, Andreas [University Hospital Zurich, Department of Radiology, Zurich (Switzerland); Luechinger, Roger [University and ETH Zurich, Institute of Biomedical Technology, Zurich (Switzerland)
2015-07-15
To investigate the technical feasibility of whole-body intravoxel incoherent motion (IVIM) imaging. Whole-body MR images of eight healthy volunteers were acquired at 3T using a spin-echo echo-planar imaging sequence with eight b-values. Coronal parametrical whole-body maps of diffusion (D), pseudodiffusion (D*), and the perfusion fraction (F{sub p}) were calculated. Image quality was rated qualitatively by two independent radiologists, and inter-reader reliability was tested with intra-class correlation coefficients (ICCs). Region of interest (ROI) analysis was performed in the brain, liver, kidney, and erector spinae muscle. Depiction of anatomic structures was rated as good on D maps and good to fair on D* and F{sub p} maps. Exemplary mean D (10{sup -3} mm{sup 2}/s), D* (10{sup -3} mm{sup 2}/s) and F{sub p} (%) values (± standard deviation) of the renal cortex were as follows: 1.7 ± 0.2; 15.6 ± 6.5; 20.9 ± 4.4. Inter-observer agreement was ''substantial'' to ''almost perfect'' (ICC = 0.80 - 0.92). The coefficient of variation of D* was significantly lower with the proposed algorithm compared to the conventional algorithm (p < 0.001), indicating higher stability. The proposed IVIM protocol allows computation of parametrical maps with good to fair image quality. Potential future clinical applications may include characterization of widespread disease such as metastatic tumours or inflammatory myopathies. (orig.)
The Implement of a Multi-layer Frozen Soil Scheme into SSiB3 and its Evaluation over Cold Regions
Li, Q.
2016-12-01
The SSiB3 is a biophysics-based model of land-atmosphere interactions and is designed for global and regional studies. It has three soil layers, three snow layers, as well as one vegetation layer. Soil moisture of the three soil layers, interception water store for the canopy, subsurface soil temperature, ground temperature, canopy temperature and snow water equivalent are all predicted based on the water and energy balance at canopy, soil and snow. SSiB3 substantially enhances the model's capability for cold season studies and produces reasonable results compared with observations. However, frozen soil processes are ignored in the SSiB3 and may have effects on the interannual variability of soil temperature and deep soil memory. A multi-layer comprehensive frozen soil scheme (FSM), which is developed for climate study has been implemented into the SSiB3 to describe soil heat transfer and water flow affected by frozen processed in soil. In the coupled SSiB3-FSM, both liquid water and ice content have been taken into account in the frozen soil hydrologic and thermal property parameterization. The maximum soil layer depth could reach 10 meters thick depending on land conditions. To better evaluate the models' performance, the coupled offline SSiB3-FSM and SSiB3 have been driven from 1948 to 1958 by the Princeton global meteorological data set, respectively. For the 10yrs run, the coupled SSiB3-FSM almost captures the features over different regions, especially cold regions. In order to analysis and compare the differences of SSIB3-FSM and SSIB3 in detail, monthly mean surface temperature for different regions are compared with CAMS data. The statistical results of surface skin temperature show that high latitude regions, Africa, Eastern Australia, and North American monsoon regions have been greatly improved in SSIB3-FSM. For the global statistics, the RMSE of the surface temperature simulated by SSiB3-FSM can be improved about 0.6K compared to SSiB3. In this study
Incoherent imaging using dynamically scattered coherent electrons
International Nuclear Information System (INIS)
Nellist, P.D.; Pennycook, S.J.
1999-01-01
We use a Bloch wave approach to show that, even for coherent dynamical scattering from a stationary lattice with no absorption, annular dark-field imaging in a scanning transmission electron microscope gives a direct incoherent structure image of the atomic-column positions of a zone-axis-aligned crystal. Although many Bloch waves may be excited by the probe, the detector provides a filtering effect so that the 1s-type bound states are found to dominate the image contrast for typical experimental conditions. We also find that the column intensity is related to the transverse kinetic energy of the 1s states, which gives atomic number, Z, contrast. The additional effects of phonon scattering are discussed, in particular the reasons why phonon scattering is not a prerequisite for transverse incoherence. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)
Energy Technology Data Exchange (ETDEWEB)
Boss, Andreas, E-mail: andreas.boss@usz.ch [Institute of Diagnostic and Interventional Radiology, University Hospital Zurich (Switzerland); Barth, Borna; Filli, Lukas; Kenkel, David; Wurnig, Moritz C. [Institute of Diagnostic and Interventional Radiology, University Hospital Zurich (Switzerland); Piccirelli, Marco [Institute of Neuroradiology, University Hospital of Zurich (Switzerland); Reiner, Caecilia S. [Institute of Diagnostic and Interventional Radiology, University Hospital Zurich (Switzerland)
2016-11-15
Purpose: To optimize and test a diffusion-weighted imaging (DWI) echo-planar imaging (EPI) sequence with simultaneous multi-slice (SMS) excitation in the liver and pancreas regarding acquisition time (TA), number of slices, signal-to-noise ratio (SNR), image quality (IQ), apparent diffusion coefficient (ADC) quantitation accuracy, and feasibility of intravoxel incoherent motion (IVIM) analysis. Materials and methods: Ten healthy volunteers underwent DWI of the upper abdomen at 3T. A SMS DWI sequence with CAIPIRINHA unaliasing technique (acceleration factors 2/3, denoted AF2/3) was compared to standard DWI-EPI (AF1). Four schemes were evaluated: (i) reducing TA, (ii) keeping TA identical with increasing number of averages, (iii) increasing number of slices with identical TA (iv) increasing number of b-values for IVIM. Acquisition schemes i-iii were evaluated qualitatively (reader score) and quantitatively (ADC values, SNR). Results: In scheme (i) no differences in SNR were observed (p = 0.321 − 0.038) with reduced TA (AF2 increase in SNR/time 75.6%, AF3 increase SNR/time 102.4%). No SNR improvement was obtained in scheme (ii). Increased SNR/time could be invested in acquisition of more and thinner slices or higher number of b-values. Image quality scores were stable for AF2 but decreased for AF3. Only for AF3, liver ADC values were systematically lower. Conclusion: SMS-DWI of the liver and pancreas provides substantially higher SNR/time, which either may be used for shorter scan time, higher slice resolution or IVIM measurements.
International Nuclear Information System (INIS)
Boss, Andreas; Barth, Borna; Filli, Lukas; Kenkel, David; Wurnig, Moritz C.; Piccirelli, Marco; Reiner, Caecilia S.
2016-01-01
Purpose: To optimize and test a diffusion-weighted imaging (DWI) echo-planar imaging (EPI) sequence with simultaneous multi-slice (SMS) excitation in the liver and pancreas regarding acquisition time (TA), number of slices, signal-to-noise ratio (SNR), image quality (IQ), apparent diffusion coefficient (ADC) quantitation accuracy, and feasibility of intravoxel incoherent motion (IVIM) analysis. Materials and methods: Ten healthy volunteers underwent DWI of the upper abdomen at 3T. A SMS DWI sequence with CAIPIRINHA unaliasing technique (acceleration factors 2/3, denoted AF2/3) was compared to standard DWI-EPI (AF1). Four schemes were evaluated: (i) reducing TA, (ii) keeping TA identical with increasing number of averages, (iii) increasing number of slices with identical TA (iv) increasing number of b-values for IVIM. Acquisition schemes i-iii were evaluated qualitatively (reader score) and quantitatively (ADC values, SNR). Results: In scheme (i) no differences in SNR were observed (p = 0.321 − 0.038) with reduced TA (AF2 increase in SNR/time 75.6%, AF3 increase SNR/time 102.4%). No SNR improvement was obtained in scheme (ii). Increased SNR/time could be invested in acquisition of more and thinner slices or higher number of b-values. Image quality scores were stable for AF2 but decreased for AF3. Only for AF3, liver ADC values were systematically lower. Conclusion: SMS-DWI of the liver and pancreas provides substantially higher SNR/time, which either may be used for shorter scan time, higher slice resolution or IVIM measurements.
Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility, December 2010
Social Security Administration — The Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility (December 2010) is produced using the data found in Table 10 from the SSI...
Supplemental Security Income (SSI) Recipients in each State by Sex and Age, December 2010
Social Security Administration — The Supplemental Security Income (SSI) Recipients in each State by Sex and Age (December 2010) is produced using the data found in Table 10 from the SSI Report of...
Püssi plaat saab 30aastaseks / Gerli Romanovitsh
Romanovitš, Gerli, 1977-
2004-01-01
Ilmunud ka: Severnoje Poberezhje, 22. dets. 2004, lk. 4. Aasta aega Šveitsi investeerimisfirmale Sorbes AG kuulunud Püssi Repo Vabrikud tähistab puitlaastvabrikute kombinaadi 30. sünnipäeva. Praegu toodetakse 170 000 m3 puitlaastplaati aastas
20 CFR 416.266 - Continuation of SSI status for Medicaid
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Continuation of SSI status for Medicaid 416... Disabling Impairment § 416.266 Continuation of SSI status for Medicaid If we stop your benefits because of... to be considered an SSI recipient for purposes of eligibility for Medicaid during the time it takes...
Hyper- and hyporesponsive mutant forms of the Saccharomyces cerevisiae Ssy1 amino acid sensor
DEFF Research Database (Denmark)
Poulsen, Peter; Gaber, Richard F.; Kielland-Brandt, Morten
2008-01-01
The Saccharomyces cerevisiae integral membrane protein Ssy1p functions with Ssy5p and Ptr3p to sense extracellular amino acids. Signal transduction leads to processing and nuclear localization of Stp1p and Stp2p, transcriptional activators of many amino acid transporter genes. Ssy1p is structural...
20 CFR 416.1816 - Information we need concerning marriage when you apply for SSI.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Information we need concerning marriage when you apply for SSI. 416.1816 Section 416.1816 Employees' Benefits SOCIAL SECURITY ADMINISTRATION....1816 Information we need concerning marriage when you apply for SSI. When you apply for SSI benefits...
Coherence and incoherence collective behavior in financial market
Zhao, Shangmei; Xie, Qiuchao; Lu, Qing; Jiang, Xin; Chen, Wei
2015-10-01
Financial markets have been extensively studied as highly complex evolving systems. In this paper, we quantify financial price fluctuations through a coupled dynamical system composed of phase oscillators. We find that a Financial Coherence and Incoherence (FCI) coexistence collective behavior emerges as the system evolves into the stable state, in which the stocks split into two groups: one is represented by coherent, phase-locked oscillators, the other is composed of incoherent, drifting oscillators. It is demonstrated that the size of the coherent stock groups fluctuates during the economic periods according to real-world financial instabilities or shocks. Further, we introduce the coherent characteristic matrix to characterize the involvement dynamics of stocks in the coherent groups. Clustering results on the matrix provides a novel manifestation of the correlations among stocks in the economic periods. Our analysis for components of the groups is consistent with the Global Industry Classification Standard (GICS) classification and can also figure out features for newly developed industries. These results can provide potentially implications on characterizing the inner dynamical structure of financial markets and making optimal investment into tragedies.
Intersubassembly incoherencies and grouping techniques in LMFBR hypothetical overpower accident
International Nuclear Information System (INIS)
Wilburn, N.P.
1977-10-01
A detailed analysis was made of the FTR core using the 100-channel MELT-IIIA code. Results were studied for the transient overpower accident (where 0.5$/sec and 1$/sec ramps) and in which the Damage Parameter and the Failure Potential criteria were used. Using the information obtained from these series of runs, a new method of grouping the subassemblies into channels has been developed. Also, it was demonstrated that a 7-channel representation of the FTR core using this method does an adequate job of representing the behavior during a hypothetical disruptive transient overpower core accident. It has been shown that this new 7-channel grouping method does a better job than an earlier 20-channel grouping. It has also been demonstrated that the incoherency effects between subassemblies as shown during the 76-channel representation of the reactor can be adequately modeled by 7-channels, provided the 7-channels are selected according to the criteria stated in the report. The overall results of power and net reactivity were shown to be only slightly different in the two cases of the 7-channel and the 76-channel runs. Therefore, it can be concluded that any intersubassembly incoherencies can be modeled adequately by a small number of channels, provided the subassemblies making up these channels are selected according to the criteria stated
Perego, R.C.
2004-01-01
Two novel neutron-based analytical techniques have been treated in this thesis, Neutron Resonance Capture Analysis (NRCA), employing a pulsed neutron source, and Neutron Incoherent Scattering (NIS), making use of a cold neutron source. With the NRCA method isotopes are identified by the
Incoherent neutron-scattering determination of hydrogen content : Theory and modeling
Perego, R.C.; Blaauw, M.
2005-01-01
Hydrogen concentrations of 0 up to 350?mg/kg in a titanium alloy have been determined at National Institute of Standards and Technology (NIST) with neutron incoherent scattering (NIS) and with cold neutron prompt gamma activation analysis. The latter is a well-established technique, while the former
Incoherent Optical Frequency Domain Reflectometry for Distributed Thermal Sensing
DEFF Research Database (Denmark)
Karamehmedovic, Emir
2006-01-01
comprising a pump laser, optical filters, optical fibre and photo-detectors are presented. Limitations, trade-offs and optimisation processes are described for setups having different specifications with respect to range, resolution and accuracy. The analysis is conducted using computer simulation programs...... developed and implemented in Matlab. The computer model is calibrated and tested, and describes the entire system with high precision. Noise analysis and digital processing of the detected signal are discussed as well. An equation describing the standard deviation of the measured temperature is derived......This thesis reports the main results from an investigation of a fibre-optic distributed temperature sensor based on spontaneous Raman scattering. The technique used for spatial resolving is the incoherent optical frequency domain reflectometry, where a pump laser is sine modulated with a stepwise...
Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood
The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to translate SSI-4 into Persian language and to discuss its relative and absolute reliability as well as its criterion validity for Persian adults who stutter (PWS). We also aimed to study how the new subjective self-reports of the SSI-4 complement the stuttering severity score obtained from the SSI-3 or the SSI-4. The cross-cultural guideline recommended by the International Quality of Life Assessment project was used to translate the SSI-4 into Persian language. Thirty five PWS from ages 17 to 42 were recruited and 10 speech and language pathologists assessed their stuttering severity using either the SSI-4 or stuttering severity ratings (SR) to test validity and reliability of the Persian translated version. A very high inter-judge relative reliability along with a poor absolute inter-judge reliability was found for the SSI-4 scores. The results were more promising for the intra-judge absolute reliability. Test-retest reliability of the complementary questions to the SSI-4 was also found acceptable. However, no strong relationship was found between the SSI-4 scores and its complementary questions. The Persian version of the SSI-4 can be used reliably by trained SLPs for research and clinical purposes, but not to document small changes in stuttering severity. We argue that the response of participants to the complementary self-report questions should also be considered in calculating their stuttering severity score. Copyright © 2018 Elsevier Inc. All rights reserved.
SSI's International Development Co-operation (SIUS). Annual report 1998
International Nuclear Information System (INIS)
Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar
1999-04-01
SSI's International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998
Effect of the gate scaling on the analogue performance of s-Si CMOS devices
International Nuclear Information System (INIS)
Fobelets, K; Calvo-Gallego, J; Velázquez-Pérez, J E
2011-01-01
In this contribution, we present a detailed study of the analogue performance of deep submicron strained n-channel Si/SiGe (s-Si) MOSFETs. The study was carried out using a 2D device simulator based on the hydrodynamic model and the impedance field method to self-consistently obtain the current noise at the device's terminals. The analysis focused on the possible benefits of the gate scaling on the ac and noise performance of the transistor for low-power applications while keeping constant the oxide thickness equal to 2 nm to guarantee negligible level of the gate tunnel current. For a drain to source bias of 50 mV, it was found that a pure scaling of the transistor's gate length under 32 nm is detrimental for subthreshold operation in terms of the subthreshold slope (S) and transconductance (g m ) but would lead to reasonably low values of the minimum noise figure (NF min ). For the sake of comparison, SOI MOSFETs with the same layout and operating under the same conditions were simulated. The SOI MOSFETs showed better immunity against the gate scaling in terms of S than the s-Si MOSFETs, but lower values of g m and a higher value of NF min at the same level of the drain current. Finally, the devices have been studied in the saturation region for a drain to source bias of 1 V. In this region, it was found that the dependence of the current level SOI or s-Si MOSFET may outperform its counterparts
ANTIMICROBIAL SUSCEPTIBILITY PATTERN OF ORGANISMS CAUSING SURGICAL SITE INFECTIONS (SSI
Directory of Open Access Journals (Sweden)
Rohini Murlidhar Gajbhiye
2017-02-01
Full Text Available BACKGROUND CDC defines surgical site infection as ‘Infections related to operative procedure that occurs at or near surgical incision within 30 days of operative procedure or within one year if the implant is left in situ’. Surgical site infection (SSI is 3 rd most frequently reported nosocomial infection (12%-16% as per National Nosocomial Infection Surveillance (NNIS. The aim of this study was to investigate the antimicrobial susceptibility pattern of organisms causing SSI. MATERIALS AND METHODS During a two year study period in a tertiary care hospital, 19,127 patients underwent surgeries in various surgical departments. Of these 517 (2.7% developed surgical site infection. The surgical wounds were classified by CDC & NNIS criteria into 4 classes. Two wound swabs were taken and processed by standard microbiological techniques. Antimicrobial susceptibility along with testing of ESBLs, MBLs, AmpCβ lactamases was done for all isolates causing SSI. RESULTS Among 19,127 patients, 517 (2.7% developed SSI. It was highest in patients of perforation peritonitis (11.99%.Among 517 specimens, 340 (65.76% showed growth and 177 (34.23% were culture negative. E.coli (23.33% was the commonest organism isolated followed by Acinetobacter spp. (16%, Klebsiella spp. (15.66%, Pseudomonas spp. (15.33%, S. aureus (10.33%, S. epidermidis(7.3%, Proteus spp. (6.00% and Citrobacter spp. (2.66%.Staphylococcus spp. were 100 % sensitive to Vancomycin & Linezolid. (27.5% S. aureus were MRSA and (17.5% were Inducible Clindamycin resistant (ICR. Enterobacteriaceae isolates showed maximum sensitivity towards Imipenem, Piperacillin-Tazobactam and Amikacin. Klebsiella spp. (40.62%, E.coli (35.89%, Citrobacter spp. (33.33%, Proteus spp. (26.08% were ESBL producers. Klebsiella spp. (17.18%, E.coli (10.25%, Proteus spp. (11.11% and Citrobacter spp. (8.69% were AmpC producers. Acinetobacter spp. (28.57% was commonest MBL producer followed by Klebsiella spp. (20
Coherent and incoherent processes in resonant photoemission
Energy Technology Data Exchange (ETDEWEB)
Magnuson, M.; Karis, O.; Weinelt, M. [Uppsala Univ. (Sweden)] [and others
1997-04-01
In this contribution the authors present the distinction between coherent and incoherent processes in resonant photoemission. As a first step they determine whether an autoionization process is photoemission-like or Auger-like. The discussion is based on measurements for a weakly bonded adsorption system, Ar/Pt(111). This type of system is well adapted to investigate these effects since it yields distinctly shifted spectral features depending on the nature of the process. After this, the question of resonance photoemission in metallic systems is addressed. This is done in connection with measurements at the 2p edges for Ni metal. Ni has been one of the prototype systems for resonant photoemission. The resonances have been discussed in connection with the strong correlation and d-band localization effects in this system. Based on the results some general comments about the appearance of resonant effects in metallic systems are made.
Electromagnetically induced absorption via incoherent collisions
International Nuclear Information System (INIS)
Yang Xihua; Sheng Jiteng; Xiao Min
2011-01-01
We conduct theoretical studies on electromagnetically induced absorption via incoherent collisions in an inhomogeneously broadened ladder-type three-level system with the density-matrix approach. The effects of the collision-induced coherence decay rates as well as the probe laser field intensity on the probe field absorption are examined. It is shown that with the increase of the collisional decay rates in a moderate range, a narrow dip due to electromagnetically induced transparency superimposed on the Doppler-broadened absorption background can be turned into a narrow peak under the conditions that the probe field intensity is not very weak as compared to the pump field, which results from the enhancement of constructive interference and suppression of destructive interference between one-photon and multiphoton transition pathways. The physical origin of the collision-assisted electromagnetically induced absorption is analyzed with a power-series solution of the density-matrix equations.
International Nuclear Information System (INIS)
Spears, Robert Edward; Coleman, Justin Leigh
2015-01-01
Currently the Department of Energy (DOE) and the nuclear industry perform seismic soil-structure interaction (SSI) analysis using equivalent linear numerical analysis tools. For lower levels of ground motion, these tools should produce reasonable in-structure response values for evaluation of existing and new facilities. For larger levels of ground motion these tools likely overestimate the in-structure response (and therefore structural demand) since they do not consider geometric nonlinearities (such as gaping and sliding between the soil and structure) and are limited in the ability to model nonlinear soil behavior. The current equivalent linear SSI (SASSI) analysis approach either joins the soil and structure together in both tension and compression or releases the soil from the structure for both tension and compression. It also makes linear approximations for material nonlinearities and generalizes energy absorption with viscous damping. This produces the potential for inaccurately establishing where the structural concerns exist and/or inaccurately establishing the amplitude of the in-structure responses. Seismic hazard curves at nuclear facilities have continued to increase over the years as more information has been developed on seismic sources (i.e. faults), additional information gathered on seismic events, and additional research performed to determine local site effects. Seismic hazard curves are used to develop design basis earthquakes (DBE) that are used to evaluate nuclear facility response. As the seismic hazard curves increase, the input ground motions (DBE's) used to numerically evaluation nuclear facility response increase causing larger in-structure response. As ground motions increase so does the importance of including nonlinear effects in numerical SSI models. To include material nonlinearity in the soil and geometric nonlinearity using contact (gaping and sliding) it is necessary to develop a nonlinear time domain methodology. This
Measurement Model of Reasoning Skills among Science Students Based on Socio Scientific Issues (SSI
Directory of Open Access Journals (Sweden)
MOHD AFIFI BAHURUDIN SETAMBAH
2018-05-01
Full Text Available The lack of reasoning skills has been recognized as one of the contributing factors to the declined achievement in the Trends in Mathematics and Science Studies (TIMSS and Programme for International Student Assessment (PISA assessments in Malaysia. The use of socio-scientific issues (SSI as a learning strategy offers the potential of improving the level of students' reasoning skills and consequently improves students’ achievement in science subjects. This study examined the development of a measurement model of reasoning skills among science students based on SSI using the analysis of moment structure (AMOS approach before going to second level to full structured equation modelling (SEM. A total of 450 respondents were selected using a stratified random sampling. Results showed a modified measurement model of reasoning skills consisting of the View Knowledge (VK was as a main construct. The items that measure the level of pre-reflection of students fulfilled the elements of unidimensionality, validity, and reliability. Although the level of student reasoning skills was still low but this development of measurement model could be identified and proposed teaching methods that could be adopted to improve students’ reasoning skills.
Incidental experiences of affective coherence and incoherence influence persuasion.
Huntsinger, Jeffrey R
2013-06-01
When affective experiences are inconsistent with activated evaluative concepts, people experience what is called affective incoherence; when affective experiences are consistent with activated evaluative concepts, people experience affective coherence. The present research asked whether incidental feelings of affective coherence and incoherence would regulate persuasion. Experiences of affective coherence and incoherence were predicted and found to influence the processing of persuasive messages when evoked prior to receipt of such messages (Experiments 1 and 3), and to influence the confidence with which thoughts generated by persuasive messages were held when evoked after presentation of such messages (Experiments 2 and 3). These results extend research on affective coherence and incoherence by showing that they exert a broader impact on cognitive activity than originally assumed.
Incoherent quasielastic neutron scattering from plastic crystals
International Nuclear Information System (INIS)
Bee, M.; Amoureux, J.P.
1980-01-01
The aim of this paper is to present some applications of a method indicated by Sears in order to correct for multiple scattering. The calculations were performed in the particular case of slow neutron incoherent quasielastic scattering from organic plastic crystals. First, an exact calculation (up to second scattering) is compared with the results of a Monte Carlo simulation technique. Then, an approximation is developed on the basis of a rotational jump model which allows a further analytical treatment. The multiple scattering is expressed in terms of generalized structure factors (which can be regarded as self convolutions of first order structure factors taking into account the instrumental geometry) and lorentzian functions the widths of which are linear combinations of the jump rates. Three examples are given. Two of them correspond to powder samples while in the third we are concerned with the case of a single crystalline slab. In every case, this approximation is shown to be a good approach to the multiple scattering evaluation, its main advantage being the possibility of applying it without any preliminary knowledge of the correlation times for rotational jumps. (author)
Processing oscillatory signals by incoherent feedforward loops
Zhang, Carolyn; Wu, Feilun; Tsoi, Ryan; Shats, Igor; You, Lingchong
From the timing of amoeba development to the maintenance of stem cell pluripotency,many biological signaling pathways exhibit the ability to differentiate between pulsatile and sustained signals in the regulation of downstream gene expression.While networks underlying this signal decoding are diverse,many are built around a common motif, the incoherent feedforward loop (IFFL),where an input simultaneously activates an output and an inhibitor of the output.With appropriate parameters,this motif can generate temporal adaptation,where the system is desensitized to a sustained input.This property serves as the foundation for distinguishing signals with varying temporal profiles.Here,we use quantitative modeling to examine another property of IFFLs,the ability to process oscillatory signals.Our results indicate that the system's ability to translate pulsatile dynamics is limited by two constraints.The kinetics of IFFL components dictate the input range for which the network can decode pulsatile dynamics.In addition,a match between the network parameters and signal characteristics is required for optimal ``counting''.We elucidate one potential mechanism by which information processing occurs in natural networks with implications in the design of synthetic gene circuits for this purpose. This work was partially supported by the National Science Foundation Graduate Research Fellowship (CZ).
Weng, Jiawen; Clark, David C.; Kim, Myung K.
2016-05-01
A numerical reconstruction method based on compressive sensing (CS) for self-interference incoherent digital holography (SIDH) is proposed to achieve sectional imaging by single-shot in-line self-interference incoherent hologram. The sensing operator is built up based on the physical mechanism of SIDH according to CS theory, and a recovery algorithm is employed for image restoration. Numerical simulation and experimental studies employing LEDs as discrete point-sources and resolution targets as extended sources are performed to demonstrate the feasibility and validity of the method. The intensity distribution and the axial resolution along the propagation direction of SIDH by angular spectrum method (ASM) and by CS are discussed. The analysis result shows that compared to ASM the reconstruction by CS can improve the axial resolution of SIDH, and achieve sectional imaging. The proposed method may be useful to 3D analysis of dynamic systems.
49 CFR 1520.15 - SSI disclosed by TSA or the Coast Guard.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false SSI disclosed by TSA or the Coast Guard. 1520.15... PROTECTION OF SENSITIVE SECURITY INFORMATION § 1520.15 SSI disclosed by TSA or the Coast Guard. (a) In... available for public inspection or copying, nor does TSA or the Coast Guard release such records to persons...
2011-01-05
... also were concerned that paying SSI in installments could distress SSI recipients. These commenters... increase an installment payment. Congress itemized certain outstanding debts relating to food, clothing... authority to make exceptions of this type. We can only approve impairment-related expenses. Comment: Several...
Effective Strategies To Improve the Employment of SSI/SSDI Participants.
Radtke, Jean, Ed.
This document is for administrators, rehabilitation counselors, and other professionals who support the employment of Social Security Disability Insurance (SSDI) beneficiaries and Supplemental Security Income (SSI) recipients with disabilities. It contains strategies for vocational rehabilitation (VR) programs to improve an SSI or SSDI…
International Nuclear Information System (INIS)
Johnson, J.J.; Maslenikov, O.R.; Benda, B.J.
1984-10-01
The Seismic Safety Margins Research Program (SSMRP) is a US NRC-funded program conducted by Lawrence Livermore National Laboratory. Its goal is to develop a complete fully coupled analysis procedure for estimating the risk of an earthquake-induced radioactive release from a commercial nuclear power plant. In Phase II of the SSMRP, the methodology was applied to the Zion nuclear power plant. Three topics in the SSI analysis of Zion were investigated and reported here - flexible foundation modeling, structure-to-structure interaction, and basemat uplift. The results of these investigations were incorporated in the SSMRP seismic risk analysis. 14 references, 51 figures, 13 tables
Directory of Open Access Journals (Sweden)
Anne Kristine Byhring
2014-10-01
Full Text Available In this article, we discuss the negotiation of the situated common ground in classroom conversations. Decision making on socioscientific issues (SSI includes norms of diverse funds of knowledge and interests. Arguments and justification may include warrants that cannot necessarily be weighed on the same scale. We discuss Roberts’ Visions 1 and 2 of scientific literacy as framing the common ground of classroom discussions. Two teacher–student dialogue sequences with 11th grade students from the Norwegian research project ElevForsk exemplify the negotiation of the situated common ground and the students’ deliberations. Our analysis examines what goes on in the thematic content, as well as at the interpersonal level of language use. Further, we suggest that different framings may complement each other and provide a space for the students’ emerging scientific conceptual development as well as for deliberation as a form of emerging procedural knowing.
SSI response of a typical shear wall structure
International Nuclear Information System (INIS)
Johnson, J.J.; Maslenikov, O.R.; Schewe, E.C.
1985-01-01
The seismic response of a typical shear structure in a commercial nuclear power plant was investigated for a series of site and foundation conditions using best estimate and design procedures. The structure selected is a part of the Zion AFT complex which is a connected group of reinforced concrete shear wall buildings, typical of nuclear power plant structures. Comparisons between best estimate responses quantified the effects of placing the structure on different sites and founding it in different manners. Calibration factors were developed by comparing simplified SSI design procedure responses to responses calculated by best estimate procedures. Nineteen basic cases were analyzed - each case was analyzed for ten earthquakes targeted to the NRC R.G. 1.60 design response spectra. The structure is a part of the Zion auxiliary-fuel handling turbine building (AFT) complex to the Zion nuclear power plants. (orig./HP)
Active Volcanism on Io as Seen by Galileo SSI
McEwen, A.S.; Keszthelyi, L.; Geissler, P.; Simonelli, D.P.; Carr, M.H.; Johnson, T.V.; Klaasen, K.P.; Breneman, H.H.; Jones, T.J.; Kaufman, J.M.; Magee, K.P.; Senske, D.A.; Belton, M.J.S.; Schubert, G.
1998-01-01
Active volcanism on Io has been monitored during the nominal Galileo satellite tour from mid 1996 through late 1997. The Solid State Imaging (SSI) experiment was able to observe many manifestations of this active volcanism, including (1) changes in the color and albedo of the surface, (2) active airborne plumes, and (3) glowing vents seen in eclipse. About 30 large-scale (tens of kilometers) surface changes are obvious from comparison of the SSI images to those acquired by Voyager in 1979. These include new pyroclastic deposits of several colors, bright and dark flows, and caldera-floor materials. There have also been significant surface changes on Io during the Galileo mission itself, such as a new 400-km-diameter dark pyroclastic deposit around Pillan Patera. While these surface changes are impressive, the number of large-scale changes observed in the four months between the Voyager 1 and Voyager 2 flybys in 1979 suggested that over 17 years the cumulative changes would have been much more impressive. There are two reasons why this was not actually the case. First, it appears that the most widespread plume deposits are ephemeral and seem to disappear within a few years. Second, it appears that a large fraction of the volcanic activity is confined to repeated resurfacing of dark calderas and flow fields that cover only a few percent of Io's surface. The plume monitoring has revealed 10 active plumes, comparable to the 9 plumes observed by Voyager. One of these plumes was visible only in the first orbit and three became active in the later orbits. Only the Prometheus plume has been consistently active and easy to detect. Observations of the Pele plume have been particularly intriguing since it was detected only once by SSI, despite repeated attempts, but has been detected several times by the Hubble Space Telescope at 255 nm. Pele's plume is much taller (460 km) than during Voyager 1 (300 km) and much fainter at visible wavelengths. Prometheus-type plumes (50
Cl@ssi 2.0: experience in Emilia Romagna
Directory of Open Access Journals (Sweden)
Elena Pacetti
2013-06-01
Full Text Available This article presents some of the results of the Ministerial Initiative Cl@ssi 2.0 in the Emilia Romagna Region. Having described the reference field in which the scaffolding action of the research group of the University of Bologna, coordinated by Prof. Luigi Guerra, is positioned, the paper presents the coaching model through which the design and documentation of the teaching practices adopted in schools was supported. Analysing the experiences of the ER classes, we have identified eight project themes, subsequently modelled on two levels: the didactic modelling of the experiences (construction of interpretation hypotheses; and the construction of a themes/models map (checking/adapting the hypotheses, experimentation through which each school was able to describe and publish processes, products, etc. which characterised their specific project experience. The paper concludes with a series of general reflections on the three years' work.
Siegel, Nisan; Storrie, Brian; Bruce, Marc; Brooker, Gary
2015-02-07
FINCH holographic fluorescence microscopy creates high resolution super-resolved images with enhanced depth of focus. The simple addition of a real-time Nipkow disk confocal image scanner in a conjugate plane of this incoherent holographic system is shown to reduce the depth of focus, and the combination of both techniques provides a simple way to enhance the axial resolution of FINCH in a combined method called "CINCH". An important feature of the combined system allows for the simultaneous real-time image capture of widefield and holographic images or confocal and confocal holographic images for ready comparison of each method on the exact same field of view. Additional GPU based complex deconvolution processing of the images further enhances resolution.
DoSSiER: Database of Scientific Simulation and Experimental Results
Wenzel, Hans; Genser, Krzysztof; Elvira, Daniel; Pokorski, Witold; Carminati, Federico; Konstantinov, Dmitri; Ribon, Alberto; Folger, Gunter; Dotti, Andrea
2017-01-01
The Geant4, GeantV and GENIE collaborations regularly perform validation and regression tests for simulation results. DoSSiER (Database of Scientific Simulation and Experimental Results) is being developed as a central repository to store the simulation results as well as the experimental data used for validation. DoSSiER can be easily accessed via a web application. In addition, a web service allows for programmatic access to the repository to extract records in json or xml exchange formats. In this article, we describe the functionality and the current status of various components of DoSSiER as well as the technology choices we made.
Coherent and incoherent (μ-, e-) conversion in nuclei
International Nuclear Information System (INIS)
Chiang, H.C.; Oset, E.; Kosmas, T.S.; Faessler, A.; Vergados, J.D.
1993-01-01
Coherent and incoherent (μ - , e - ) conversion in nuclei is studied within the framework of several theories which violate flavour lepton number. A useful approach is followed which allows a factorization of the conversion widths into nuclear factors and other factors which depend only on the elementary process. The nuclear factors are evaluated in a wide range of nuclei allowing simple calculations of the conversion rates throughout the periodic table for a given theory with a minimum of work in the elementary sector. The coherent conversion is found to dominate the process. The results obtained modify appreciable previous results in the literature, particularly in the incoherent process. (orig.)
Incoherent transport for phases that spontaneously break translations
Donos, Aristomenis; Gauntlett, Jerome P.; Griffin, Tom; Ziogas, Vaios
2018-04-01
We consider phases of matter at finite charge density which spontaneously break spatial translations. Without taking a hydrodynamic limit we identify a boost invariant incoherent current operator. We also derive expressions for the small frequency behaviour of the thermoelectric conductivities generalising those that have been derived in a translationally invariant context. Within holographic constructions we show that the DC conductivity for the incoherent current can be obtained from a solution to a Stokes flow for an auxiliary fluid on the black hole horizon combined with specific thermodynamic quantities associated with the equilibrium black hole solutions.
NOAA Climate Data Record (CDR) of Solar Spectral Irradiance (SSI), NRLSSI Version 2
National Oceanic and Atmospheric Administration, Department of Commerce — This Climate Data Record (CDR) contains solar spectral irradiance (SSI) as a function of time and wavelength created with the Naval Research Laboratory model for...
Social Security Administration — The Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area (December 2010) is produced using the data found in Table 38...
20 CFR 416.250 - Experimental, pilot, and demonstration projects in the SSI program.
2010-04-01
... administration of the SSI program. These projects will test the advantages of altering certain requirements... demonstration project will have a termination date (up to 10 years from the start of the project). [48 FR 7576...
SSI [soil-structure interactions] and structural benchmarks
International Nuclear Information System (INIS)
Philippacopoulos, A.J.; Miller, C.A.; Costantino, C.J.; Graves, H.
1986-01-01
This paper presents the latest results of the ongoing program entitled, ''Standard Problems for Structural Computer Codes'', currently being worked on at BNL for the USNRC, Office of Nuclear Regulatory Research. During FY 1986, efforts were focussed on three tasks, namely, (1) an investigation of ground water effects on the response of Category I structures, (2) the Soil-Structure Interaction Workshop and (3) studies on structural benchmarks associated with Category I structures. The objective of the studies on ground water effects is to verify the applicability and the limitations of the SSI methods currently used by the industry in performing seismic evaluations of nuclear plants which are located at sites with high water tables. In a previous study by BNL (NUREG/CR-4588), it has been concluded that the pore water can influence significantly the soil-structure interaction process. This result, however, is based on the assumption of fully saturated soil profiles. Consequently, the work was further extended to include cases associated with variable water table depths. In this paper, results related to ''cut-off'' depths beyond which the pore water effects can be ignored in seismic calculations, are addressed. Comprehensive numerical data are given for soil configurations typical to those encountered in nuclear plant sites. These data were generated by using a modified version of the SLAM code which is capable of handling problems related to the dynamic response of saturated soils
Interfacial Energy and Fine Defect Structures for Incoherent Films
Cermelli, Paolo; Gurtin, Morton E.; Leoni, Giovanni
1999-01-01
This note summarizes recent results in which modern techniques of the calculus of variations are used to obtain qualitative features of film-substrate interfaces for a broad class of interfacial energies. In particular, we show that the existence of a critical thickness for incoherency and the formation of interfacial dislocations depend strongly on the convexity and smoothness of the interfacial energy function.
Coherence Inherent in an Incoherent Synchrotron Radio Source ...
Indian Academy of Sciences (India)
It is well known that synchrotron radiation mechanism does not allow MASER type coherent emission (Pacholczyk 1970). Here we show that coherence can naturally occur in a synchrotron ... cally thick region (Fig. 1), then divides the synchrotron spectrum into an incoherent. 1A thin flat circular unleavened Indian bread.
Optically transparent multiple access networks employing incoherent spectral codes
Huiszoon, B.
2008-01-01
This Ph.D. thesis is divided into 7 chapters to provide the reader an overview of the main results achieved in di®erent sub-topics of the study towards optically transparent multiple access networks employing incoherent spectral codes taking into account wireless transmission aspects. The work
Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood
2018-01-01
Purpose: The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to
Xiao, Z; Tang, Z; Qiang, J; Wang, S; Qian, W; Zhong, Y; Wang, R; Wang, J; Wu, L; Tang, W; Zhang, Z
2018-01-25
Intravoxel incoherent motion is a promising method for the differentiation of sinonasal lesions. This study aimed to evaluate the value of intravoxel incoherent motion in the differentiation of benign and malignant sinonasal lesions and to compare the diagnostic performance of intravoxel incoherent motion with that of conventional DWI. One hundred thirty-one patients with histologically proved solid sinonasal lesions (56 benign and 75 malignant) who underwent conventional DWI and intravoxel incoherent motion were recruited in this study. The diffusion coefficient ( D ), pseudodiffusion coefficient ( D *), and perfusion fraction ( f ) values derived from intravoxel incoherent motion and ADC values derived from conventional DWI were measured and compared between the 2 groups using the Student t test. Receiver operating characteristic curve analysis, logistic regression analysis, and 10-fold cross-validation were performed to evaluate the diagnostic performance of single-parametric and multiparametric models. The mean ADC and D values were significantly lower in malignant sinonasal lesions than in benign sinonasal lesions (both P benign and malignant sinonasal lesions. © 2018 by American Journal of Neuroradiology.
SKI's and SSI's review of SKB's safety report SR-Can
International Nuclear Information System (INIS)
Dverstorp, Bjoern; Stroemberg, Bo
2008-03-01
This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be further developed for the licence application. -SKB's quality
On the response of large dams to incoherent seismic excitation
International Nuclear Information System (INIS)
Ramadan, O.; Novak, M.
1993-01-01
An intensive parametric study was conducted to investigate the response of concrete gravity dams to horizontal, spatially variable seismic ground motions. Both segmented dams consisting of separate blocks, or monoliths, and continuous monolithic dams are considered. The study includes the effects of various parameters on system natural frequencies, vibration modes, modal displacement ratios, as well as dam displacements and internal stresses due to spatially variable ground motions. The dam analytical model, and dam response to incoherent ground motions are described. The results show that the dam vibrates almost as a rigid body under the fully correlated waves, but bends and twists significantly under the spatially correlated motions. Dam-foundation interaction magnifies the low frequency components of the dam response, more so for a full reservoir, but decreases the high frequency components. For long dams, the effects of spatially incoherent ground motions are qualitatively different and can be much greater than those due to surface travelling waves. 3 refs., 3 figs
Incoherently combining logarithmic aspheric lenses for extended depth of field.
Chu, Kaiqin; George, Nicholas; Chi, Wanli
2009-10-01
We describe a method for combining concentric logarithmic aspheric lenses in order to obtain an extended depth of field. Substantial improvement in extending the depth of field is obtained by carefully controlling the optical path difference among the concentric lenses so that their outputs combine incoherently. The system is analyzed through diffraction theory and the point spread function is shown to be highly invariant over a long range of object distances. After testing the image performance on a three-dimensional scene, we found that the incoherently combined logarithmic aspheres can provide a high-quality image over an axial distance corresponding to a defocus of +/- 14(lambda/4). Studies of the images of two-point objects are presented to illustrate the resolution of these lenses.
Coherent and Incoherent Neutral Current Scattering for Supernova Detection
Directory of Open Access Journals (Sweden)
P. C. Divari
2012-01-01
Full Text Available The total cross sections as well as the neutrino event rates are calculated in the neutral current neutrino scattering off 40Ar and 132Xe isotopes at neutrino energies (Ev<100 MeV. The individual contribution coming from coherent and incoherent channels is taking into account. An enhancement of the neutral current component is achieved via the coherent (0gs+→0gs+ channel which is dominant with respect to incoherent (0gs+→Jf one. The response of the above isotopes as a supernova neutrino detection has been considered, assuming a two parameter Fermi-Dirac distribution for the supernova neutrino energy spectra. The calculated total cross sections are tested on a gaseous spherical TPC detector dedicated for supernova neutrino detection.
Phase diagram of incoherently driven strongly correlated photonic lattices
Biella, Alberto; Storme, Florent; Lebreuilly, José; Rossini, Davide; Fazio, Rosario; Carusotto, Iacopo; Ciuti, Cristiano
2017-08-01
We explore theoretically the nonequilibrium photonic phases of an array of coupled cavities in presence of incoherent driving and dissipation. In particular, we consider a Hubbard model system where each site is a Kerr nonlinear resonator coupled to a two-level emitter, which is pumped incoherently. Within a Gutzwiller mean-field approach, we determine the steady-state phase diagram of such a system. We find that, at a critical value of the intercavity photon hopping rate, a second-order nonequilibrium phase transition associated with the spontaneous breaking of the U(1 ) symmetry occurs. The transition from an incompressible Mott-like photon fluid to a coherent delocalized phase is driven by commensurability effects and not by the competition between photon hopping and optical nonlinearity. The essence of the mean-field predictions is corroborated by finite-size simulations obtained with matrix product operators and corner-space renormalization methods.
Evidence of strong proton shape fluctuations from incoherent diffraction
International Nuclear Information System (INIS)
Mantysaari, H.; Schenke, B.
2016-01-01
We show within the saturation framework that measurements of exclusive vector meson production at high energy provide evidence for strong geometric fluctuations of the proton. In comparison, the effect of saturation scale and color charge fluctuations is weak. This knowledge will allow detailed future measurements of the incoherent cross section to tightly constrain the fluctuating geometry of the proton as a function of the parton momentum fraction x.
Incoherent scatter studies of upper atmosphere dynamics and coding technique
International Nuclear Information System (INIS)
Haeggstroem, Ingemar.
1990-09-01
Observations by the EISCAT incoherent scatter radar are used to study the dynamics of the auroral upper atmosphere. The study describes some effects of the strong plasma convection occurring at these latitudes and a new coding technique for incoherent scatter radars. A technique to determine the thermospheric neutral wind from incoherent scatter measurements is described. Simultaneous Fabry-Perot interferometer measurements of the wind are compared with those derived from the radar data. F-region electron density depletions in the afternoon/evening sector of the auroral zone, identified as the main ionospheric trough, are investigated. In a statistical study, based on wide latitude scanning experiment made at solar minimum, the trough appearance at a given latitude is compared to the geomagnetic index K p , and an empirical model predicting the latitude of the trough is proposed. Detailed studies, using different experiment modes, show that the equatorward edge of the auroral oval is co-located of up to 1 degree poleward of the trough minimum, which in turn is co-located with the peak convective electric field, with its boundary 1 degree - 2 degree equatorward of the trough minimum. It is shown that the F-region ion composition changes from pure 0 + to molecular ion dominated (NO + /O 2 + ) as the trough moves into the region probed by the radar. In a special case, where a geomagnetic sudden impulse caused an expansion of the plasma convection pattern, the equatorward trough progression is studied together with ionosonde measurements. A new coding technique for incoherent scatter radar measurement is introduced and described. The method, called alternating codes, provides significantly more accurate estimates of the plasma parameters than can be obtained by frequency commutated multipulse measurements. Simple explanations of the method are given as well as a precise definition. Two examples of application of the alternating codes are presented, showing the high
Are Ascriptions of Intentionality to the Brain Incoherent?
DEFF Research Database (Denmark)
Presskorn-Thygesen, Thomas
The ascriptions of ‘agency’ or ‘intentionality’ to the brain has long been regarded with suspicion from social scientists and philosophers. In the talk, I will argue that this suspicion is perfectly legitimate and that the standard response from the defenders of cognitive neuroscience is illegiti...... to the brain are conceptually incoherent because it commits a mereological fallacy (Bennett&Hacker 2001, 2007)....
International Nuclear Information System (INIS)
Reese, K.W.; Johnson, R.M.; Killeen, T.L.
1991-01-01
Ion-neutral collision frequencies determined from measurements obtained by the incoherent scatter radar located at Soendre Stroemfjord, Greenland, have been used to derive lower thermospheric neutral densities during the first Lower Thermosphere Coupling Study (LTCS 1), September 21-26, 1987. Periods of Joule and particle heating which might disturb the E region thermal equilibrium were systematically eliminated. The mean profile of neutral density for the period is in good agreement with the mass spectrometer incoherent scatter 1986 (MSIS-86) model between 92 and 104 km. A tendency to overestimate collision frequencies above 105 km may arise from range-smearing effects. The results of a tidal analysis performed on the neutral density between 92 and 109 km show that the amplitudes of the diurnal and semidiurnal components of the tides are approximately equivalent. The observations are generally in better agreement with the MSIS-86 predictions than with the thermosphere-ionosphere general circulation model (TIGCM) simulation of the LTCS 1 interval. The observed phase of the diurnal component is approximately constant with height above 98 km and is in close agreement with the MSIS-86 model phases; however, the TIGCM diurnal phases are shifted by 6-8 hours to later local times. The phase of the semidiurnal tide is in good agreement with predictions of the MSIS-86 model and the TIGCM simulation of this interval, except near 98 km. The observed semidiurnal phase is also consistent with previous high-latitude results (Kirkwood, 1986). The relative amplitude of the observed semidiurnal oscillation is up to 15% larger than that previously observed at the European Incoherent Scatter facility but is consistent with the amplitudes presented in an earlier study of Millstone Hill measurements (Salah, 1974)
Holographic fluorescence microscopy with incoherent digital holographic adaptive optics.
Jang, Changwon; Kim, Jonghyun; Clark, David C; Lee, Seungjae; Lee, Byoungho; Kim, Myung K
2015-01-01
Introduction of adaptive optics technology into astronomy and ophthalmology has made great contributions in these fields, allowing one to recover images blurred by atmospheric turbulence or aberrations of the eye. Similar adaptive optics improvement in microscopic imaging is also of interest to researchers using various techniques. Current technology of adaptive optics typically contains three key elements: a wavefront sensor, wavefront corrector, and controller. These hardware elements tend to be bulky, expensive, and limited in resolution, involving, for example, lenslet arrays for sensing or multiactuator deformable mirrors for correcting. We have previously introduced an alternate approach based on unique capabilities of digital holography, namely direct access to the phase profile of an optical field and the ability to numerically manipulate the phase profile. We have also demonstrated that direct access and compensation of the phase profile are possible not only with conventional coherent digital holography, but also with a new type of digital holography using incoherent light: selfinterference incoherent digital holography (SIDH). The SIDH generates a complex—i.e., amplitude plus phase—hologram from one or several interferograms acquired with incoherent light, such as LEDs, lamps, sunlight, or fluorescence. The complex point spread function can be measured using guide star illumination and it allows deterministic deconvolution of the full-field image. We present experimental demonstration of aberration compensation in holographic fluorescence microscopy using SIDH. Adaptive optics by SIDH provides new tools for improved cellular fluorescence microscopy through intact tissue layers or other types of aberrant media.
Electromagnetically induced two-dimensional grating assisted by incoherent pump
Energy Technology Data Exchange (ETDEWEB)
Chen, Yu-Yuan; Liu, Zhuan-Zhuan; Wan, Ren-Gang, E-mail: wrg@snnu.edu.cn
2017-04-25
We propose a scheme for realizing electromagnetically induced two-dimensional grating in a double-Λ system driven simultaneously by a coherent field and an incoherent pump field. In such an atomic configuration, the absorption is suppressed owing to the incoherent pumping process and the probe can be even amplified, while the refractivity is mainly attributed to the dynamically induced coherence. With the help of a standing-wave pattern coherent field, we obtain periodically modulated refractive index without or with gain, and therefore phase grating or gain-phase grating which diffracts a probe light into high-order direction efficiently can be formed in the medium via appropriate manipulation of the system parameters. The diffraction efficiency attainable by the present gratings can be controlled by tuning the coherent field intensity or the interaction length. Hence, the two-dimensional grating can be utilized as all-optical splitter or router in optical networking and communication. - Highlights: • Two-dimensional grating is coherently induced in four-level atoms. • Phase and gain-phase gratings are obtained assisted by incoherent pump. • The diffraction power is improved due to the enhanced refraction modulation. • The gratings can be utilized as multi-channel all-optical splitter and router.
Coherent imaging with incoherent light in digital holographic microscopy
Chmelik, Radim
2012-01-01
Digital holographic microscope (DHM) allows for imaging with a quantitative phase contrast. In this way it becomes an important instrument, a completely non-invasive tool for a contrast intravital observation of living cells and a cell drymass density distribution measurement. A serious drawback of current DHMs is highly coherent illumination which makes the lateral resolution worse and impairs the image quality by a coherence noise and a parasitic interference. An uncompromising solution to this problem can be found in the Leith concept of incoherent holography. An off-axis hologram can be formed with arbitrary degree of light coherence in systems equipped with an achromatic interferometer and thus the resolution and the image quality typical for an incoherent-light wide-field microscopy can be achieved. In addition, advanced imaging modes based on limited coherence can be utilized. The typical example is a coherence-gating effect which provides a finite axial resolution and makes DHM image similar to that of a confocal microscope. These possibilities were described theoretically using the formalism of three-dimensional coherent transfer functions and proved experimentally by the coherence-controlled holographic microscope which is DHM based on the Leith achromatic interferometer. Quantitative-phase-contrast imaging is demonstrated with incoherent light by the living cancer cells observation and their motility evaluation. The coherence-gating effect was proved by imaging of model samples through a scattering layer and living cells inside an opalescent medium.
SSI on the Dynamic Behaviour of a Historical Masonry Building: Experimental versus Numerical Results
Directory of Open Access Journals (Sweden)
Francesca Ceroni
2014-11-01
Full Text Available A reliable procedure to identify the dynamic behaviour of existing masonry buildings is described in the paper, referring to a representative case study: a historical masonry palace located in Benevento (Italy. Since the building has been equipped with a permanent dynamic monitoring system by the Department of Civil Protection, some of the recorded data, acquired in various operating conditions, have been analysed with basic instruments of the Operational Modal Analysis in order to identify the main eigenfrequencies and vibration modes of the structure. The obtained experimental results have been compared to the numerical outcomes provided by three detailed Finite Element (FE models of the building. The influence of Soil-Structure Interaction (SSI has been also introduced in the FE model by a sub-structure approach where concentrated springs were placed at the base of the building to simulate the effect of soil and foundation on the global dynamic behaviour of the structure. The obtained results evidence that subsoil cannot a priori be disregarded in identifying the dynamic response of the building.
[Spanish adaptation of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM)].
Escobar Espejo, Milagros; Blanca, María J; Fernández-Baena, F Javier; Trianes Torres, María Victoria
2011-08-01
The aim of the present study was to translate into Spanish and to describe the psychometric properties of the Stress Manifestations Scale of the Student Stress Inventory (SSI-SM), developed by Fimian, Fastenau, Tashner and Cross to identify the main manifestations of stress in adolescents. The scale was applied to a sample of 1,002 pupils from years one and two of Secondary Education. The paper reports the factor structure, an item analysis, the internal consistency, differences by sex and academic year, external evidence of validity, and norms for scoring the scale. The results reveal a factor structure based on three first-order factors (emotional manifestations, physiological manifestations and behavioural manifestations) and one second-order factor (indicative of stress manifestations). In terms of external validity, there was a positive association with measures of perceived stress, aggressiveness, internalized/externalized symptoms, and a negative association with life satisfaction. The results show that the scale is an adequate tool for evaluating stress manifestations in adolescents.
SSI and SKI's Review of SKB's Updated Final Safety Report for SFR 1. Review Report
International Nuclear Information System (INIS)
2003-10-01
compared with the inventory used in the safety assessment. On the whole, the review committee considers SKB's calculation results to be reasonable. However, deficient information concerning uncertainties in calculation results and risk estimates make it difficult to judge the compliance with SSI's requirements on the protective capability of the repository. The situation is further complicated by the fact that the calculated overall risk is on the same level as SSI's risk criterion. Therefore, the review committee considers that SKB's safety report should be supplemented with respect to a number of points. An important point is that a more comprehensive sensitivity and uncertainty analysis should be conducted in order to provide a better understanding of the safety margins that SKB refers to in its evaluation of the results. Furthermore, an improved estimate of the inventory of certain long-lived radionuclides is needed
Energy Technology Data Exchange (ETDEWEB)
Oehlen, Elisabeth
2006-09-15
The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect.
International Nuclear Information System (INIS)
Glesk, I.; Baby, V.
2005-01-01
We present the architecture and code design for a highly scalable, 2.5 Gb/s per user optical code division multiple access (OCDMA) system. The system is scalable to 100 potential and more than 10 simultaneous users, each with a bit error rate (BER) of less than 10 -9 . The system architecture uses a fast wavelength-hopping, time-spreading codes. Unlike frequency and phase sensitive coherent OCDMA systems, this architecture utilizes standard on off keyed optical pulses allocated in the time and wavelength dimensions. This incoherent OCDMA approach is compatible with existing WDM optical networks and utilizes off the shelf components. We discuss the novel optical subsystem design for encoders and decoders that enable the realization of a highly scalable incoherent OCDMA system with rapid reconfigurability. A detailed analysis of the scalability of the two dimensional code is presented and select network deployment architectures for OCDMA are discussed (Authors)
First E- and D-region incoherent scatter spectra observed over Jicamarca
Directory of Open Access Journals (Sweden)
J. L. Chau
2006-07-01
Full Text Available We present here the first Jicamarca observations of incoherent scatter radar (ISR spectra detected from E- and D-region altitudes. In the past such observations have not been possible at Jicamarca due a combined effect of strong equatorial electrojet (EEJ clutter and hardware limitations in the receiving system. The observations presented here were made during weak EEJ conditions (i.e., almost zero zonal electric field using an improved digital receiving system with a wide dynamic range and a high data throughput. The observed ISR spectra from E- and D-region altitudes are, as expected, narrow and get even narrower with decreasing altitude due to increasing ion-neutral collision frequencies. Therefore, it was possible to obtain accurate spectral measurements using a pulse-to-pulse data analysis. At lower altitudes in the D-region where signal correlation times are relatively long we used coherent integration to improve the signal-to-noise ratio of the collected data samples. The spectral estimates were fitted using a standard incoherent scatter (IS spectral model between 87 and 120 km, and a Lorentzian function below 110 km. Our preliminary estimates of temperature and ion-neutral collisions frequencies above 87 km are in good agreement with the MSISE-90 model. Below 87 km, the measured spectral widths are larger than expected, causing an overestimation of the temperatures, most likely due to spectral distortions caused by atmospheric turbulence.
Pitiporntapin, Sasithep; Lankford, Deanna Marie
2015-01-01
This paper addresses using social media to promote pre-service science teachers' practices of Socio-Scientific Issue (SSI) based teaching in a science classroom setting. We designed our research in two phases. The first phase examined pre-service science teachers' perceptions about using social media to promote their SSI-based teaching. The…
International Nuclear Information System (INIS)
Oehlen, Elisabeth
2006-09-01
The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect
Experimental tests of induced spatial incoherence using short laser wavelength
International Nuclear Information System (INIS)
Obenschain, S.P.; Grun, J.; Herbst, M.J.
1986-01-01
The authors have developed a laser beam smoothing technique called induced spatial incoherence (ISI), which can produce the highly uniform focal profiles required for direct-drive laser fusion. Uniform well-controlled focal profiles are required to obtain the highly symmetric pellet implosions needed for high-energy gain. In recent experiments, the authors' tested the effects of ISI on high-power laser-target interaction. With short laser wavelength, the coupling physics dramatically improved over that obtained with an ordinary laser beam
Impact of Microwaves on the Electron Cloud and Incoherent Effects
Decker, Franz Josef; Zimmermann, Frank
2002-01-01
We consider the use of microwaves for manipulating the electron cloud, describing an exploratory experiment at PEP-II as well as computer simulations of the electron cloud build-up in the presence of a microwave for an LHC dipole. We then show that the incoherent effects of the electron cloud - energy loss and transverse emittance growth due to scattering of the electrons - are negligible. This suggests that the disturbance of the coherent motion may be another possible application of microwaves, which could prevent beam emittance growth and beam loss.
2010-01-11
... extend the home exclusion to beneficiaries who, because of domestic abuse, leave a home that had... Domestic Abuse An SSI applicant's or beneficiary's home and associated land are excluded from resources by... abuse leaves the home and resides elsewhere. Currently, a victim fleeing from domestic abuse may return...
Galileo SSI Observations of Io During Orbits C30 I33
Keszthelyi, L.; Turtle, E.; McEwen, A.; Simonelli, D.; Geissler, P.; Williams, D.; Milazzo, M.; Radebaugh, J.; Jaeger, W.; Klaasen, K. P.
2002-01-01
New Galileo SSI imaging of Io from orbits C30 I33 will be presented. The aging Galileo spacecraft continues to produce spectacular new results, including the tallest volcanic plume yet found on Io. Additional information is contained in the original extended abstract.
20 CFR 416.1826 - Showing that you are not married when you apply for SSI.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Showing that you are not married when you apply for SSI. 416.1826 Section 416.1826 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL... used on mail for each of you? (iv) Who owns or rents the place where you live? (v) Do any deeds, leases...
Investigation of the Reliability of the SSI-3 for Preschool Persian-Speaking Children Who Stutter
Bakhtiar, Mehdi; Seifpanahi, Sadegh; Ansari, Hossein; Ghanadzade, Mehdi; Packman, Ann
2010-01-01
There is a pressing need in Iran for the translation of widely used speech-language assessment tools into Persian. This study reports the interjudge and intrajudge reliability of a Persian translation of the Stuttering Severity Instrument-3 (SSI-3) (Riley, 1994). There was greater than 80% interjudge and intrajudge agreement on scale scores for…
Confidence interval of intrinsic optimum temperature estimated using thermodynamic SSI model
Institute of Scientific and Technical Information of China (English)
Takaya Ikemoto; Issei Kurahashi; Pei-Jian Shi
2013-01-01
The intrinsic optimum temperature for the development of ectotherms is one of the most important factors not only for their physiological processes but also for ecological and evolutional processes.The Sharpe-Schoolfield-Ikemoto (SSI) model succeeded in defining the temperature that can thermodynamically meet the condition that at a particular temperature the probability of an active enzyme reaching its maximum activity is realized.Previously,an algorithm was developed by Ikemoto (Tropical malaria does not mean hot environments.Journal of Medical Entomology,45,963-969) to estimate model parameters,but that program was computationally very time consuming.Now,investigators can use the SSI model more easily because a full automatic computer program was designed by Shi et al.(A modified program for estimating the parameters of the SSI model.Environmental Entomology,40,462-469).However,the statistical significance of the point estimate of the intrinsic optimum temperature for each ectotherm has not yet been determined.Here,we provided a new method for calculating the confidence interval of the estimated intrinsic optimum temperature by modifying the approximate bootstrap confidence intervals method.For this purpose,it was necessary to develop a new program for a faster estimation of the parameters in the SSI model,which we have also done.
QR code optical encryption using spatially incoherent illumination
Cheremkhin, P. A.; Krasnov, V. V.; Rodin, V. G.; Starikov, R. S.
2017-02-01
Optical encryption is an actively developing field of science. The majority of encryption techniques use coherent illumination and suffer from speckle noise, which severely limits their applicability. The spatially incoherent encryption technique does not have this drawback, but its effectiveness is dependent on the Fourier spectrum properties of the image to be encrypted. The application of a quick response (QR) code in the capacity of a data container solves this problem, and the embedded error correction code also enables errorless decryption. The optical encryption of digital information in the form of QR codes using spatially incoherent illumination was implemented experimentally. The encryption is based on the optical convolution of the image to be encrypted with the kinoform point spread function, which serves as an encryption key. Two liquid crystal spatial light modulators were used in the experimental setup for the QR code and the kinoform imaging, respectively. The quality of the encryption and decryption was analyzed in relation to the QR code size. Decryption was conducted digitally. The successful decryption of encrypted QR codes of up to 129 × 129 pixels was demonstrated. A comparison with the coherent QR code encryption technique showed that the proposed technique has a signal-to-noise ratio that is at least two times higher.
International Nuclear Information System (INIS)
2008-03-01
The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish
Expert judgements in performance assessments. Report of an SKI/SSI seminar
International Nuclear Information System (INIS)
Wilmot, R.D.; Galson, D.A.; Hora, S.C.
2000-09-01
Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session, designed to
Expert judgements in performance assessments. Report of an SKI/SSI seminar
Energy Technology Data Exchange (ETDEWEB)
Wilmot, R.D.; Galson, D.A. [Galson Sciences Ltd, Oakham (United Kingdom); Hora, S.C. [Univ. of Hawaii, Hilo, HI (United States)
2000-09-01
Expert judgements are an important element of all performance assessments and are made when alternative approaches to decision-making are not available or are not feasible. Decisions regarding the scope of a particular assessment or the type of modelling approach adopted must be made through judgements because there are no observations that can be made. Similarly, any assumptions concerning human activities in the far future are essentially speculative and must be based on expert judgement. Observations of spatial heterogeneity within a disposal system may, on the other hand, be theoretically possible but not be feasible because of excessive cost or because they would adversely affect the system they were intended to characterise. Because there is a wide range of judgements made within a performance assessment, there are several ways of making the judgements and of assessing how they have been made. Judgements may, for example, be made by individuals or by groups, and they may be formally elicited or made without formal elicitation. Dialogue with stake holders can be an important means of assessing judgements, as can peer review. Documentation is a key element throughout the process of making and reviewing judgements, and appropriate quality assurance procedures can also build confidence in judgements. In order to develop an understanding of the processes of making and assessing judgements, the Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) jointly sponsored a seminar entitled 'The Use of Expert Judgements in Performance Assessments'. The seminar was held in Norrtaelje, Sweden, on 17-19 January 2000. The seminar was organised by Galson Sciences Ltd (GSL) on behalf of SKI, and conducted jointly by GSL and Professor Steve Hora of the University of Hawaii. Participants at the seminar included SKI and SSI staff and independent experts. A key element of the seminar was an illustrative expert elicitation session
2009-12-01
The Supplemental Security Income (SSI) program remains an important source of financial support for low-income families of children with special health care needs and disabling conditions. In most states, SSI eligibility also qualifies children for the state Medicaid program, providing access to health care services. The Social Security Administration (SSA), which administers the SSI program, considers a child disabled under SSI if there is a medically determinable physical or mental impairment or combination of impairments that results in marked and severe functional limitations. The impairment(s) must be expected to result in death or have lasted or be expected to last for a continuous period of at least 12 months. The income and assets of families of children with disabilities are also considered when determining financial eligibility. When an individual with a disability becomes an adult at 18 years of age, the SSA considers only the individual's income and assets. The SSA considers an adult to be disabled if there is a medically determinable impairment (or combination of impairments) that prevents substantial gainful activity for at least 12 continuous months. SSI benefits are important for youth with chronic conditions who are transitioning to adulthood. The purpose of this statement is to provide updated information about the SSI medical and financial eligibility criteria and the disability-determination process. This statement also discusses how pediatricians can help children and youth when they apply for SSI benefits.
The Precautionary Principle Has Not Been Shown to Be Incoherent: A Reply to Peterson : Response
Boyer-Kassem, Thomas
2017-01-01
In this journal, I have objected to Peterson's 2006 claim that the precautionary principle is an incoherent decision rule. I defend my objections to Peterson's recent replies, and I still claim that the precautionary principle has not been shown to be incoherent.
Van Aert, S.; Van Dyck, D.; Den Dekker, A.J.
2006-01-01
The resolution of coherent and incoherent imaging systems is usually evaluated in terms of classical resolution criteria, such as Rayleigh’s. Based on these criteria, incoherent imaging is generally concluded to be ‘better’ than coherent imaging. However, this paper reveals some misconceptions in
Errors due to random noise in velocity measurement using incoherent-scatter radar
Directory of Open Access Journals (Sweden)
P. J. S. Williams
1996-12-01
Full Text Available The random-noise errors involved in measuring the Doppler shift of an 'incoherent-scatter' spectrum are predicted theoretically for all values of Te/Ti from 1.0 to 3.0. After correction has been made for the effects of convolution during transmission and reception and the additional errors introduced by subtracting the average of the background gates, the rms errors can be expressed by a simple semi-empirical formula. The observed errors are determined from a comparison of simultaneous EISCAT measurements using an identical pulse code on several adjacent frequencies. The plot of observed versus predicted error has a slope of 0.991 and a correlation coefficient of 99.3%. The prediction also agrees well with the mean of the error distribution reported by the standard EISCAT analysis programme.
Takeda, Kosuke; Shao, Danying; Adler, Micha; Charest, Pascale G; Loomis, William F; Levine, Herbert; Groisman, Alex; Rappel, Wouter-Jan; Firtel, Richard A
2012-01-03
Adaptation in signaling systems, during which the output returns to a fixed baseline after a change in the input, often involves negative feedback loops and plays a crucial role in eukaryotic chemotaxis. We determined the dynamical response to a uniform change in chemoattractant concentration of a eukaryotic chemotaxis pathway immediately downstream from G protein-coupled receptors. The response of an activated Ras showed near-perfect adaptation, leading us to attempt to fit the results using mathematical models for the two possible simple network topologies that can provide perfect adaptation. Only the incoherent feedforward network accurately described the experimental results. This analysis revealed that adaptation in this Ras pathway is achieved through the proportional activation of upstream components and not through negative feedback loops. Furthermore, these results are consistent with a local excitation, global inhibition mechanism for gradient sensing, possibly with a Ras guanosine triphosphatase-activating protein acting as a global inhibitor.
Application of Incoherent Inelastic Neutron Scattering in Pharmaceutical Analysis
DEFF Research Database (Denmark)
Bordallo, Heloisa N.; A. Zakharov, Boris; Boidyreva, E.V.
2012-01-01
This study centers on the use of inelastic neutron scattering as an alternative tool for physical characterization of solid pharmaceutical drugs. On the basis of such approach, relaxation processes in the pharmaceutical compound phenacetin (p-ethoxyacetanilide, C(10)H(13)NO(2)) were evidenced...... contributes to understanding the relationships between intermolecular hydrogen bonds, intramolecular dynamics, and conformational flexibility in pharmaceuticals on a molecular level, which can help in evaluating phase stability with respect to temperature variations on processing or on storage, and is related...
Delineating incoherent non-Markovian dynamics using quantum coherence
Energy Technology Data Exchange (ETDEWEB)
Chanda, Titas, E-mail: titaschanda@hri.res.in; Bhattacharya, Samyadeb, E-mail: samyadebbhattacharya@hri.res.in
2016-03-15
We introduce a method of characterization of non-Markovianity using coherence of a system interacting with the environment. We show that under the allowed incoherent operations, monotonicity of a valid coherence measure is affected due to non-Markovian features of the system–environment evolution. We also define a measure to quantify non-Markovianity of the underlying dynamics based on the non-monotonic behavior of the coherence measure. We investigate our proposed non-Markovianity marker in the behavior of dephasing and dissipative dynamics for one and two qubit cases. We also show that our proposed measure captures the back-flow of information from the environment to the system and compatible with well known distinguishability criteria of non-Markovianity.
Plasma density fluctuation measurements from coherent and incoherent microwave reflection
International Nuclear Information System (INIS)
Conway, G.D.; Schott, L.; Hirose, A.
1996-01-01
Using the spatial coherency present in a reflected microwave signal (Conway et al 1994 Rev. Sci. Instrum. 65 2920) it is possible to measure a coherent, Γ c , and an incoherent, Γ i , reflection coefficient (proportional to the radar cross section) from a turbulent plasma cutoff layer. Results acquired with a 17 GHz reflectometer from a STOR-M tokamak edge region (r/a ∼ 0.8) give significant Γ c and Γ i , which suggests two-dimensional structure in the reflection layer. Using a 'distorted-mirror' model for the plasma fluctuations, estimates of an effective radial width, σ, and poloidal correlation length, L p , can be derived from the reflection coefficients. STOR-M results typically give a σ of a few millimetres and an L p of a couple of centimetres. (author)
Color transparency in incoherent electroproduction of ρ mesons off nuclei
International Nuclear Information System (INIS)
Nemchik, J.; Kopeliovich, B. Z.; Potashnikova, I. K.
2013-01-01
Color transparency (CT) phenomena in elastic electroproduction of vector mesons off nuclei are usually infected by the onset of coherence length (CL) effects. However, at low energies corresponding to the CLAS experiment at Jefferson Lab (JLab), one can study practically the net CT effects, since CL is much shorter than the nuclear radius. We investigate various manifestations of CT effects using rigorous quantum mechanical approach based on the path integral technique. We include also the effects of ρ meson decay inside the nucleus leading to a rise of the nuclear suppression towards small values of Q 2 . Motivated by the last CLAS data we predict the A, Q 2 and l c dependence of nuclear transparency for ρ 0 mesons produced incoherently off nuclei. We also perform predictions for expected signal of CT corresponding to the planned JLab upgrade to 12 GeV electron beam.
Incoherent beam combining based on the momentum SPGD algorithm
Yang, Guoqing; Liu, Lisheng; Jiang, Zhenhua; Guo, Jin; Wang, Tingfeng
2018-05-01
Incoherent beam combining (ICBC) technology is one of the most promising ways to achieve high-energy, near-diffraction laser output. In this paper, the momentum method is proposed as a modification of the stochastic parallel gradient descent (SPGD) algorithm. The momentum method can improve the speed of convergence of the combining system efficiently. The analytical method is employed to interpret the principle of the momentum method. Furthermore, the proposed algorithm is testified through simulations as well as experiments. The results of the simulations and the experiments show that the proposed algorithm not only accelerates the speed of the iteration, but also keeps the stability of the combining process. Therefore the feasibility of the proposed algorithm in the beam combining system is testified.
Incoherent neutron scattering in acetanilide and three deuterated derivatives
Barthes, Mariette; Almairac, Robert; Sauvajol, Jean-Louis; Moret, Jacques; Currat, Roland; Dianoux, José
1991-03-01
Incoherent-neutron-scattering measurements of the vibrational density of states of acetanilide and three deuterated derivatives are presented. These data allow one to identify an intense maximum, assigned to the N-H out-of-plane bending mode. The data display the specific behavior of the methyl torsional modes: large isotopic shift and strong low-temperature intensity; confirm our previous inelastic-neutron-scattering studies, indicating no obvious anomalies in the range of frequency of the acoustic phonons. In addition, the data show the existence of thermally activated quasielastic scattering above 100 K, assigned to the random diffusive motion of the methyl protons. These results are discussed in the light of recent theoretical models proposed to explain the anomalous optical properties of this crystal.
Color transparency in incoherent electroproduction of {rho} mesons off nuclei
Energy Technology Data Exchange (ETDEWEB)
Nemchik, J. [Institute of Experimental Physics SAS, Watsonova 47, 04001 Kosice, Slovakia and Czech Technical University, FNSPE, Brehova 7, 11519 Praque (Czech Republic); Kopeliovich, B. Z.; Potashnikova, I. K. [Departamento de Fisica y Centro de Estudios Subatomicos, Universidad Tecnica Federico Santa Maria, Casilla 110-V, Valparaiso (Chile)
2013-04-15
Color transparency (CT) phenomena in elastic electroproduction of vector mesons off nuclei are usually infected by the onset of coherence length (CL) effects. However, at low energies corresponding to the CLAS experiment at Jefferson Lab (JLab), one can study practically the net CT effects, since CL is much shorter than the nuclear radius. We investigate various manifestations of CT effects using rigorous quantum mechanical approach based on the path integral technique. We include also the effects of {rho} meson decay inside the nucleus leading to a rise of the nuclear suppression towards small values of Q{sup 2}. Motivated by the last CLAS data we predict the A, Q{sup 2} and l{sub c} dependence of nuclear transparency for {rho}{sup 0} mesons produced incoherently off nuclei. We also perform predictions for expected signal of CT corresponding to the planned JLab upgrade to 12 GeV electron beam.
Fiedler, A.; Schewski, R.; Baldini, M.; Galazka, Z.; Wagner, G.; Albrecht, M.; Irmscher, K.
2017-10-01
We present a quantitative model that addresses the influence of incoherent twin boundaries on the electrical properties in β-Ga2O3. This model can explain the mobility collapse below a threshold electron concentration of 1 × 1018 cm-3 as well as partly the low doping efficiency in β-Ga2O3 layers grown homoepitaxially by metal-organic vapor phase epitaxy on (100) substrates of only slight off-orientation. A structural analysis by transmission electron microscopy (TEM) reveals a high density of twin lamellae in these layers. In contrast to the coherent twin boundaries parallel to the (100) plane, the lateral incoherent twin boundaries exhibit one dangling bond per unit cell that acts as an acceptor-like electron trap. Since the twin lamellae are thin, we consider the incoherent twin boundaries to be line defects with a density of 1011-1012 cm-2 as determined by TEM. We estimate the influence of the incoherent twin boundaries on the electrical transport properties by adapting Read's model of charged dislocations. Our calculations quantitatively confirm that the mobility reduction and collapse as well as partly the compensation are due to the presence of twin lamellae.
Energy Technology Data Exchange (ETDEWEB)
Larsson, Carl-Magnus; Hedberg, Bjoern; Wiebert, Anders [and others
2005-06-01
In this report the Swedish Radiation Protection Authority's (SSI) review of the Swedish Nuclear Fuel and Waste Management Company's (SKB) RDandD programme 2004 is presented. In the review SSI comments, among other things, SKB's plan of action and future direction of SKB's RDandD programme, need for different types of consultations, plans for demonstration of canister deposition and long term experiments, and strategies for dismantling of nuclear facilities.
Effects of different SSI parameters on the floor response spectra of a nuclear reactor building
International Nuclear Information System (INIS)
Kabir, A.F.; Bolourchi, S.; Maryak, M.E.
1991-01-01
The effects of several critical soil-structure interaction (SSI) parameters on the floor response spectra (FRS) of a typical nuclear reactor building have been examined. These parameters are computation of soil impedance functions using different approaches, scattering effects (reductions in ground motion due to embedment and rigidity of building foundation) and strain dependency of soil dynamic properties. This paper reports that the significant conclusions of the study, which are applicable to a deeply embedded very rigid nuclear reactor building, are as follows: FRS generated without considering scattering effects are highly conservative; differences between FRS, generated considering strain-dependency of soil dynamic properties, and those generated suing low-strain values, are not significant; and the lumped-parameter approach of SSI calculations, which only uses a single value of soil shear modulus in impedance calculations, may not be able to properly compute the soil impedances for a soil deposit with irregularly varying properties with depth
Single-shot self-interference incoherent digital holography using off-axis configuration.
Hong, Jisoo; Kim, Myung K
2013-12-01
We propose a single-shot incoherent holographic imaging technique that adopts self-interference incoherent digital holography (SIDH) with slight tilt of the plane mirror in the optical configuration. The limited temporal coherence length of the illumination leads the guide-star hologram of the proposed system to have a Gaussian envelope of elliptical ring shape. The observation shows that the reconstruction by cross correlation with the guide-star hologram achieves better quality than the usual propagation methods. Experimentally, we verify that the hologram and 3D reconstruction can be implemented incoherently with the proposed single-shot off-axis SIDH.
Seeded Supercontinuum Generation - Modulation Instability Gain, Coherent and Incoherent Rogue Waves
DEFF Research Database (Denmark)
Sørensen, Simon Toft; Larsen, Casper; Møller, Uffe Visbech
2012-01-01
Deterministic supercontinuum can be generated by seeding the modulation instability-induced pulse break-up. We investigate the influence of the modulation instability gain on seeding and demonstrate the generation of coherent and incoherent rogue waves....
Optical bistability via quantum interference from incoherent pumping and spontaneous emission
International Nuclear Information System (INIS)
Sahrai, M.; Asadpour, S.H.; Sadighi-Bonabi, R.
2011-01-01
We theoretically investigate the optical bistability (OB) in a V-type three-level atomic system confined in a unidirectional ring cavity via incoherent pumping field. It is shown that the threshold of optical bistability can be controlled by the rate of an incoherent pumping field and by interference mechanism arising from the spontaneous emission and incoherent pumping field. We demonstrate that the optical bistability converts to optical multi-stability (OM) by the quantum interference mechanism. - Highlights: → We modulate the optical bistability (OB) in a four-level N-type atomic system. → The threshold of optical bistability can be controlled by the quantum interferences. → OB converts to optical multi-stability (OM) by the quantum interferences. → We discuss the effect of an incoherent pumping field on reduction of OB threshold.
Sub-Angstrom microscopy through incoherent imaging and image reconstruction
International Nuclear Information System (INIS)
Pennycook, S.J.; Jesson, D.E.; Chisholm, M.F.; Ferridge, A.G.; Seddon, M.J.
1992-03-01
Z-contrast scanning transmission electron microscopy (STEM) with a high-angle annular detector breaks the coherence of the imaging process, and provides an incoherent image of a crystal projection. Even in the presence of strong dynamical diffraction, the image can be accurately described as a convolution between an object function, sharply peaked at the projected atomic sites, and the probe intensity profile. Such an image can be inverted intuitively without the need for model structures, and therefore provides the important capability to reveal unanticipated interfacial arrangements. It represents a direct image of the crystal projection, revealing the location of the atomic columns and their relative high-angle scattering power. Since no phase is associated with a peak in the object function or the contrast transfer function, extension to higher resolution is also straightforward. Image restoration techniques such as maximum entropy, in conjunction with the 1.3 Angstrom probe anticipated for a 300 kV STEM, appear to provide a simple and robust route to the achievement of sub-Angstrom resolution electron microscopy
An incoherent feedforward loop facilitates adaptive tuning of gene expression.
Hong, Jungeui; Brandt, Nathan; Abdul-Rahman, Farah; Yang, Ally; Hughes, Tim; Gresham, David
2018-04-05
We studied adaptive evolution of gene expression using long-term experimental evolution of Saccharomyces cerevisiae in ammonium-limited chemostats. We found repeated selection for non-synonymous variation in the DNA binding domain of the transcriptional activator, GAT1, which functions with the repressor, DAL80 in an incoherent type-1 feedforward loop (I1-FFL) to control expression of the high affinity ammonium transporter gene, MEP2. Missense mutations in the DNA binding domain of GAT1 reduce its binding to the GATAA consensus sequence. However, we show experimentally, and using mathematical modeling, that decreases in GAT1 binding result in increased expression of MEP2 as a consequence of properties of I1-FFLs. Our results show that I1-FFLs, one of the most commonly occurring network motifs in transcriptional networks, can facilitate adaptive tuning of gene expression through modulation of transcription factor binding affinities. Our findings highlight the importance of gene regulatory architectures in the evolution of gene expression. © 2018, Hong et al.
Interference in the resonance fluorescence of two incoherently coupled transitions
International Nuclear Information System (INIS)
Kiffner, Martin; Evers, Joerg; Keitel, Christoph H.
2006-01-01
The fluorescence light emitted by a four-level system in J=1/2 to J=1/2 configuration driven by a monochromatic laser field and in an external magnetic field is studied. We show that the spectrum of resonance fluorescence emitted on the π transitions shows a signature of spontaneously generated interference effects. The degree of interference in the fluorescence spectrum can be controlled by means of the external magnetic field, provided that the Lande g factors of the excited and the ground state doublet are different. For a suitably chosen magnetic field strength, the relative weight of the Rayleigh line can be completely suppressed, even for low intensities of the coherent driving field. The incoherent fluorescence spectrum emitted on the π transitions exhibits a very narrow peak whose width and weight depend on the magnetic field strength. We demonstrate that the spectrum of resonance fluorescence emitted on the σ transitions shows an indirect signature of interference. A measurement of the relative peak heights in the spectrum from the σ transitions allows us to determine the branching ratio of the spontaneous decay of each excited state into the σ channel
Higher derivative corrections to incoherent metallic transport in holography
Energy Technology Data Exchange (ETDEWEB)
Baggioli, Matteo [Institut de Física d’Altes Energies (IFAE), Universitat Autónoma de Barcelona,The Barcelona Institute of Science and Technology,Campus UAB, 08193 Bellaterra (Barcelona) (Spain); Crete Center for Theoretical Physics and I.P.P., Department of Physics, University of Crete,71003 Heraklion (Greece); Goutéraux, Blaise [Nordita, KTH Royal Institute of Technology and Stockholm University,Roslagstullsbacken 23, SE-106 91 Stockholm (Sweden); Stanford Institute for Theoretical Physics, Department of Physics, Stanford University,Varian Laboratory of Physics, 382 Via Pueblo Mall, Stanford, CA 94305-4060 (United States); APC, Université Paris 7, CNRS/IN2P3, CEA/IRFU, Obs. de Paris,Sorbonne Paris Cité (UMR du CNRS 7164),Bâtiment Condorcet, 10, rue Alice Domon et Léonie Duquet, F-75205, Paris Cedex 13 (France); Kiritsis, Elias [APC, Université Paris 7, CNRS/IN2P3, CEA/IRFU, Obs. de Paris,Sorbonne Paris Cité (UMR du CNRS 7164),Bâtiment Condorcet, 10, rue Alice Domon et Léonie Duquet, F-75205, Paris Cedex 13 (France); Crete Center for Theoretical Physics and I.P.P., Department of Physics, University of Crete,71003 Heraklion (Greece); Crete Center for Quantum Complexity and Nanotechnology, University of Crete,71003 Heraklion (Greece); Li, Wei-Jia [Institute of Theoretical Physics, School of Physics and Optoelectronic Technology,Dalian University of Technology, 214 School of Physics,2 Linggong road, Ganjingzi District, Dalian 116024, Liaoning Province (China); Crete Center for Theoretical Physics and I.P.P., Department of Physics, University of Crete,71003 Heraklion (Greece)
2017-03-31
Transport in strongly-disordered, metallic systems is governed by diffusive processes. Based on quantum mechanics, it has been conjectured that these diffusivities obey a lower bound D/v{sup 2}≳ℏ/k{sub B}T, the saturation of which provides a mechanism for the T-linear resistivity of bad metals. This bound features a characteristic velocity v, which was later argued to be the butterfly velocity v{sub B}, based on holographic models of transport. This establishes a link between incoherent metallic transport, quantum chaos and Planckian timescales. Here we study higher derivative corrections to an effective holographic action of homogeneous disorder. The higher derivative terms involve only the charge and translation symmetry breaking sector. We show that they have a strong impact on the bound on charge diffusion D{sub c}/v{sub B}{sup 2}≳ℏ/k{sub B}T, by potentially making the coefficient of its right-hand side arbitrarily small. On the other hand, the bound on energy diffusion is not affected.
Eikonal theory of the transition to phase incoherence
International Nuclear Information System (INIS)
Kaufman, A.N.; Rosengaus, E.
1983-02-01
When a monochromatic electromagnetic wave propagates through a nonuniform plasma (of n dimensions), its refraction may be studied in terms of its family of rays in 2n-dimensional phase space (k,x). These rays generate and n-dimensional surface. Imbedded in the phase space. The wave amplitude and phase are defined on this surface. As the rays twist and separate (from the dynamics of the ray Hamiltonian), the surface develops pleats and becomes convoluted. Projection of the surface onto x-space then yields a multivalued k(x). The local spectral density, as a function of k for given x, exhibits sharp spikes at these k(x), in the ray-optics limit. The next correction yields a finite width to these spikes. As the surface becomes more and more pppleated, these spectral peaks overlap; the spectrum changes qualitatively from a line spectrum to a continuous spectrum. Correspondingly, the two-point spatial correlation function loses its long-range order, as the correlation volume contracts. This phenomenon is what we call the transition to incoherence
International Nuclear Information System (INIS)
Samuelsson, P.
2007-01-01
We present a theory for the full distribution of current fluctuations in incoherent diffusive superconducting junctions, subjected to a voltage bias. This theory of full counting statistics of incoherent multiple Andreev reflections is valid for an arbitrary applied voltage. We present a detailed discussion of the properties of the first four cumulants as well as the low and high voltage regimes of the full counting statistics. (orig.)
Coherent vs Incoherent Emission from Semiconductor Structures after Resonant Femtosecond Excitation
Gurioli, Massimo; Bogani, Franco; Ceccherini, Simone; Colocci, Marcello
1997-04-01
We show that an interferometric correlation measurement with fs time resolution provides an unambiguous discrimination between coherent and incoherent emission after resonant femtosecond excitation. The experiment directly probes the most important difference between the two emissions, that is, the phase correlation with the excitation pulse. The comparison with cw frequency resolved measurements demonstrates that the relationship between coherent and incoherent emission is similar under femtosecond and steady-state excitation.
Bolea, Mario; Mora, José; Ortega, Beatriz; Capmany, José
2012-03-12
A novel all-optical technique based on the incoherent processing of optical signals using high-order dispersive elements is analyzed for microwave arbitrary pulse generation. We show an approach which allows a full reconfigurability of a pulse in terms of chirp, envelope and central frequency by the proper control of the second-order dispersion and the incoherent optical source power distribution, achieving large values of time-bandwidth product.
Rius, Manuel; Bolea, Mario; Mora, José; Ortega, Beatriz; Capmany, José
2015-05-18
We experimentally demonstrate, for the first time, a chirped microwave pulses generator based on the processing of an incoherent optical signal by means of a nonlinear dispersive element. Different capabilities have been demonstrated such as the control of the time-bandwidth product and the frequency tuning increasing the flexibility of the generated waveform compared to coherent techniques. Moreover, the use of differential detection improves considerably the limitation over the signal-to-noise ratio related to incoherent processing.
Optical image encryption method based on incoherent imaging and polarized light encoding
Wang, Q.; Xiong, D.; Alfalou, A.; Brosseau, C.
2018-05-01
We propose an incoherent encoding system for image encryption based on a polarized encoding method combined with an incoherent imaging. Incoherent imaging is the core component of this proposal, in which the incoherent point-spread function (PSF) of the imaging system serves as the main key to encode the input intensity distribution thanks to a convolution operation. An array of retarders and polarizers is placed on the input plane of the imaging structure to encrypt the polarized state of light based on Mueller polarization calculus. The proposal makes full use of randomness of polarization parameters and incoherent PSF so that a multidimensional key space is generated to deal with illegal attacks. Mueller polarization calculus and incoherent illumination of imaging structure ensure that only intensity information is manipulated. Another key advantage is that complicated processing and recording related to a complex-valued signal are avoided. The encoded information is just an intensity distribution, which is advantageous for data storage and transition because information expansion accompanying conventional encryption methods is also avoided. The decryption procedure can be performed digitally or using optoelectronic devices. Numerical simulation tests demonstrate the validity of the proposed scheme.
Chilukoti, N.; Xue, Y.
2016-12-01
The land surface play a vital role in determining the surface energy budget, accurate representation of land use and land cover (LULC) is necessary to improve forecast. In this study, we have investigated the influence of surface vegetation maps with different LULC on simulating the boreal summer monsoon rainfall. Using a National Centres for Environmental Prediction (NCEP) Coupled Forecast System version 2(CFSv2) model coupled with Simplified Simple Biosphere (SSiB) model, two experiments were conducted: one with old vegetation map and one with new vegetation map. The significant differences between new and old vegetation map were in semi-arid and arid areas. For example, in old map Tibetan plateau classified as desert, which is not appropriate, while in new map it was classified as grasslands or shrubs with bare soil. Old map classified the Sahara desert as a bare soil and shrubs with bare soil, whereas in new map it was classified as bare ground. In addition to central Asia and the Sahara desert, in new vegetation map, Europe had more cropped area and India's vegetation cover was changed from crops and forests to wooded grassland and small areas of grassland and shrubs. The simulated surface air temperature with new map shows a significant improvement over Asia, South Africa, and northern America by some 1 to 2ºC and 2 to 3ºC over north east China and these are consistent with the reduced rainfall biases over Africa, near Somali coast, north east India, Bangladesh, east China sea, eastern Pacific and northern USA. Over Indian continent and bay of Bengal dry rainfall anomalies that is the only area showing large dry rainfall bias, however, they were unchanged with new map simulation. Overall the CFSv2(coupled with SSiB) model with new vegetation map show a promising result in improving the monsoon forecast by improving the Land -Atmosphere interactions. To compare with the LULC forcing, experiment was conducted using the Global Forecast System (GFS) simulations
SKI's and SSI's review of SKB's safety report SR-Can
Energy Technology Data Exchange (ETDEWEB)
Dverstorp, Bjoern; Stroemberg, Bo (and others)
2008-03-15
This report summarises SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned licence application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: -SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be
Mao, Wei; Zhou, Jianjun; Zeng, Mengsu; Ding, Yuqin; Qu, Lijie; Chen, Caizhong; Ding, Xiaoqiang; Wang, Yaqiong; Fu, Caixia
2018-05-01
Because chronic kidney disease (CKD) is a worldwide problem, accurate pathological and functional evaluation is required for planning treatment and follow-up. Intravoxel incoherent motion diffusion-weighted imaging (IVIM-DWI) can assess both capillary perfusion and tissue diffusion and may be helpful in evaluating renal function and pathology. To evaluate functional and pathological alterations in CKD by applying IVIM-DWI. Prospective study. In all, 72 CKD patients who required renal biopsy and 20 healthy volunteers. 1.5T. All subjects underwent IVIM-DWI of the kidneys, and image analysis was performed by two radiologists. The mean values of true diffusion coefficient (D), pseudo diffusion coefficient (D*), and perfusion fraction (f) were acquired from renal parenchyma. Correlation between IVIM-DWI parameters and estimated glomerular filtration rate (eGFR), as well as pathological damage, were assessed. One-way analysis of variance (ANOVA), paired sample t-test and Spearman correlation analysis. The paired sample t-test revealed that IVIM-DWI parameters were significantly lower in medulla than cortex for both patients and controls (P Imaging 2018;47:1251-1259. © 2017 International Society for Magnetic Resonance in Medicine.
SSI`s International Development Co-operation (SIUS). Annual report 1998
Energy Technology Data Exchange (ETDEWEB)
Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar
1999-04-01
SSI`s International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998
Directory of Open Access Journals (Sweden)
Patricia Maria Sens
2011-10-01
Full Text Available The Synthetic Sentence Identification (SSI test assesses central auditory pathways by measuring auditory and visual sensitivity and testing selective attention. Cerebellum activation in auditory attention and sensorial activity modulation have already been described. Assessing patients with cerebellar lesions alone using the SSI test can confirm the role of the cerebellum in auditory processing. AIM: To evaluate the role of the cerebellum in auditory processing in individuals with normal hearing and in those with chronic cerebellum lesions, using the SSI test. MATERIALS AND METHODS: Cross-sectional cohort study. A study group comprising 18 patients with chronic cerebellar lesion and a control group of 20 healthy individuals were assessed. The SSI test was applied in an Ipsilateral Competitive Message (ICM and Contralateral Competitive Message (CCM modes. To compare the results between groups, we used the chi-square test for qualitative variables. RESULTS: A statistically significant difference was found between the study and control groups using the ICM mode of the SSI test (p=0.035, but not in the CCM mode (p=0.083. CONCLUSION: The results on the SSI confirmed cerebellar participation in auditory processing in individuals with chronic cerebellar lesions and in those with normal hearing assessed in this study.O teste de Identificação de Sentenças Sintéticas (SSI avalia as vias centrais da audição utilizando a sensibilidade auditiva e visual e testando a atenção seletiva. A ativação do cerebelo na atenção auditiva, assim como na modulação da atividade sensorial, já é descrita. Avaliar pacientes com lesão exclusiva do cerebelo por meio do teste SSI pode confirmar ou refutar a hipótese da participação do cerebelo no processamento auditivo. OBJETIVO: Avaliar pelo teste SSI a participação do cerebelo no processamento auditivo, em indivíduos com lesão crônica do cerebelo e audição normal. MATERIAL E MÉTODOS: Estudo coorte
Directory of Open Access Journals (Sweden)
Satoshi Nagano
2014-01-01
Full Text Available Surgical site infection (SSI has not been extensively studied in musculoskeletal tumors (MST owing to the rarity of the disease. We analyzed incidence and risk factors of SSI in MST. SSI incidence was evaluated in consecutive 457 MST cases (benign, 310 cases and malignant, 147 cases treated at our institution. A detailed analysis of the clinical background of the patients, pre- and postoperative hematological data, and other factors that might be associated with SSI incidence was performed for malignant MST cases. SSI occurred in 0.32% and 12.2% of benign and malignant MST cases, respectively. The duration of the surgery (P=0.0002 and intraoperative blood loss (P=0.0005 was significantly more in the SSI group than in the non-SSI group. We established the musculoskeletal oncological surgery invasiveness (MOSI index by combining 4 risk factors (blood loss, operation duration, preoperative chemotherapy, and the use of artificial materials. The MOSI index (0–4 points score significantly correlated with the risk of SSI, as demonstrated by an SSI incidence of 38.5% in the group with a high score (3-4 points. The MOSI index score and laboratory data at 1 week after surgery could facilitate risk evaluation and prompt diagnosis of SSI.
Intravoxel incoherent motion perfusion imaging in acute stroke: initial clinical experience
International Nuclear Information System (INIS)
Federau, C.; Becce, F.; Maeder, P.; Meuli, R.; Sumer, S.; Wintermark, M.; O'Brien, K.
2014-01-01
Intravoxel incoherent motion (IVIM) imaging is an MRI perfusion technique that uses a diffusion-weighted sequence with multiple b values and a bi-compartmental signal model to measure the so-called pseudo-diffusion of blood caused by its passage through the microvascular network. The goal of the current study was to assess the feasibility of IVIM perfusion fraction imaging in patients with acute stroke. Images were collected in 17 patients with acute stroke. Exclusion criteria were onset of symptoms to imaging >5 days, hemorrhagic transformation, infratentorial lesions, small lesions 2 . Image quality was assessed by two radiologists, and quantitative analysis was performed in regions of interest placed in the stroke area, defined by thresholding the apparent diffusion coefficient maps, as well as in the contralateral region. IVIM perfusion fraction maps showed an area of decreased perfusion fraction f in the region of decreased apparent diffusion coefficient. Quantitative analysis showed a statistically significant decrease in both IVIM perfusion fraction f (0.026 ± 0.019 vs. 0.056 ± 0.025, p = 2.2 . 10 -6 ) and diffusion coefficient D compared with the contralateral side (3.9 ± 0.79 . 10 -4 vs. 7.5 ± 0.86 . 10 -4 mm 2 /s, p = 1.3 . 10 -20 ). IVIM perfusion fraction imaging is feasible in acute stroke. IVIM perfusion fraction is significantly reduced in the visible infarct. Further studies should evaluate the potential for IVIM to predict clinical outcome and treatment response. (orig.)
Development of generic soil profiles and soil data development for SSI analyses
Energy Technology Data Exchange (ETDEWEB)
Parker, Josh, E-mail: jparker@nuscalepower.com [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States); Khan, Mohsin; Rajagopal, Raj [ARES Corporation, 1990N California Boulevard, Suite 500, Walnut Creek, CA 94596 (United States); Groome, John [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States)
2014-04-01
This paper presents the approach to developing generic soil profiles for the design of reactor building for small modular reactor (SMR) nuclear power plant developed by NuScale Power. The reactor building is a deeply embedded structure. In order to perform soil structure interaction (SSI) analyses, generic soil profiles are required to be defined for the standardized Nuclear Power Plant (NPP) designs for the United States Nuclear Regulatory Commission (NRC) in a design control document (DCD). The development of generic soil profiles is based on utilization of information on generic soil profiles from the new standardized nuclear power plant designs already submitted to the NRC for license certification. Eleven generic soil profiles have been recommended, and those profiles cover a wide range of parameters such as soil depth, shear wave velocity, unit weight, Poisson's ratio, water table, and depth to rock strata. The soil profiles are developed for a range of shear wave velocities between bounds of 1000 fps and 8000 fps as inferred from NRC Standard Review Plan (NUREG 0800) Sections 3.7.1 and 3.7.2. To account for the soil degradation due to seismic events, the strain compatible soil properties are based on the EPRI generic soil degradation curves. In addition, one dimensional soil dynamic response analyses were performed to study the soil layer input motions for performing the SSI analyses.
Dingreville, Rémi; Hallil, Abdelmalek; Berbenni, Stéphane
2014-12-01
The equilibrium of coherent and incoherent mismatched interfaces is reformulated in the context of continuum mechanics based on the Gibbs dividing surface concept. Two surface stresses are introduced: a coherent surface stress and an incoherent surface stress, as well as a transverse excess strain. The coherent surface stress and the transverse excess strain represent the thermodynamic driving forces of stretching the interface while the incoherent surface stress represents the driving force of stretching one crystal while holding the other fixed and thereby altering the structure of the interface. These three quantities fully characterize the elastic behavior of coherent and incoherent interfaces as a function of the in-plane strain, the transverse stress and the mismatch strain. The isotropic case is developed in detail and particular attention is paid to the case of interfacial thermo-elasticity. This exercise provides an insight on the physical significance of the interfacial elastic constants introduced in the formulation and illustrates the obvious coupling between the interface structure and its associated thermodynamics quantities. Finally, an example based on atomistic simulations of Cu/Cu2O interfaces is given to demonstrate the relevance of the generalized interfacial formulation and to emphasize the dependence of the interfacial thermodynamic quantities on the incoherency strain with an actual material system.
International Nuclear Information System (INIS)
Kofman, W.; Lejeune, G.; Hagfors, T.; Bauer, P.
1981-01-01
The results of experiments aimed at the determination of the electron temperature by a plasma line technique are presented. Using the multistatic capabilities of the French incoherent scatter radar, the plasma line frequencies were simultaneously measured at two receiving stations (Mende and Nancay) at the altitude corresponding to the maximum of the F layer. Different plasma line frequencies are measued because of different effective k vectors that appear in the thermal term of the plasma dispersion relation. We derive and apply two data analysis procedures that enable us to determine this frequency difference. Comparison of this measured frequency difference to that calculated using the ion component electron temperature demonstrates that the plasma lines could indeed be used to determine the electron temperature. A strong dependence of the power in the plasma line as a function of the angle between k vector and magnetic field is observed in agreement with the theory. The future developments of this technique with the EISCAT radar facilities are discussed
Directory of Open Access Journals (Sweden)
Ma Luo
2017-10-01
Full Text Available PURPOSE: To evaluate whether intravoxel incoherent motion (IVIM–related parameters could be used to differentiate malignant from benign focal liver lesions (FLLs and to improve diagnostic efficiency. METHODS: Seventy-four patients with 75 lesions, including 51 malignant FLLs and 24 benign FLLs, underwent liver 3.0-T magnetic resonance imaging for routine examination sequences. IVIM diffusion-weighted imaging (DWI with 11 b values (0-800 s/mm2 was also acquired concurrently. Apparent diffusion coefficient (ADCtotal and IVIM-derived parameters, such as the pure diffusion coefficient (D, the pseudodiffusion coefficient (D⁎, and the perfusion fraction (f, were calculated and compared between the two groups. A receiver operating characteristic curve analysis was performed to assess their diagnostic value. RESULTS: ADCtotal, D, and f were significantly lower in the malignant group than in the benign group, whereas D⁎ did not show a statistical difference. D had a larger area under the curve value (0.968 and higher sensitivity (92.30% for differentiation. CONCLUSION: IVIM is a useful method to differentiate malignant and benign FLLs. The D value showed higher efficacy to detect hepatic solid lesions.
International Nuclear Information System (INIS)
Richmond, A.D.; Kamide, Y.; Akasofu, S.I.; Alcayde, D.; Blanc, M.; De LaBeaujardiere, O.; Evans, D.S.; Foster, J.C.; Holt, J.M.; Friis-Christensen, E.; Pellinen, R.J.; Senior, C.; Zaitzev, A.N.
1990-01-01
An analysis of several global measures of high-latitude ionospheric electrodynamic activity is undertakn on the basis of results obtained from the Assimilative Mapping of Ionospheric Electrodynamics (AMIE) procedure applied to incoherent scatter radar and ground magnetometer observatons for January 18-19, 1984. Different global measures of electric potentials, currents, resistances, and energy transfer from the magnetosphere show temporal variations that are generally well correlated. The authors present parameterizations of thees quantities in terms of the AE index and the hemispheric power index of precipitating auroral particles. It is shown how error estimates of the mapped electric fields can be used to correct the estimation of Joule heating. Global measures of potential drop, field-aligned current, and Joule heating as obtained by the AMIE procedure are compared with similar measures presented in previous studies. Agreement is found to within the uncertainties inherent in each study. The mean potential drop through which field-aligned currents flow in closing through the ionosphere is approximately 28% of the total polar cap potential drop under all conditions during these 2 days. They note that order-of-magnitude differences can appear when comparing different global measures of total electric current flow and of effective resistances of the global circuit, so that care must be exercised in choosing characteristic values of these parameters for circuit-analogy studies of ionosphere-magnetosphere electrodynamic coupling
Kilinc, Ahmet; Demiral, Umit; Kartal, Tezcan
2017-01-01
Teaching socioscientific issues (SSI) necessitates dialogic discourse activities. However, a majority of science teachers prefer monologic discourse in SSI contexts. In addition, some of these teachers are resistant to change (from monologic to dialogic discourse) despite certain professional development attempts. The purpose of the present…
Incoherent and coherent backscattering of light by a layer of densely packed random medium
Energy Technology Data Exchange (ETDEWEB)
Tishkovets, Victor P. [Institute of Radio Astronomy of NASU, 4 Chervonopraporna Street, Kharkiv 61002 (Ukraine)], E-mail: tishkovets@ira.kharkov.ua
2007-12-15
The problem of light scattering by a layer of densely packed discrete random medium is considered. The theory of light scattering by systems of nonspherical particles is applied to derive equations corresponding to incoherent (diffuse) and interference parts of radiation reflected from the medium. A solution of the system of linear equations describing light scattering by a system of particles is represented by iteration. It is shown that the symmetry properties of the T-matrices and of the translation coefficients for the vector Helmholtz harmonics lead to the reciprocity relation for an arbitrary iteration. This relation is applied to consider the backscattering enhancement phenomenon. Equations expressing the incoherent and interference parts of reflected light from statistically homogeneous and isotropic plane-parallel layer of medium are given. In the exact backscattering direction the relation between incoherent and interference parts is identical to that of sparse media.
Hiesinger, H.; Jaumann, R.; Neukum, G.
1993-01-01
Both the Apollo 17 and the Mare Serenitatis region were observed by Galileo during its fly-by in December 1992. We used earth-based multispectral data to define mare units which then can be compared with the results of the Galileo SSI data evaluation.
Sintered silicon carbides for sliding applications in pumps; Pumpenbauteile aus SSiC
Energy Technology Data Exchange (ETDEWEB)
Fundus, M. [Wacker Engineer Ceramics, Inc., Adrian, MI (United States)
2000-07-01
The focus of the paper is on enhancement and optimization of the tribological properties of SSiC materials based on field experience obtained with the materials EKasic {sup trademark} D, TRIBO 2000, and TRIBO 2000-1. Current product development activities discussed in this paper concentrate on slide bearings and seal rings. (orig./cB) [German] Mit EKasic {sup trademark} D, TRIBO 2000 und TRIBO 2000-1 stehen drei SiC-Werkstoffe zur Verfuegung, die in der Lage sind die ganze Bandbreite der Anwendungen abzudecken. Durch eine konsequente Fortsetzung der tribologischen Optimierung der SiC-Werkstoffe koennen auch die in den naechsten Jahren weiter steigenden Anforderungen im Lager- und Dichtungsbereich erfuellt werden (Gleitringdichtungen, Gleitlager). (orig./MM)
Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97
Energy Technology Data Exchange (ETDEWEB)
Hora, Stephen
2002-09-01
The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches.
Expert Opinion in SR 97 and the SKI/SSI Joint Review of SR 97
International Nuclear Information System (INIS)
Hora, Stephen
2002-09-01
The role of sensitivity and uncertainty analyses for radioactive waste disposal assessments is reviewed. The report covers a description of the these concepts were applied in the authorities' review of the safety report SR 97. With regard to the use of expert knowledge, the most significant weakness of SR 97 is absence of any standards, procedures, and even definitions for expert judgment. This situation needs to be dealt with by SKB in the near future as it denigrates the portions of the study that are well done. In developing expert judgment processes, SSI should ensure that SKB creates procedures that guarantee traceability and transparency. This will become very important as the repository system matures and receives greater public scrutiny. Both in the area of scenario creation and expert judgement, there are processes that have gained international acceptance. It would be in the best interest of SKB, and the public, to adhere these accepted approaches
Todd Berliner. Hollywood Incoherent. Narration in Seventies Cinema.
Directory of Open Access Journals (Sweden)
Pascal Lefèvre
2010-12-01
Full Text Available Todd Berliner. Hollywood Incoherent. Narration in Seventies Cinema. Austin: University of Texas Press, 2010. ISBN-10: 0292722796 ISBN-13: 978-0292722798
Abbasabadi, Majid; Sahrai, Mostafa
2018-01-01
We investigated the propagation of an electromagnetic pulse through a one-dimensional photonic crystal doped with quantum-dot (QD) molecules in a defect layer. The QD molecules behave as a three-level quantum system and are driven by a coherent probe laser field and an incoherent pump field. No coherent coupling laser fields were introduced, and the coherence was created by the interdot tunnel effect. Further studied was the effect of tunneling and incoherent pumping on the group velocity of the transmitted and reflected probe pulse.
Ultrafast Dephasing and Incoherent Light Photon Echoes in Organic Amorphous Systems
Yano, Ryuzi; Matsumoto, Yoshinori; Tani, Toshiro; Nakatsuka, Hiroki
1989-10-01
Incoherent light photon echoes were observed in organic amorphous systems (cresyl violet in polyvinyl alcohol and 1,4-dihydroxyanthraquinone in polymethacrylic acid) by using temporally-incoherent nanosecond laser pulses. It was found that an echo decay curve of an organic amorphous system is composed of a sharp peak which decays very rapidly and a slowly decaying wing at the tail. We show that the persistent hole burning (PHB) spectra were reproduced by the Fourier-cosine transforms of the echo decay curves. We claim that in general, we must take into account the multi-level feature of the system in order to explain ultrafast dephasing at very low temperatures.
International Nuclear Information System (INIS)
Su Yanli; Jiang Qichang; Ji Xuanmang
2010-01-01
The incoherently coupled grey-grey screening-photovoltaic spatial soliton pairs are predicted in biased two-photon photovoltaic photorefractive crystals under steady-state conditions. These grey-grey screening-photovoltaic soliton pairs can be established provided that the incident beams have the same polarization, wavelength, and are mutually incoherent. The grey-grey screening-photovoltaic soliton pairs can be considered as the united form of grey-grey screening soliton pairs and open or closed-circuit grey-grey photovoltaic soliton pairs. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
The final Galileo SSI observations of Io: Orbits G28-I33
Turtle, E.P.; Keszthelyi, L.P.; McEwen, A.S.; Radebaugh, J.; Milazzo, M.; Simonelli, D.P.; Geissler, P.; Williams, D.A.; Perry, J.; Jaeger, W.L.; Klaasen, K.P.; Breneman, H.H.; Denk, T.; Phillips, C.B.
2004-01-01
We present the observations of Io acquired by the Solid State Imaging (SSI) experiment during the Galileo Millennium Mission (GMM) and the strategy we used to plan the exploration of Io. Despite Galileo's tight restrictions on data volume and downlink capability and several spacecraft and camera anomalies due to the intense radiation close to Jupiter, there were many successful SSI observations during GMM. Four giant, high-latitude plumes, including the largest plume ever observed on Io, were documented over a period of eight months; only faint evidence of such plumes had been seen since the Voyager 2 encounter, despite monitoring by Galileo during the previous five years. Moreover, the source of one of the plumes was Tvashtar Catena, demonstrating that a single site can exhibit remarkably diverse eruption styles - from a curtain of lava fountains, to extensive surface flows, and finally a ??? 400 km high plume - over a relatively short period of time (??? 13 months between orbits 125 and G29). Despite this substantial activity, no evidence of any truly new volcanic center was seen during the six years of Galileo observations. The recent observations also revealed details of mass wasting processes acting on Io. Slumping and landsliding dominate and occur in close proximity to each other, demonstrating spatial variation in material properties over distances of several kilometers. However, despite the ubiquitous evidence for mass wasting, the rate of volcanic resurfacing seems to dominate; the floors of paterae in proximity to mountains are generally free of debris. Finally, the highest resolution observations obtained during Galileo's final encounters with Io provided further evidence for a wide diversity of surface processes at work on Io. ?? 2003 Elsevier Inc. All rights reserved.
Yuasa, T.; Akiba, M.; Takeda, T.; Kazama, M.; Hoshino, A.; Watanabe, Y.; Hyodo, K.; Dilmanian, F. A.; Akatsuka, T.; Itai, Y.
1997-10-01
We describe a new system of incoherent scatter computed tomography (ISCT) using monochromatic synchrotron X rays, and we discuss its potential to be used in in vivo imaging for medical use. The system operates on the basis of computed tomography (CT) of the first generation. The reconstruction method for ISCT uses the least squares method with singular value decomposition. The research was carried out at the BLNE-5A bending magnet beam line of the Tristan Accumulation Ring in KEK, Japan. An acrylic cylindrical phantom of 20-mm diameter containing a cross-shaped channel was imaged. The channel was filled with a diluted iodine solution with a concentration of 200 /spl mu/gI/ml. Spectra obtained with the system's high purity germanium (HPGe) detector separated the incoherent X-ray line from the other notable peaks, i.e., the iK/sub /spl alpha// and K/sub /spl beta/1/ X-ray fluorescent lines and the coherent scattering peak. CT images were reconstructed from projections generated by integrating the counts In the energy window centering around the incoherent scattering peak and whose width was approximately 2 keV. The reconstruction routine employed an X-ray attenuation correction algorithm. The resulting image showed more homogeneity than one without the attenuation correction.
Directory of Open Access Journals (Sweden)
B. Damtie
2009-02-01
Full Text Available Improving an estimate of an incoherent scatter radar signal is vital to provide reliable and unbiased information about the Earth's ionosphere. Thus optimizing the measurement spatial and temporal resolutions has attracted considerable attention. The optimization usually relies on employing different kinds of pulse compression filters in the analysis and a matched filter is perhaps the most widely used one. A mismatched filter has also been used in order to suppress the undesirable sidelobes that appear in the case of matched filtering. Moreover, recently an adaptive pulse compression method, which can be derived based on the minimum mean-square error estimate, has been proposed. In this paper we have investigated the performance of matched, mismatched and adaptive pulse compression methods in terms of the output signal-to-noise ratio (SNR and the variance and bias of the estimator. This is done by using different types of optimal radar waveforms. It is shown that for the case of low SNR the signal degradation associated to an adaptive filtering is less than that of the mismatched filtering. The SNR loss of both matched and adaptive pulse compression techniques was found to be nearly the same for most of the investigated codes for the case of high SNR. We have shown that the adaptive filtering technique is a compromise between matched and mismatched filtering method when one evaluates its performance in terms of the variance and the bias of the estimator. All the three analysis methods were found to have the same performance when a sidelobe-free matched filter code is employed.
Directory of Open Access Journals (Sweden)
B. Damtie
2009-02-01
Full Text Available Improving an estimate of an incoherent scatter radar signal is vital to provide reliable and unbiased information about the Earth's ionosphere. Thus optimizing the measurement spatial and temporal resolutions has attracted considerable attention. The optimization usually relies on employing different kinds of pulse compression filters in the analysis and a matched filter is perhaps the most widely used one. A mismatched filter has also been used in order to suppress the undesirable sidelobes that appear in the case of matched filtering. Moreover, recently an adaptive pulse compression method, which can be derived based on the minimum mean-square error estimate, has been proposed. In this paper we have investigated the performance of matched, mismatched and adaptive pulse compression methods in terms of the output signal-to-noise ratio (SNR and the variance and bias of the estimator. This is done by using different types of optimal radar waveforms. It is shown that for the case of low SNR the signal degradation associated to an adaptive filtering is less than that of the mismatched filtering. The SNR loss of both matched and adaptive pulse compression techniques was found to be nearly the same for most of the investigated codes for the case of high SNR. We have shown that the adaptive filtering technique is a compromise between matched and mismatched filtering method when one evaluates its performance in terms of the variance and the bias of the estimator. All the three analysis methods were found to have the same performance when a sidelobe-free matched filter code is employed.
Energy Technology Data Exchange (ETDEWEB)
2008-03-15
The Swedish Nuclear Fuel and Waste Management Co (SKB) plans to submit a license application for the construction of a repository for spent nuclear fuel in Sweden 2010. In support of this application SKB will present a safety report, SR-Site, on the repository's long-term safety and radiological consequences. As a preparation for SR-Site, SKB published the preliminary safety assessment SR-Can in November 2006. The purposes were to document a first evaluation of long-term safety for the two candidate sites at Forsmark and Laxemar and to provide feedback to SKB's future programme of work. An important objective of the authorities' review of SR-Can is to provide guidance to SKB on the complete safety reporting for the license application. The authorities have engaged external experts for independent modelling, analysis and review, with the aim to provide a range of expert opinions related to the sufficiency and appropriateness of various aspects of SR-Can. The conclusions and judgments in this report are those of the authors and may not necessarily coincide with those of SKI and SSI. The authorities own review will be published separately (SKI Report 2008:23, SSI Report 2008:04 E). This report compiles contributions from several specific research projects. The separate reviews cover topics regarding the engineered barrier system, the quality assurance, the climate evolution and its effects, and the ecosystems and environmental impacts. All contributions are in English apart from the review concerning ecosystems and environmental impacts, which is presented in Swedish
International Nuclear Information System (INIS)
Zhang, Chi; Xu, Yiqing; Wei, Xiaoming; Tsia, Kevin K.; Wong, Kenneth K. Y.
2014-01-01
Time-stretch microscopy has emerged as an ultrafast optical imaging concept offering the unprecedented combination of the imaging speed and sensitivity. However, dedicated wideband and coherence optical pulse source with high shot-to-shot stability has been mandated for time-wavelength mapping—the enabling process for ultrahigh speed wavelength-encoded image retrieval. From the practical point of view, exploiting methods to relax the stringent requirements (e.g., temporal stability and coherence) for the source of time-stretch microscopy is thus of great value. In this paper, we demonstrated time-stretch microscopy by reconstructing the time-wavelength mapping sequence from a wideband incoherent source. Utilizing the time-lens focusing mechanism mediated by a narrow-band pulse source, this approach allows generation of a wideband incoherent source, with the spectral efficiency enhanced by a factor of 18. As a proof-of-principle demonstration, time-stretch imaging with the scan rate as high as MHz and diffraction-limited resolution is achieved based on the wideband incoherent source. We note that the concept of time-wavelength sequence reconstruction from wideband incoherent source can also be generalized to any high-speed optical real-time measurements, where wavelength is acted as the information carrier
Coherent laser phase retrieval in the presence of measurement imperfections and incoherent light
DEFF Research Database (Denmark)
Hansen, Anders Kragh
2017-01-01
-plane Gerchberg–Saxton algorithm and demonstrate that it is highly successful at extracting the intensity profile and wavefront of the spatially coherent part of the light from various lasers, including tapered laser diodes, at a very high fidelity despite the presence of incoherent light and noise....
Optical sectioning using a digital Fresnel incoherent-holography-based confocal imaging system
Kelner, Roy; Katz, Barak; Rosen, Joseph
2015-01-01
We propose a new type of confocal microscope using Fresnel incoherent correlation holography (FINCH). Presented here is a confocal configuration of FINCH using a phase pinhole and point illumination that is able to suppress out-of-focus information from the recorded hologram and hence combine the super-resolution capabilities of FINCH with the sectioning capabilities of confocal microscopy. PMID:26413560
Optical sectioning using a digital Fresnel incoherent-holography-based confocal imaging system
Kelner, Roy; Katz, Barak; Rosen, Joseph
2014-01-01
We propose a new type of confocal microscope using Fresnel incoherent correlation holography (FINCH). Presented here is a confocal configuration of FINCH using a phase pinhole and point illumination that is able to suppress out-of-focus information from the recorded hologram and hence combine the super-resolution capabilities of FINCH with the sectioning capabilities of confocal microscopy.
Measurements of integral cross-sections of incoherent interactions of photons with L-shell electrons
Energy Technology Data Exchange (ETDEWEB)
Verma, S L; Allawadhi, K L; Sood, B S [Punjabi Univ., Patiala (India). Nuclear Science Labs.
1983-05-21
Integral cross-sections of incoherent interactions of 662 and 1250 keV gamma-rays with L-shell electrons of different elements with 74<=Z<=92 have been measured. The experimental results, when interpreted in terms of photoelectric and Compton interaction cross-sections, are found to agree with theory.
Measurement of integral cross-sections of incoherent interactions of photons with K-shell electrons
Energy Technology Data Exchange (ETDEWEB)
Verma, S L; Allawadhi, K L; Sood, B S [Punjabi Univ., Patiala (India). Dept. of Physics. Nuclear Science Labs.
1981-06-01
Integral cross-sections of incoherent interactions of 145, 279, 662 and 1250 keV gamma-rays with K-shell electrons of thirty-one different elements with 26 <= Z <= 92 have been measured. The results are interpreted in terms of the photoelectric and Compton interactions and are found to agree with theory.
Velocity-Autocorrelation Function in Liquids, Deduced from Neutron Incoherent Scattering Results
DEFF Research Database (Denmark)
Carneiro, Kim
1976-01-01
The Fourier transform p(ω) of the velocity-autocorrelation function is derived from neutron incoherent scattering results, obtained from the two liquids Ar and H2. The quality and significance of the results are discussed with special emphasis on the long-time t-3/2 tail, found in computer simula...
Determination of the thermospheric neutral wind from incoherent scatter radar measurements
International Nuclear Information System (INIS)
Haeggstroem, I.; Murdin, J.; Rees, D.
1984-11-01
Measurements made by the EISCAT UHF incoherent scatter radar are used to derive thermospheric winds. The derived wind is compared to Fabry-Perot interferometer measurements of the neutral wind made simultaneously. The uncertainties in the radar derived wind are discussed. (author)
Energy Technology Data Exchange (ETDEWEB)
Lai, Vincent; Li, Xiao; Huang, Bingsheng; Khong, Pek Lan [University of Hong Kong, Queen Mary Hospital, Department of Diagnostic Radiology, Li Ka Shing Faculty of Medicine, Hong Kong (China); Lee, Victor Ho Fun; Lam, Ka On [University of Hong Kong, Queen Mary Hospital, Department of Clinical Oncology, Li Ka Shing Faculty of Medicine, Hong Kong (China); Fong, Daniel Yee Tak [University of Hong Kong, School of Nursing, Li Ka Shing Faculty of Medicine, Hong Kong (China); Chan, Queenie [Philips Healthcare, Hong Kong, New Territories (China)
2014-01-15
To explore intravoxel incoherent motion (IVIM) characteristics of nasopharyngeal carcinoma (NPC) and relationships with different tumour stages. We prospectively recruited 80 patients with newly diagnosed undifferentiated NPC. Diffusion-weighted MR imaging was performed and IVIM parameters (D, pure diffusion; f, perfusion fraction; D*, pseudodiffusion coefficient) were calculated. Patients were stratified into low and high tumour stage groups based on American Joint Committee on Cancer (AJCC) and TNM staging for determination of the predictive powers of IVIM parameters using t test, multiple logistic regression and ROC curve analyses. D, f and D* were all statistically significantly lower in high-stage groups in AJCC, T and N staging. D, f and D* were all independent predictors of AJCC staging, f and D* were independent predictors of T staging, and D was an independent predictor of N staging. D was most powerful for AJCC and N staging, whereas f was most powerful for T staging. Optimal cut-off values (area under the curve, sensitivity, specificity, positive likelihood ratio, negative likelihood ratio) were as follows: AJCC stage, D = 0.782 x 10{sup -3} mm{sup 2}/s (0.915, 93.3 %, 76.2 %, 3.92, 0.09); T staging, f = 0.133 (0.905, 80.5 %, 92.5 %, 10.73, 0.21); N staging, D = 0.761 x 10{sup -3} mm{sup 2}/s (0.848, 87.5 %, 66.7 %, 2.62, 0.19). Multivariate analysis showed no diagnostic improvement. Nasopharyngeal carcinoma has distinctive intravoxel incoherent motion characteristics parameters in different tumour staging, potentially helping pretreatment staging. (orig.)
International Nuclear Information System (INIS)
Hamano, R.
1993-01-01
The effect of the coexistence of coherent and incoherent precipitates, such as M 2 C and NiAl, on the ductility and plane strain fracture toughness of 5 wt pct Ni-2 wt pct Al-based high-strength steels was studied. In order to disperse coherent and incoherent precipitates, the heat treatments were carried out as follows: (a) austenitizing at 1373 K, (b) tempering at 1023 or 923 K for dispersing the incoherent precipitates of M 2 C and NiAl, and then (c) aging at 843 K for 2.4 ks to disperse the coherent precipitate of NiAl into the matrix, which contains incoherent precipitates, such as M 2 C and NiAl. The results were obtained as follows: (a) when the strengthening precipitates consist of coherent ones, such as M 2 C and/or NiAl, the ductility and toughness are extremely low, and (b) when the strengthening precipitates consist of coherent and incoherent precipitates, such as M 2 C and NiAl, the ductility and fracture toughness significantly increase with no loss in strength. It is shown that the coexistence of coherent and incoherent precipitates increases homogeneous deformation, thus preventing local strain concentration and early cleavage cracking. Accordingly, the actions of coherent precipitates in strengthening the matrix and of incoherent precipitates in promoting, homogeneous deformation can be expected to increase both the strength and toughness of the material
International Nuclear Information System (INIS)
Westerlind, M.; Hedberg, B.
2000-01-01
This paper summarises some experiences gained by the SKI and SSI during the ongoing process for siting a final repository for spent nuclear fuel. The focus is on activities in the municipalities involved in the siting process. In order to give the proper context some basic elements in the legislation, which are important for public participation and confidence in the siting process, are outlined. The importance of clearly defined responsibilities and early participation of the regulators in the siting process are emphasised. It should be pointed out that this paper is not a comprehensive review of the Swedish situation but only contains a few selected issues and personal remarks from the authors. Thus, the views and opinions do not necessarily coincide with those of SKI and SSI. (authors)
International Nuclear Information System (INIS)
Maximov, A.V.; Ourdev, I.G.; Rozmus, W.; Capjack, C.E.; Mounaix, Ph.; Huller, S.; Pesme, D.; Tikhonchuk, V.T.; Divol, L.
2000-01-01
It is shown that plasma-induced angular spreading and spectral broadening of a spatially incoherent laser beam correspond to increased spatial and temporal incoherence of the laser light. The spatial incoherence is characterized by an effective beam f-number, decreasing in space along the direction of light propagation. Plasma-induced beam smoothing can influence laser-plasma interaction physics. In particular, decreasing the correlation time of the propagating laser light may dramatically reduce the levels of backward stimulated Brillouin and Raman scattering inside the plasma. Also, the decrease of the laser beam effective f-number reduces the reflectivity of backward stimulated Brillouin scattering. (authors)
International Nuclear Information System (INIS)
Espejo, R.; Gill, A.
1998-01-01
The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section 'A problem of identity'. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI's regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions
Glendening, Zachary S; McCauley, Erin; Shinn, Marybeth; Brown, Scott R
2018-04-01
Though disability and housing instability are discussed separately in public health literature, few studies address families at their intersection. As a result, little is known about families who experience both homelessness and disability, how many receive disability benefits like SSI and SSDI, or the influence of those benefits on health-promoting outcomes like housing stability and self-sufficiency. Moreover, no previous research compares the ability of different housing and service interventions to increase disability benefit access. We examine relationships between disabilities and SSI/SSDI income reported when families enter emergency shelters and later health-promoting outcomes (housing stability and self-sufficiency) and how housing interventions affect SSI/SSDI receipt. Families in the (name removed) Study (N = 1857) were interviewed in emergency shelters, randomly offered of one of three housing interventions or usual care (i.e., no immediate referral to any intervention beyond shelter), and re-interviewed 20 months later. A third of families reported a disability at shelter entry. SSI/SSDI coverage of these families increased nearly 10% points over 20 months but never exceeded 40%. Disabilities predicted greater housing instability, food insecurity, and economic stress and less work and income. Among families reporting disabilities, SSI/SSDI receipt predicted fewer returns to emergency shelter, and more income despite less work. Offers of long-term housing subsidies increased SSI/SSDI receipt. Many families experiencing homelessness have disabilities; those receiving SSI/SSDI benefits have better housing and income outcomes. Providing families experiencing homelessness with long-term housing subsidies and SSI/SSDI could improve public health. Copyright © 2017 Elsevier Inc. All rights reserved.
Analysis of Seismic Soil-Structure Interaction for a Nuclear Power Plant (HTR-10
Directory of Open Access Journals (Sweden)
Xiaoxin Wang
2017-01-01
Full Text Available The response of nuclear power plants (NPPs to seismic events is affected by soil-structure interactions (SSI. In the present paper, a finite element (FE model with transmitting boundaries is used to analyse the SSI effect on the response of NPP buildings subjected to vertically incident seismic excitation. Analysis parameters that affect the accuracy of the calculations, including the dimension of the domain and artificial boundary types, are investigated through a set of models. A numerical SSI analysis for the 10 MW High Temperature Gas Cooled Test Reactor (HTR-10 under seismic excitation was carried out using the developed model. The floor response spectra (FRS produced by the SSI analysis are compared with a fixed-base model to investigate the SSI effect on the dynamic response of the reactor building. The results show that the FRS at foundation level are reduced and those at higher floor levels are altered significantly when taking SSI into account. The peak frequencies of the FRS are reduced due to the SSI, whereas the acceleration at high floor levels is increased at a certain frequency range. The seismic response of the primary system components, however, is reduced by the analysed SSI for the HTR-10 on the current soil site.
Depth-resolved incoherent and coherent wide-field high-content imaging (Conference Presentation)
So, Peter T.
2016-03-01
Recent advances in depth-resolved wide-field imaging technique has enabled many high throughput applications in biology and medicine. Depth resolved imaging of incoherent signals can be readily accomplished with structured light illumination or nonlinear temporal focusing. The integration of these high throughput systems with novel spectroscopic resolving elements further enable high-content information extraction. We will introduce a novel near common-path interferometer and demonstrate its uses in toxicology and cancer biology applications. The extension of incoherent depth-resolved wide-field imaging to coherent modality is non-trivial. Here, we will cover recent advances in wide-field 3D resolved mapping of refractive index, absorbance, and vibronic components in biological specimens.
Production of flat KrF laser focal profiles with echelon free-induced spatial incoherence
International Nuclear Information System (INIS)
Deniz, A.V.; Obenschain, S.P.; Pronko, M.; Lehmberg, R.H.
1990-01-01
High gain direct-drive laser fusion requires a uniform spherical pellet implosion. This in turn requires that the focal profile of each driving beam be sufficiently uniform and controlled. Several methods for producing uniform beams have been proposed. One promising technique, echelon free-induced spatial incoherence (ISI), consists of propagating a broadband spatially incoherent beam through an entire laser system. This technique will be used in the Nike laser, which is a twenty-four- to forty-eight-beam multikilojoule KrF system currently under construction at the Naval Research Laboratory (NRL). This paper presents measurements of focal profiles of laser light smoothed by echelon free ISI from a KrF oscillator and amplifier. The initial implementation is shown
SFERXS, Photoabsorption, Coherent, Incoherent Scattering Cross-Sections Function for Shielding
International Nuclear Information System (INIS)
Legarda, F.; Mtz de la Fuente, O.; Herranz, M.
2002-01-01
Description of program or function: The use of electromagnetic radiation cross-sections in radiation shielding calculations and more generally in transport theory applications actually requires an interpolation between values which are tabulated for certain values of the energy. In order to facilitate this process and to reduce the computer memory requirements, we have developed, by a least squares method, a set of functions which represents the cross-sections for the photoelectric absorption, the coherent (Rayleigh) and the incoherent (Compton) scattering (1). For this purpose we have accepted as true values the ones tabulated by Storm and Israel (2) for the photoeffect, by Hubbell et Al. (3) for the incoherent scattering and by Hubbell and Overbo (4) for the coherent scattering
Transformation of EIA to EIT by incoherent pumping of the 85Rb D1 line
Yu, Hoon; Kim, Jung Dong; Jung, Tae Young; Kim, Jung Bog
2012-10-01
We have observed a transformation from electromagnetically-induced absorption (EIA) to electromagnetically induced transparency (EIT) in open systems of the 85Rb D1 line by adding an incoherent optical pumping laser. This result raises a new question about recent theoretical work which does not address the degree of open. The pump beam only plays a role in transferring atoms by a spontaneous transition into the interacting system for EIT observation, which is an incoherent process. The dependence of the absorption spectra on the intensity and the polarization of each laser beam were observed. We have found the same tendencies in all transitions except the F = 2 ↔ F' = 3 transition of the 85Rb D1 line, which is the system that almost satisfies conventional EIA conditions.
Incoherent scattering of gamma photons for non-destructive tomographic inspection of pipeline
International Nuclear Information System (INIS)
Sharma, Amandeep; Sandhu, B.S.; Singh, Bhajan
2010-01-01
A scanner system, operating in a non-destructive and non-invasive way, is presented for pipeline to determine its location in land soil, wall thickness, type of liquid flowing and crack/blockage position. The present experiment simulates a real case where pipe corrosion (wall thinning) under insulation can be known from the study of incoherent scattering of 662 keV gamma photons. The incoherent scattered intensity, obtained by unfolding (deconvolution) the experimental pulse-height distribution of NaI(Tl) scintillation detector with the help of inverse response matrix, provides the desired information. The method is quite sensitive for small change (∼1 mm) in the thickness of pipe wall, locating a defect of 1 mm width under insulation and a small change (∼0.1 gm cm -3 ) in the density of liquid flowing through pipe.
Vibronic dephasing model for coherent-to-incoherent crossover in DNA
Karasch, Patrick; Ryndyk, Dmitry A.; Frauenheim, Thomas
2018-05-01
In this paper, we investigate the interplay between coherent and incoherent charge transport in cytosine-guanine (GC-) rich DNA molecules. Our objective is to introduce a physically grounded approach to dephasing in large molecules and to understand the length-dependent charge transport characteristics, and especially the crossover from the coherent tunneling to incoherent hopping regime at different temperatures. Therefore, we apply the vibronic dephasing model and compare the results to the Büttiker probe model which is commonly used to describe decoherence effects in charge transport. Using the full ladder model and simplified one-dimensional model of DNA, we consider molecular junctions with alternating and stacked GC sequences and compare our results to recent experimental measurements.
Pustozerov, A.; Shandarov, V.
2017-12-01
The influence of incoherent background illumination produced by light-emitting diodes (LED's) of different average wavelengths and laser diode emitting in blue region of visible on diffraction characteristics of narrow coherent light beams of He-Ne laser due to refractive index changes of Fe-doped lithium niobate sample are studied. It has been experimentally demonstrated that nonlinear diffraction of red beams with wavelength 633 nm and diameters on full width of half maximum (FWHM) near to 15 μm may be totally compensated using background light with average wavelengths 450 - 465 nm. To provide the necessary intensity of incoherent background, the combinations of spherical and cylindrical concave lenses with blue LED and laser diode module without focusing its beam have been used.
Bound coherent and incoherent thermal neutron scattering cross sections of the elements
International Nuclear Information System (INIS)
Sears, V.F.
1982-12-01
An up-to-date table of bound coherent and incoherent thermal neutron scattering cross sections of the elements is presented. Values from two different data sources are calculated and compared. These sources are: (1) the free-atom cross sections listed in the Σbarn bookΣ and (2) the Julich scattering length tables. We also call attention to, and clarify, the confusion that exists in the literature concerning the sign of the imaginary part of the complex scattering length
Ceccherini, S.; Colocci, M.; Gurioli, M.; Bogani, F.
1998-11-01
The distinction between the coherent and the incoherent component of the radiation emitted from resonantly excited material systems is difficult experimentally, particularly when ultra-short optical pulses are used for excitation. We propose an experimental procedure allowing an easy measurement of the two components. The method is completely general and applicable to any kind of physical system; its feasibility is demonstrated on the resonant emission from excitons in a semiconductor quantum well.
Dose and dose rate effects on coherent-to-incoherent transition of precipitates upon irradiation
Institute of Scientific and Technical Information of China (English)
LI Zhengchao
2006-01-01
A typical precipitation hardened alloy, Cu-Co dilute alloy was selected to study the precipitation behavior and irradiation effect on precipitates. It is found that the principal effect of ion irradiation on the coherent precipitates is loss of coherency, and TEM cross-section observations show that the fraction of the incoherent precipitates is dependent on dose but not on dose rate during heavy ion irradiation.
Larsen, Delmar S.; van Stokkum, Ivo H. M.; Vengris, Mikas; van der Horst, Michael A.; de Weerd, Frank L.; Hellingwerf, Klaas J.; van Grondelle, Rienk
2004-01-01
Photoactive yellow protein is the protein responsible for initiating the ``blue-light vision¿¿ of Halorhodospira halophila. The dynamical processes responsible for triggering the photoactive yellow protein photocycle have been disentangled with the use of a novel application of dispersed ultrafast pump-dump-probe spectroscopy, where the photocycle can be started and interrupted with appropriately tuned and timed laser pulses. This ``incoherent¿¿ manipulation of the photocycle allows for the d...
Deng, Yi; Yang, Biran; Peng, Yan; Liu, Zhiqiang; Luo, Jinwen; Du, Guoxin
2018-03-14
The purpose of the study was to examine differences in kidney intravoxel incoherent motion diffusion-weighted imaging (IVIM-DWI) parameters in early-stage diabetic patients versus healthy controls. Nineteen type 2 diabetic patients (group A) with a urinary albumin-to-creatinine ratio (ACR) diabetic kidney changes was determined by receiver operating characteristic analysis. Three radiologists independently measured the parameters derived from IVIM-DWI in the two groups by free-hand placing regions of interest, and the interclass coefficients (ICCs) were analyzed by SPSS.16.0 software. The f values of the kidneys were significantly higher in diabetic patients than in healthy volunteers. The D value of the kidneys was significantly lower in diabetic patients than in healthy volunteers. No significant differences in the D* values of the kidneys were observed between diabetic patients and healthy volunteers. The D values of the right kidneys were significantly higher than those of the left kidneys in both groups. The results of the receiver operating characteristic analysis were as follows: left kidney-f value AUC = 0.650 (cutoff point ≥ 27.49%) and D value AUC = 0.752 (cutoff point ≤ 1.68 × 10 -3 mm 2 /s); and right kidney-f value AUC = 0.650 (cutoff point ≥ 28.24%) and D value AUC = 0.752 (cutoff point ≤ 1.81 × 10 -3 mm 2 /s). The diagnostic performance of the D* value was very low (AUC 0.05). The ICCs of the f value and D value were between 0.637 and 0.827. The ICC of the D* value was less than 0.3. The results of our study suggest that changes in kidneys detected by IVIM-DWI may serve as indicators of early diabetic kidney disease.
International Nuclear Information System (INIS)
Yao, Y.; Zhang, S.; Tang, X.; Zhang, S.; Shi, J.; Zhu, W.; Zhu, W.
2016-01-01
Aim: To evaluate the feasibility of using intravoxel incoherent motion (IVIM) to measure diffusion and perfusion parameter variations in stroke. Materials and methods: Thirty-eight stroke patients were enrolled in the study. IVIM imaging was performed using 15 b-values from 0 to 1000 s/mm"2. Arterial spin labelling (ASL) magnetic resonance perfusion was also undertaken. Relations between the IVIM parameters (including apparent diffusion coefficient [ADC], diffusion coefficient D_s_l_o_w [D], pseudo-diffusion coefficient D_f_a_s_t [D*], fractional perfusion-related volume [f]) and fD* (the multiplication of the first two parameters) and the ASL-derived parameter, cerebral blood flow (CBF), were analysed using paired t-tests. Comparisons of all the parameters between lesions and contralateral normal regions, as well as between acute and subacute groups were analysed using Student's t-test. Results: There were positive correlations between f and CBF as well as fD* and CBF (r=0.472 and 0.653). Quantitative analysis showed a significant decrease in ADC, D, D*, f, fD*, and CBF of the lesions compared with the contralateral side, in which the decrease of fD* (68.6%) was highest. The values of ADC, f, and fD* increased in the subacute period group compared with the acute period group. Conclusions: IVIM analysis allowed separation of perfusion contribution from true diffusion and thus provided an evaluation of the perfusion and diffusion variations during stroke, which might further elucidate the mechanisms of ischaemic stroke. - Highlights: • There exist positive correlations between fractional perfusion-related volume (f) and cerebral blood flow (CBF) as well as fD"∗ and CBF. • A significant decrease in ADC, diffusion coefficient D_s_l_o_w (D), pseudo-diffusion coefficient D_f_a_s_t (D"∗), f, fD"∗ and CBF of the lesions compared with the contralateral normal regions. • The values of ADC, f and fD"∗ increase significantly in the subacute period compared with
LifeStyle-Specific-Islands (LiSSI): Integrated Bioinformatics Platform for Genomic Island Analysis
DEFF Research Database (Denmark)
Barbosa, Eudes; Rottger, Richard; Hauschild, Anne-Christin
2017-01-01
Distinct bacteria are able to cope with highly diverse lifestyles; for instance, they can be free living or host-associated. Thus, these organisms must possess a large and varied genomic arsenal to withstand different environmental conditions. To facilitate the identification of genomic features ...
An analysis of account holders acceptability and satisfaction towards Sukanya Samriddhi Yojana (SSY)
R., Venkatesh.
2018-01-01
The 15th census of India, carried out in the year 2011, states that the sex ratio of India is still 943 female per 1000 male population. This data proves the existence of two important social evils, namely, female foeticide and female infanticide, which are rampant in the Indian society. Till late, there was great tendency among people in India to get the sex of the unborn child medically tested and get the pregnancy terminated if it was female. Many were so cruel that they tend to kill the...
Coherent and incoherent J /ψ photonuclear production in an energy-dependent hot-spot model
Cepila, J.; Contreras, J. G.; Krelina, M.
2018-02-01
In a previous publication, we have presented a model for the photoproduction of J /ψ vector mesons off protons, where the proton structure in the impact-parameter plane is described by an energy-dependent hot-spot profile. Here we extend this model to study the photonuclear production of J /ψ vector mesons in coherent and incoherent interactions of heavy nuclei. We study two methods to extend the model to the nuclear case: using the standard Glauber-Gribov formalism and using geometric scaling to obtain the nuclear saturation scale. We find that the incoherent cross section changes sizably with the inclusion of subnucleonic hot spots and that this change is energy dependent. We propose to search for this behavior by measuring the ratio of the incoherent to coherent cross sections at different energies. We compare the results of our model to results from the Relativistic Heavy-Ion Collider (RHIC) and from run 1 at the Large Hadron Collider (LHC), finding satisfactory agreement. We also present predictions for the LHC at the new energies reached in run 2. The predictions include J /ψ production in ultraperipheral collisions, as well as the recently observed photonuclear production in peripheral collisions.
Singh, Lakhwinder Pal; Bhardwaj, Arvind; Deepak, K K; Bedi, Raman
2009-08-01
Occupational noise has been recognized as hazardous for the human beings. A high noise level in forging shops is considered to lower the labour productivity and cause illness however occupational noise is being accepted as an integral part of the job. The present study has been carried out in 5 small scale hand tool forging units (SSI) of different sizes in Northern India in Punjab. Noise levels at various sections were measured. OSHA norms for hearing conservation has been incorporated which includes an exchange rate of 5 dB (A), criterion level at 90 dB (A), criterion time of 8 h, threshold level=80 dB (A), upper limit=140 dB (A) and with F/S response rate. Equivalent sound pressure level (L(eq)) has been measured in various sections of these plants. Noise at various sections like hammer section, cutting presses, punching, grinding and barrelling process was found to be >90 dB (A), which is greater than OSHA norms. A cross-sectional study on the basis of questionnaire has been carried out. The results of which revealed that 68% of the workers are not wearing ear protective equipments out of these 50% were not provided with PPE by the company. About 95% of the workers were suffering speech interference though high noise annoyance was reported by only 20%. It has been established that the maximum noise exposure is being taken by the workers as they are working more than 8h a day for six days per week. More than 90% workers are working 12 to 24 h over time per week which lead to very high noise exposure i.e. 50 to 80% per week higher than exposure time/week in USA or European countries(15, 16)).
Energy Technology Data Exchange (ETDEWEB)
Dverstorp, Bjorrn
2007-09-15
This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009.
Assessment of cervical cancer with a parameter-free intravoxel incoherent motion imaging algorithm
Energy Technology Data Exchange (ETDEWEB)
Becker, Anton S.; Wurnig, Moritz C.; Boss, Andreas; Ghafoor, Soleen [Institute of Diagnostic and Interventional Radiology, University Hospital of Zurich, Zurich (Switzerland); Perucho, Jose A.; Khong, Pek Lan; Lee, Elaine Y. P. [Dept. of Diagnostic Radiology, The University of Hong Kong, Hong Kong (China)
2017-06-15
To evaluate the feasibility of a parameter-free intravoxel incoherent motion (IVIM) approach in cervical cancer, to assess the optimal b-value threshold, and to preliminarily examine differences in the derived perfusion and diffusion parameters for different histological cancer types. After Institutional Review Board approval, 19 female patients (mean age, 54 years; age range, 37–78 years) gave consent and were enrolled in this prospective magnetic resonance imaging study. Clinical staging and biopsy results were obtained. Echo-planar diffusion weighted sequences at 13 b-values were acquired at 3 tesla field strength. Single-sliced region-of-interest IVIM analysis with adaptive b-value thresholds was applied to each tumor, yielding the optimal fit and the optimal parameters for pseudodiffusion (D*), perfusion fraction (Fp) and diffusion coefficient (D). Monoexponential apparent diffusion coefficient (ADC) was calculated for comparison with D. Biopsy revealed squamous cell carcinoma in 10 patients and adenocarcinoma in 9. The b-value threshold (median [interquartile range]) depended on the histological type and was 35 (22.5–50) s/mm{sup 2} in squamous cell carcinoma and 150 (100–150) s/mm{sup 2} in adenocarcinoma (p < 0.05). Comparing squamous cell vs. adenocarcinoma, D* (45.1 [25.1–60.4] × 10{sup −3} mm{sup 2}/s vs. 12.4 [10.5–21.2] × 10{sup −3} mm{sup 2}/s) and Fp (7.5% [7.0–9.0%] vs. 9.9% [9.0–11.4%]) differed significantly between the subtypes (p < 0.02), whereas D did not (0.89 [0.75–0.94] × 10{sup −3} mm{sup 2}/s vs. 0.90 [0.82–0.97] × 10{sup −3} mm{sup 2}/s, p = 0.27). The residuals did not differ (0.74 [0.60–0.92] vs. 0.94 [0.67–1.01], p = 0.32). The ADC systematically underestimated the magnitude of diffusion restriction compared to D (p < 0.001). The parameter-free IVIM approach is feasible in cervical cancer. The b-value threshold and perfusion-related parameters depend on the tumor histology type.
Incoherent quasielastic neutron scattering from water in supercooled regime
International Nuclear Information System (INIS)
Chen, S.; Teixeira, J.; Nicklow, R.
1982-01-01
Measurements of the quasielastic spectra have been made with a three-axis neutron spectrometer at constant-Q mode in a temperature range from 38 0 C down to -20 0 C. Two energy resolutions both high (δE = 100 μ eV) and low (δE = 800 μ eV) were used to identify and separate a sharp component from a broad one. As temperature is decreased below zero the spectrum shows an increasing sharp component standing out on top of the broad one. The broad component is attributed to rotational motions of water molecules. A preliminary analysis of the linewidths gives a Q-independent relaxation time which has the same magnitude as the rotational relaxation time measured by nuclear magnetic resonance. The Q dependence of the sharp line is analyzed by a Q-dependent diffusion coefficient. A temperature-independent characteristic length l 0 = 0.5 A is obtained. We then attempt to relate this length to local geometry of protons associated with hydrogen bonding
Variable-length code construction for incoherent optical CDMA systems
Lin, Jen-Yung; Jhou, Jhih-Syue; Wen, Jyh-Horng
2007-04-01
The purpose of this study is to investigate the multirate transmission in fiber-optic code-division multiple-access (CDMA) networks. In this article, we propose a variable-length code construction for any existing optical orthogonal code to implement a multirate optical CDMA system (called as the multirate code system). For comparison, a multirate system where the lower-rate user sends each symbol twice is implemented and is called as the repeat code system. The repetition as an error-detection code in an ARQ scheme in the repeat code system is also investigated. Moreover, a parallel approach for the optical CDMA systems, which is proposed by Marić et al., is also compared with other systems proposed in this study. Theoretical analysis shows that the bit error probability of the proposed multirate code system is smaller than other systems, especially when the number of lower-rate users is large. Moreover, if there is at least one lower-rate user in the system, the multirate code system accommodates more users than other systems when the error probability of system is set below 10 -9.
Theoretical study of incoherent φ photoproduction on a deuteron target
International Nuclear Information System (INIS)
Sekihara, T.; Martinez Torres, A.; Jido, D.; Oset, E.
2012-01-01
We study the photoproduction of φ mesons in deuteron, paying attention to the modification of the cross-section from bound protons to the free ones. For this purpose we take into account Fermi motion in single scattering and rescattering of φ to account for φ absorption on a second nucleon as well as the rescattering of the proton on the neutron. We find that the contribution of the double scattering for φ is much smaller than the typical cross-section of γp→φp in free space, which implies a very small screening of the φ production in deuteron. The contribution from the proton rescattering, on the other hand, is found to be not negligible compared to the cross-section of γp→φp in free space, and leads to a moderate reduction of the φ photoproduction cross-section on a deuteron at forward angles if the LEPS set-up is taken into account. The Fermi motion allows contribution of the single scattering in regions forbidden by phase-space in the free case. In particular, we find that for momentum transfer squared close to the maximum value, the Fermi motion changes drastically the shape of dσ/dt, to the point that the ratio of this cross-section to the free one becomes very sensitive to the precise value of t chosen, or the size of the bin used in an experimental analysis. Hence, this particular region of t does not seem to be the most indicated to find effects of a possible φ absorption in the deuteron. This reaction is studied theoretically as a function of t and the results are contrasted with recent experiments at LEPS and Jefferson Lab. The effect of the experimental angular cuts at LEPS is also discussed, providing guidelines for future experimental analyses of the reaction. (orig.)
A demonstrator for an incoherent Doppler wind lidar receiver
Fabre, F.; Marini, A.; Sidler, Thomas C.; Morancais, Didier; Fongy, G.; Vidal, Ph.
2018-04-01
The knowledge of wind fields for a global terrestrial coverage and accurate altitude sampling is one of the main keys for improvement of meteorological predictions and general understanding of atmosphere behaviour. The best way to recover this information is remote sensing from space using low Earth orbit satellites. The measurement principle is to analyse the Doppler shift of the flux emitted by the space instrument and backscattered by the atmosphere. One of the most promising principle for Doppler shift measurement is the direct detection which does not need local oscillators. what significantly simplifies the design of such a space-borne receiver. ESA-ESTEC initiated at early 95' a programme called "lncoherent Doppler Wind Lidar (IDWL) technologies" for the study and bread-boarding phase. MMS won this contract proposing an original concept based on the use of a Fizeau high resolution interferometer working in the UV band. coupled with an intensified CCD. This concept is patented by MMS, as well as the special CCD timing sequence that will be depicted below. The programme begun by a study of the space-borne instrument in order to identify main constraints and define the receiver as could be for a flight model. A detailed performance model was established and parametric analysis allowed to optimise the concept in order to reach required performances. This study phase finally provided the definition of a bread-board for expected performances demonstration. Moreover, the Laser Signal Simulator (LSS) which is used to simulate the Lidar echo in term of amplitude as well as frequency modulation was defined at this step. The performances of this test support equipment are of main importance for the validation of the demonstrator design and performances. The second part of the study aimed at defining the derailed design of the demonstrator and associated test support equipment as well as initiating preliminary validation experiments on most critical technologies, like
Energy Technology Data Exchange (ETDEWEB)
Wu, Chih-Horng; Liang, Po-Chin; Shih, Tiffany Ting-Fang [National Taiwan University Hospital, Department of Medical Imaging, Taipei (China); National Taiwan University College of Medicine, Department of Radiology, Taipei (China); Ho, Ming-Chih; Hu, Rey-Heng; Lai, Hong-Shiee [National Taiwan University Hospital and College of Medicine, Department of Surgery, Taipei (China); Jeng, Yung-Ming [National Taiwan University Hospital and College of Medicine, Department of Pathology, Taipei (China)
2015-12-15
This study compared the diagnostic performance of intravoxel incoherent motion (IVIM) in magnetic resonance imaging (MRI) and acoustic radiation force impulse imaging (ARFI) in ultrasound (US) for liver fibrosis (LF) evaluation. A total of 49 patients scheduled for liver surgery were recruited. LF in the non-tumorous liver parenchyma at the right lobe was estimated using a slow diffusion coefficient, fast diffusion coefficient (D{sub fast}), perfusion fraction (f) of the IVIM parameters, the total apparent diffusion coefficient of conventional diffusion-weighted imaging and the shear wave velocity (Vs) of ARFI. LF was graded using the Metavir scoring system on histological examination. The Spearman rank correlation coefficient for correlation and analysis of variance was used for determining difference. The diagnostic performance was compared using receiver operating characteristic curve analysis. LF exhibited significant correlation with the three parameters D{sub fast}, f, and Vs (r = -0.528, -0.337, and 0.481, respectively, P < 0.05). The D{sub fast} values in the F4 group were significantly lower than those in the F0, F1 and F2 groups. D{sub fast} exhibited a non-inferior performance for diagnosing all fibrosis grades compared with that of Vs. Both IVIM and ARFI provide reliable estimations for the noninvasive assessment of LF. (orig.)
International Nuclear Information System (INIS)
Dverstorp, Bjorrn
2007-09-01
This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009
Small, simple but useful: the SSI approach to a real-time system for decision making support
International Nuclear Information System (INIS)
Baeverstam, U.
1993-01-01
In case of a nuclear accident or a threat of a release, the Swedish Radiation Protection Institute (SSI) is responsible for advising and informing the Government, other authorities and the public. The institute's experts are supported by a newly developed, small computerised system. Some components of the system are: a simple model for atmospheric dispersion and dose predictions; databases including maps, nuclides, instruments and facilities to store and handle measured values; on-line connection to nationwide system of automatic measuring stations; a number of data display facilities; and computer based handbooks. Most software for the system is written for the MS Windows environment. (author)
Directory of Open Access Journals (Sweden)
Ester Chiessi
2011-10-01
Full Text Available Chemically cross-linked polymer networks of poly(vinyl alcohol/poly(methacrylate form monolitic hydrogels and microgels suitable for biomedical applications, such as in situ tissue replacement and drug delivery. In this work, molecular dynamics (MD simulation and incoherent neutron scattering methods are used to study the local polymer dynamics and the polymer induced modification of water properties in poly(vinyl alcohol/poly(methacrylate hydrogels. This information is particularly relevant when the diffusion of metabolites and drugs is a requirement for the polymer microgel functionality. MD simulations of an atomic detailed model of the junction domain at the experimental hydration degree were carried out at 283, 293 and 313 K. The polymer-water interaction, the polymer connectivity and the water dynamics were investigated as a function of temperature. Simulation results are compared with findings of elastic and quasi-elastic incoherent neutron scattering measurements, experimental approaches which sample the same space-time window of MD simulations. This combined analysis shows a supercooled water component and an increase of hydrophilicity and mobility with temperature of these amphiphilic polymer networks.
Atomic form factors, incoherent scattering functions, and photon scattering cross sections
International Nuclear Information System (INIS)
Hubbell, J.H.; Veigele, W.J.; Briggs, E.A.; Brown, R.T.; Cromer, D.T.; Howerton, R.J.
1975-01-01
Tabulations are presented of the atomic form factor, F (α,Z), and the incoherent scattering function, S (x,Z), for values of x (=sin theta/2)/lambda) from 0.005 A -1 to 10 9 A -1 , for all elements A=1 to 100. These tables are constructed from available state-of-the-art theoretical data, including the Pirenne formulas for Z=1, configuration-into action results by Brown using Brown-Fontana and Weiss correlated wavefunctions for Z=2 to 6 non-relativistic Hartree-Fock results by Cromer for Z=7 to 100 and a relativistic K-shell analytic expression for F (x,Z) by Bethe Levinger for x>10 A -1 for all elements Z=2 to 100. These tabulated values are graphically compared with available photon scattering angular distribution measurements. Tables of coherent (Rayleigh) and incoherent (Compton) total scattering cross sections obtained by nummerical integration over combinations of F 2 (x,Z) with the Thomson formula and S (x,Z) with the Klum-Nishina Formual, respectively, are presented for all elements Z=1 to 100, for photon energies 100 eV (lambda=124 A) to 100 MeV (0.000124 A). The incoherent scattering cross sections also include the radiative and double-Compton corrections as given by Mork. Similar tables are presented for the special cases of terminally-bonded hydrogen and for the H 2 molecule, interpolated and extrapolated from values calculated by Stewart et al., and by Bentley and Stewart using Kolos-Roothaan wavefunctions
Parametric instabilities of parallel propagating incoherent Alfven waves in a finite ion beta plasma
International Nuclear Information System (INIS)
Nariyuki, Y.; Hada, T.; Tsubouchi, K.
2007-01-01
Large amplitude, low-frequency Alfven waves constitute one of the most essential elements of magnetohydrodynamic (MHD) turbulence in the fast solar wind. Due to small collisionless dissipation rates, the waves can propagate long distances and efficiently convey such macroscopic quantities as momentum, energy, and helicity. Since loading of such quantities is completed when the waves damp away, it is important to examine how the waves can dissipate in the solar wind. Among various possible dissipation processes of the Alfven waves, parametric instabilities have been believed to be important. In this paper, we numerically discuss the parametric instabilities of coherent/incoherent Alfven waves in a finite ion beta plasma using a one-dimensional hybrid (superparticle ions plus an electron massless fluid) simulation, in order to explain local production of sunward propagating Alfven waves, as suggested by Helios/Ulysses observation results. Parameter studies clarify the dependence of parametric instabilities of coherent/incoherent Alfven waves on the ion and electron beta ratio. Parametric instabilities of coherent Alfven waves in a finite ion beta plasma are vastly different from those in the cold ions (i.e., MHD and/or Hall-MHD systems), even if the collisionless damping of the Alfven waves are neglected. Further, ''nonlinearly driven'' modulational instability is important for the dissipation of incoherent Alfven waves in a finite ion beta plasma regardless of their polarization, since the ion kinetic effects let both the right-hand and left-hand polarized waves become unstable to the modulational instability. The present results suggest that, although the antisunward propagating dispersive Alfven waves are efficiently dissipated through the parametric instabilities in a finite ion beta plasma, these instabilities hardly produce the sunward propagating waves
Misplaced Idealism and Incoherent Realism in the Philosophy of the Refugee Crisis
DEFF Research Database (Denmark)
Lægaard, Sune
2016-01-01
Many contributions to the philosophical debate about conceptual and normative issues raised by the refugee crisis fail to take properly account of the difference between ideal and nonideal theory. This makes several otherwise interesting and apparently plausible contributions to the philosophy...... of arguments about how we should understand or respond to the refugee crisis, which appear to offer coherent principles for the moral guidance of political actors but which are actually incoherent as principles of practical reasoning for the context they aim to address....
Incoherent neutron scattering functions for random jump diffusion in bounded and infinite media
International Nuclear Information System (INIS)
Hall, P.L.; Ross, D.K.
1981-01-01
The incoherent neutron scattering function for unbounded jump diffusion is calculated from random walk theory assuming a gaussian distribution of jump lengths. The method is then applied to calculate the scattering function for spatially bounded random jumps in one dimension. The dependence on momentum transfer of the quasi-elastic energy broadenings predicted by this model and a previous model for bounded one-dimensional continuous diffusion are calculated and compared with the predictions of models for diffusion in unbounded media. The one-dimensional solutions can readily be generalized to three dimensions to provide a description of quasi-elastic scattering of neutrons by molecules undergoing localized random motions. (author)
International Nuclear Information System (INIS)
Scha''fer, W.; Lo''venich, R.; Fromer, N. A.; Chemla, D. S.
2001-01-01
Recent theories of highly excited semiconductors are based on two formalisms, referring to complementary experimental conditions, the real-time nonequilibrium Green's function techniques and the coherently controlled truncation of the many-particle problem. We present a novel many-particle theory containing both of these methods as limiting cases. As a first example of its application, we investigate four-particle correlations in a strong magnetic field including dephasing resulting from the growth of incoherent one-particle distribution functions. Our results are the first rigorous solution concerning formation and decay of four-particle correlations in semiconductors. They are in excellent agreement with experimental data
Anomalous vibrational modes in acetanilide: A F.D.S. incoherent inelastic neutron scattering study
International Nuclear Information System (INIS)
Barthes, M.; Moret, J.; Eckert, J.; Johnson, S.W.; Swanson, B.I.; Unkefer, C.J.
1991-01-01
The origin of the anomalous infra-red and Raman modes in acetanilide (C 6 H 5 NHCOCH 3 , or ACN), remains a subject of considerable controversy. One family of theoretical models involves Davydov-like solitons nonlinear vibrational coupling, or ''polaronic'' localized modes. An alternative interpretation of the extra-bands in terms of a Fermi resonance was proposed and recently the existence of slightly non-degenerate hydrogen atom configurations in the H-bond was suggested as an explanation for the anomalies. In this paper we report some new results on the anomalous vibrational modes in ACN that were obtained by inelastic incoherent neutron scattering (INS)
Coexistence of synchrony and incoherence in oscillatory media under nonlinear global coupling
Energy Technology Data Exchange (ETDEWEB)
Schmidt, Lennart; García-Morales, Vladimir [Physik-Department, Nonequilibrium Chemical Physics, Technische Universität München, James-Franck-Str. 1, D-85748 Garching (Germany); Institute for Advanced Study, Technische Universität München, Lichtenbergstr. 2a, D-85748 Garching (Germany); Schönleber, Konrad; Krischer, Katharina, E-mail: krischer@tum.de [Physik-Department, Nonequilibrium Chemical Physics, Technische Universität München, James-Franck-Str. 1, D-85748 Garching (Germany)
2014-03-15
We report a novel mechanism for the formation of chimera states, a peculiar spatiotemporal pattern with coexisting synchronized and incoherent domains found in ensembles of identical oscillators. Considering Stuart-Landau oscillators, we demonstrate that a nonlinear global coupling can induce this symmetry breaking. We find chimera states also in a spatially extended system, a modified complex Ginzburg-Landau equation. This theoretical prediction is validated with an oscillatory electrochemical system, the electro-oxidation of silicon, where the spontaneous formation of chimeras is observed without any external feedback control.
Microscopic theory of coherent and incoherent optical properties of semiconductor heterostructures
Energy Technology Data Exchange (ETDEWEB)
Schaefer, Martin
2008-09-02
An important question is whether there is a regime in which lasing from indirect semiconductors is possible. Thus, we discuss this question in this thesis. It is shown that under incoherent emission conditions it is possible to create an exciton condensate in multiple-quantum-well (MQW) systems. The influence of a MQW structure on the exciton lifetime is investigated. For the description of the light-matter interaction of a QW in the coherent excitation regime, the semiconductor Bloch equation (SBE) are used. The incoherent regime is described by the semiconductor luminescence equations (SLE). In principle it is even possible to couple SBE and SLE. The resulting theory is able to describe interactions between coherent and incoherent processes we investigate both, the coherent and the incoherent light-emission regime. Thus we define the investigated system and introduce the many-body Hamiltonian that describes consistently the light-matter interaction in the classical and the quantum limit. We introduce the SBE that allow to compute the light-matter interaction in the coherent scenario. The extended scattering model is used to investigate the absorption of a Ge QW for different time delays after the excitations. In this context, we analyze whether there is a regime in which optical gain can be realized. Then we apply a transfer-matrix method to include into our calculations the influence of the dielectric environment on the optical response. Thereafter the SLE for a MQW system are introduced. We derive a scheme that allows for decoupling environmental effects from the pure PL-emission properties of the QW. The PL of the actual QW system is obtained by multiplying this filter function and the free-space PL that describes the quantum emission into a medium with spatially constant background-refractive index. It is studied how the MQW-Bragg structure influences the PL-emission properties compared to the emission of a single QW device. As a last feature, it is shown
All-fiber 7x1 signal combiner for incoherent laser beam combining
DEFF Research Database (Denmark)
Noordegraaf, Danny; Maack, Martin D.; Skovgaard, Peter M. W.
2011-01-01
We demonstrate an all-fiber 7x1 signal combiner for incoherent laser beam combining. This is a potential key component for reaching several kW of stabile laser output power. The combiner couples the output from 7 single-mode (SM) fiber lasers into a single multi-mode (MM) fiber. The input signal ...... in device temperature is observed. At an intermediate power level of 600 W a beam parameter product (BPP) of 2.22 mm x mrad is measured, corresponding to an M2 value of 6.5. These values are approaching the theoretical limit dictated by brightness conservation....
Barbay, S; Kuszelewicz, R
2007-09-17
We present a physical mechanism that explains the recent observations of incoherent writing and erasure of Cavity Solitons in a semiconductor optical amplifier [S. Barbay et al, Opt. Lett. 31, 1504-1506 (2006)]. This mechanism allows to understand the main observations of the experiment. In particular it perfectly explains why writing and erasure are possible as a result of a local perturbation in the carrier density, and why a delay is observed along with the writing process. Numerical simulations in 1D are performed and show very good qualitative agreement with the experimental observations.
Q2 Dependence of Nuclear Transparency for Incoherent ρ0 Electroproduction
International Nuclear Information System (INIS)
John Arrington; Frank Dohrmann; Ahmed El Alaoui; Don Geesaman; Kawtar Hafidi; Roy Holt; Harold Jackson; David Potterveld; Brahim Mustapha; Paul Reimer; Elaine Schulte; Krishni Wijesooriya; Maurik Holtrop; Jacques Ball; Michel Garcon; Jean Laget; Franck Sabatie; Michel Guidal; Latifa Elouadrhiri; Borissov, A.; Wolfgang Lorenzon; Stepan Stepanyan; Lawrence Weinstein
2002-01-01
Measurements of exclusive incoherent electroproduction of ρ 0 (770) meson from 2 D, 12 C, and 63 Cu targets up to Q 2 = 4 GeV 2 are proposed using the CLAS detector. The objective of these measurements is to determine the Q 2 dependence of the nuclear transparency ratio for the two nuclear targets: 12 C and 63 Cu at fixed coherence length of quark-antiquark fluctuations of the virtual photon. A sizeable rise of the nuclear transparency is predicted and can be measured in this experiment. A relatively large increase of the nuclear transparency can be considered as a signature of the onset of color transparency
International Nuclear Information System (INIS)
Klug, D.D.; Tulk, C.A.; Svensson, E.C.; Loong, C.
1999-01-01
Incoherent-inelastic neutron scattering data are obtained over the energy range of lattice and internal vibrations of water molecules in phases of ice prepared by pressure-induced amorphization (high-density amorphous ice, hda), by thermal annealing of hda (low-density amorphous ice, lda), and by rapidly cooling water, as well as in ice Ih and Ic . Hydrogen bonding interactions in lda differ significantly from those in the glass obtained by rapid quenching, which has hydrogen-bond interactions characteristic of highly supercooled water. Hydrogen-bond interactions in hda are weaker than in the low-density phases. copyright 1999 The American Physical Society
Bolea, Mario; Mora, José; Ortega, Beatriz; Capmany, José
2013-11-18
We present a high-order UWB pulses generator based on a microwave photonic filter which provides a set of positive and negative samples by using the slicing of an incoherent optical source and the phase inversion in a Mach-Zehnder modulator. The simple scalability and high reconfigurability of the system permit a better accomplishment of the FCC requirements. Moreover, the proposed scheme permits an easy adaptation to pulse amplitude modulation, bi phase modulation, pulse shape modulation and pulse position modulation. The flexibility of the scheme for being adaptable to multilevel modulation formats permits to increase the transmission bit rate by using hybrid modulation formats.
Coherent versus incoherent dynamics in InAs quantum-dot active wave guides
DEFF Research Database (Denmark)
Borri, Paola; Langbein, W.; Hvam, Jørn Märcher
2001-01-01
Coherent dynamics measured by time-resolved four-wave mixing is compared to incoherent population dynamics measured by differential transmission spectroscopy on the ground-state transition at room temperature of two types of InAs-based quantum dots with different confinement energies. The measure....... The measurements are performed with heterodyne detection on quantum-dot active wave guides to enhance the light-matter interaction length. An elastic nature of the measured dephasing is revealed which is independent of the dot energy level scheme....
Charged-particle incoherent-motion damping in storage rings by means of dissipative elements
International Nuclear Information System (INIS)
Derbenev, Ya.S.; Khejfets, S.A.
1979-01-01
In consecutive order a possibility of damping of beam incoherent oscillations in a storage ring was studied by means of an external dissipative system in a sufficient common case. It is shown, that a useful effect, as for the case of electron cooling, is one-particle effect of particle oscillations damping due to nonconservatism of its interaction with an external system. Each other mutual influence through the external system becomes significant with increasing beam density and results in the limitation to achievable damping decrements
International Nuclear Information System (INIS)
Bracker, A.S.; Lee, Y.T.; Bracker, A.S.; Wouters, E.R.; Suits, A.G.; Lee, Y.T.; Lee, Y.T.; Vasyutinskii, O.S.
1998-01-01
We have analyzed the recoil angle dependence of chlorine atom angular momentum alignment for the dissociation of chlorine molecules at 355nm. This angular distribution was isolated from ion image measurements, which map a three-dimensional velocity vector distribution of state-selectively-ionized photofragments into a two-dimensional spatial distribution. Using a general quantum mechanical method to simulate the alignment angular distribution, we show that there are clear contributions to alignment from both incoherent and coherent components of a perpendicular optical transition in the molecule. copyright 1998 The American Physical Society
Three-Dimensional Imaging by Self-Reference Single-Channel Digital Incoherent Holography
Rosen, Joseph; Kelner, Roy
2016-01-01
Digital holography offers a reliable and fast method to image a three-dimensional scene from a single perspective. This article reviews recent developments of self-reference single-channel incoherent hologram recorders. Hologram recorders in which both interfering beams, commonly referred to as the signal and the reference beams, originate from the same observed objects are considered as self-reference systems. Moreover, the hologram recorders reviewed herein are configured in a setup of a single channel interferometer. This unique configuration is achieved through the use of one or more spatial light modulators. PMID:28757811
Three-dimensional mapping of fluorescent nanoparticles using incoherent digital holography.
Yanagawa, Takumi; Abe, Ryosuke; Hayasaki, Yoshio
2015-07-15
Three-dimensional mapping of fluorescent nanoparticles was performed by using incoherent digital holography. The positions of the nanoparticles were quantitatively determined by using Gaussian fitting of the axial- and lateral-diffraction distributions through position calibration from the observation space to the sample space. It was found that the axial magnification was constant whereas the lateral magnification linearly depended on the axial position of the fluorescent nanoparticles. The mapping of multiple fluorescent nanoparticles fixed in gelatin and a single fluorescent nanoparticle manipulated with optical tweezers in water were demonstrated.
Hu, Anzhong; Lv, Tiejun; Gao, Hui; Zhang, Zhang; Yang, Shaoshi
2014-10-01
In this paper, an approach of estimating signal parameters via rotational invariance technique (ESPRIT) is proposed for two-dimensional (2-D) localization of incoherently distributed (ID) sources in large-scale/massive multiple-input multiple-output (MIMO) systems. The traditional ESPRIT-based methods are valid only for one-dimensional (1-D) localization of the ID sources. By contrast, in the proposed approach the signal subspace is constructed for estimating the nominal azimuth and elevation direction-of-arrivals and the angular spreads. The proposed estimator enjoys closed-form expressions and hence it bypasses the searching over the entire feasible field. Therefore, it imposes significantly lower computational complexity than the conventional 2-D estimation approaches. Our analysis shows that the estimation performance of the proposed approach improves when the large-scale/massive MIMO systems are employed. The approximate Cram\\'{e}r-Rao bound of the proposed estimator for the 2-D localization is also derived. Numerical results demonstrate that albeit the proposed estimation method is comparable with the traditional 2-D estimators in terms of performance, it benefits from a remarkably lower computational complexity.
Energy Technology Data Exchange (ETDEWEB)
Yan, Y.; Qian, S.; Littrell, K.; Parish, C.M. [Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States); Plummer, L.K. [University of Oregon, Eugene, OR 97403 (United States)
2015-05-15
A nondestructive neutron scattering method to precisely measure the uptake of hydrogen and the distribution of hydride precipitates in light water reactor (LWR) fuel cladding was developed. Zircaloy-4 cladding used in commercial LWRs was used to produce hydrided specimens. The hydriding apparatus consists of a closed stainless-steel vessel that contains Zr alloy specimens and hydrogen gas. Following hydrogen charging, the hydrogen content of the hydrided specimens was measured using the vacuum hot extraction method, by which the samples with desired hydrogen concentrations were selected for the neutron study. Optical microscopy shows that our hydriding procedure results in uniform distribution of circumferential hydrides across the wall thickness. Small angle neutron incoherent scattering was performed in the High Flux Isotope Reactor at Oak Ridge National Laboratory. Our study demonstrates that the hydrogen in commercial Zircaloy-4 cladding can be measured very accurately in minutes by this nondestructive method over a wide range of hydrogen concentrations from a very small amount (≈20 ppm) to over 1000 ppm. The hydrogen distribution in a tube sample was obtained by scaling the neutron scattering rate with a factor determined by a calibration process using standard, destructive direct chemical analysis methods on the specimens. This scale factor can be used in future tests with unknown hydrogen concentrations, thus providing a nondestructive method for determining absolute hydrogen concentrations.
Jiang, Jingxuan; Xiao, Zebin; Tang, Zuohua; Zhong, Yufeng; Qiang, Jinwei
2018-01-01
To explore the value of dynamic contrast-enhanced MRI (DCE-MRI) and intravoxel incoherent motion (IVIM) for distinguishing between benign and malignant sinonasal lesions and investigate the correlations between the two methods. Patients with sinonasal lesions (42 benign and 31 malignant) who underwent DCE-MRI and IVIM before confirmation by histopathology were enrolled in this prospective study. Parameters derived from DCE-MRI and IVIM were measured, the optimal cut-off values for differential diagnosis were determined, and the correlations between the two methods were evaluated. Statistical analyses were performed using the Wilcoxon rank sum test, receiver operating characteristic (ROC) curve analysis, and Spearman's rank correlation. Significantly higher K trans and K ep values but lower D and f values were found in malignant lesions than in benign lesions (all pbenign and malignant sinonasal lesions. IVIM findings correlate with DCE-MRI results and may represent an alternative to DCE-MRI. Copyright © 2017 Elsevier B.V. All rights reserved.
Prakash, Neeraj; Ramachandran, Arun; Varma, Ravi; Chen, Jun; Mazzoleni, Claudio; Du, Ke
2018-06-28
The principle of near-infrared incoherent broadband cavity enhanced absorption spectroscopy was employed to develop a novel instrument for detecting natural gas leaks as well as for testing the quality of natural gas mixtures. The instrument utilizes the absorption features of methane, butane, ethane, and propane in the wavelength region of 1100 nm to 1250 nm. The absorption cross-section spectrum in this region for methane was adopted from the HITRAN database, and those for the other three gases were measured in the laboratory. A singular-value decomposition (SVD) based analysis scheme was employed for quantifying methane, butane, ethane, and propane by performing a linear least-square fit. The developed instrument achieved a detection limit of 460 ppm, 141 ppm, 175 ppm and 173 ppm for methane, butane, ethane, and propane, respectively, with a measurement time of 1 second and a cavity length of 0.59 m. These detection limits are less than 1% of the Lower Explosive Limit (LEL) for each gas. The sensitivity can be further enhanced by changing the experimental parameters (such as cavity length, lamp power etc.) and using longer averaging intervals. The detection system is a low-cost and portable instrument suitable for performing field monitorings. The results obtained on the gas mixture emphasize the instrument's potential for deployment at industrial facilities dealing with natural gas, where potential leaks pose a threat to public safety.
International Nuclear Information System (INIS)
Lee, Elaine Yuen Phin; Yu, Xue; Khong, Pek-Lan; Chu, Mandy Man Yee; Ngan, Hextan Yuen Sheung; Siu, Steven Wai Kwan; Soong, Inda Sung; Chan, Queenie
2014-01-01
To investigate the tissue characteristics of cervical cancer based on the intravoxel incoherent motion (IVIM) model and to assess the IVIM parameters in tissue differentiation in the female pelvis. Sixteen treatment-naive cervical cancer and 17 age-matched healthy subjects were prospectively recruited for diffusion-weighted (b = 0-1,000 s/mm 2 ) and standard pelvic MRI. Bi-exponential analysis was performed to derive the perfusion parameters f (perfusion fraction) and D* (pseudodiffusion coefficient) as well as the diffusion parameter D (true molecular diffusion coefficient) in cervical cancer (n = 16), normal cervix (n = 17), myometrium (n = 33) and leiomyoma (n = 14). Apparent diffusion coefficient (ADC) was calculated. Kruskal-Wallis test and receiver operating characteristics (ROC) curves were used. Cervical cancer had the lowest f (14.9 ± 2.6 %) and was significantly different from normal cervix and leiomyoma (p -3 mm2/s) was lowest in cervical cancer and was significantly different from normal cervix and myometrium (p -3 mm 2 /s and ADC -3 mm 2 /s could differentiate cervical cancer from non-malignant tissues (AUC 0.773-0.908). Cervical cancer has low perfusion and diffusion IVIM characteristics with promising potential for tissue differentiation. (orig.)
Directory of Open Access Journals (Sweden)
Eris Ratnawati
2017-03-01
Key words: Learning Cycle-5E , Socioscientific Issues, Nature Of Science, Buffer Solution, Salt Hydrolysis Abstrak: Penelitian ini bertujuan menguji perbedaan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional pada materi larutan penyangga dan hidrolisis garam. Penelitian ini menggunakan rancangan penelitian eksperimen semu dengan pretes dan pascates. Sampel terdiri dari dua kelas dan dipilih menggunakan teknik convenience sampling di SMAN Tulungagung. Data diperoleh menggunakan instrumen angket hakikat sains berskala likert (R = 0,883 dan dianalisis dengan ANCOVA satu jalur dan effect size. Hasil penelitian menunjukkan ada perbedaan signifikan pemahaman hakikat sains siswa yang dibelajarkan dengan model pembelajaran Learning Cycle-5E berkonteks SSI dan model pembelajaran konvensional. Berdasarkan effect size, aspek hakikat sains yang berkontribusi tinggi adalah metode ilmiah, empiris, inferensi, dimensi sosial sains, dan penerapan sains dalam bidang sosbud. Aspek hakikat sains yang berkontribusi sedang adalah tentatif, kreatif, dan theory driven. Sedangkan hukum dan teori berkontribusi kecil. Kata kunci: Learning Cycle-5E , Socioscientific Issues, Hakikat Sains, Larutan Penyangga, Hidrolisis Garam
SKI's and SSI's joint review of SKB's safety assessment report, SR 97. Summary
International Nuclear Information System (INIS)
2001-01-01
The Swedish Nuclear Fuel and Waste Management Co (SKB) has a programme for the siting of a repository for spent nuclear fuel in Swedish bedrock. In 1996, the Swedish Government decided that SKB must perform an assessment of the repository's long-term safety before undertaking the next step of the programme which entails drilling in a minimum of two municipalities (site investigations). SKB has presented such a safety assessment in SR 97 Post-closure Safety (henceforth referred to as SR 97). SR 97 is one of the documents in the comprehensive reporting that SKB must provide when it proposes sites for investigation. The Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Institute (SSI) have evaluated SR 97 in terms of its purposes which are to demonstrate a methodology for safety assessment, to show that Swedish bedrock can provide a safe repository using SKB's method, to provide a basis for specifying the factors that are important for site selection and to derive preliminary requirements on the function of the engineered barriers. The authorities have reached the following conclusions: SR 97 does not indicate any conditions that would mean that geological final disposal in accordance with SKB's method would have significant deficiencies in relation to the safety and radiation protection requirements of the authorities. SR 97 contains the elements required for a comprehensive assessment of safety and radiation protection. SKB's safety assessment methodology has improved within several important areas, such as the documentation of processes and properties that can affect repository performance and the development of models for safety assessment calculations. The methodology used in SR 97 has some deficiencies, for example, the specification of future events to be described in the safety assessment. SR 97 has not, to an adequate extent, dealt with unfavourable conditions that can affect the future safety of a repository. SKB states that the
Energy Technology Data Exchange (ETDEWEB)
Cederlund, Torsten; Finck, Robert; Mjoenes, Lars; Moberg, Leif; Soederman, Ann-Louis; Wiklund, Aasa; Yuen Katarina; Oelander Guer, Hanna
2004-09-01
The Swedish Government has requested the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures.
Energy Technology Data Exchange (ETDEWEB)
Hyrke, Lena; Almen, Anja; Blixt, Anders; Brewitz, Erica; Mjoenes, Lars; Moberg, Leif; Skeppstroem, Kirlna; Wester, Ulf
2008-04-15
The Swedish Government has requested that the Swedish Radiation Protection Authority (SSI) to make an account of the authority's role in the field of public health. Radiation Protection consists largely of preventive actions in order to protect man and the environment against harmful effects of radiation. The SSI thus considers most of the authority's activities to be public health related. The report describes a number of radiation protection areas from a health perspective. The measures taken by the authority in these areas are also described along with planned activities. In some areas the authority also points out additional measures
International Nuclear Information System (INIS)
Papakonstantinou, P.; Wambach, J.; Kosmas, T.S.; Faessler, A.
2006-01-01
The incoherent transition strength of the exotic μ - -e - conversion in the 208 Pb nucleus is investigated by utilizing the continuum random-phase-approximation method, appropriate for the evaluation of the rate that goes to the continuum of the nuclear spectrum. We find that the contribution of resonances lying high in the continuum is not negligible. Special attention is paid to the detailed study of the pronounced 1 - contribution that according to previous calculations, dominates the overall incoherent rate in about all the nuclear targets. The spurious center-of-mass admixture to the partial rate originating from the 1 - excitations is explored, and its elimination is performed by correcting properly the dipole operators. The results found this way show that the greatest portion of the total 1 - contribution to the incoherent rate is spurious
Lindgren, Line M; Tingskov, Pernille N; Justesen, Annette H; Nedergaard, Bettina S; Olsen, Klaus J; Andreasen, Lars V; Kromann, Ingrid; Sørensen, Charlotte; Dietrich, Jes; Thierry-Carstensen, Birgit
2017-01-23
There is a demand of affordable IPV in the World. Statens Serum Institut (SSI) has developed three reduced dose IPV formulations adsorbed to aluminium hydroxide; 1/3 IPV-Al, 1/5 IPV-Al and 1/10 IPV-Al SSI, and now report the results of the first investigations in humans. 240 Danish adolescents, aged 10-15years, and childhood vaccinated with IPV were booster vaccinated with 1/3 IPV-Al, 1/5 IPV-Al, 1/10 IPV-Al or IPV Vaccine SSI. The booster effects (GMTRs) of the three IPV-Al SSI were compared to IPV Vaccine SSI, and evaluated for non-inferiority. The pre-vaccination GMTs were similar across the groups; 926 (type 1), 969 (type 2) and 846 (type 3) in the total trial population. The GMTRs by poliovirus type and IPV formulation were: Type 1: 17.0 (1/3 IPV-Al), 13.0 (1/5 IPV-Al), 7.1 (1/10 IPV-Al) and 42.2 (IPV Vaccine SSI). Type 2: 12.5 (1/3 IPV-Al), 13.1 (1/5 IPV-Al), 7.6 (1/10 IPV-Al) and 47.8 (IPV Vaccine SSI). Type 3: 14.5 (1/3 IPV-Al), 16.2 (1/5 IPV-Al), 8.9 (1/10 IPV-Al) and 62.4 (IPV Vaccine SSI) Thus, the three IPV-Al formulations were highly immunogenic, but inferior to IPV Vaccine SSI, in this booster vaccination trial. No SAE and no AE of severe intensity occurred. 59.2% of the subjects reported at least one AE. Injection site pain was the most frequent AE in all groups; from 24.6% to 43.3%. Injection site redness and swelling frequencies were<5% in most and<10% in all groups. The most frequent systemic AEs were fatigue (from 8.2% to 15.0%) and headache (from 15.0% to 28.3%). Most AEs were of mild intensity. In conclusion, the three IPV-Al SSI were safe in adolescents and the booster effects were satisfactory. ClinicalTrials.gov registration number: NCT02280447. Copyright © 2016. Published by Elsevier Ltd.
Quantum imaging with incoherently scattered light from a free-electron laser
Schneider, Raimund; Mehringer, Thomas; Mercurio, Giuseppe; Wenthaus, Lukas; Classen, Anton; Brenner, Günter; Gorobtsov, Oleg; Benz, Adrian; Bhatti, Daniel; Bocklage, Lars; Fischer, Birgit; Lazarev, Sergey; Obukhov, Yuri; Schlage, Kai; Skopintsev, Petr; Wagner, Jochen; Waldmann, Felix; Willing, Svenja; Zaluzhnyy, Ivan; Wurth, Wilfried; Vartanyants, Ivan A.; Röhlsberger, Ralf; von Zanthier, Joachim
2018-02-01
The advent of accelerator-driven free-electron lasers (FEL) has opened new avenues for high-resolution structure determination via diffraction methods that go far beyond conventional X-ray crystallography methods. These techniques rely on coherent scattering processes that require the maintenance of first-order coherence of the radiation field throughout the imaging procedure. Here we show that higher-order degrees of coherence, displayed in the intensity correlations of incoherently scattered X-rays from an FEL, can be used to image two-dimensional objects with a spatial resolution close to or even below the Abbe limit. This constitutes a new approach towards structure determination based on incoherent processes, including fluorescence emission or wavefront distortions, generally considered detrimental for imaging applications. Our method is an extension of the landmark intensity correlation measurements of Hanbury Brown and Twiss to higher than second order, paving the way towards determination of structure and dynamics of matter in regimes where coherent imaging methods have intrinsic limitations.
ARTIFICIAL INCOHERENT SPECKLES ENABLE PRECISION ASTROMETRY AND PHOTOMETRY IN HIGH-CONTRAST IMAGING
Energy Technology Data Exchange (ETDEWEB)
Jovanovic, N.; Guyon, O.; Pathak, P.; Kudo, T. [National Astronomical Observatory of Japan, Subaru Telescope, 650 North A’Ohoku Place, Hilo, HI, 96720 (United States); Martinache, F. [Observatoire de la Cote d’Azur, Boulevard de l’Observatoire, F-06304 Nice (France); Hagelberg, J., E-mail: jovanovic.nem@gmail.com [Institute for Astronomy, University of Hawaii, 2680 Woodlawn Drive, Honolulu, HI 96822 (United States)
2015-11-10
State-of-the-art coronagraphs employed on extreme adaptive optics enabled instruments are constantly improving the contrast detection limit for companions at ever-closer separations from the host star. In order to constrain their properties and, ultimately, compositions, it is important to precisely determine orbital parameters and contrasts with respect to the stars they orbit. This can be difficult in the post-coronagraphic image plane, as by definition the central star has been occulted by the coronagraph. We demonstrate the flexibility of utilizing the deformable mirror in the adaptive optics system of the Subaru Coronagraphic Extreme Adaptive Optics system to generate a field of speckles for the purposes of calibration. Speckles can be placed up to 22.5 λ/D from the star, with any position angle, brightness, and abundance required. Most importantly, we show that a fast modulation of the added speckle phase, between 0 and π, during a long science integration renders these speckles effectively incoherent with the underlying halo. We quantitatively show for the first time that this incoherence, in turn, increases the robustness and stability of the adaptive speckles, which will improve the precision of astrometric and photometric calibration procedures. This technique will be valuable for high-contrast imaging observations with imagers and integral field spectrographs alike.
Ground clutter cancellation in incoherent radars: solutions for EISCAT Svalbard radar
Directory of Open Access Journals (Sweden)
T. Turunen
2000-09-01
Full Text Available Incoherent scatter radars measure ionosphere parameters using modified Thomson scatter from free electrons in the target (see e.g. Hagfors, 1997. The integrated cross section of the ionospheric scatterers is extremely small and the measurements can easily be disturbed by signals returned by unwanted targets. Ground clutter signals, entering via the antenna side lobes, can render measurements at the nearest target ranges totally impossible. The EISCAT Svalbard Radar (ESR, which started measurements in 1996, suffers from severe ground clutter and the ionosphere cannot be measured in any simple manner at ranges less than about 120–150 km, depending on the modulation employed. If the target and clutter signals have different, and clearly identifiable, properties then, in principle, there are always ways to eliminate the clutter. In incoherent scatter measurements, differences in the coherence times of the wanted and unwanted signals can be used for clutter cancellation. The clutter cancellation must be applied to all modulations, usually alternating codes in modern experiments, used for shorter ranges. Excellent results have been obtained at the ESR using a simple pulse-to-pulse clutter subtraction method, but there are also other possibilities.Key words: Radio science (ionospheric physics; signal processing; instruments and techniques
Direct, coherent and incoherent intermediate state tunneling and scanning tunnel microscopy (STM)
International Nuclear Information System (INIS)
Halbritter, J.
1997-01-01
Theory and experiment in tunneling are still qualitative in nature, which hold true also for the latest developments in direct-, resonant-, coherent- and incoherent-tunneling. Those tunnel processes have recently branched out of the field of ''solid state tunnel junctions'' into the fields of scanning tunnel microscopy (STM), single electron tunneling (SET) and semiconducting resonant tunnel structures (RTS). All these fields have promoted the understanding of tunneling in different ways reaching from the effect of coherence, of incoherence and of charging in tunneling, to spin flip or inelastic effects. STM allows not only the accurate measurements of the tunnel current and its voltage dependence but, more importantly, the easy quantification via the (quantum) tunnel channel conductance and the distance dependence. This new degree of freedom entering exponentially the tunnel current allows an unique identification of individual tunnel channels and their quantification. In STM measurements large tunnel currents are observed for large distances d > 1 nm explainable by intermediate state tunneling. Direct tunneling with its reduced tunnel time and reduced off-site Coulomb charging bridges distances below 1 nm, only. The effective charge transfer process with its larger off-site and on-site charging at intermediate states dominates tunnel transfer in STM, biology and chemistry over distances in the nm-range. Intermediates state tunneling becomes variable range hopping conduction for distances larger than d > 2 nm, for larger densities of intermediate states n 1 (ε) and for larger temperatures T or voltages U, still allowing high resolution imaging
Loss of incoherence and determination of coupling constants in quantum gravity
International Nuclear Information System (INIS)
Giddings, S.B.; Strominger, A.
1988-01-01
The wave function of an interacting 'family' of one large 'parent' and many Planck-sized 'baby' universes is computed in a semiclassical approximation using an adaptation of Hartle-Hawking initial conditions. A recently discovered gravitational instanton which exists for general relativity coupled to axions is employed. The outcome of a single experiment in the parent universe is in general described by a mixed state, even if the initial state is pure. However, a sequence of measurements rapidly collapses the wave function of the family of universes into one of an infinite number of 'coherent' states for which quantum incoherence is not observed in the parent universe. This provides a concrete illustration of an unexpected phenomena whose existence has been argued for on quite general grounds by Coleman: Quantum incoherence due to information loss to baby universes is not experimentally observable. We further argue that all coupling constants governing dynamics in the parent universe depend on the parameters describing the particular coherent state into which the family wave function collapses. In particular, generically terms that violate any global symmetries will be induced in the effective action for the parent universe. These last results have much broader applicability than our specific model. (orig.)
Structure and motion of junctions between coherent and incoherent twin boundaries in copper
Energy Technology Data Exchange (ETDEWEB)
Brown, J.A. [Mechanical and Aerospace Engineering, University of California, Los Angeles, CA 90095 (United States); Ghoniem, N.M., E-mail: ghoniem@ucla.edu [Mechanical and Aerospace Engineering, University of California, Los Angeles, CA 90095 (United States)
2009-09-15
The atomic mechanisms of twin boundary migration in copper under externally applied mechanical loads and during thermal annealing are investigated utilizing molecular dynamics computer simulations. The migration dynamics of the incoherent {Sigma}=3[110](112) twin boundary (ITB), pinned between two {Sigma}=3[110](111) twin boundaries, is determined. A three-dimensional structural model is described for the junction between intersecting coherent and incoherent twin boundaries, and migration velocities are calculated under thermal annealing conditions. It is shown that the coherent twin boundary (CTB)/ITB junction results in breaking the crystal symmetry by creation of either an edge dislocation or a mixed (edge/screw) at the intersection. These two types of defects can lead to pronounced differences in the observed migration (and hence annealing) rates of ICT/CTB junctions. The annealing rate resulting from the migration of ITBs with a mixed dislocation is found to be more than twice that of the edge dislocation. The mechanism of ITB motion is shown to be governed by successive kink-like motion of neighboring atomic columns, each of which is shifted by 1/4[1 1 0], followed by structural relaxation to accommodate boundary motion.
Structure and motion of junctions between coherent and incoherent twin boundaries in copper
International Nuclear Information System (INIS)
Brown, J.A.; Ghoniem, N.M.
2009-01-01
The atomic mechanisms of twin boundary migration in copper under externally applied mechanical loads and during thermal annealing are investigated utilizing molecular dynamics computer simulations. The migration dynamics of the incoherent Σ=3[110](112) twin boundary (ITB), pinned between two Σ=3[110](111) twin boundaries, is determined. A three-dimensional structural model is described for the junction between intersecting coherent and incoherent twin boundaries, and migration velocities are calculated under thermal annealing conditions. It is shown that the coherent twin boundary (CTB)/ITB junction results in breaking the crystal symmetry by creation of either an edge dislocation or a mixed (edge/screw) at the intersection. These two types of defects can lead to pronounced differences in the observed migration (and hence annealing) rates of ICT/CTB junctions. The annealing rate resulting from the migration of ITBs with a mixed dislocation is found to be more than twice that of the edge dislocation. The mechanism of ITB motion is shown to be governed by successive kink-like motion of neighboring atomic columns, each of which is shifted by 1/4[1 1 0], followed by structural relaxation to accommodate boundary motion.
International Nuclear Information System (INIS)
Zhao Mao-Rong; Wu Zheng-Mao; Deng Tao; Zhou Zhen-Li; Xia Guang-Qiong
2015-01-01
Based on a semiconductor laser (SL) with incoherent optical feedback, a novel all-optical scheme for generating tunable and broadband microwave frequency combs (MFCs) is proposed and investigated numerically. The results show that, under suitable operation parameters, the SL with incoherent optical feedback can be driven to operate at a regular pulsing state, and the generated MFCs have bandwidths broader than 40 GHz within a 10 dB amplitude variation. For a fixed bias current, the line spacing (or repetition frequency) of the MFCs can be easily tuned by varying the feedback delay time and the feedback strength, and the tuning range of the line spacing increases with the increase in the bias current. The linewidth of the MFCs is sensitive to the variation of the feedback delay time and the feedback strength, and a linewidth of tens of KHz can be achieved through finely adjusting the feedback delay time and the feedback strength. In addition, mappings of amplitude variation, repetition frequency, and linewidth of MFCs in the parameter space of the feedback delay time and the feedback strength are presented. (paper)
Lee, Lindsay; Mann, Graham; Carslaw, Ken; Toohey, Matthew; Aquila, Valentina
2016-04-01
The World Climate Research Program's SPARC initiative has a new international activity "Stratospheric Sulphur and its Role in Climate" (SSiRC) to better understand changes in stratospheric aerosol and precursor gaseous sulphur species. One component of SSiRC involves an intercomparison "ISA-MIP" of composition-climate models that simulate the stratospheric aerosol layer interactively. Within PoEMS each modelling group will run a "perturbed physics ensemble" (PPE) of interactive stratospheric aerosol (ISA) simulations of the Pinatubo eruption, varying several uncertain parameters associated with the eruption's SO2 emissions and model processes. A powerful new technique to quantify and attribute sources of uncertainty in complex global models is described by Lee et al. (2011, ACP). The analysis uses Gaussian emulation to derive a probability density function (pdf) of predicted quantities, essentially interpolating the PPE results in multi-dimensional parameter space. Once trained on the ensemble, a Monte Carlo simulation with the fast Gaussian emulator enabling a full variance-based sensitivity analysis. The approach has already been used effectively by Carslaw et al., (2013, Nature) to quantify the uncertainty in the cloud albedo effect forcing from a 3D global aerosol-microphysics model allowing to compare the sensitivy of different predicted quantities to uncertainties in natural and anthropogenic emissions types, and structural parameters in the models. Within ISA-MIP, each group will carry out a PPE of runs, with the subsequent analysis with the emulator assessing the uncertainty in the volcanic forcings predicted by each model. In this poster presentation we will give an outline of the "PoEMS" analysis, describing the uncertain parameters to be varied and the relevance to further understanding differences identified in previous international stratospheric aerosol assessments.
Karimi, Hamid; Nilipour, Reza; Shafiei, Bijan; Howell, Peter
2011-01-01
Bakhtiar, Seifpanahi, Ansari, Ghanadzade and Packman (2010) reported high inter-, and intra-judge agreement of a translation of the Stuttering Severity Instrument (SSI-3) for preschool Persian-speaking children who stutter. Translation of SSI-3 into Persian is desirable as there is no standardised stuttering severity test for that language.…
International Nuclear Information System (INIS)
Liu, Zhaohong; Liu, Simin; Guo, Ru; Song, Tao; Zhu, Nan
2007-01-01
We study experimentally the interaction of a dark spot with a nonlinear photonic lattice with fully incoherent white light emitted from an incandescent bulb in the self-defocussing photovoltaic media when the dark spot is aimed at different positions of lattices with different lattice spacing. In this case a host of novel phenomena is demonstrated, including dark spot induced lattice dislocation-deformation, the annihilation of the dark spot and so on. Results demonstrate that the interaction between incoherent dark spot and photonic lattice is always attraction and the large-spacing photonic lattice is analogous to the continuous medium
DEFF Research Database (Denmark)
Company Torres, Victor; Tafur Monroy, Idelfonso; Lancis, Jesus
2008-01-01
We present a proof-of-principle experiment for achieving simultaneous distribution of baseband radio-frequency data and up-conversion with broadcasting support over a passive optical network. The technique is based on an incoherent frequency-to-time mapping method for pulse shaping. Specifically...... resembles the shape of the incoherent source. The photodetected signal contains both the baseband data and an up-frequency converted copy with central wavelength for the microwave carrier into the ultra-wideband range and tuning capability by selection of the fiber length. (c) 2008 Elsevier B.V. All rights...
Energy Technology Data Exchange (ETDEWEB)
Acharya, V B; Ghumman, B S [Punjabi Univ., Patiala (India). Dept. of Physics
1980-06-01
Differential cross-sections for incoherent scattering of 145 keV photons from K-shell electrons of tin, silver and molybdenum have been measured at 110deg to investigate the effect of electron binding on differential cross-sections in the low energy region. The incoherent scattered photons are selected in coincidence with X-rays which follow the vacancies caused by the ejection of the electrons. NaI(Tl) scintillators are used for the detection of scattered photons and emitted X-rays. The experimental results are compared with the available theoretical data.
International Nuclear Information System (INIS)
Hossein Asadpour, Seyyed; Solookinejad, G; Panahi, M; Ahmadi Sangachin, E
2016-01-01
Role of Fano interference and incoherent pumping field on optical bistability in a four-level designed InGaN/GaN quantum dot nanostructure embedded in a unidirectional ring cavity are analyzed. It is found that intensity threshold of optical bistability can be manipulated by Fano interference. It is shown that incoherent pumping fields make the threshold of optical bistability behave differently by Fano interference. Moreover, in the presence of Fano interference the medium becomes phase-dependent. Therefore, the relative phase of applied fields can affect the behaviors of optical bistability and intensity threshold can be controlled easily. (paper)
Ying, M L; Xiao, W W; Xu, S L; Shu, J E; Pan, J F; Fu, J F; Lu, J H; Pan, Y H; Jiang, Y
2016-11-20
Objective: To investigate the value of intravoxel incoherent motion diffusion-weighted imaging (IVIM-DWI) in the differential diagnosis and blood perfusion evaluation of benign and malignant hepatic lesions. Methods: A retrospective analysis was performed for 86 patients (96 lesions) with pathologically or clinically confirmed hepatic lesions or hepatic lesions diagnosed based on follow-up results, among whom 48 had malignant lesions (53 lesions) and 38 had benign lesions (43 lesions). The patients underwent conventional magnetic resonance (MR) plain scan, contrast-enhanced scan, and diffusion-weighted imaging (DWI) with different b values (b = 0, 50, 100, 150, 200, 400, 600, 800, 1 000, and 1 200 s/mm 2 ) to determine the parameters of the double exponential model for intravoxel incoherent motion (IVIM): fast diffusion coefficient Dfast, slow diffusion coefficient Dslow, and percentage of fast-diffusion constituent F value. The patients were divided into groups according to the blood supply to lesions on conventional MR plain scan and contrast-enhanced scan, and there were 47 lesions in abundant blood supply group and 49 in poor blood supply group. The data for analysis were Dfast, Dslow, and F values of benign/malignant lesion groups and abundant/poor blood supply groups. The independent samples t-test was used for statistical analysis; the independent samples non-parametric test Mann-Whitney U test was used for the comparison of F value; the receiver operating characteristic (ROC) curve was used to evaluate the value of above parameters in the differentiation of benign and malignant lesions and blood supply evaluation. Results: Compared with the malignant lesion group, the benign lesion group had significantly higher Dslow, and F values ( P benign and malignant hepatic lesions, and F value can show blood perfusion in benign and malignant hepatic lesions without the need for contrast-enhanced scan, which provides a reference for the qualitative diagnosis of liver
International Nuclear Information System (INIS)
Arias Avendano, Fabio Andres
2008-01-01
The procedure to capture spectra of incoherent optical radiation for the Laboratorio de Fotonica y Tecnologia Laser Aplicada (LAFTLA), of the Escuela de Ingenieria Electrica de la Universidad de Costa Rica is developed through the use of a spectrometer brand Spectral Products. The thorough understanding of manuals spectrometer brand Spectral Products was necessary for the satisfactory development of the project. Spectrometer and the card National Instruments are installed and run both devices with a montage of suitable laboratory. Two catches of spectrum for two different sources of optical radiation are performanced, since damages to the files .ddl precluded that the SM 240 spectrometer worked properly to take more catches to other sources of optical radiation. A final report containing the two catches is produced with the respective analysis. (author) [es
International Nuclear Information System (INIS)
Bengtson, P.; Larsson, C.M.; Simenstad, P.; Suomela, J.
1995-09-01
Marine samples from the vicinity of the plants show elevated radionuclide concentrations, caused by discharges from the plants. Very low concentrations are noted in terrestrial samples. At several locations, the effects of the Chernobyl disaster still dominates. Control samples measured by SSI have confirmed the measurements performed by the operators. 8 refs, 6 tabs, 46 figs
DEFF Research Database (Denmark)
Birk, Nina Marie; Nissen, Thomas Nørrelykke; Ladekarl, Monica
2017-01-01
BACKGROUND: The Bacillus Calmette-Guérin vaccine (BCG) against tuberculosis is administered intradermally, and vaccination is often followed by a scar at the injection site. Among BCG-vaccinated individuals, having a scar has been associated with lower mortality. We aimed to examine the impact...... of vaccination technique for scarring in a high income setting, by assessing the associations between the post injection reaction, the wheal size, and the probability of developing a scar, and scar size. METHODS: This study was nested within a clinical multicenter study randomizing 4262 infants to either BCG...... vaccination (BCG 1331 SSI) or no intervention. In this substudy, including 492 vaccinated infants, the immediate post BCG vaccination reaction was registered as either wheal (a raised, blanched papule at the injection site), bulge (a palpable element at the injection site), or no reaction. The presence...
Energy Technology Data Exchange (ETDEWEB)
Xu, Xiao Quan [Department of Radiology and Research Institute of Radiology, University of Ulsan College of Medicine, Asan Medical Center, Seoul 05505 (Korea, Republic of); Department of Radiology, The First Affiliated Hospital of Nanjing Medical University, Nanjing 210029 (China); Choi, Young Jun; Sung, Yu Sub [Department of Radiology and Research Institute of Radiology, University of Ulsan College of Medicine, Asan Medical Center, Seoul 05505 (Korea, Republic of); Yoon, Ra Gyoung [Department of Radiology, Catholic Kwandong University International St. Mary' s Hospital, Catholic Kwandong University College of Medicine, Incheon 22711 (Korea, Republic of); Jang, Seung Won; Park, Ji Eun [Department of Radiology and Research Institute of Radiology, University of Ulsan College of Medicine, Asan Medical Center, Seoul 05505 (Korea, Republic of); Heo, Young Jin [Department of Radiology and Research Institute of Radiology, University of Ulsan College of Medicine, Asan Medical Center, Seoul 05505 (Korea, Republic of); Department of Radiology, Busan Paik Hospital, Inje University College of Medicine, Busan 47392 (Korea, Republic of); Baek, Jung Hwan; Lee, Jeong Hyun [Department of Radiology and Research Institute of Radiology, University of Ulsan College of Medicine, Asan Medical Center, Seoul 05505 (Korea, Republic of)
2016-11-01
To investigate the correlation between perfusion- and diffusion-related parameters from intravoxel incoherent motion (IVIM) and those from dynamic contrast-enhanced MR imaging (DCE-MRI) and diffusion-weighted imaging in tumors and normal muscles of the head and neck. We retrospectively enrolled 20 consecutive patients with head and neck tumors with MR imaging performed using a 3T MR scanner. Tissue diffusivity (D), pseudo-diffusion coefficient (D{sup *}), and perfusion fraction (f) were derived from bi-exponential fitting of IVIM data obtained with 14 different b-values in three orthogonal directions. We investigated the correlation between D, f, and D{sup *} and model-free parameters from the DCE-MRI (wash-in, T{sub max}, E{sub max}, initial AUC{sub 60}, whole AUC) and the apparent diffusion coefficient (ADC) value in the tumor and normal masseter muscle using a whole volume-of-interest approach. Pearson's correlation test was used for statistical analysis. No correlation was found between f or D{sup *} and any of the parameters from the DCE-MRI in all patients or in patients with squamous cell carcinoma (p > 0.05). The ADC was significantly correlated with D values in the tumors (p < 0.001, r = 0.980) and muscles (p = 0.013, r = 0.542), despite its significantly higher value than D. The difference between ADC and D showed significant correlation with f values in the tumors (p = 0.017, r = 0.528) and muscles (p = 0.003, r = 0.630), but no correlation with D{sup *} (p > 0.05, respectively). Intravoxel incoherent motion shows no significant correlation with model-free perfusion parameters derived from the DCE-MRI but is feasible for the analysis of diffusivity in both tumors and normal muscles of the head and neck.
Xu, Xiao Quan; Choi, Young Jun; Sung, Yu Sub; Yoon, Ra Gyoung; Jang, Seung Won; Park, Ji Eun; Heo, Young Jin; Baek, Jung Hwan; Lee, Jeong Hyun
2016-01-01
To investigate the correlation between perfusion- and diffusion-related parameters from intravoxel incoherent motion (IVIM) and those from dynamic contrast-enhanced MR imaging (DCE-MRI) and diffusion-weighted imaging in tumors and normal muscles of the head and neck. We retrospectively enrolled 20 consecutive patients with head and neck tumors with MR imaging performed using a 3T MR scanner. Tissue diffusivity (D), pseudo-diffusion coefficient (D(*)), and perfusion fraction (f) were derived from bi-exponential fitting of IVIM data obtained with 14 different b-values in three orthogonal directions. We investigated the correlation between D, f, and D(*) and model-free parameters from the DCE-MRI (wash-in, Tmax, Emax, initial AUC60, whole AUC) and the apparent diffusion coefficient (ADC) value in the tumor and normal masseter muscle using a whole volume-of-interest approach. Pearson's correlation test was used for statistical analysis. No correlation was found between f or D(*) and any of the parameters from the DCE-MRI in all patients or in patients with squamous cell carcinoma (p > 0.05). The ADC was significantly correlated with D values in the tumors (p correlation with f values in the tumors (p = 0.017, r = 0.528) and muscles (p = 0.003, r = 0.630), but no correlation with D(*) (p > 0.05, respectively). Intravoxel incoherent motion shows no significant correlation with model-free perfusion parameters derived from the DCE-MRI but is feasible for the analysis of diffusivity in both tumors and normal muscles of the head and neck.
1985-12-01
Incoherent *scatter observations and their interpretation, 3. Atmos. Tarr. Phys., 34, 351-364, 1972. Bohnk&,R., and Harper,R., Vector measurements of F...equatorial F-region, 3. Atmos. Terr. Phys., 39, 1159-1168, 1977. Rishbeth, H., Ganguly,S., Walker,3.C., Feild -aligned and field-perpendicular velocities
Knoester, J.; Himbergen, J.E. Van
1984-01-01
In this paper we consider a system of identical, randomly distributed donors, between which incoherent energy transfer takes place, described by coupled rate equations. It is proved, that the well-known diagrammatic series expansion of Gochanour, Andersen, and Fayer for the self-energy, while not an
International Nuclear Information System (INIS)
Cvikl, B.; Dahlborg, U.; Calvo-Dahlborg, M.
1999-01-01
Based upon the model of particles diffusion within the sphere of partially absorbing boundaries, the possibilities of the detection, by the incoherent cold neutron scattering method, of particle precipitation on the boundary walls, has been investigated. The calculated scattering law as a function of the boundary absorption properties exhibits distinct characteristic which might, under favorable conditions, make such an experimental attempt feasible.(author)
DEFF Research Database (Denmark)
Konakli, Katerina; Der Kiureghian, Armen
2012-01-01
A method is presented for simulating arrays of spatially varying ground motions, incorporating the effects of incoherence, wave passage, and differential site response. Non‐stationarity is accounted for by considering the motions as consisting of stationary segments. Two approaches are developed....
International Nuclear Information System (INIS)
Benson, R.F.; Bauer, P.; Brace, L.H.; Carlson, H.C.; Hagen, J.; Hanson, W.B.; Hoegy, W.R.; Torr, M.R.; Wickwar, V.B.
1977-01-01
The Atmosphere Exploere-C satellite (AE-C) is uniquely suited for correlative studies with ground-based stations because its on-board propulsion system enables a desired ground station overflight condition to be maintained for a period of several weeks. It also provides the first low-altitude (below 260 km) comparison of satellite and incoherent scatter electron and ion temperatures. More than 40 comparisons of remote and in situ measurements were made by using data from AE-C and four incoherent scatter stations (Arecibo, Chatanika, Millstone Hill, and St. Santin). The results indicate very good agreement between satellite and ground measurements of the ion temperature, the average satellite retarding potential analyzer temperatures differing from the average incoherent scatter temperatures by -2% at St. Santin, +3% at Millstone Hill, and +2% at Arecibo. The electron temperatures also agree well, the average satellite temperatures exceeding the average incoherent scatter temperatures by 3% at St. Santin, 2% at Arecibo, and 11% at Millstone Hill. Several temperature comparisons were made between AE-C and Chatanika. In spite of the highly variable ionosphere often encountered at this high-latitude location, good agreement was obtained between the in situ and remote measurements of electron and ion temperatures. Longitudinal variations are found to be very important in the comparisons of electron temperature in some locations. The agreement between the electron temperatures is considerably better than that found in some earlier comparisons involving satellities at higher altitudes
A compact new incoherent Thomson scattering diagnostic for low-temperature plasma studies
Vincent, Benjamin; Tsikata, Sedina; Mazouffre, Stéphane; Minea, Tiberiu; Fils, Jérôme
2018-05-01
Incoherent Thomson scattering (ITS) has a long history of application for the determination of electron density and temperature in dense fusion plasmas, and in recent years, has been increasingly extended to studies in low-temperature plasma environments. In this work, the design and preliminary implementation of a new, sensitive and uniquely compact ITS platform known as Thomson scattering experiments for low temperature ion sources are described. Measurements have been performed on a hollow cathode plasma source, providing access to electron densities as low as 1016 m‑3 and electron temperatures of a few eV and below. This achievement has been made possible by the implementation of a narrow volume Bragg grating notch filter for the attenuation of stray light, a feature which guarantees compactness and reduced transmission losses in comparison to standard ITS platforms.
Ray-optics cloaking devices for large objects in incoherent natural light
Chen, Hongsheng; Zheng, Bin; Shen, Lian; Wang, Huaping; Zhang, Xianmin; Zheludev, Nikolay I.; Zhang, Baile
2013-10-01
A cloak that can hide living creatures from sight is a common feature of mythology but still remains unrealized as a practical device. To preserve the wave phase, the previous cloaking solution proposed by Pendry and colleagues required transformation of the electromagnetic space around the hidden object in such a way that the rays bending around the object inside the cloak region have to travel faster than those passing it by. This difficult phase preservation requirement is the main obstacle for building a broadband polarization-insensitive cloak for large objects. Here we propose a simplified version of Pendry’s cloak by abolishing the requirement for phase preservation, as it is irrelevant for observation using incoherent natural light with human eyes, which are phase and polarization insensitive. This allows for a cloak design on large scales using commonly available materials. We successfully demonstrate the cloaking of living creatures, a cat and a fish, from the eye.
Collective dynamics of populations of weakly correlated filaments of incoherent white light
International Nuclear Information System (INIS)
Guo, Jinxin; Sheridan, John T; Saravanamuttu, Kalaichelvi
2013-01-01
We examined the dynamics of two populations of self-trapped filaments of spatially and temporally incoherent white light. The populations consisted of (i) independent filaments generated through self-trapping of incandescent speckles, and (ii) co-dependent filaments created through modulation instability of a broad incandescent beam. Both filament populations were positionally stable in conditions where individual pairs of self-trapped beams interact strongly. Both also acquired significantly broad intensity distributions, which were independent of their parent optical fields; a small but persistent number of high-intensity filaments was identified in both cases. These studies provide accessible routes to weakly correlated ensembles, insight into their collective behaviour such as self-stabilization and self-selected intensity distributions, and reveal intriguing similarities between the dynamics of two populations of different origins. (paper)
Incoherent dictionary learning for reducing crosstalk noise in least-squares reverse time migration
Wu, Juan; Bai, Min
2018-05-01
We propose to apply a novel incoherent dictionary learning (IDL) algorithm for regularizing the least-squares inversion in seismic imaging. The IDL is proposed to overcome the drawback of traditional dictionary learning algorithm in losing partial texture information. Firstly, the noisy image is divided into overlapped image patches, and some random patches are extracted for dictionary learning. Then, we apply the IDL technology to minimize the coherency between atoms during dictionary learning. Finally, the sparse representation problem is solved by a sparse coding algorithm, and image is restored by those sparse coefficients. By reducing the correlation among atoms, it is possible to preserve most of the small-scale features in the image while removing much of the long-wavelength noise. The application of the IDL method to regularization of seismic images from least-squares reverse time migration shows successful performance.
International Nuclear Information System (INIS)
Basnarkov, Lasko; Urumov, Viktor
2009-01-01
We consider an analytically solvable version of the Winfree model of synchronization of phase oscillators (proposed by Ariaratnam and Strogatz 2001 Phys. Rev. Lett. 86 4278). It is obtained that the transition from incoherence to a partial death state is characterized by third-order or higher phase transitions according to the Ehrenfest classification. The order of the transition depends on the shape of the distribution function for natural frequencies of oscillators in the vicinity of their lowest frequency. The corresponding critical exponents are found analytically and verified with numerical simulations of equations of motion. We also consider the generalized Winfree model with the interaction strength proportional to a power of the Kuramoto order parameter and find the domain where the critical exponent remains unchanged by this modification
International Nuclear Information System (INIS)
Bjoernaa, N.; Havnes, O.; Jensen, J.O.; Trulsen, J.
1982-01-01
Precipitating protons in the energy range 1-100 keV are regularly present in the auroral ionosphere. These protons will produce enhancements in the intensity of the upshifted plasma line of the incoherently scattered spectrum. Similarly, secondary electrons produced by the precipitating protons give rise to enhanced plasma line intensities. For a quantitative discussion of these effects an experimentally measured proton flux is adapted and the corresponding secondary electron flux calculated. These particle fluxes are then applied in connection with the EISCAT radar facility. Both fluxes give rise to enhancements of the order of 20. It is possible to separate between proton and electron contributions to the enhanced plasma lines for scattering heights above the source region of secondary electrons. (Auth.)
Incoherent-scatter radar measurements of electric field and plasma in the auroral ionosphere
International Nuclear Information System (INIS)
Vondrak, R.
1983-01-01
This chapter summarizes Chatanika radar measurements of electric fields and currents, and their relation to E-region ionization and conductivity. Electric-field coupling between the ionosphere and magnetosphere and the relationship between field-aligned currents and meridional ionospheric currents are examined. Topics considered include the diurnal pattern of the ionization and electric field; electrical coupling between the ionosphere and magnetosphere; and the relationship between meridional currents and field-aligned currents. It is concluded that the incoherent-scatter radar technique has been developed into a powerful method for remotely measuring the electrical and thermal properties of the auroral ionospheric plasma, and that the usefulness of the radar measurements is greatly enhanced when combined with simultaneous satellite measurements
Mank, Nils N; Berghoff, Bork A; Klug, Gabriele
2013-03-01
Living cells use a variety of regulatory network motifs for accurate gene expression in response to changes in their environment or during differentiation processes. In Rhodobacter sphaeroides, a complex regulatory network controls expression of photosynthesis genes to guarantee optimal energy supply on one hand and to avoid photooxidative stress on the other hand. Recently, we identified a mixed incoherent feed-forward loop comprising the transcription factor PrrA, the sRNA PcrZ and photosynthesis target genes as part of this regulatory network. This point-of-view provides a comparison to other described feed-forward loops and discusses the physiological relevance of PcrZ in more detail.
Annealing characteristics of SiO2-Si structures after incoherent light pulse processing
International Nuclear Information System (INIS)
Sieber, N.; Klabes, R.; Voelskow, M.; Fenske, F.
1982-01-01
The behaviour of oxide charges and interface charges in boron implanted and non-implanted SiO 2 -Si structures as well as the electrical activation of the dopants by the action of incoherent light pulses was studied. Depth profiles of electrically active boron ions are presented for different annealing conditions as measured by the pulsed C-V method. It can be concluded that exposure of MOS structures to intense radiation of flash lamps does not increase the fixed charge and the fast state density at the SiO 2 -Si interface if optimal annealing conditions (energy densities) are employed. Low dose boron implanted silicon can be electrically activated without diffusion or segregation of dopants
Formation of incoherent deformation twin boundaries in a coarse-grained Al-7Mg alloy
Jin, S. B.; Zhang, K.; Bjørge, R.; Tao, N. R.; Marthinsen, K.; Lu, K.; Li, Y. J.
2015-08-01
Deformation twinning has rarely been observed in coarse grained Al and its alloys except under some extreme conditions such as ultrahigh deformation strain or strain rates. Here, we report that a significant amount of Σ3 deformation twins could be generated in a coarse-grained Al-7 Mg alloy by dynamic plastic deformation (DPD). A systematic investigation of the Σ3 boundaries shows that they are Σ3{112} type incoherent twin boundaries (ITBs). These ITBs have formed by gradual evolution from copious low-angle deformation bands through -twist Σ boundaries by lattice rotation. These findings provide an approach to generate deformation twin boundaries in high stacking fault energy metallic alloys. It is suggested that high solution content of Mg in the alloy and the special deformation mode of DPD played an important role in formation of the Σ and ITBs.
Optical information encryption based on incoherent superposition with the help of the QR code
Qin, Yi; Gong, Qiong
2014-01-01
In this paper, a novel optical information encryption approach is proposed with the help of QR code. This method is based on the concept of incoherent superposition which we introduce for the first time. The information to be encrypted is first transformed into the corresponding QR code, and thereafter the QR code is further encrypted into two phase only masks analytically by use of the intensity superposition of two diffraction wave fields. The proposed method has several advantages over the previous interference-based method, such as a higher security level, a better robustness against noise attack, a more relaxed work condition, and so on. Numerical simulation results and actual smartphone collected results are shown to validate our proposal.
Unidirectional reflection and invisibility in nonlinear media with an incoherent nonlinearity
Mostafazadeh, Ali; Oflaz, Neslihan
2017-11-01
We give explicit criteria for the reflectionlessness, transparency, and invisibility of a finite-range potential in the presence of an incoherent (intensity-dependent) nonlinearity that is confined to the range of the potential. This allows us to conduct a systematic study of the effects of such a nonlinearity on a locally periodic class of finite-range potentials that display perturbative unidirectional invisibility. We use our general results to examine the effects of a weak Kerr nonlinearity on the behavior of these potentials and show that the presence of nonlinearity destroys the unidirectional invisibility of these potentials. If the strength of the Kerr nonlinearity is so weak that the first-order perturbation theory is reliable, the presence of nonlinearity does not affect the unidirectional reflectionlessness and transmission reciprocity of the potential. We show that the expected violation of the latter is a second order perturbative effect.
Directory of Open Access Journals (Sweden)
Gene Y. Cho
Full Text Available Objective: To examine the prognostic capabilities of intravoxel incoherent motion (IVIM metrics and their ability to predict response to neoadjuvant treatment (NAT. Additionally, to observe changes in IVIM metrics between pre- and post-treatment MRI. Methods: This IRB-approved, HIPAA-compliant retrospective study observed 31 breast cancer patients (32 lesions. Patients underwent standard bilateral breast MRI along with diffusion-weighted imaging before and after NAT. Six patients underwent an additional IVIM-MRI scan 12â14 weeks after initial scan and 2 cycles of treatment. In addition to apparent diffusion coefficients (ADC from monoexponential decay, IVIM mean values (tissue diffusivity Dt, perfusion fraction fp, and pseudodiffusivity Dp and histogram metrics were derived using a biexponential model. An additional filter identified voxels of highly vascular tumor tissue (VTT, excluding necrotic or normal tissue. Clinical data include histology of biopsy and clinical response to treatment through RECIST assessment. Comparisons of treatment response were made using Wilcoxon rank-sum tests. Results: Average, kurtosis, and skewness of pseudodiffusion Dp significantly differentiated RECIST responders from nonresponders. ADC and Dt values generally increased (â¼70% and VTT% values generally decreased (â¼20% post-treatment. Conclusion: Dp metrics showed prognostic capabilities; slow and heterogeneous pseudodiffusion offer poor prognosis. Baseline ADC/Dt parameters were not significant predictors of response. This work suggests that IVIM mean values and heterogeneity metrics may have prognostic value in the setting of breast cancer NAT. Keywords: Breast cancer, Diffusion weighted MRI, Intravoxel incoherent motion, Neoadjuvant treatment, Response evaluation criteria in solid tumors
Iima, Mami; Kataoka, Masako; Kanao, Shotaro; Kawai, Makiko; Onishi, Natsuko; Koyasu, Sho; Murata, Katsutoshi; Ohashi, Akane; Sakaguchi, Rena; Togashi, Kaori
2018-01-01
We prospectively examined the variability of non-Gaussian diffusion magnetic resonance imaging (MRI) and intravoxel incoherent motion (IVIM) measurements with different numbers of b-values and excitations in normal breast tissue and breast lesions. Thirteen volunteers and fourteen patients with breast lesions (seven malignant, eight benign; one patient had bilateral lesions) were recruited in this prospective study (approved by the Internal Review Board). Diffusion-weighted MRI was performed with 16 b-values (0-2500 s/mm2 with one number of excitations [NEX]) and five b-values (0-2500 s/mm2, 3 NEX), using a 3T breast MRI. Intravoxel incoherent motion (flowing blood volume fraction [fIVIM] and pseudodiffusion coefficient [D*]) and non-Gaussian diffusion (theoretical apparent diffusion coefficient [ADC] at b value of 0 sec/mm2 [ADC0] and kurtosis [K]) parameters were estimated from IVIM and Kurtosis models using 16 b-values, and synthetic apparent diffusion coefficient (sADC) values were obtained from two key b-values. The variabilities between and within subjects and between different diffusion acquisition methods were estimated. There were no statistical differences in ADC0, K, or sADC values between the different b-values or NEX. A good agreement of diffusion parameters was observed between 16 b-values (one NEX), five b-values (one NEX), and five b-values (three NEX) in normal breast tissue or breast lesions. Insufficient agreement was observed for IVIM parameters. There were no statistical differences in the non-Gaussian diffusion MRI estimated values obtained from a different number of b-values or excitations in normal breast tissue or breast lesions. These data suggest that a limited MRI protocol using a few b-values might be relevant in a clinical setting for the estimation of non-Gaussian diffusion MRI parameters in normal breast tissue and breast lesions.
Energy Technology Data Exchange (ETDEWEB)
Lee, Elaine Yuen Phin; Yu, Xue; Khong, Pek-Lan [The University of Hong Kong, Department of Diagnostic Radiology, Queen Mary Hospital, Hong Kong (China); Chu, Mandy Man Yee; Ngan, Hextan Yuen Sheung [The University of Hong Kong, Department of Obstetrics and Gynaecology, Queen Mary Hospital, Hong Kong (China); Siu, Steven Wai Kwan [Queen Mary Hospital, Department of Clinical Oncology, Hong Kong (China); Soong, Inda Sung [Pamela Youde Nethersole Eastern Hospital, Department of Clinical Oncology, Hong Kong (China); Chan, Queenie [Philips Healthcare, Hong Kong (China)
2014-07-15
To investigate the tissue characteristics of cervical cancer based on the intravoxel incoherent motion (IVIM) model and to assess the IVIM parameters in tissue differentiation in the female pelvis. Sixteen treatment-naive cervical cancer and 17 age-matched healthy subjects were prospectively recruited for diffusion-weighted (b = 0-1,000 s/mm{sup 2}) and standard pelvic MRI. Bi-exponential analysis was performed to derive the perfusion parameters f (perfusion fraction) and D* (pseudodiffusion coefficient) as well as the diffusion parameter D (true molecular diffusion coefficient) in cervical cancer (n = 16), normal cervix (n = 17), myometrium (n = 33) and leiomyoma (n = 14). Apparent diffusion coefficient (ADC) was calculated. Kruskal-Wallis test and receiver operating characteristics (ROC) curves were used. Cervical cancer had the lowest f (14.9 ± 2.6 %) and was significantly different from normal cervix and leiomyoma (p < 0.05). The D (0.86 ± 0.16 x 10{sup -3} mm2/s) was lowest in cervical cancer and was significantly different from normal cervix and myometrium (p < 0.05) but not leiomyoma. No difference was observed in D*. D was consistently lower than ADC in all tissues. ROC curves indicated that f < 16.38 %, D < 1.04 x 10{sup -3} mm{sup 2}/s and ADC < 1.13 x 10{sup -3} mm{sup 2}/s could differentiate cervical cancer from non-malignant tissues (AUC 0.773-0.908). Cervical cancer has low perfusion and diffusion IVIM characteristics with promising potential for tissue differentiation. (orig.)
Goncharenko, L. P.; Panasenko, S.; Aksonova, K.; Erickson, P. J.; Domnin, I. F.
2016-12-01
Travelling ionospheric disturbances (TIDs) play a key role in the coupling of different ionospheric regions through momentum an energy transfer. They are thought to be mostly associated with atmospheric gravity waves and are known to strongly affect radio propagation conditions. The incoherent scatter (IS) method enables TIDs detection in such ionospheric parameters as electron density, ion and electron temperatures, and plasma velocity along radar beam, thus providing critical information needed to examine different hypothesis about association of TIDs with their sources. In 2016, several joint measuring campaigns were conducted using Kharkiv (49.6 N, 36.4 E) and Millstone Hill (42.6 N, 288.5 E) IS radars. These campaigns covered the periods of sudden stratospheric warnings (SSW) in February, vernal equinox and summer solstice. For consistency, the data acquired by radars were processed using the same data analysis methods. The results obtained show the TIDs to be detected throughout all observation intervals in February measurements. The differences found in the behavior of TIDs over Kharkiv and Millstone Hill sites may be partially explained by variations in stratospheric wind velocity vectors during SSW period. As for March equinox and June solstice, the prevailing TIDs are observed near solar terminators. Their periods vary mostly in the range of 40 - 80 minutes, relative amplitudes are about 0.05 - 0.3 of the background electron density, and the maximum values are observed at the heights of 200 - 250 km. Systematic long-term observations of wave processes in the ionosphere with multiple IS facilities can reveal interhemispheric variability in TID parameters, give better understanding the mechanisms of TID generation and propagation, and improve regional and global ionospheric models.
Ichikawa, Shintaro; Motosugi, Utaroh; Hernando, Diego; Morisaka, Hiroyuki; Enomoto, Nobuyuki; Matsuda, Masanori; Onishi, Hiroshi
2018-04-10
To compare the abilities of three intravoxel incoherent motion (IVIM) imaging approximation methods to discriminate the histological grade of hepatocellular carcinomas (HCCs). Fifty-eight patients (60 HCCs) underwent IVIM imaging with 11 b-values (0-1000 s/mm 2 ). Slow (D) and fast diffusion coefficients (D * ) and the perfusion fraction (f) were calculated for the HCCs using the mean signal intensities in regions of interest drawn by two radiologists. Three approximation methods were used. First, all three parameters were obtained simultaneously using non-linear fitting (method A). Second, D was obtained using linear fitting (b = 500 and 1000), followed by non-linear fitting for D * and f (method B). Third, D was obtained by linear fitting, f was obtained using the regression line intersection and signals at b = 0, and non-linear fitting was used for D * (method C). A receiver operating characteristic analysis was performed to reveal the abilities of these methods to distinguish poorly-differentiated from well-to-moderately-differentiated HCCs. Inter-reader agreements were assessed using intraclass correlation coefficients (ICCs). The measurements of D, D * , and f in methods B and C (Az-value, 0.658-0.881) had better discrimination abilities than did those in method A (Az-value, 0.527-0.607). The ICCs of D and f were good to excellent (0.639-0.835) with all methods. The ICCs of D * were moderate with methods B (0.580) and C (0.463) and good with method A (0.705). The IVIM parameters may vary depending on the fitting methods, and therefore, further technical refinement may be needed.
International Nuclear Information System (INIS)
Morton, Y.T.
1991-01-01
This thesis uses data accumulated during 1980-1989 by the Arecibo incoherent scatter radar to study the behavior and physics of ionization irregularities. Low latitude ionization irregularities, known as sporadic-E and intermediate layers, undergo a regular daily descent, convergence, and dumping of ion layers controlled by the neutral tidal wind. A useful way of studying ion layers and their motion is by ion layer trajectory maps which consist of points representing the altitude and time of ionization layers. Two types of maps were used which assigned either a uniform layer intensity or a gray level/pseudo-color to indicate different layer intensities. Important aspects of layer formation are revealed by map analysis. During January, intermediate layers consistently appeared four times per day instead of the normal twice per day pattern. Simulation of ion trajectories based on the ion momentum equation, which includes both Lorentzian and collisional forces, shows that a combination of diurnal, semidiurnal, and six-hour tides is necessary for such a feature to exist, whereas only diurnal and semidiurnal tides are needed to create the normal pattern. The six-hour period tide has not been previously reported. Extra or irregular layers appear frequently in layer trajectory maps, which can be simulated by the addition of gravity waves to the regular tidal wind system. Electric field effects are normally not a factor in low latitude ion layer formation because they are relatively weak and not commonly observed. Layer configurations during a geomagnetic storm, however, indicate that the electric field played an important role in controlling ion motion
International Nuclear Information System (INIS)
Drottz-Sjoeberg, Britt-Marie
2003-11-01
The project was a result of the authority's continued work on the 1998 regulations on protection of human health and the environment in final disposal of spent nuclear fuel and nuclear waste. The idea behind the project, to involve persons from the municipalities participating in SKB's site selection investigation in focus group discussions, was that the questions and points of views that emerged in the discussions could serve as a basis for the authority's work of producing general guidelines associated with the regulations. The finished report would then be handed over to an expert group at the authority which answered or commented on the issues raised, and made a report on this to the participating municipalities Oskarshamn and Oesthammar. The result of discussions in two focus groups in Oskarshamn municipality and two in Oesthammar municipality in October 2002 is presented here, together with a presentation of the project's purpose and organisation. The results are presented in three main sections. The first concentrates on radiation and radioactivity since the task in the discussion groups was to attempt to clarify the issues and problems observed in this area in order to contribute to the authority's work of developing the general guidelines. The second section, on understanding of concepts, measurement, risk and safety, illustrates that the frequently asked and 'simple' knowledge related questions are only the tip of the iceberg where many of the participants have also thought about the more complex contexts and the fundamental problems in the risk and safety analysis, its validity and use. The third section of the report focuses primarily on content and information aspects. It provides a number of ideas about how information on current problems and important issues can be improved, how knowledge can be deepened in the site selection municipalities and how working methods in the process can be developed. The report mainly consists of a presentation of the
Energy Technology Data Exchange (ETDEWEB)
Drottz-Sjoeberg, Britt-Marie [BMD Research (Sweden)
2003-11-01
The project was a result of the authority's continued work on the 1998 regulations on protection of human health and the environment in final disposal of spent nuclear fuel and nuclear waste. The idea behind the project, to involve persons from the municipalities participating in SKB's site selection investigation in focus group discussions, was that the questions and points of views that emerged in the discussions could serve as a basis for the authority's work of producing general guidelines associated with the regulations. The finished report would then be handed over to an expert group at the authority which answered or commented on the issues raised, and made a report on this to the participating municipalities Oskarshamn and Oesthammar. The result of discussions in two focus groups in Oskarshamn municipality and two in Oesthammar municipality in October 2002 is presented here, together with a presentation of the project's purpose and organisation. The results are presented in three main sections. The first concentrates on radiation and radioactivity since the task in the discussion groups was to attempt to clarify the issues and problems observed in this area in order to contribute to the authority's work of developing the general guidelines. The second section, on understanding of concepts, measurement, risk and safety, illustrates that the frequently asked and 'simple' knowledge related questions are only the tip of the iceberg where many of the participants have also thought about the more complex contexts and the fundamental problems in the risk and safety analysis, its validity and use. The third section of the report focuses primarily on content and information aspects. It provides a number of ideas about how information on current problems and important issues can be improved, how knowledge can be deepened in the site selection municipalities and how working methods in the process can be developed. The report mainly
International Nuclear Information System (INIS)
Shulan Xu; Dverstorp, Bjoern; Woerman, Anders; Marklund, Lars; Klos, Richard; Shaw, George
2008-03-01
With the publication of the SR-Can report at the end of 2006, Swedish Nuclear Fuel and Waste Management Co (SKB) have presented a complete assessment of long-term safety for a KBS-3 repository. The SR-Can project demonstrates progress in SKB's capabilities in respect of the methodology for assessment of long-term safety in support of a licence application for a final repository. According to SKB's plans, applications to construct a geological repository will be submitted in 2009, supported by post-closure safety assessments. Project CLIMB (Catchment LInked Models of radiological effects in the Biosphere) was instituted in 2004 to provide SSI with an independent modelling capability when reviewing SKB's assessments. Modelling in CLIMB covers all aspects of performance assessment (PA) from nearfield releases to radiological consequences in the surface environment. This review of SR-Can provides the first opportunity to apply the models and to compare the CLIMB approach with developments at SKB. The aim of the independent calculations is to investigate key aspects of the PA models and so to better understand the assessment methodology used by SKB. Independent modelling allows critical review issues to be addressed by the application of alternative models and assumptions. Three reviews are undertaken here: - Reproduction of selected cases from SR-Can in order to demonstrate an adequate understanding of the PA model from details given in the SR-Can documentation. - Alternative conceptualisation of radionuclide transport and accumulation in the surface system. Two modelling approaches have been used: GEMA (the Generic Ecosystem Modelling Approach) is a traditional compartmental model similar to that used by SKB in SR-Can but with additional functionality and flexibility. The second approach takes continuous transport models to investigate contaminant migration through the Quaternary deposits into the surface drainage system. - The final strand of the CLIMB investigation
Energy Technology Data Exchange (ETDEWEB)
Shulan Xu; Dverstorp, Bjoern (Swedish Radiation Protection Authority, Stockholm (Sweden)); Woerman, Anders; Marklund, Lars (Royal Institute of Technology (KTH), Stockholm (SE)); Klos, Richard (Aleksandria Sciences, Sheffield (GB)); Shaw, George (Univ. of Nottingham (GB))
2008-03-15
With the publication of the SR-Can report at the end of 2006, Swedish Nuclear Fuel and Waste Management Co (SKB) have presented a complete assessment of long-term safety for a KBS-3 repository. The SR-Can project demonstrates progress in SKB's capabilities in respect of the methodology for assessment of long-term safety in support of a licence application for a final repository. According to SKB's plans, applications to construct a geological repository will be submitted in 2009, supported by post-closure safety assessments. Project CLIMB (Catchment LInked Models of radiological effects in the Biosphere) was instituted in 2004 to provide SSI with an independent modelling capability when reviewing SKB's assessments. Modelling in CLIMB covers all aspects of performance assessment (PA) from nearfield releases to radiological consequences in the surface environment. This review of SR-Can provides the first opportunity to apply the models and to compare the CLIMB approach with developments at SKB. The aim of the independent calculations is to investigate key aspects of the PA models and so to better understand the assessment methodology used by SKB. Independent modelling allows critical review issues to be addressed by the application of alternative models and assumptions. Three reviews are undertaken here: - Reproduction of selected cases from SR-Can in order to demonstrate an adequate understanding of the PA model from details given in the SR-Can documentation. - Alternative conceptualisation of radionuclide transport and accumulation in the surface system. Two modelling approaches have been used: GEMA (the Generic Ecosystem Modelling Approach) is a traditional compartmental model similar to that used by SKB in SR-Can but with additional functionality and flexibility. The second approach takes continuous transport models to investigate contaminant migration through the Quaternary deposits into the surface drainage system. - The final strand of the CLIMB
International Nuclear Information System (INIS)
Grech, M.; Riazuelo, G.; Pesme, D.; Weber, S.; Tikhonchuk, V. T.
2009-01-01
A statistical model for forward stimulated-Brillouin scattering is developed for a spatially incoherent, monochromatic, laser beam propagating in a plasma. The threshold above which the laser beam spatial incoherence cannot prevent the coherent growth of forward stimulated-Brillouin scattering is computed. It is found to be well below the threshold for self-focusing. Three-dimensional simulations confirm its existence and reveal the onset of beam spray above it. From these results, we propose a new figure of merit for the control of propagation through a plasma of a spatially incoherent laser beam
The Applicability of Incoherent Array Processing to IMS Seismic Array Stations
Gibbons, S. J.
2012-04-01
The seismic arrays of the International Monitoring System for the CTBT differ greatly in size and geometry, with apertures ranging from below 1 km to over 60 km. Large and medium aperture arrays with large inter-site spacings complicate the detection and estimation of high frequency phases since signals are often incoherent between sensors. Many such phases, typically from events at regional distances, remain undetected since pipeline algorithms often consider only frequencies low enough to allow coherent array processing. High frequency phases that are detected are frequently attributed qualitatively incorrect backazimuth and slowness estimates and are consequently not associated with the correct event hypotheses. This can lead to missed events both due to a lack of contributing phase detections and by corruption of event hypotheses by spurious detections. Continuous spectral estimation can be used for phase detection and parameter estimation on the largest aperture arrays, with phase arrivals identified as local maxima on beams of transformed spectrograms. The estimation procedure in effect measures group velocity rather than phase velocity and the ability to estimate backazimuth and slowness requires that the spatial extent of the array is large enough to resolve time-delays between envelopes with a period of approximately 4 or 5 seconds. The NOA, AKASG, YKA, WRA, and KURK arrays have apertures in excess of 20 km and spectrogram beamforming on these stations provides high quality slowness estimates for regional phases without additional post-processing. Seven arrays with aperture between 10 and 20 km (MJAR, ESDC, ILAR, KSRS, CMAR, ASAR, and EKA) can provide robust parameter estimates subject to a smoothing of the resulting slowness grids, most effectively achieved by convolving the measured slowness grids with the array response function for a 4 or 5 second period signal. The MJAR array in Japan recorded high SNR Pn signals for both the 2006 and 2009 North Korea
International Nuclear Information System (INIS)
Chen, J.C.; Chun, R.C.; Goudreau, G.L.; Maslenikov, O.R.; Johnson, J.J.
1984-01-01
This paper summarizes the results of the dynamic response analysis of the Zion reactor containment building using three different soil-structure interaction (SSI) analytical procedures: the substructure method, CLASSI; the equivalent linear finite element approach, ALUSH and the nonlinear finite element procedure, DYNA3D. Uncertainties in analyzing a soil-structure system due to SSI analysis procedures were investigated. Responses at selected locations in the structure were compared: peak accelerations and response spectra
International Nuclear Information System (INIS)
Schmid, G.; Willms, G.; Huh, Y.; Gibhardt, M.
1988-12-01
SSI 2D/3D is a computer programm to calculate dynamic stiffness matrices for soil-structure-interaction problems in frequency domain. It is applicable to two- or three-dimensional situations. The present report is a detailed manual for the use of the computer code written in FORTRAN 77. In addition it gives a survey of the possibilities of the Boundary Element Method applied to dynamic problems in infinite domains. (orig.) [de
Energy Technology Data Exchange (ETDEWEB)
Espejo, R. [Syncho, Solihull (United Kingdom); Gill, A. [Syncho, Oxon (United Kingdom)
1998-01-01
The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section `A problem of identity`. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI`s regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions.
Kamimura, K; Nakajo, M; Fukukura, Y; Iwanaga, T; Saito, T; Sasaki, M; Fujisaki, T; Takemura, A; Okuaki, T; Yoshiura, T
2016-12-01
DWI with conventional single-shot EPI of the pituitary gland is hampered by strong susceptibility artifacts. Our purpose was to evaluate the feasibility of intravoxel incoherent motion assessment by using DWI based on TSE of the normal anterior pituitary lobe. The intravoxel incoherent motion parameters, including the true diffusion coefficient (D), the perfusion fraction (f), and the pseudo-diffusion coefficient (D*), were obtained with TSE-DWI in 5 brain regions (the pons, the WM and GM of the vermis, and the genu and splenium of the corpus callosum) in 8 healthy volunteers, and their agreement with those obtained with EPI-DWI was evaluated by using the intraclass correlation coefficient. The 3 intravoxel incoherent motion parameters in the anterior pituitary lobe were compared with those in the brain regions by using the Dunnett test. The agreement between TSE-DWI and EPI-DWI was moderate (intraclass correlation coefficient = 0.571) for D, substantial (0.699) for f', but fair (0.405) for D*. D in the anterior pituitary lobe was significantly higher than in the 5 brain regions (P anterior pituitary lobe was significantly higher than in the 5 brain regions (P pituitary D* was not significantly different from that in the 5 brain regions. Our results demonstrated the feasibility of intravoxel incoherent motion assessment of the normal anterior pituitary lobe by using TSE-DWI. High D and f values in the anterior pituitary lobe were thought to reflect its microstructural and perfusion characteristics. © 2016 by American Journal of Neuroradiology.
Kozub, V. I.; Caro, J.
2004-01-01
We describe spin transfer in a ferromagnet/normal metal/ferromagnet spin-valve point contact. Spin is transferred from the spin-polarized device current to the magnetization of the free layer by the mechanism of incoherent magnon emission by electrons. Our approach is based on the rate equation for the magnon occupation, using Fermi's golden rule for magnon emission and absorption and the non-equilibrium electron distribution for a biased spin valve. The magnon emission reduces the magnetizat...
An efficient central DOA tracking algorithm for multiple incoherently distributed sources
Hassen, Sonia Ben; Samet, Abdelaziz
2015-12-01
In this paper, we develop a new tracking method for the direction of arrival (DOA) parameters assuming multiple incoherently distributed (ID) sources. The new approach is based on a simple covariance fitting optimization technique exploiting the central and noncentral moments of the source angular power densities to estimate the central DOAs. The current estimates are treated as measurements provided to the Kalman filter that model the dynamic property of directional changes for the moving sources. Then, the covariance-fitting-based algorithm and the Kalman filtering theory are combined to formulate an adaptive tracking algorithm. Our algorithm is compared to the fast approximated power iteration-total least square-estimation of signal parameters via rotational invariance technique (FAPI-TLS-ESPRIT) algorithm using the TLS-ESPRIT method and the subspace updating via FAPI-algorithm. It will be shown that the proposed algorithm offers an excellent DOA tracking performance and outperforms the FAPI-TLS-ESPRIT method especially at low signal-to-noise ratio (SNR) values. Moreover, the performances of the two methods increase as the SNR values increase. This increase is more prominent with the FAPI-TLS-ESPRIT method. However, their performances degrade when the number of sources increases. It will be also proved that our method depends on the form of the angular distribution function when tracking the central DOAs. Finally, it will be shown that the more the sources are spaced, the more the proposed method can exactly track the DOAs.
Energy Technology Data Exchange (ETDEWEB)
Kim, Jeong Woo; Lee, Chang Hee; Park, Yang Shin; Kim, Kyeong Ah; Park, Cheol Min [Korea University College of Medicine, Departments of Radiology, Korea University Guro Hospital, 80 Guro-dong, Guro-gu, Seoul (Korea, Republic of); Yoo, Kee Hwan [Korea University College of Medicine, Departments of Pediatrics, Korea University Guro Hospital, Seoul (Korea, Republic of); Je, Bo-Kyung [Korea University College of Medicine, Department of Radiology, Korea University Ansan Hospital, Seoul (Korea, Republic of); Kiefer, Berthold [Oncology Application Development, Siemens Healthcare, Erlangen (Germany)
2016-06-15
To compare the diffusion parameters of intravoxel incoherent motion (IVIM) diffusion-weighted imaging (DWI) between the ''reflux'' and the ''non-reflux'' kidneys, and to evaluate the feasibility of using IVIM DWI to predict vesicoureteral reflux (VUR) in children with a urinary tract infection (UTI). Eighty-three kidneys from 57 pediatric patients with a UTI were classified into ''reflux'' and ''non-reflux'' groups according to voiding cystourethrography (VCUG) results. The apparent diffusion coefficient (ADC), true diffusion coefficient (D), pseudo-diffusion coefficient (D*), and perfusion fraction (PF) were measured and compared in the renal pelvis of both groups. Four indices (D*/ADC, PF/ADC, D*/D, and PF/D) were calculated and receiver operating characteristic (ROC) curve analyses were performed. VURs were detected on VCUG in 21 kidneys. PF and D* were significantly higher in the ''reflux'' group than in the ''non-reflux'' group. The indices were all significantly higher. The PF/D index showed the best diagnostic performance in predicting VUR in children with UTI (A{sub z} = 0.864). PF and D* were significantly higher in the ''reflux'' kidney than in the ''non-reflux'' kidney. Our new index (PF/D) could prove useful for predicting VUR. (orig.)
Angular distribution of diffuse reflectance from incoherent multiple scattering in turbid media.
Gao, M; Huang, X; Yang, P; Kattawar, G W
2013-08-20
The angular distribution of diffuse reflection is elucidated with greater understanding by studying a homogeneous turbid medium. We modeled the medium as an infinite slab and studied the reflection dependence on the following three parameters: the incident direction, optical depth, and asymmetry factor. The diffuse reflection is produced by incoherent multiple scattering and is solved through radiative transfer theory. At large optical depths, the angular distribution of the diffuse reflection with small incident angles is similar to that of a Lambertian surface, but, with incident angles larger than 60°, the angular distributions have a prominent reflection peak around the specular reflection angle. These reflection peaks are found originating from the scattering within one transport mean free path in the top layer of the medium. The maximum reflection angles for different incident angles are analyzed and can characterize the structure of angular distributions for different asymmetry factors and optical depths. The properties of the angular distribution can be applied to more complex systems for a better understanding of diffuse reflection.
Semidiurnal tide in the E region from incoherent scatter measurements at Arecibo
International Nuclear Information System (INIS)
Wand, R.H.
1976-01-01
A five-pulse technique was implemented for the 430 MHz incoherent scatter radar at Arecibo Observatory (18.3 0 N) to explore the detailed thermal structure of the E region from 105 to 130 km with an altitude resolution of 3 km. Five days of measurements in Sept-Oct 1970 showed long-period temperature fluctuations having a downward phase progression. The temperature oscillations are interpreted as manifestations of a semidiurnal tide which is quite stable over a 12-day period, together with a superimposed spectrum of shorter-period gravity waves which are randomly phased from day to day. The semidiurnal tide increased to a maximum amplitude of 17 percent of the mean temperature near 115 km and decreased above this altitude as dissipative effects became important. The vertical wavelength, deduced from the altitude variation of semidiurnal tidal phase, showed a smooth increase from about 20 km at an altitude of 109 km to about 50 km at an altitude of 127 km. No ready interpretation of the observed tidal characteristics was possible in terms of present theories for the semidiurnal tide. Altitude profiles of mean daytime temperature and ion-neutral collision frequency were also obtained from the measurements. The mean temperature gradient between 115 and 130 km was 15 K/km, which is somewhat larger than that given by current atmospheric models
Directory of Open Access Journals (Sweden)
M. Koeppel
2018-02-01
Full Text Available Optical temperature sensors offer unique features which make them indispensable for key industries such as the energy sector. However, commercially available systems are usually designed to perform either distributed or distinct hot spot temperature measurements since they are restricted to one measurement principle. We have combined two concepts, fiber Bragg grating (FBG temperature sensors and Raman-based distributed temperature sensing (DTS, to overcome these limitations. Using a technique called incoherent optical frequency domain reflectometry (IOFDR, it is possible to cascade several FBGs with the same Bragg wavelength in one fiber and simultaneously perform truly distributed Raman temperature measurements. In our lab we have achieved a standard deviation of 2.5 K or better at a spatial resolution in the order of 1 m with the Raman DTS. We have also carried out a field test in a high-voltage environment with strong magnetic fields where we performed simultaneous Raman and FBG temperature measurements using a single sensor fiber only.
All-fiber 7x1 signal combiner for incoherent laser beam combining
Noordegraaf, D.; Maack, M. D.; Skovgaard, P. M. W.; Johansen, J.; Becker, F.; Belke, S.; Blomqvist, M.; Laegsgaard, J.
2011-02-01
We demonstrate an all-fiber 7x1 signal combiner for incoherent laser beam combining. This is a potential key component for reaching several kW of stabile laser output power. The combiner couples the output from 7 single-mode (SM) fiber lasers into a single multi-mode (MM) fiber. The input signal fibers have a core diameter of 17 μm and the output MM fiber has a core diameter of 100 μm. In a tapered section light gradually leaks out of the SM fibers and is captured by a surrounding fluorine-doped cladding. The combiner is tested up to 2.5 kW of combined output power and only a minor increase in device temperature is observed. At an intermediate power level of 600 W a beam parameter product (BPP) of 2.22 mm x mrad is measured, corresponding to an M2 value of 6.5. These values are approaching the theoretical limit dictated by brightness conservation.
Comparison of the UAF Ionosphere Model with Incoherent-Scatter Radar Data
McAllister, J.; Maurits, S.; Kulchitsky, A.; Watkins, B.
2004-12-01
The UAF Eulerian Parallel Polar Ionosphere Model (UAF EPPIM) is a first-principles three-dimensional time-dependent representation of the northern polar ionosphere (>50 degrees north latitude). The model routinely generates short-term (~2 hours) ionospheric forecasts in real-time. It may also be run in post-processing/batch mode for specific time periods, including long-term (multi-year) simulations. The model code has been extensively validated (~100k comparisons/model year) against ionosonde foF2 data during quiet and moderate solar activity in 2002-2004 with reasonable fidelity (typical relative RMS 10-20% for summer daytime, 30-50% winter nighttime). However, ionosonde data is frequently not available during geomagnetic disturbances. The objective of the work reported here is to compare model outputs with available incoherent-scatter radar data during the storm period of October-November 2003. Model accuracy is examined for this period and compared to model performance during geomagnetically quiet and moderate circumstances. Possible improvements are suggested which are likely to boost model fidelity during storm conditions.
Sparse synthetic aperture with Fresnel elements (S-SAFE) using digital incoherent holograms
Kashter, Yuval; Rivenson, Yair; Stern, Adrian; Rosen, Joseph
2015-01-01
Creating a large-scale synthetic aperture makes it possible to break the resolution boundaries dictated by the wave nature of light of common optical systems. However, their implementation is challenging, since the generation of a large size continuous mosaic synthetic aperture composed of many patterns is complicated in terms of both phase matching and time-multiplexing duration. In this study we present an advanced configuration for an incoherent holographic imaging system with super resolution qualities that creates a partial synthetic aperture. The new system, termed sparse synthetic aperture with Fresnel elements (S-SAFE), enables significantly decreasing the number of the recorded elements, and it is free from positional constrains on their location. Additionally, in order to obtain the best image quality we propose an optimal mosaicking structure derived on the basis of physical and numerical considerations, and introduce three reconstruction approaches which are compared and discussed. The super-resolution capabilities of the proposed scheme and its limitations are analyzed, numerically simulated and experimentally demonstrated. PMID:26367947
Kumar, Manoj; Vijayakumar, A; Rosen, Joseph
2017-09-14
We present a lensless, interferenceless incoherent digital holography technique based on the principle of coded aperture correlation holography. The acquired digital hologram by this technique contains a three-dimensional image of some observed scene. Light diffracted by a point object (pinhole) is modulated using a random-like coded phase mask (CPM) and the intensity pattern is recorded and composed as a point spread hologram (PSH). A library of PSHs is created using the same CPM by moving the pinhole to all possible axial locations. Intensity diffracted through the same CPM from an object placed within the axial limits of the PSH library is recorded by a digital camera. The recorded intensity this time is composed as the object hologram. The image of the object at any axial plane is reconstructed by cross-correlating the object hologram with the corresponding component of the PSH library. The reconstruction noise attached to the image is suppressed by various methods. The reconstruction results of multiplane and thick objects by this technique are compared with regular lens-based imaging.
Larsen, Delmar S; van Stokkum, Ivo H M; Vengris, Mikas; van Der Horst, Michael A; de Weerd, Frank L; Hellingwerf, Klaas J; van Grondelle, Rienk
2004-09-01
Photoactive yellow protein is the protein responsible for initiating the "blue-light vision" of Halorhodospira halophila. The dynamical processes responsible for triggering the photoactive yellow protein photocycle have been disentangled with the use of a novel application of dispersed ultrafast pump-dump-probe spectroscopy, where the photocycle can be started and interrupted with appropriately tuned and timed laser pulses. This "incoherent" manipulation of the photocycle allows for the detailed spectroscopic investigation of the underlying photocycle dynamics and the construction of a fully self-consistent dynamical model. This model requires three kinetically distinct excited-state intermediates, two (ground-state) photocycle intermediates, I(0) and pR, and a ground-state intermediate through which the protein, after unsuccessful attempts at initiating the photocycle, returns to the equilibrium ground state. Also observed is a previously unknown two-photon ionization channel that generates a radical and an ejected electron into the protein environment. This second excitation pathway evolves simultaneously with the pathway containing the one-photon photocycle intermediates.
Noise processing by microRNA-mediated circuits: The Incoherent Feed-Forward Loop, revisited
Directory of Open Access Journals (Sweden)
Silvia Grigolon
2016-04-01
Full Text Available The intrinsic stochasticity of gene expression is usually mitigated in higher eukaryotes by post-transcriptional regulation channels that stabilise the output layer, most notably protein levels. The discovery of small non-coding RNAs (miRNAs in specific motifs of the genetic regulatory network has led to identifying noise buffering as the possible key function they exert in regulation. Recent in vitro and in silico studies have corroborated this hypothesis. It is however also known that miRNA-mediated noise reduction is hampered by transcriptional bursting in simple topologies. Here, using stochastic simulations validated by analytical calculations based on van Kampen's expansion, we revisit the noise-buffering capacity of the miRNA-mediated Incoherent Feed Forward Loop (IFFL, a small module that is widespread in the gene regulatory networks of higher eukaryotes, in order to account for the effects of intermittency in the transcriptional activity of the modulator gene. We show that bursting considerably alters the circuit's ability to control static protein noise. By comparing with other regulatory architectures, we find that direct transcriptional regulation significantly outperforms the IFFL in a broad range of kinetic parameters. This suggests that, under pulsatile inputs, static noise reduction may be less important than dynamical aspects of noise and information processing in characterising the performance of regulatory elements.
International Nuclear Information System (INIS)
Kim, Jeong Woo; Lee, Chang Hee; Park, Yang Shin; Kim, Kyeong Ah; Park, Cheol Min; Yoo, Kee Hwan; Je, Bo-Kyung; Kiefer, Berthold
2016-01-01
To compare the diffusion parameters of intravoxel incoherent motion (IVIM) diffusion-weighted imaging (DWI) between the ''reflux'' and the ''non-reflux'' kidneys, and to evaluate the feasibility of using IVIM DWI to predict vesicoureteral reflux (VUR) in children with a urinary tract infection (UTI). Eighty-three kidneys from 57 pediatric patients with a UTI were classified into ''reflux'' and ''non-reflux'' groups according to voiding cystourethrography (VCUG) results. The apparent diffusion coefficient (ADC), true diffusion coefficient (D), pseudo-diffusion coefficient (D*), and perfusion fraction (PF) were measured and compared in the renal pelvis of both groups. Four indices (D*/ADC, PF/ADC, D*/D, and PF/D) were calculated and receiver operating characteristic (ROC) curve analyses were performed. VURs were detected on VCUG in 21 kidneys. PF and D* were significantly higher in the ''reflux'' group than in the ''non-reflux'' group. The indices were all significantly higher. The PF/D index showed the best diagnostic performance in predicting VUR in children with UTI (A z = 0.864). PF and D* were significantly higher in the ''reflux'' kidney than in the ''non-reflux'' kidney. Our new index (PF/D) could prove useful for predicting VUR. (orig.)
A new method for incoherent combining of far-field laser beams based on multiple faculae recognition
Ye, Demao; Li, Sichao; Yan, Zhihui; Zhang, Zenan; Liu, Yuan
2018-03-01
Compared to coherent beam combining, incoherent beam combining can complete the output of high power laser beam with high efficiency, simple structure, low cost and high thermal damage resistance, and it is easy to realize in engineering. Higher target power is achieved by incoherent beam combination which using technology of multi-channel optical path correction. However, each channel forms a spot in the far field respectively, which cannot form higher laser power density with low overlap ratio of faculae. In order to improve the combat effectiveness of the system, it is necessary to overlap different faculae that improve the target energy density. Hence, a novel method for incoherent combining of far-field laser beams is present. The method compromises piezoelectric ceramic technology and evaluation algorithm of faculae coincidence degree which based on high precision multi-channel optical path correction. The results show that the faculae recognition algorithm is low-latency(less than 10ms), which can meet the needs of practical engineering. Furthermore, the real time focusing ability of far field faculae is improved which was beneficial to the engineering of high-energy laser weapon or other laser jamming systems.
Directory of Open Access Journals (Sweden)
R. S. Dhillon
2009-01-01
Full Text Available Previous studies of the aspect sensitivity of heater-enhanced incoherent radar backscatter in the high-latitude ionosphere have demonstrated the directional dependence of incoherent scatter signatures corresponding to artificially excited electrostatic waves, together with consistent field-aligned signatures that may be related to the presence of artificial field-aligned irregularities. These earlier high-latitude results have provided motivation for repeating the investigation in the different geophysical conditions that obtain in the polar cap ionosphere. The Space Plasma Exploration by Active Radar (SPEAR facility is located within the polar cap and has provided observations of RF-enhanced ion and plasma line spectra recorded by the EISCAT Svalbard UHF incoherent scatter radar system (ESR, which is collocated with SPEAR. In this paper, we present observations of aspect sensitive E- and F-region SPEAR-induced ion and plasma line enhancements that indicate excitation of both the purely growing mode and the parametric decay instability, together with sporadic E-layer results that may indicate the presence of cavitons. We note consistent enhancements from field-aligned, vertical and also from 5° south of field-aligned. We attribute the prevalence of vertical scatter to the importance of the Spitze region, and of that from field-aligned to possible wave/irregularity coupling.
Al-Khafaji, Hamza M. R.; Aljunid, S. A.; Fadhil, Hilal A.
2012-06-01
The major drawback of incoherent spectral-amplitude coding optical code-division multiple-access (SAC-OCDMA) systems is their inherent intensity noise originating due to the incoherency of the broadband light sources. In this paper, we propose a developed detection technique named the modified-AND subtraction detection for incoherent SAC-OCDMA systems. This detection technique is based upon decreasing the received signal strength during the decoding process by dividing the spectrum of the utilized code sequence. The proposed technique is capable of mitigating the intensity noise effect, as well as suppressing the multiple-access interference impact. Based on modified quadratic congruence (MQC) code, the analytical results reveal that the modified-AND detection offer best bit-error rate (BER) performance and enables MQC code to support higher transmission rate up to 1.25 Gb/s compared to conventional AND detection. Furthermore, we ascertained that the proposed technique enhances the system performance using a simulation experiment.
DEFF Research Database (Denmark)
Rasmussen, Christian Jørgen; Liu, Fenghai; Pedersen, Rune Johan Skullerud
1999-01-01
Calculations based on the exact probability density function of the received power show that for a fixed total crosstalk power, the incoherent crosstalk penalty increases with the number of crosstalk signals. Performed experiments verify this.......Calculations based on the exact probability density function of the received power show that for a fixed total crosstalk power, the incoherent crosstalk penalty increases with the number of crosstalk signals. Performed experiments verify this....
The Social Support Inventory (SSI) : A brief scale to assess perceived adequacy of social support
Timmerman, IGH; Emanuels-Zuurveen, ES; Emmelkamp, PMG
The development of a brief measure to assess satisfaction with obtained social support using Simultaneous Components Analysis (SCA) is described. In the first study the component structure of the Social Support Questionnaire (Van Sonderen, 1991) was determined in a sample of men (n = 401) and women
Intravoxel Incoherent Motion Metrics as Potential Biomarkers for Survival in Glioblastoma.
Directory of Open Access Journals (Sweden)
Josep Puig
Full Text Available Intravoxel incoherent motion (IVIM is an MRI technique with potential applications in measuring brain tumor perfusion, but its clinical impact remains to be determined. We assessed the usefulness of IVIM-metrics in predicting survival in newly diagnosed glioblastoma.Fifteen patients with glioblastoma underwent MRI including spin-echo echo-planar DWI using 13 b-values ranging from 0 to 1000 s/mm2. Parametric maps for diffusion coefficient (D, pseudodiffusion coefficient (D*, and perfusion fraction (f were generated for contrast-enhancing regions (CER and non-enhancing regions (NCER. Regions of interest were manually drawn in regions of maximum f and on the corresponding dynamic susceptibility contrast images. Prognostic factors were evaluated by Kaplan-Meier survival and Cox proportional hazards analyses.We found that fCER and D*CER correlated with rCBFCER. The best cutoffs for 6-month survival were fCER>9.86% and D*CER>21.712 x10-3mm2/s (100% sensitivity, 71.4% specificity, 100% and 80% positive predictive values, and 80% and 100% negative predictive values; AUC:0.893 and 0.857, respectively. Treatment yielded the highest hazard ratio (5.484; 95% CI: 1.162-25.88; AUC: 0.723; P = 0.031; fCER combined with treatment predicted survival with 100% accuracy.The IVIM-metrics fCER and D*CER are promising biomarkers of 6-month survival in newly diagnosed glioblastoma.
The role of incoherent microRNA-mediated feedforward loops in noise buffering.
Directory of Open Access Journals (Sweden)
Matteo Osella
2011-03-01
Full Text Available MicroRNAs are endogenous non-coding RNAs which negatively regulate the expression of protein-coding genes in plants and animals. They are known to play an important role in several biological processes and, together with transcription factors, form a complex and highly interconnected regulatory network. Looking at the structure of this network, it is possible to recognize a few overrepresented motifs which are expected to perform important elementary regulatory functions. Among them, a special role is played by the microRNA-mediated feedforward loop in which a master transcription factor regulates a microRNA and, together with it, a set of target genes. In this paper we show analytically and through simulations that the incoherent version of this motif can couple the fine-tuning of a target protein level with an efficient noise control, thus conferring precision and stability to the overall gene expression program, especially in the presence of fluctuations in upstream regulators. Among the other results, a nontrivial prediction of our model is that the optimal attenuation of fluctuations coincides with a modest repression of the target expression. This feature is coherent with the expected fine-tuning function and in agreement with experimental observations of the actual impact of a wide class of microRNAs on the protein output of their targets. Finally, we describe the impact on noise-buffering efficiency of the cross-talk between microRNA targets that can naturally arise if the microRNA-mediated circuit is not considered as isolated, but embedded in a larger network of regulations.
Intravoxel incoherent motion (IVIM) DWI of the liver. Pre-and postprandial comparison
International Nuclear Information System (INIS)
Hirose, Junji; Satou, Yuuichi; Amemiya, Ryoji; Yoda, Yoshioki; Motosugi, Utaroh
2013-01-01
We evaluated if meal intake changes the diffusivity result calculated using the intravoxel incoherent motion (IVIM) model and the portal flow velocity measured by phase contrast magnetic resonance (MR) imaging. We asked 3 healthy volunteers to eat 794-kcal meals and acquired MR images before and 20 minutes after the meal using a 1.5-tesla clinical MR scanner. We acquired 2-dimensional (2D) phase contrast (PC) gradient echo MR images to measure portal flow and diffusion-weighted images to calculate diffusivity results using the IVIM model and b-values of 0, 10, 20, 30, 40, 50, 70, 100, 200, 400, and 800 s/mm 2 . Portal flow was greater after the meal than (before): Volunteer A, 16.1 cm/s (9.7 cm/s); B, 18.0 cm/s (12.8 cm/s); and C, 18.3 cm/s (11.7 cm/s). The diffusivity results of D * and f were also increased after the meal in all 3 volunteers. D * and f values before and (after) the meal were: Volunteer A, 97.1 and 0.14 (149.6 and 0.20); Volunteer B, 79.4 and 0.20 (183.4 and 0.21); and Volunteer C, 29.4 and 0.19 (132.7 and 0.20). The trend in apparent diffusion coefficient (ADC) and D values were inconsistent among the 3 volunteers. The higher D * and f values in the liver after eating calculated using the IVIM model indicated increased portal flow due to the meal. (author)
Energy Technology Data Exchange (ETDEWEB)
Hilbert, Fabian; Sauer, Alexander; Koestler, Herbert [University Hospital Wuerzburg, Department of Diagnostic and Interventional Radiology, Wuerzburg (Germany); Holl-Wieden, Annette [University Hospital Wuerzburg, Department of Paediatrics, Wuerzburg (Germany); Neubauer, Henning [University Hospital Wuerzburg, Department of Diagnostic and Interventional Radiology, Wuerzburg (Germany); University Hospital Ulm, Department of Diagnostic and Interventional Radiology, Ulm (Germany)
2017-05-15
MRI of synovitis relies on use of a gadolinium-based contrast agent. Diffusion-weighted MRI (DWI) visualises thickened synovium but is of limited use in the presence of joint effusion. To investigate the feasibility and diagnostic accuracy of diffusion-weighted MRI with intravoxel incoherent motion (IVIM) for diagnosing synovitis in the knee joint of children with juvenile idiopathic arthritis. Twelve consecutive children with confirmed or suspected juvenile idiopathic arthritis (10 girls, median age 11 years) underwent MRI with contrast-enhanced T1-weighted imaging and DWI at 1.5 T. Read-out segmented multi-shot DWI was acquired at b values of 0 s/mm{sup 2}, 200 s/mm{sup 2}, 400 s/mm{sup 2} and 800 s/mm{sup 2}. We calculated the IVIM parameters perfusion fraction (f) and tissue diffusion coefficient (D). Diffusion-weighted images at b=800 s/mm{sup 2}, f parameter maps and post-contrast T1-weighted images were retrospectively assessed by two independent readers for synovitis using the Juvenile Arthritis MRI Scoring system. Seven (58%) children showed synovial hypertrophy on contrast-enhanced imaging. Diagnostic ratings for synovitis on DWI and on f maps were fully consistent with contrast-enhanced imaging, the diagnostic reference. Two children had equivocal low-confidence assessments on DWI. Median f was 6.7±2.0% for synovitis, 2.1±1.2% for effusion, 5.0±1.0% for muscle and 10.6±5.7% for popliteal lymph nodes. Diagnostic confidence was higher based on f maps in three (25%) children and lower in one child (8%), as compared to DWI. DWI with IVIM reliably visualises synovitis of the knee joint. Perfusion fraction maps differentiate thickened synovium from joint effusion and hence increase diagnostic confidence. (orig.)
Tan, Hui; Chen, Jun; Zhao, Yi Ling; Liu, Jin Huan; Zhang, Liang; Liu, Chang Sheng; Huang, Dongjie
2018-06-13
This study aimed to preliminarily investigate the feasibility of intravoxel incoherent motion (IVIM) theory in the differential diagnosis of benign and malignant thyroid nodules. Forty-five patients with 56 confirmed thyroid nodules underwent preoperative routine magnetic resonance imaging and IVIM diffusion-weighted imaging. The histopathologic diagnosis was confirmed by surgery. Apparent diffusion coefficient (ADC), perfusion fraction f, diffusivity D, and pseudo-diffusivity D* were quantified. Independent samples t test of IVIM-derived metrics were conducted between benign and malignant nodules. Receiver-operating characteristic analyses were performed to determine the optimal thresholds as well as the sensitivity and specificity for differentiating. Significant intergroup difference was observed in ADC, D, D*, and f (p < 0.001). Malignant tumors featured significantly lower ADC, D and D* values and a higher f value than that of benign nodules. The ADC, D, and D* could distinguish the benign from malignant thyroid nodules, and parameter f differentiate the malignant tumors from benign nodules. The values of the area under the curve for parameter ADC, D, and D* were 0.784 (p = 0.001), 0.795 (p = 0.001), and 0.850 (p < 0.001), separately, of which the area under the curve of f value was the maximum for identifying the malignant from benign nodules, which was 0.841 (p < 0.001). This study suggested that ADC and IVIM-derived metrics, including D, D*, and f, could potentially serve as noninvasive predictors for the preoperative differentiating of thyroid nodules, and f value performed best in identifying the malignant from benign nodules among these parameters. Copyright © 2018 Academic Radiology. Published by Elsevier Inc. All rights reserved.
Wang, Y.; Xue, Y.; Huang, B.; Lee, J.; De Sales, F.
2016-12-01
A long term simulation has been conducted using the Climate Forecast System (CFSv2) coupled to the SSiB-2 land model, which consists of the Global Forecast System atmospheric model (GFS) and the Modular Ocean model - version 4 (MOM4) as the ocean component. This study evaluates the model's performance in simulating sea surface temperature (SST) mean state, trend, and inter-annual and decadal variabilities. The model is able to produce the reasonable spatial distribution of the SST climatology; however, it has prominent large scale biases. In the middle latitude of the Northern Hemisphere, major cold biases is close to the warm side of the large SST gradients, which may be associated with the weaker Kuroshio and Gulf Stream extensions that diffuse the SST gradient. IN addition, warm biases extend along the west coast of the North America continent to the high latitude, which may be related with excessive Ekman down-welling and solar radiation fluxes reaching to the surface due to the lack of cloud there. Warm biases also exist over the tropical cold tough areas in the Pacific and Atlantic. The global SST trend and interannual variations are well captured except for that in the south Hemisphere after year 2000, which is mainly contributed by the bias from the southern Pacific Ocean. Although the model fails to accurately produce ENSO events in proper years, it does reproduce the ENSO frequency well; they are skewed toward more warm events after 1990. The model also shows ability in SST decadal variation, such as the so-called inter-decadal Pacific oscillation (IPO); however, its phases seem to go reversely compared with the observation.
International Nuclear Information System (INIS)
Saxena, Navjeev; Paul, D.K.
2012-01-01
Highlights: ► Both the slip and separation of reactor base reduce with increase in embedment. ► The slip and separation become insignificant beyond 1/4 and 1/2 embedment respectively. ► The stresses in reactor reduce significantly upto 1/4 embedment. ► The stress reduction with embedment is more pronounced in case of tensile stresses. ► The modeling of interface is important beyond 1/8 embedment as stresses are underestimated otherwise. - Abstract: The seismic response of nuclear reactor containment building considering the effects of embedment, slip and separation at soil–structure interface requires modeling of the soil, structure and interface altogether. Slip and separation at the interface causes stress redistribution in the soil and the structure around the interface. The embedment changes the dynamic characteristics of the soil–structure system. Consideration of these aspects allows capturing the realistic response of the structure, which has been a research gap and presented here individually as well as taken together. Finite element analysis has been carried out in time domain to attempt the highly nonlinear problem. The study draws important conclusions useful for design of nuclear reactor containment building.
Energy Technology Data Exchange (ETDEWEB)
Graf, Markus; Simon, Dirk; Mang, Sarah [Deutsches Krebsforschungszentrum (DKFZ), Heidelberg (Germany). Software Development for Integrated Therapy and Diagnostics; Lemke, Andreas [Heidelberg Univ., Mannheim (Germany). Dept. of Computer Assisted Clinical Medicine; Gruenberg, Katharina [Deutsches Krebsforschungszentrum (DKFZ), Heidelberg (Germany). Dept. of Radiology
2013-03-01
Early recognition of and differential diagnosis between pancreatic cancer and chronic pancreatitis is an important step in successful therapy. Parameters of the IVIM (intra-voxel incoherent motion) theory can be used to differentiate between those lesions. The objective of this work is to evaluate the effects of rigid image registration on IVIM derived parameters for differentiation of pancreatic lesions such as pancreatic cancer and solid mass forming pancreatitis. The effects of linear image registration methods on reproducibility and accuracy of IVIM derived parameters were quantified on MR images of ten volunteers. For this purpose, they were evaluated statistically by comparison of registered and unregistered parameter data. Further, the perfusion fraction f was used to differentiate pancreatic lesions on eleven previously diagnosed patient data sets. Its diagnostic power with and without rigid registration was evaluated using receiver operating curves (ROC) analysis. The pancreas was segmented manually on MR data sets of healthy volunteers as well as the patients showing solid pancreatic lesions. Diffusion weighted imaging was performed in 10 blocks of breath-hold phases. Linear registration of the weighted image stack leads to a 3.7% decrease in variability of the IVIM derived parameter f due to an improved anatomical overlap of 5%. Consequently, after registration the area under the curve in the ROC-analysis for the differentiation approach increased by 2.7%. In conclusion, rigid registration improves the differentiation process based on f-values. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Fujima, Noriyuki; Yoshida, Daisuke; Tsukahara, Akiko; Shimizu, Yukie; Kudo, Kohsuke [Hokkaido University Hospital, Department of Diagnostic and Interventional Radiology, Sapporo, Hokkaido (Japan); Sakashita, Tomohiro; Homma, Akihiro [Hokkaido University Graduate School of Medicine, Department of Otolaryngology-Head and Neck Surgery, Sapporo (Japan); Tha, Khin Khin; Shirato, Hiroki [Hokkaido University Graduate School of Medicine, Department of Radiation Medicine, Sapporo (Japan); Global Institution for Collaborative Research and Education, The Global Station for Quantum Medical Science and Engineering, Sapporo (Japan)
2017-03-15
To evaluate the diagnostic value of intravoxel incoherent motion (IVIM) and diffusional kurtosis imaging (DKI) parameters in nasal or sinonasal squamous cell carcinoma (SCC) patients to determine local control/failure. Twenty-eight patients were evaluated. MR acquisition used single-shot spin-echo EPI with 12 b-values. Quantitative parameters (mean value, 25th, 50th and 75th percentiles) of IVIM (perfusion fraction f, pseudo-diffusion coefficient D*, and true-diffusion coefficient D), DKI (kurtosis value K, kurtosis corrected diffusion coefficient D{sub k}) and apparent diffusion coefficient (ADC) were calculated. Parameter values at both the pretreatment and early-treatment period, and the percentage change between these two periods were obtained. Multivariate logistic regression analysis: the percentage changes of D (mean, 25th, 50th, 75th), K (mean, 50th, 75th), Dk (mean, 25th, 50th), and ADC (mean, 25th, 50th) were predictors of local control. ROC curve analysis: the parameter with the highest accuracy = the percentage change of D value with the histogram 25th percentile (0.93 diagnostic accuracy). Multivariate Cox regression analyses: the percentage changes of D (mean, 25th, 50th), K (mean, 50th, 75th), Dk (mean, 25th, 50th) and ADC (mean, 25th, 50th) are predictors. IVIM and DKI parameters, especially the D-value's histogram 25th percentile, are useful for predicting local control. (orig.)
International Nuclear Information System (INIS)
Graf, Markus; Simon, Dirk; Mang, Sarah; Lemke, Andreas; Gruenberg, Katharina
2013-01-01
Early recognition of and differential diagnosis between pancreatic cancer and chronic pancreatitis is an important step in successful therapy. Parameters of the IVIM (intra-voxel incoherent motion) theory can be used to differentiate between those lesions. The objective of this work is to evaluate the effects of rigid image registration on IVIM derived parameters for differentiation of pancreatic lesions such as pancreatic cancer and solid mass forming pancreatitis. The effects of linear image registration methods on reproducibility and accuracy of IVIM derived parameters were quantified on MR images of ten volunteers. For this purpose, they were evaluated statistically by comparison of registered and unregistered parameter data. Further, the perfusion fraction f was used to differentiate pancreatic lesions on eleven previously diagnosed patient data sets. Its diagnostic power with and without rigid registration was evaluated using receiver operating curves (ROC) analysis. The pancreas was segmented manually on MR data sets of healthy volunteers as well as the patients showing solid pancreatic lesions. Diffusion weighted imaging was performed in 10 blocks of breath-hold phases. Linear registration of the weighted image stack leads to a 3.7% decrease in variability of the IVIM derived parameter f due to an improved anatomical overlap of 5%. Consequently, after registration the area under the curve in the ROC-analysis for the differentiation approach increased by 2.7%. In conclusion, rigid registration improves the differentiation process based on f-values. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Mikayama, Ryoji; Yabuuchi, Hidetake; Nagatomo, Kazuya; Kimura, Mitsuhiro; Kumazawa, Seiji [Kyushu University, Department of Health Sciences, Graduate School of Medical Sciences, Fukuoka (Japan); Sonoda, Shinjiro; Kobayashi, Koji [Kyushu University Hospital, Division of Radiology, Department of Medical Technology, Fukuoka (Japan); Kawanami, Satoshi; Kamitani, Takeshi; Honda, Hiroshi [Kyushu University, Department of Clinical Radiology, Graduate School of Medical Sciences, Fukuoka (Japan)
2018-01-15
To compare image quality, apparent diffusion coefficient (ADC), and intravoxel incoherent motion (IVIM)-derived parameters between turbo spin-echo (TSE)-diffusion-weighted imaging (DWI) and echo-planar imaging (EPI)-DWI of the head and neck. Fourteen volunteers underwent head and neck imaging using TSE-DWI and EPI-DWI. Distortion ratio (DR), signal-to-noise ratio (SNR), contrast-to-noise ratio (CNR), ADC and IVIM-derived parameters were compared between the two techniques. Bland-Altman analysis was performed to analyse reproducibility between the quantitative parameters of TSE-DWI and EPI-DWI. DR of TSE-DWI was significantly smaller than that of EPI-DWI. SNR and CNR of TSE-DWI were significantly higher than those of EPI-DWI. ADC and IVIM-derived parameters of TSE-DWI showed higher values than those of EPI-DWI, although the difference was not significant. Bland-Altman analysis showed wide limits of agreement between the two sequences. TSE-DWI can produce better image quality than EPI-DWI, while TSE-DWI possibly exhibits different values of quantitative parameters. Therefore, TSE-DWI could be a good alternative to EPI-DWI for patients sensitive to distortion. However, it is not recommended to use both TSE-DWI and EPI-DWI on follow-up. (orig.)
Innate lymphoid cells: a paradigm for low SSI in cleft lip repair.
Simmerman, Erika; Qin, Xu; Marshall, Brendan; Perry, Libby; Cai, Lei; Wang, Tailing; Yu, Jack; Akbari, Omid; Baban, Babak
2016-10-01
Cleft lip and palate reconstructions demonstrate significantly lower surgical site infection rates compared with clean-contaminated cases, prompting investigation into the pathophysiology causing this discrepancy. Recent studies have identified a new group of innate lymphocytes called innate lymphoid cells (ILCs), located in barrier surfaces of the skin, airways, and intestine. Our objectives were to explore for the first time the presence of ILCs in the vermillion of neonates and young children undergoing cleft lip reconstruction and characterize their composition by measuring the three classes of ILCs. Lip tissue samples were collected from 13 subjects undergoing vermillion resection during cleft lip reconstructive surgery. Preparative, transmission electron microscopy, and analytical flow cytometry were performed. The functionality of ILCs was tested in terms of their capacity to produce type 1 (IFN-γ/TNF-α), type 2 (IL-5/IL-13), and type 3 (IL-17/IL-22) cytokines. Data were analyzed using Student t test or the analysis of variance to establish significance (P < 0.05) among groups for all other data. All three classes of ILCs were detected and visualized in the tissue samples. In all samples, the level of ILC2 subset was significantly higher than the other two ILC subsets (P < 0.01), followed by the ILC1 subset, which was present in significantly higher levels than the ILC3 subset (P < 0.05). Our data place ILCs for the first time in the interface of oral mucosal immunity, tissue microenvironment, and homeostasis during and after tissue development, possibly explaining lower infection rates in cleft lip or palate reconstructions. Copyright © 2016 Elsevier Inc. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Dverstorp, Bjoern; Stroemberg, Bo (and others)
2008-03-15
This report summarizes SKI's and SSI's joint review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) safety report SR-Can (SKB TR-06-09). SR-Can is the first assessment of post-closure safety for a KBS-3 spent nuclear fuel repository at the candidate sites Forsmark and Laxemar, respectively. The analysis builds on data from the initial stage of SKB's surface-based site investigations and on data from full-scale manufacturing and testing of buffer and copper canisters. SR-Can can be regarded as a preliminary version of the safety report that will be required in connection with SKB's planned license application for a final repository in late 2009. The main purpose of the authorities' review is to provide feedback to SKB on their safety reporting as part of the pre-licensing consultation process. However, SR-Can is not part of the formal licensing process. In support of the authorities' review three international peer review teams were set up to make independent reviews of SR-Can from three perspectives, namely integration of site data, representation of the engineered barriers and safety assessment methodology, respectively. Further, several external experts and consultants have been engaged to review detailed technical and scientific issues in SR-Can. The municipalities of Oesthammar and Oskarshamn where SKB is conducting site investigations, as well NGOs involved in SKB's programme, have been invited to provide their views on SR-Can as input to the authorities' review. Finally, the authorities themselves, and with the help of consultants, have used independent models to reproduce part of SKB's calculations and to make complementary calculations. All supporting review documents are published in SKI's and SSI's report series. The main findings of the review are: SKB's safety assessment methodology is overall in accordance with applicable regulations, but part of the methodology needs to be
[Incidence of surgical site infections in sub-Saharan Africa: systematic review and meta-analysis].
Ngaroua; Ngah, Joseph Eloundou; Bénet, Thomas; Djibrilla, Yaouba
2016-01-01
Surgical Site Infections (SSI) cause morbi-mortality and additional healthcare expenditures. Developing countries are the most affected. The objective was to estimate the pooled incidence of SSI in Sub-Saharan Africa and describe its major risk factors. Systematic review and meta-analysis were conducted using the databases of the World Health Organization Regional Office for Africa, PubMed and standard search to select electronic articles published between 2006 and 2015. Only articles investigating SSI impact and risk factors in Sub-Saharan African countries were retained. Out of 95 articles found, 11 met the inclusion criteria. Only 9 countries out of 45 have contributed, with a huge amount of information coming from Nigeria (5 articles out of 11). The impact of SSI ranged from 6.8% to 26% with predominance in general surgery. The pooled incidence of SSI was 14.8% (95% CI: 15,5-16,2%) with significant heterogeneity according to the specialty and the method of monitoring. Most cited risk factors were long procedure length and categories 3 and 4 of Altemeier contamination class. Other factors included hospital environment, inadequate care practices and underlying pathologies. SSI incidence is high in Sub-Saharan Africa. Studies in this area could improve knowledge, prevention and control of these multiple risk factors.
Incoherent scattering functions of 145 keV gamma rays by K-shell electrons in Y, Ag and Au
International Nuclear Information System (INIS)
Raghava Rao, A.; Ramana Reddy, S.V.S.; Premchand, K.; Narasimham, K.L.; Parthasaradhi, K.; Lakshminarayana, V.
1982-01-01
The values of incoherent scattering functions are determined experimentally for 145 keV gamma rays in elements Au, Ag and Y at scattering angles 40 0 , 70 0 and 100 0 , using a x-ray gamma coincidence technique. The corresponding theoretical values are obtained from the tabulations of Hubbell et al, and computed from the models of Jauch and Rohrlich and Shimizu et al. A comparison between the theoretical and experimental results showed that the non-relativistic approach adopted in the theory of Shimizu et al is inapplicable to the present cases. A gross agreement is noticed between the present experimental results and the other theoretical values. (author)
Martini, M; G. Chanfray; Marteau, J
2010-01-01
Neutrino-nucleus cross-sections are needed to interpret neutrino oscillation data, as neutrino detectors involve complex nuclei. We present a theory of neutrino interactions with nuclei aimed at a unified description of the partial cross-sections, namely quasi-elastic and multi-nucleon emission, coherent and incoherent single pion production. We compare our approach to the available neutrino experimental data on carbon. We also discuss the evolution of the neutrino cross-sections with the mass number in view of future precision ex- periments which will use a liquid argon chamber.
Umucalılar, R. O.; Carusotto, I.
2017-11-01
We investigate theoretically a driven dissipative model of strongly interacting photons in a nonlinear optical cavity in the presence of a synthetic magnetic field. We show the possibility of using a frequency-dependent incoherent pump to create a strongly correlated ν =1 /2 bosonic Laughlin state of light: Due to the incompressibility of the Laughlin state, fluctuations in the total particle number and excitation of edge modes can be tamed by imposing a suitable external potential profile for photons. We further propose angular-momentum-selective spectroscopy of the emitted light as a tool to obtain unambiguous signatures of the microscopic physics of the quantum Hall liquid of light.
Using the Flipchem Photochemistry Model When Fitting Incoherent Scatter Radar Data
Reimer, A. S.; Varney, R. H.
2017-12-01
The North face Resolute Bay Incoherent Scatter Radar (RISR-N) routinely images the dynamics of the polar ionosphere, providing measurements of the plasma density, electron temperature, ion temperature, and line of sight velocity with seconds to minutes time resolution. RISR-N does not directly measure ionospheric parameters, but backscattered signals, recording them as voltage samples. Using signal processing techniques, radar autocorrelation functions (ACF) are estimated from the voltage samples. A model of the signal ACF is then fitted to the ACF using non-linear least-squares techniques to obtain the best-fit ionospheric parameters. The signal model, and therefore the fitted parameters, depend on the ionospheric ion composition that is used [e.g. Zettergren et. al. (2010), Zou et. al. (2017)].The software used to process RISR-N ACF data includes the "flipchem" model, which is an ion photochemistry model developed by Richards [2011] that was adapted from the Field LineInterhemispheric Plasma (FLIP) model. Flipchem requires neutral densities, neutral temperatures, electron density, ion temperature, electron temperature, solar zenith angle, and F10.7 as inputs to compute ion densities, which are input to the signal model. A description of how the flipchem model is used in RISR-N fitting software will be presented. Additionally, a statistical comparison of the fitted electron density, ion temperature, electron temperature, and velocity obtained using a flipchem ionosphere, a pure O+ ionosphere, and a Chapman O+ ionosphere will be presented. The comparison covers nearly two years of RISR-N data (April 2015 - December 2016). Richards, P. G. (2011), Reexamination of ionospheric photochemistry, J. Geophys. Res., 116, A08307, doi:10.1029/2011JA016613.Zettergren, M., Semeter, J., Burnett, B., Oliver, W., Heinselman, C., Blelly, P.-L., and Diaz, M.: Dynamic variability in F-region ionospheric composition at auroral arc boundaries, Ann. Geophys., 28, 651-664, https
Zou, S.; Lu, J.; Varney, R. H.
2017-12-01
This study aims to investigate the occurrence rate of ion upflow and downflow events in the auroral ionosphere, using a full 3-year (2011-2013) dataset collected by the Poker Flat Incoherent Scatter Radar (PFISR) at 65.5° magnetic latitude. Ion upflow and downflow events are defined if there are three consecutive data points larger/smaller than 100/-100 m/s in the ion field-aligned velocity altitude profile. Their occurrence rates have been evaluated as a function of magnetic local time (MLT), season, geomagnetic activity, solar wind and interplanetary magnetic field (IMF). We found that the ion upflows are twice more likely to occur on the nightside than the dayside, and have slightly higher occurrence rate near Fall equinox. In contrast, the ion downflow events are more likely to occur in the afternoon sector but also during Fall equinox. In addition, the occurrence rate of ion upflows on the nightside increases when the aurora electrojet index (AE) and planetary K index (Kp) increase, while the downflows measured on the dayside clearly increase as the AE and Kp increase. In general, the occurrence rate of ion upflows increases with enhanced solar wind and IMF drivers. This correlation is particularly strong between the upflows on the nightside and the solar wind dynamic pressure and IMF Bz. The lack of correlation of upflows on the dayside with these parameters is due to the location of PFISR, which is usually equatorward of the dayside auroral zone and within the nightside auroral zone under disturbed conditions. The occurrence rate of downflow at all MLTs does not show strong dependence on the solar wind and IMF conditions. However, it occurs much more frequently on the dayside when the IMF By is strongly positive, i.e., >10 nT and the IMF Bz is strongly negative, i.e., < -10 nT. We suggest that the increased occurrence rate of downflows on the dayside is associated with dayside storm-enhanced density and the plume.
International Nuclear Information System (INIS)
Roosen-Runge, F.; Seydel, T.
2015-01-01
Elastic fixed window scans of incoherent neutron scattering are an established and frequently employed method to study dynamical changes, usually over a broad temperature range or during a process such as a conformational change in the sample. In particular, the apparent mean-squared displacement can be extracted via a model-free analysis based on a solid physical interpretation as an effective amplitude of molecular motions. Here, we provide a new account of elastic and inelastic fixed window scans, defining a generalized mean-squared displacement for all fixed energy transfers. We show that this generalized mean-squared displacement in principle contains all information on the real mean-square displacement accessible in the instrumental time window. The derived formula provides a clear understanding of the effects of instrumental resolution on the apparent mean-squared displacement. Finally, we show that the generalized mean-square displacement can be used as a model-free indicator on confinement effects within the instrumental time window. (authors)
Energy Technology Data Exchange (ETDEWEB)
Jia, Qian-Jun; Zhang, Shui-Xing; Chen, Wen-Bo; Liang, Long; Zhou, Zheng-Gen; Liu, Zai-Yi; Zeng, Qiong-Xin; Liang, Chang-Hong [Guangdong General Hospital/Guangdong Academy of Medical Sciences, Department of Radiology, Guangzhou, Guangdong Province (China); Qiu, Qian-Hui [Guangdong General Hospital/Guangdong Academy of Medical Sciences, Department of Otolaryngology, Guangzhou, Guangdong Province (China)
2014-12-15
To determine the correlation between intravoxel incoherent motion (IVIM) and dynamic contrast-enhanced (DCE) magnetic resonance imaging (MRI) parameters. Thirty-eight newly diagnosed NPC patients were prospectively enrolled. Diffusion-weighted images (DWI) at 13 b-values were acquired using a 3.0-T MRI system. IVIM parameters including the pure molecular diffusion (D), perfusion-related diffusion (D*), perfusion fraction (f), DCE-MRI parameters including maximum slope of increase (MSI), enhancement amplitude (EA) and enhancement ratio (ER) were calculated by two investigators independently. Intra- and interobserver agreement were evaluated using the intraclass correlation coefficient (ICC) and Bland-Altman analysis. Relationships between IVIM and DCE-MRI parameters were evaluated by calculation of Spearman's correlation coefficient. Intra- and interobserver reproducibility were excellent to relatively good (ICC = 0.887-0.997; narrow width of 95 % limits of agreement). The highest correlation was observed between f and EA (r = 0.633, P < 0.001), with a strong correlation between f and MSI (r = 0.598, P = 0.001). No correlation was observed between f and ER (r = -0.162; P = 0.421) or D* and DCE parameters (r = 0.125-0.307; P > 0.119). This study suggests IVIM perfusion imaging using 3.0-T MRI is feasible in NPC, and f correlates significantly with EA and MSI. (orig.)
Soil Surface Runoff Scheme for Improving Land-Hydrology and Surface Fluxes in Simple SiB (SSiB)
Sud, Y. C.; Mocko, David M.
1999-01-01
Evapotranspiration on land is hard to measure and difficult to simulate. On the scale of a GCM grid, there is large subgrid-scale variability of orography, soil moisture, and vegetation. Our hope is to be able to tune the biophysical constants of vegetation and soil parameters to get the most realistic space-averaged diurnal cycle of evaporation and its climatology. Field experiments such as First ISLSCP Field Experiment (FIFE), Boreal Ecosystem-Atmosphere Study (BOREAS), and LBA help a great deal in improving our evapotranspiration schemes. However, these improvements have to be matched with, and coupled to, consistent improvement in land-hydrology; otherwise, the runoff problems will intrinsically reflect on the soil moisture and evapotranspiration errors. Indeed, a realistic runoff simulation also ensures a reasonable evapotranspiration simulation provided the precipitation forcing is reliable. We have been working on all of the above problems to improve the simulated hydrologic cycle. Through our participation in the evaluation and intercomparison of land-models under the behest of Global Soil Wetness Project (GSWP), we identified a few problems with Simple SiB (SSIB; Xue et al., 1991) hydrology in regions of significant snowmelt. Sud and Mocko (1999) show that inclusion of a separate snowpack model, with its own energy budget and fluxes with the atmosphere aloft and soil beneath, helps to ameliorate some of the deficiencies of delayed snowmelt and excessive spring season runoff. Thus, much more realistic timing of melt water generation was simulated with the new snowpack model in the subsequent GSWP re-evaluations using 2 years of ISLSCP Initiative I forcing data for 1987 and 1988. However, we noted an overcorrection of the low meltwater infiltration of SSiB. While the improvement in snowmelt timing was found everywhere, the snowmelt infiltration has became excessive in some regions, e.g., Lena river basin. This leads to much reduced runoff in many basins as
Mu, Hongqian; Wang, Muguang; Tang, Yu; Zhang, Jing; Jian, Shuisheng
2018-03-01
A novel scheme for the generation of FCC-compliant UWB pulse is proposed based on modified Gaussian quadruplet and incoherent wavelength-to-time conversion. The modified Gaussian quadruplet is synthesized based on linear sum of a broad Gaussian pulse and two narrow Gaussian pulses with the same pulse-width and amplitude peak. Within specific parameter range, FCC-compliant UWB with spectral power efficiency of higher than 39.9% can be achieved. In order to realize the designed waveform, a UWB generator based on spectral shaping and incoherent wavelength-to-time mapping is proposed. The spectral shaper is composed of a Gaussian filter and a programmable filter. Single-mode fiber functions as both dispersion device and transmission medium. Balanced photodetection is employed to combine linearly the broad Gaussian pulse and two narrow Gaussian pulses, and at same time to suppress pulse pedestals that result in low-frequency components. The proposed UWB generator can be reconfigured for UWB doublet by operating the programmable filter as a single-band Gaussian filter. The feasibility of proposed UWB generator is demonstrated experimentally. Measured UWB pulses match well with simulation results. FCC-compliant quadruplet with 10-dB bandwidth of 6.88-GHz, fractional bandwidth of 106.8% and power efficiency of 51% is achieved.
Cady, Eric; Shaklan, Stuart
2014-08-01
A major component of the estimation and correction of starlight at very high contrasts is the creation of a dark hole: a region in the vicinity of the core of the stellar point spread function (PSF) where speckles in the PSF wings have been greatly attenuated, up to a factor of 1010 for the imaging of terrestrial exoplanets. At these very high contrasts, removing these speckles requires distinguishing between light from the stellar PSF scattered by instrument imperfections, which may be partially corrected across a broad band using deformable mirrors in the system, from light from other sources which generally may not. These other sources may be external or internal to the instrument (e.g. planets, exozodiacal light), but in either case, their distinguishing characteristic is their inability to interfere coherently with the PSF. In the following we discuss the estimation, structure, and expected origin of this incoherent" signal, primarily in the context of a series of experiments made with a linear band-limited mask in Jan-Mar 2013. We find that the incoherent" signal at moderate contrasts is largely estimation error of the coherent signal, while at very high contrasts it represents a true floor which is stable over week-timescales.
Directory of Open Access Journals (Sweden)
Zhenwei Chen
2016-09-01
Full Text Available Co-registration is one of the most important steps in interferometric synthetic aperture radar (InSAR data processing. The standard offset-measurement method based on cross-correlating uniformly distributed patches takes no account of specific geometric transformation between images or characteristics of ground scatterers. Hence, it is inefficient and difficult to obtain satisfying co-registration results for image pairs with relatively big distortion or large incoherent areas. Given this, an improved co-registration strategy is proposed in this paper which takes both the geometric features and image content into consideration. Firstly, some geometric transformations including scale, flip, rotation, and shear between images were eliminated based on the geometrical information, and the initial co-registration polynomial was obtained. Then the registration points were automatically detected by integrating the signal-to-clutter-ratio (SCR thresholds and the amplitude information, and a further co-registration process was performed to refine the polynomial. Several comparison experiments were carried out using 2 TerraSAR-X data from the Hong Kong airport and 21 PALSAR data from the Donghai Bridge. Experiment results demonstrate that the proposed method brings accuracy and efficiency improvements for co-registration and processing abilities in the cases of big distortion between images or large incoherent areas in the images. For most co-registrations, the proposed method can enhance the reliability and applicability of co-registration and thus promote the automation to a higher level.
Chen, Zhenwei; Zhang, Lei; Zhang, Guo
2016-09-17
Co-registration is one of the most important steps in interferometric synthetic aperture radar (InSAR) data processing. The standard offset-measurement method based on cross-correlating uniformly distributed patches takes no account of specific geometric transformation between images or characteristics of ground scatterers. Hence, it is inefficient and difficult to obtain satisfying co-registration results for image pairs with relatively big distortion or large incoherent areas. Given this, an improved co-registration strategy is proposed in this paper which takes both the geometric features and image content into consideration. Firstly, some geometric transformations including scale, flip, rotation, and shear between images were eliminated based on the geometrical information, and the initial co-registration polynomial was obtained. Then the registration points were automatically detected by integrating the signal-to-clutter-ratio (SCR) thresholds and the amplitude information, and a further co-registration process was performed to refine the polynomial. Several comparison experiments were carried out using 2 TerraSAR-X data from the Hong Kong airport and 21 PALSAR data from the Donghai Bridge. Experiment results demonstrate that the proposed method brings accuracy and efficiency improvements for co-registration and processing abilities in the cases of big distortion between images or large incoherent areas in the images. For most co-registrations, the proposed method can enhance the reliability and applicability of co-registration and thus promote the automation to a higher level.
Cheaito, Ramez; Polanco, Carlos A.; Addamane, Sadhvikas; Zhang, Jingjie; Ghosh, Avik W.; Balakrishnan, Ganesh; Hopkins, Patrick E.
2018-02-01
We report on the room temperature thermal conductivity of AlAs-GaAs superlattices (SLs), in which we systematically vary the period thickness and total thickness between 2 -24 nm and 20.1 -2 ,160 nm , respectively. The thermal conductivity increases with the SL thickness and plateaus at a thickness around 200 nm, showing a clear transition from a quasiballistic to a diffusive phonon transport regime. These results demonstrate the existence of classical size effects in SLs, even at the highest interface density samples. We use harmonic atomistic Green's function calculations to capture incoherence in phonon transport by averaging the calculated transmission over several purely coherent simulations of independent SL with different random mixing at the AlAs-GaAs interfaces. These simulations demonstrate the significant contribution of incoherent phonon transport through the decrease in the transmission and conductance in the SLs as the number of interfaces increases. In spite of this conductance decrease, our simulations show a quasilinear increase in thermal conductivity with the superlattice thickness. This suggests that the observation of a quasilinear increase in thermal conductivity can have important contributions from incoherent phonon transport. Furthermore, this seemingly linear slope in thermal conductivity versus SL thickness data may actually be nonlinear when extended to a larger number of periods, which is a signature of incoherent effects. Indeed, this trend for superlattices with interatomic mixing at the interfaces could easily be interpreted as linear when the number of periods is small. Our results reveal that the change in thermal conductivity with period thickness is dominated by incoherent (particlelike) phonons, whose properties are not dictated by changes in the AlAs or GaAs phonon dispersion relations. This work demonstrates the importance of studying both period and sample thickness dependencies of thermal conductivity to understand the
Directory of Open Access Journals (Sweden)
Peña-Santiago, R.
2010-12-01
Full Text Available Bathyodontus mirus (Andrássy, 1956 Hopper & Cairns, 1956, collected in sand dunes of SW Iberian peninsula, is studied. Description, measurements and illustrations (LM pictures are provided. Iberian specimens are briefly compared to other known populations of the species. And a compendium of Bathyodontus species, including a key to their identification, is also given. This is the first record of a representative of the nematode suborder Bathyodontina in the Iberian-Balearic range and in the Mediterranean region.Se estudia la especie Bathyodontus mirus (Andrássy, 1956 Hopper y Cairns, 1956, recolectada en dunas de arena en el suroeste peninsular. Se presentan una descripción, medidas e ilustraciones (fotografías con microscopía óptica. Los ejemplares ibéricos se comparan brevemente con otras poblaciones conocidas de la misma especie. Y se ofrece un compendio de las especies del género Bathyodontus, incluida una clave para su identification. Se trata de la primera cita de un miembro del suborden Bathyodontina en el ámbito Ibero-balear y en la región Mediterránea.
Hu, Fubi; Yang, Ru; Huang, Zixing; Wang, Min; Zhang, Hanmei; Yan, Xu; Song, Bin
2017-12-01
To retrospectively determine the feasibility of intravoxel incoherent motion (IVIM) imaging based on histogram analysis for the staging of liver fibrosis (LF) using histopathologic findings as the reference standard. 56 consecutive patients (14 men, 42 women; age range, 15-76, years) with chronic liver diseases (CLDs) were studied using IVIM-DWI with 9 b-values (0, 25, 50, 75, 100, 150, 200, 500, 800 s/mm 2 ) at 3.0 T. Fibrosis stage was evaluated using the METAVIR scoring system. Histogram metrics including mean, standard deviation (Std), skewness, kurtosis, minimum (Min), maximum (Max), range, interquartile (Iq) range, and percentiles (10, 25, 50, 75, 90th) were extracted from apparent diffusion coefficient (ADC), true diffusion coefficient (D), pseudo-diffusion coefficient (D*), and perfusion fraction (f) maps. All histogram metrics among different fibrosis groups were compared using one-way analysis of variance or nonparametric Kruskal-Wallis test. For significant parameters, receivers operating characteristic curve (ROC) analyses were further performed for the staging of LF. Based on their METAVIR stage, the 56 patients were reclassified into three groups as follows: F0-1 group (n = 25), F2-3 group (n = 21), and F4 group (n = 10). The mean, Iq range, percentiles (50, 75, and 90th) of D* maps between the groups were significant differences (all P histogram metrics of ADC, D, and f maps demonstrated no significant difference among the groups (all P > 0.05). Histogram analysis of D* map derived from IVIM can be used to stage liver fibrosis in patients with CLDs and provide more quantitative information beyond the mean value.
International Nuclear Information System (INIS)
2001-03-01
SKI and SSI find that SKB's first proper safety assessment of the SFL 3-5 repositories provides a valuable springboard for continued efforts in this field. Even though the safety assessment is relatively limited in scope, it has numerous merits. The specific problems associated with the chosen repository concept for SFL 3-5 are discussed in a generally transparent manner. On the other hand, the authorities consider that SKB have only partly achieved the expressed goal of studying the significance of the current repository design and the choice of site. The greatest deficiency consists in that neither internal disturbances (such as considerable cracking or degradation of concrete structures) nor external disturbances (such as the effects of climate changes and glaciation) have been addressed in a thorough manner. A coherent report justifying the design choice from a long-term safety perspective is, in large part, not found here. SKI and SSI recommend that SKB provide a comparison with other possible SFL 3-5 repository designs. Depending upon, among other factors, what geospheric and biospheric conditions are assumed, SKB have shown that the calculated dose values could be relatively high for certain cases. More realistic assessments would be needed to draw reasonable comparisons between different sites, and to evaluate the importance of different nuclides in different contexts. Our review of SKBs preliminary safety assessment indicates that a great deal of research and development work remains to be done before the level of knowledge in this field is comparable with that associated with the final repository for spent fuel. This is reflected with unanimity in the international expert committee's review, and in the consultants' reviews. SKI and SSI wish to point out in particular the fact that comparison with SFR is of limited value, since the safety associated with SFL 3- 5 must be assessed on a much longer time scale. SKI and SSI find it remarkable that SKB have
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
SKI and SSI find that SKB's first proper safety assessment of the SFL 3-5 repositories provides a valuable springboard for continued efforts in this field. Even though the safety assessment is relatively limited in scope, it has numerous merits. The specific problems associated with the chosen repository concept for SFL 3-5 are discussed in a generally transparent manner. On the other hand, the authorities consider that SKB have only partly achieved the expressed goal of studying the significance of the current repository design and the choice of site. The greatest deficiency consists in that neither internal disturbances (such as considerable cracking or degradation of concrete structures) nor external disturbances (such as the effects of climate changes and glaciation) have been addressed in a thorough manner. A coherent report justifying the design choice from a long-term safety perspective is, in large part, not found here. SKI and SSI recommend that SKB provide a comparison with other possible SFL 3-5 repository designs. Depending upon, among other factors, what geospheric and biospheric conditions are assumed, SKB have shown that the calculated dose values could be relatively high for certain cases. More realistic assessments would be needed to draw reasonable comparisons between different sites, and to evaluate the importance of different nuclides in different contexts. Our review of SKBs preliminary safety assessment indicates that a great deal of research and development work remains to be done before the level of knowledge in this field is comparable with that associated with the final repository for spent fuel. This is reflected with unanimity in the international expert committee's review, and in the consultants' reviews. SKI and SSI wish to point out in particular the fact that comparison with SFR is of limited value, since the safety associated with SFL 3- 5 must be assessed on a much longer time scale. SKI and SSI find it remarkable
Energy Technology Data Exchange (ETDEWEB)
Park, Sunghoon; Kwack, Kyu-Sung; Kim, Jae Ho [Ajou University School of Medicine, Division of Musculoskeletal Radiology, Department of Radiology, Suwon, Gyeonggi-do (Korea, Republic of); Ajou University Medical Center, Musculoskeletal Imaging Laboratory, Suwon (Korea, Republic of); Chung, Nam-Su [Ajou University School of Medicine, Department of Orthopaedic Surgery, Suwon (Korea, Republic of); Hwang, Jinwoo [Philips Healthcare, Department of Clinical Science, Seoul (Korea, Republic of); Lee, Hyun Young [Ajou University Medical Center, Regional Clinical Trial Center, Suwon (Korea, Republic of); Yonsei University College of Medicine, Department of Biostatistics, Seoul (Korea, Republic of)
2017-05-15
To evaluate the ability of intravoxel incoherent motion (IVIM) diffusion-weighted magnetic resonance imaging (MRI) parameters to differentiate nodular hyperplastic hematopoietic bone marrow (HHBM) from malignant vertebral bone marrow lesions (VBMLs). A total of 33 patients with 58 VBMLs, including 9 nodular HHBM lesions, 39 bone metastases, and 10 myelomas, were retrospectively assessed. All diagnoses were confirmed either pathologically or via image assessment. IVIM diffusion-weighted MRI with 11 b values (from 0 to 800 s/mm{sup 2}) were obtained using a 3.0-T MR imager. The apparent diffusion coefficient (ADC), pure diffusion coefficient (D), perfusion fraction (f), and pseudodiffusion coefficient (D*) were calculated. ADC and IVIM parameters were compared using the Mann-Whitney U test. Receiver operating characteristic (ROC) curve analysis was performed to assess the diagnostic performances of ADC, D, f, and D* in terms of VBML characterization. The diagnostic performance of morphological MR sequences was also assessed for comparison. The ADC and D values of nodular HHBM were significantly lower than those of malignant VBML (both p values < 0.001), whereas the f value was significantly higher (p < 0.001). However, there were no significant differences in D* between the two groups (p = 0.688). On ROC analysis, the area under the curve (AUC) for D was 1.000, which was significantly larger than that for ADC (AUC = 0.902). Intravoxel incoherent motion diffusion-weighted MRI can be used to differentiate between nodular HHBM and malignant VBML. The D value was significantly lower for nodular HHBM, and afforded a better diagnostic performance than the ADC, f, and D* values in terms of such differentiation. (orig.)
Huiszoon, B.; Leinse, Arne; Geuzebroek, D.H.; Augustin, L.M.; Klein, E.J.; de Waardt, H.; Khoe, G.D.; Koonen, A.M.J.; Emplit, Ph.; Delqué, M.; Gorza, S.-P.; Kockaert, P.; Leijtens, X
2007-01-01
In this paper, we show and analyze, for the first time, the static performance of integrated multi-stage cascade and tree spectral amplitude OCDMA en/decoders (E/Ds) which are fabricated in the low loss Si3N4–SiO2 material system. Combined with incoherent broad spectral sources these E/Ds enable
Energy Technology Data Exchange (ETDEWEB)
Benedetti, C.; Schroeder, C.B.; Esarey, E.; Leemans, W.P.
2014-05-01
he wakefield generated in a plasma by incoherently combining a large number of low energy laser pulses (i.e.,without constraining the pulse phases) is studied analytically and by means of fully-self-consistent particle-in-cell simulations. The structure of the wakefield has been characterized and its amplitude compared with the amplitude of the wake generated by a single (coherent) laser pulse. We show that, in spite of the incoherent nature of the wakefield within the volume occupied by the laser pulses, behind this region the structure of the wakefield can be regular with an amplitude comparable or equal to that obtained from a single pulse with the same energy. Wake generation requires that the incoherent structure in the laser energy density produced by the combined pulses exists on a time scale short compared to the plasma period. Incoherent combination of multiple laser pulses may enable a technologically simpler path to high-repetition rate, high-average power laser-plasma accelerators and associated applications.
Diehl, Manfred; Hay, Elizabeth L.
2010-01-01
This study observed young, middle-aged, and older adults (N = 239; M[subscript age] = 49.6 years; range = 18-89 years) for 30 consecutive days to examine the association between daily stress and negative affect, taking into account potential risk (i.e., self-concept incoherence) and resilience (i.e., age, perceived personal control) factors.…
Malhotra, A.; Mathews, J. D.
2011-01-01
There has been much interest in the meteor physics community recently regarding the form that meteoroid mass flux arrives in the upper atmosphere. Of particular interest are the relative roles of simple ablation, differential ablation, and fragmentation in the meteoroid mass flux observed by the Incoherent Scatter Radars (ISR). We present here the first-ever statistical study showing the relative contribution of the above-mentioned three mechanisms. These are also one of the first meteor results from the newly-operational Resolute Bay ISR. These initial results emphasize that meteoroid disintegration into the upper atmosphere is a complex process in which all the three above-mentioned mechanisms play an important role though fragmentation seems to be the dominant mechanism. These results prove vital in studying how meteoroid mass is deposited in the upper atmosphere which has important implications to the aeronomy of the region and will also contribute in improving current meteoroid disintegration/ablation models.
Directory of Open Access Journals (Sweden)
M. Milla
2006-07-01
Full Text Available The ALTAIR UHF radar was used in an incoherent scatter experiment to observe the low-latitude ionosphere during the Equis 2 rocket campaign. The measurements provided the first high-resolution electron density maps of the low-latitude D- and E-region in the Pacific sector and also extended into the F-region and topside ionosphere. Although the sampling frequency was well below the Nyquist frequency of F-region returns, we were able to estimate Te / Ti ratio and infer unbiased electron density estimates using a regularized inversion technique described here. The technique exploits magnetic aspect angle dependence of ISR cross-section for Te>Ti.
Guard, O; Fournet, F; Sautreaux, J L; Dumas, R
1983-01-01
Clinical, neuropsychological, and CT scan data are reported in a patient with a right prefrontal hematoma following meningeal hemorrhage due to the rupture of an aneurysm of the anterior communicating artery. Over a period of six weeks, before and after surgery, the patient presented a particular type of language disorder characterized by incoherent speech, verbal paraphasias, unexpected or guided along ideic perseverations, emphatic and affected terms, and impossibility of brief responses, particularly in denomination tests. Contrasting with the absurdity of the discourse, the respect of oral comprehension, the absence of grammatical disorders, and the perfect phonemic and phonetic organization provided evidence of the integrity of the linguistic code. The purely semantic disturbance, however, was the cause of the apparent alteration in reasoning and judgment. A major amnestic syndrome was also present. It improved concomitantly with the language disorders. The explanation proposed is that of a disturbance of an attention process and of word selection due to a prefrontal lesion.
Energy Technology Data Exchange (ETDEWEB)
Kirillin, I.V. [Akhiezer Institute for Theoretical Physics, National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkov (Ukraine); Shul' ga, N.F. [Akhiezer Institute for Theoretical Physics, National Science Center ' ' Kharkov Institute of Physics and Technology' ' , Kharkov (Ukraine); V.N. Karazin Kharkov National University, Kharkov (Ukraine); Bandiera, L. [INFN Sezione di Ferrara, Ferrara (Italy); Guidi, V.; Mazzolari, A. [INFN Sezione di Ferrara, Ferrara (Italy); Universita degli Studi di Ferrara, Dipartimento di Fisica e Scienze della Terra, Ferrara (Italy)
2017-02-15
An investigation on stochastic deflection of high-energy negatively charged particles in a bent crystal was carried out. On the basis of analytical calculation and numerical simulation it was shown that there is a maximum angle at which most of the beam is deflected. The existence of a maximum, which is taken in the correspondence of the optimal radius of curvature, is a novelty with respect to the case of positively charged particles, for which the deflection angle can be freely increased by increasing the crystal length. This difference has to be ascribed to the stronger contribution of incoherent scattering affecting the dynamics of negative particles that move closer to atomic nuclei and electrons. We therefore identified the ideal parameters for the exploitation of axial confinement for negatively charged particle beam manipulation in future high-energy accelerators, e.g., ILC or muon colliders. (orig.)
International Nuclear Information System (INIS)
Darwish, E.M.; Arenhoevel, H.; Schwamb, M.
2003-01-01
The contribution of incoherent single-pion photoproduction to the spin response of the deuteron, i.e., the asymmetry of the total photoabsorption cross-section with respect to parallel and antiparallel spins of photon and deuteron, is calculated over the region of the Δ-resonance with inclusion of final-state NN and πN rescattering. Sizeable effects, mainly from NN rescattering, are found leading to an appreciable reduction of the spin asymmetry. Furthermore, the contribution to the Gerasimov-Drell-Hearn integral is explicitly evaluated by integration up to a photon energy of 550 MeV. Final-state interaction reduces the value of the integral to about half of the value obtained for the pure impulse approximation. (orig.)
International Nuclear Information System (INIS)
Hubbell, J.H.
1993-01-01
This report reviews available information on polarization effects arising when photons in the X-ray and gamma-ray energy regime undergo coherent (Rayleigh) scattering and incoherent (Compton) scattering by atomic electrons. In addition to descriptions and discussions of these effects, including estimates of their magnitudes as they apply to radiation transport calculations, an annotated bibliography of 102 selected works covering the period 1905-1991 is provided, with particularly relevant works for the purpose of this report flagged with asterisks (*). A major resource for this report is a 1948 unpublished informal report by L.V. Spencer which has been quoted here almost in its entirety, since, of all the works cited in the annotated bibliography, it appears to be the only one which explicitly and directly addresses the purpose of this report. Hence this valuable material should be re-introduced into the available and current literature. (author). 119 refs., 7 figs
Bhandari, Anak; Hamre, Børge; Frette, Øvynd; Zhao, Lu; Stamnes, Jakob J; Kildemo, Morten
2011-06-01
A Lambert surface would appear equally bright from all observation directions regardless of the illumination direction. However, the reflection from a randomly scattering object generally has directional variation, which can be described in terms of the bidirectional reflectance distribution function (BRDF). We measured the BRDF of a Spectralon white reflectance standard for incoherent illumination at 405 and 680 nm with unpolarized and plane-polarized light from different directions of incidence. Our measurements show deviations of the BRDF for the Spectralon white reflectance standard from that of a Lambertian reflector that depend both on the angle of incidence and the polarization states of the incident light and detected light. The non-Lambertian reflection characteristics were found to increase more toward the direction of specular reflection as the angle of incidence gets larger.
Guo, Tan; Chen, Juan; Wu, Bing; Zheng, Dandan; Jiao, Sheng; Song, Yan; Chen, Min
2017-04-01
To investigate the hypothesis that the intravoxel incoherent motion (IVIM) diffusion-weighted imaging may depict microcirculation of meniscus and the perfusion changes in meniscal disorder. Fifty patients received diffusion-weighted MRI with multiple b-values ranging from 0 to 400 s/mm 2 . The four horns of the menisci were divided into normal, degenerated, and torn groups. IVIM parameters including perfusion fraction (f), pseudo-diffusion coefficient (D*), true diffusion coefficient (D), and the product of f and D* (f D*) of normal meniscal red zone and white zone were derived and compared for microcirculation changes of normal, degenerated, and torn posterior horn of the medial meniscus (PMM). The parameters between red and white zones among the groups were compared. Significant differences were considered when P meniscus and the perfusion changes in meniscal disorder. 3 J. Magn. Reson. Imaging 2017;45:1090-1096. © 2016 International Society for Magnetic Resonance in Medicine.
Directory of Open Access Journals (Sweden)
A. V. Mikhailov
1997-11-01
Full Text Available A self-consistent method for day-time F2-region modelling was applied to the analysis of Millstone Hill incoherent scatter observations during the storm period of March 16-22, 1990. The method allows us to calculate in a self-consistent way neutral composition, temperature and meridional wind as well as the ionized species height distribution. Theoretically calculated Ne(h profiles fit the observed daytime ones with great accuracy in the whole range of heights above 150 km for both quiet and disturbed days. The overall increase in Tex by 270 K from March 16 to March 22 reflects the increase of solar activity level during the period in question. A 30% decrease in [O] and a two-fold increase in [N2] are calculated for the disturbed day of March 22 relative to quiet time prestorm conditions. Only a small reaction to the first geomagnetic disturbance on March 18 and the initial phase of the second storm on March 20 was found in [O] and [N2] variations. The meridional neutral wind inferred from plasma vertical drift clearly demonstrates the dependence on the geomagnetic activity level being more equatorward on disturbed days. Small positive F2-layer storm effects on March 18 and 20 are totally attributed to the decrease in the northward neutral wind but not to changes in neutral composition. A moderate (by a factor of 1.5 O/N2 ratio decrease relative to the MSIS-83 model prediction is required to describe the observed NmF2 decrease on the most disturbed day of March 22, but virtually no change of this ratio is needed for March 21.
International Nuclear Information System (INIS)
Cercueil, Jean-Pierre; Petit, Jean-Michel; Nougaret, Stephanie; Pierredon-Foulongne, Marie-Ange; Schembri, Valentina; Delhom, Elisabeth; Guiu, Boris; Soyer, Philippe; Fohlen, Audrey; Schmidt, Sabine; Denys, Alban; Aho, Serge
2015-01-01
To determine whether a mono-, bi- or tri-exponential model best fits the intravoxel incoherent motion (IVIM) diffusion-weighted imaging (DWI) signal of normal livers. The pilot and validation studies were conducted in 38 and 36 patients with normal livers, respectively. The DWI sequence was performed using single-shot echoplanar imaging with 11 (pilot study) and 16 (validation study) b values. In each study, data from all patients were used to model the IVIM signal of normal liver. Diffusion coefficients (D i ± standard deviations) and their fractions (f i ± standard deviations) were determined from each model. The models were compared using the extra sum-of-squares test and information criteria. The tri-exponential model provided a better fit than both the bi- and mono-exponential models. The tri-exponential IVIM model determined three diffusion compartments: a slow (D 1 = 1.35 ± 0.03 x 10 -3 mm 2 /s; f 1 = 72.7 ± 0.9 %), a fast (D 2 = 26.50 ± 2.49 x 10 -3 mm 2 /s; f 2 = 13.7 ± 0.6 %) and a very fast (D 3 = 404.00 ± 43.7 x 10 -3 mm 2 /s; f 3 = 13.5 ± 0.8 %) diffusion compartment [results from the validation study]. The very fast compartment contributed to the IVIM signal only for b values ≤15 s/mm 2 The tri-exponential model provided the best fit for IVIM signal decay in the liver over the 0-800 s/mm 2 range. In IVIM analysis of normal liver, a third very fast (pseudo)diffusion component might be relevant. (orig.)
Doblas, Sabrina; Wagner, Mathilde; Leitao, Helena S; Daire, Jean-Luc; Sinkus, Ralph; Vilgrain, Valérie; Van Beers, Bernard E
2013-10-01
The objective of this study was to compare the value of the apparent diffusion coefficient (ADC) determined with 3 b values and the intravoxel incoherent motion (IVIM)-derived parameters in the determination of malignancy and characterization of hepatic tumor type. Seventy-six patients with 86 solid hepatic lesions, including 8 hemangiomas, 20 lesions of focal nodular hyperplasia, 9 adenomas, 30 hepatocellular carcinomas, 13 metastases, and 6 cholangiocarcinomas, were assessed in this prospective study. Diffusion-weighted images were acquired with 11 b values to measure the ADCs (with b = 0, 150, and 500 s/mm) and the IVIM-derived parameters, namely, the pure diffusion coefficient and the perfusion-related diffusion fraction and coefficient. The diffusion parameters were compared between benign and malignant tumors and between tumor types, and their diagnostic value in identifying tumor malignancy was assessed. The apparent and pure diffusion coefficients were significantly higher in benign than in malignant tumors (benign: 2.32 [0.87] × 10 mm/s and 1.42 [0.37] × 10 mm/s vs malignant: 1.64 [0.51] × 10 mm/s and 1.14 [0.28] × 10 mm/s, respectively; P coefficients provided similar accuracy in assessing tumor malignancy (areas under the receiver operating characteristic curve of 0.770 and 0.723, respectively). In the multigroup analysis, the ADC was found to be significantly higher in hemangiomas than in hepatocellular carcinomas, metastases, and cholangiocarcinomas. In the same manner, it was higher in lesions of focal nodular hyperplasia than in metastases and cholangiocarcinomas. However, the pure diffusion coefficient was significantly higher only in hemangiomas versus hepatocellular and cholangiocellular carcinomas. Compared with the ADC, the diffusion parameters derived from the IVIM model did not improve the determination of malignancy and characterization of hepatic tumor type.
Sigmund, E E; Baete, S H; Luo, T; Patel, K; Wang, D; Rossi, I; Duarte, A; Bruno, M; Mossa, D; Femia, A; Ramachandran, S; Stoffel, D; Babb, J S; Franks, A; Bencardino, J
2018-06-04
Dermatomyositis (DM) is an idiopathic inflammatory myopathy involving severe debilitation in need of diagnostics. We evaluated the proximal lower extremity musculature with diffusion tensor imaging (DTI), intravoxel incoherent motion (IVIM) and dynamic DTI in DM patients and controls and compared with standard clinical workup. METHODS: In this IRB-approved, HIPAA-compliant study with written informed consent, anatomical, Dixon fat/water and diffusion imaging were collected in bilateral thigh MRI of 22 controls and 27 DM patients in a 3T scanner. Compartments were scored on T1/T2 scales. Single voxel dynamic DTI metrics in quadriceps before and after 3-min leg exercise were measured. Spearman rank correlation and mixed model analysis of variance/covariance (ANOVA/ANCOVA) were used to correlate with T1 and T2 scores and to compare patients with controls. DM patients showed significantly lower pseudo-diffusion and volume in quadriceps than controls. All subjects showed significant correlation between T1 score and signal-weighted fat fraction; tissue diffusion and pseudo-diffusion varied significantly with T1 and T2 score in patients. Radial and mean diffusion exercise response in patients was significantly higher than controls. Static and dynamic diffusion imaging metrics show correlation with conventional imaging scores, reveal spatial heterogeneity, and provide means to differentiate dermatomyositis patients from controls. • Diffusion imaging shows regional differences between thigh muscles of dermatomyositis patients and controls. • Signal-weighted fat fraction and diffusion metrics correlate with T1/T2 scores of disease severity. • Dermatomyositis patients show significantly higher radial diffusion exercise response than controls.
Sooväli-Sepping, Helen, 1974-
2016-01-01
TLÜ keskkonnakorralduse professor ja linnakorralduse õppekava juht Helen Sooväli-Sepping, TTÜ maastikuarhitektuuri õppekava juht ja linnaplaneerija-urbanist Kristi Grišakov ning Stockholmi keskkonnainstituudi Tallinna keskuse liikuvus- ja keskkonnaekspert Mari Jüssi kinnitavad, et Reidi tee projekt ei ole endiselt inimsõbralik
Charehbili, Ayoub; Swijnenburg, Rutger-Jan; van de Velde, Cornelis; van den Bremer, Jephta; van Gijn, Willem
2014-06-01
Surgical site infection (SSI) is the most common hospital-acquired infection in the Netherlands. There is little evidence in regard to differences in the efficacy of pre-operative topical antisepsis with iodine-alcohol as compared with chlorhexidine-alcohol for preventing SSI. We conducted a retrospective analysis at a single center, involving all patients who underwent breast, colon, or vascular surgery in 2010 and 2011, in which pre-operative disinfection of the skin was done with iodine-alcohol in 2010 and with chlorhexidine-alcohol in 2011. Demographic characteristics, surgical parameters, and rates of SSI were compared in the two groups of patients. Subgroup analyses were done for wound classification, wound type, and type of surgery performed. Associations of patient characteristics with SSI were also investigated. Data were analyzed with χ(2) tests, Student t-tests, and logistic regression analysis. No statistically significant difference was found in the rates of SSI in the two study groups, at 6.1% for the patients who underwent antisepsis with iodine-alcohol and 3.8% for those who underwent disinfection with chlorhexidine-alcohol (p=0.20). After multivariable analysis, an odds ratio (OR) of 0.68 (95% confidence interval [CI] 0.30-1.47) in favor of chlorhexidine-alcohol was found. Male gender, acute surgery, absence of antibiotic prophylaxis, and longer hospital length of stay (LOS) were all associated with SSI after pre-operative topical antisepsis. In this single-center study conducted over a course of one year with each of the preparations investigated, no difference in the rate of SSI was found after an instantaneous protocol change from iodine-alcohol to chlorhexidine-alcohol for pre-operative topical antisepsis.
Wloch-Salamon, Dominika M; Tomala, Katarzyna; Aggeli, Dimitra; Dunn, Barbara
2017-06-07
Over its evolutionary history, Saccharomyces cerevisiae has evolved to be well-adapted to fluctuating nutrient availability. In the presence of sufficient nutrients, yeast cells continue to proliferate, but upon starvation haploid yeast cells enter stationary phase and differentiate into nonquiescent (NQ) and quiescent (Q) cells. Q cells survive stress better than NQ cells and show greater viability when nutrient-rich conditions are restored. To investigate the genes that may be involved in the differentiation of Q and NQ cells, we serially propagated yeast populations that were enriched for either only Q or only NQ cell types over many repeated growth-starvation cycles. After 30 cycles (equivalent to 300 generations), each enriched population produced a higher proportion of the enriched cell type compared to the starting population, suggestive of adaptive change. We also observed differences in each population's fitness suggesting possible tradeoffs: clones from NQ lines were better adapted to logarithmic growth, while clones from Q lines were better adapted to starvation. Whole-genome sequencing of clones from Q- and NQ-enriched lines revealed mutations in genes involved in the stress response and survival in limiting nutrients ( ECM21 , RSP5 , MSN1 , SIR4 , and IRA2 ) in both Q and NQ lines, but also differences between the two lines: NQ line clones had recurrent independent mutations affecting the Ssy1p-Ptr3p-Ssy5p (SPS) amino acid sensing pathway, while Q line clones had recurrent, independent mutations in SIR3 and FAS1 Our results suggest that both sets of enriched-cell type lines responded to common, as well as distinct, selective pressures. Copyright © 2017 Wloch-Salamon et al.
Zhao, Xuefei; Wang, Shuguang; Du, Dongsheng; Liu, Weiqing
2017-01-01
In this study, simplified numerical models are developed to analyze the soil-structure interaction (SSI) effect on frame structures equipped with viscoelastic dampers (VEDs) based on pile group foundation. First, a single degree-of-freedom (SDOF) oscillator is successfully utilized to replace the SDOF energy dissipated structure considering the SSI effect. The equivalent period and damping ratio of the system are obtained through analogical analysis using the frequency transfer function with adoption of the modal strain energy (MSE) technique. A parametric analysis is carried out to study the SSI effect on the performance of VEDs. Then the equilibrium equations of the multi degree-of-freedom (MDOF) structure with VEDs considering SSI effect are established in the frequency domain. Based on the assumption that the superstructure of the coupled system possesses the classical normal mode, the MDOF superstructure is decoupled to a set of individual SDOF systems resting on a rigid foundation with adoption of the MSE technique through formula derivation. Numerical results demonstrate that the proposed methods have the advantage of reducing computational cost, however, retaining the satisfactory accuracy. The numerical method proposed herein can provide a fast evaluation of the efficiency of VEDs considering the SSI effect.
Soil structure interaction analysis of buried tank subjected to vertical excitations
International Nuclear Information System (INIS)
Wong, C.K.; Stine, M.; Wagenblast, G.; Farnworth, S.
1995-09-01
Underground High Level Waste Storage Tanks are subjected to strigent seismic requirements At some DOE sites, many existing waste storage tanks are of the double-shell tank design. In this configuration, the concrete outer structure acts as the vault and provides secondary confinement for the primary steel waste storage tank. To ensure the safety of the design and a good understanding of the seismic response of the concrete confinement structure, seismic analysis, including the effects of Soil-Structure Interaction (SSI), is generally performed with special purpose SSI computer analysis programs. Generally, the seismic SSI response due to vertical excitation is considered to be secondary to those of the horizontal excitation. In this paper, a detailed evaluation of the SSI response due to vertical excitation is presented and is shown to merit equal consideration relative to the horizontal excitation. The geometry and relative dimensions (i.e. flexibility) of the structure can have significant influence on the vertical seismic SSI response in local region(s) of the concrete structure
Woods, Thomas N.; Eparvier, Francis G.; Harder, Jerald; Snow, Martin
2018-05-01
The solar spectral irradiance (SSI) dataset is a key record for studying and understanding the energetics and radiation balance in Earth's environment. Understanding the long-term variations of the SSI over timescales of the 11-year solar activity cycle and longer is critical for many Sun-Earth research topics. Satellite measurements of the SSI have been made since the 1970s, most of them in the ultraviolet, but recently also in the visible and near-infrared. A limiting factor for the accuracy of previous solar variability results is the uncertainties for the instrument degradation corrections, which need fairly large corrections relative to the amount of solar cycle variability at some wavelengths. The primary objective of this investigation has been to separate out solar cycle variability and any residual uncorrected instrumental trends in the SSI measurements from the Solar Radiation and Climate Experiment (SORCE) mission and the Thermosphere, Mesosphere, Ionosphere, Energetic, and Dynamics (TIMED) mission. A new technique called the Multiple Same-Irradiance-Level (MuSIL) analysis has been developed, which examines an SSI time series at different levels of solar activity to provide long-term trends in an SSI record, and the most common result is a downward trend that most likely stems from uncorrected instrument degradation. This technique has been applied to each wavelength in the SSI records from SORCE (2003 - present) and TIMED (2002 - present) to provide new solar cycle variability results between 27 nm and 1600 nm with a resolution of about 1 nm at most wavelengths. This technique, which was validated with the highly accurate total solar irradiance (TSI) record, has an estimated relative uncertainty of about 5% of the measured solar cycle variability. The MuSIL results are further validated with the comparison of the new solar cycle variability results from different solar cycles.
International Nuclear Information System (INIS)
Savage, David; Bennett, David; Apted, Mick; Saellfors, Goeran; Saario, Timo; Segle, Peter
2008-03-01
The Swedish Nuclear Fuel and Waste Management Company (SKB) has recently submitted a license application for the construction of a spent fuel encapsulation plant. SKB plans to submit a further license application in 2009 for the construction of a repository for the disposal spent nuclear fuel. In connection with the first of these applications, SKB published a safety report, known as SR-Can, which assessed the safety of a spent-fuel repository. The Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Authority (SSI) (the Authorities) will make formal reviews of the licence applications, and have, therefore, jointly commissioned a team of independent experts to assess and provide comments on SKB's safety reports. The Authorities will consider the views of the independent review team in completing their own reviews. This document presents the comments and findings of the Engineered Barrier System (EBS) review group on SR-Can. The SR-Can safety report includes an examination of EBS design and performance for a range of scenarios, including expected repository evolution and possible variant scenarios, that together address processes and events that might result in the loss of certain repository safety functions. Furthermore, a series of sensitivity analyses is also presented that provides helpful insights into the relative importance of many key parameters and processes related to the EBS. In general, the explanatory text of the SR-Can safety report is clear, and the cited references provide adequate technical justifications for the assumptions, models, and data that are abstracted into the SR-Can safety report. The review group considers, therefore, that SKB's development of SR-Can has been a very valuable exercise, and that SKB should be congratulated on the breadth, depth and general clarity of its research and development and safety assessment programmes. Notwithstanding these successes, the EBS review group has identified a range of
Energy Technology Data Exchange (ETDEWEB)
Savage, David (Quintessa Limited, Henley-on-Thames (GB)); Bennett, David (TerraSalus Limited, Oakham (GB)); Apted, Mick (Monitor Scientific LLC, Denver, CO (US)); Saellfors, Goeran (Chalmers Univ. of Technology, Goeteborg (SE)); Saario, Timo (VTT Materials and Building (FI)); Segle, Peter (Inspecta, Stockholm (SE))
2008-03-15
The Swedish Nuclear Fuel and Waste Management Company (SKB) has recently submitted a license application for the construction of a spent fuel encapsulation plant. SKB plans to submit a further license application in 2009 for the construction of a repository for the disposal spent nuclear fuel. In connection with the first of these applications, SKB published a safety report, known as SR-Can, which assessed the safety of a spent-fuel repository. The Swedish Nuclear Power Inspectorate (SKI) and the Swedish Radiation Protection Authority (SSI) (the Authorities) will make formal reviews of the licence applications, and have, therefore, jointly commissioned a team of independent experts to assess and provide comments on SKB's safety reports. The Authorities will consider the views of the independent review team in completing their own reviews. This document presents the comments and findings of the Engineered Barrier System (EBS) review group on SR-Can. The SR-Can safety report includes an examination of EBS design and performance for a range of scenarios, including expected repository evolution and possible variant scenarios, that together address processes and events that might result in the loss of certain repository safety functions. Furthermore, a series of sensitivity analyses is also presented that provides helpful insights into the relative importance of many key parameters and processes related to the EBS. In general, the explanatory text of the SR-Can safety report is clear, and the cited references provide adequate technical justifications for the assumptions, models, and data that are abstracted into the SR-Can safety report. The review group considers, therefore, that SKB's development of SR-Can has been a very valuable exercise, and that SKB should be congratulated on the breadth, depth and general clarity of its research and development and safety assessment programmes. Notwithstanding these successes, the EBS review group has identified a range
Lei, Chengmin; Gu, Yanran; Chen, Zilun; Wang, Zengfeng; Zhou, Pu; Ma, Yanxing; Xiao, Hu; Leng, Jinyong; Wang, Xiaolin; Hou, Jing; Xu, Xiaojun; Chen, Jinbao; Liu, Zejin
2018-04-16
We demonstrate an all-fiber 7 × 1 signal combiner with an output core diameter of 50 μm for high power incoherent beam combining of seven self-made Yb-doped single-mode fiber lasers around a wavelength of 1080 nm and output power of 2 kW. 14.1 kW combined output power is achieved with a total transmission efficiency of higher than 98.5% and a beam quality of M 2 = 5.37, which is close to the theoretical results based on finite-difference beam propagation technique. To the best of our knowledge, this is the highest output power ever reported for all-fiber structure beam combining generation, which indicates the feasibility and potential of >10 kW high brightness incoherent beam combining based on an all-fiber signal combiner.
International Nuclear Information System (INIS)
Arrighi, V.; Triolo, A.
1999-01-01
Complete text of publication follows. Results from the analysis of recent quasielastic neutron scattering (QENS) experiments on atactic polypropylene (aPP), are presented both in the sub-T g and above T g regimes. Experiments were carried out on the IRIS (ISIS, Rutherford Appleton Laboratory, UK) and IN10 (ILL FR) spectrometers in the temperature range from 140 to 400 K. Different instrumental resolutions were used in order to cover a wide energy window. The high resolution data collected on IN10 using the fixed energy scan technique, give clear evidence of two separate dynamic processes that we attribute to methyl group rotational hopping (below T g ) and to segmental motion (above T g ), respectively. Data were fitted using a model involving a distribution of relaxation rates. The IN10 results are used in interpreting and analyzing the QENS data from the IRIS spectrometer. In order to exploit the different energy resolutions of IRIS, Fourier inversion of the experimental data was carried out. This approach to data analysis allows us to widen the energy range available for data analysis. Due to the high activation energy of the methyl group hopping in aPP, this motion overlaps with the segmental relaxation, thus making analysis of high temperature data quite complex. The IN10 results are employed in order to perform data analysis in terms of two distinct processes. (author)
Togao, Osamu; Hiwatashi, Akio; Yamashita, Koji; Kikuchi, Kazufumi; Momosaka, Daichi; Yoshimoto, Koji; Kuga, Daisuke; Mizoguchi, Masahiro; Suzuki, Satoshi O; Iwaki, Toru; Van Cauteren, Marc; Iihara, Koji; Honda, Hiroshi
2018-05-01
To evaluate the quantification performance of the perfusion fraction (f) measured with intravoxel incoherent motion (IVIM) MR imaging in a comparison with the histological vascular density in meningiomas. 29 consecutive patients with meningioma (59.0 ± 16.8 years old, 8 males and 21 females) who underwent a subsequent surgical resection were examined with both IVIM imaging and a histopathological analysis. IVIM imaging was conducted using a single-shot SE-EPI sequence with 13 b-factors (0, 10, 20, 30, 50, 80, 100, 200, 300, 400, 600, 800, 1000 s mm - 2 ) at 3T. The perfusion fraction (f) was calculated by fitting the IVIM bi-exponential model. The 90-percentile f-value in the tumor region-of-interest (ROI) was defined as the maximum f-value (f-max). Histopathological vascular density (%Vessel) was measured on CD31-immunostainted histopathological specimens. The correlation and agreement between the f-values and %Vessel was assessed. The f-max (15.5 ± 5.5%) showed excellent agreement [intraclass correlation coefficient (ICC) = 0.754] and a significant correlation (r = 0.69, p < 0.0001) with the %Vessel (12.9 ± 9.4%) of the tumors. The Bland-Altman plot analysis showed excellent agreement between the f-max and %Vessel (bias, -2.6%; 95% limits of agreement, from -16.0 to 10.8%). The f-max was not significantly different among the histological subtypes of meningioma. An excellent agreement and a significant correlation were observed between the f-values and %Vessel. The f-value can be used as a noninvasive quantitative imaging measure to directly assess the vascular volume fraction in brain tumors. Advances in knowledge: The f-value measured by IVIM imaging showed a significant correlation and an excellent agreement with the histological vascular density in the meningiomas. The f-value can be used as a noninvasive and quantitative imaging measure to directly assess the volume fraction of capillaries in brain tumors.
Energy Technology Data Exchange (ETDEWEB)
He, Peng; Gao, Xinliang; Lu, Quanming; Wang, Shui, E-mail: gaoxl@mail.ustc.edu.cn [CAS Key Laboratory of Geospace Environment, Department of Geophysics and Planetary Science, University of Science and Technology of China, Hefei 230026 (China)
2016-08-10
The preferential heating of heavy ions in the solar corona and solar wind has been a long-standing hot topic. In this paper we use a one-dimensional hybrid simulation model to investigate the heating of He{sup 2+} particles during the parametric instabilities of parallel propagating Alfvén waves with an incoherent spectrum. The evolution of the parametric instabilities has two stages and involves the heavy ion heating during the entire evolution. In the first stage, the density fluctuations are generated by the modulation of the pump Alfvén waves with a spectrum, which then results in rapid coupling with the pump Alfvén waves and the cascade of the magnetic fluctuations. In the second stage, each pump Alfvén wave decays into a forward density mode and a backward daughter Alfvén mode, which is similar to that of a monochromatic pump Alfvén wave. In both stages the perpendicular heating of He{sup 2+} particles occurs. This is caused by the cyclotron resonance between He{sup 2+} particles and the high-frequency magnetic fluctuations, whereas the Landau resonance between He{sup 2+} particles and the density fluctuations leads to the parallel heating of He{sup 2+} particles. The influence of the drift velocity between the protons and the He{sup 2+} particles on the heating of He{sup 2+} particles is also discussed in this paper.
Buzi, Gentian; Khammash, Mustafa
2016-06-01
Biological systems use a variety of mechanisms to deal with the uncertain nature of their external and internal environments. Two of the most common motifs employed for this purpose are the incoherent feedforward (IFF) and feedback (FB) topologies. Many theoretical and experimental studies suggest that these circuits play very different roles in providing robustness to uncertainty in the cellular environment. Here, we use a control theoretic approach to analyze two common FB and IFF architectures that make use of an intermediary species to achieve regulation. We show the equivalence of both circuits topologies in suppressing static cell-to-cell variations. While both circuits can suppress variations due to input noise, they are ineffective in suppressing inherent chemical reaction stochasticity. Indeed, these circuits realize comparable improvements limited to a modest 25% variance reduction in best case scenarios. Such limitations are attributed to the use of intermediary species in regulation, and as such, they persist even for circuit architectures that combine both IFF and FB features. Intriguingly, while the FB circuits are better suited in dealing with dynamic input variability, the most significant difference between the two topologies lies not in the structural features of the circuits, but in their practical implementation considerations.
Directory of Open Access Journals (Sweden)
Gentian Buzi
2016-06-01
Full Text Available Biological systems use a variety of mechanisms to deal with the uncertain nature of their external and internal environments. Two of the most common motifs employed for this purpose are the incoherent feedforward (IFF and feedback (FB topologies. Many theoretical and experimental studies suggest that these circuits play very different roles in providing robustness to uncertainty in the cellular environment. Here, we use a control theoretic approach to analyze two common FB and IFF architectures that make use of an intermediary species to achieve regulation. We show the equivalence of both circuits topologies in suppressing static cell-to-cell variations. While both circuits can suppress variations due to input noise, they are ineffective in suppressing inherent chemical reaction stochasticity. Indeed, these circuits realize comparable improvements limited to a modest 25% variance reduction in best case scenarios. Such limitations are attributed to the use of intermediary species in regulation, and as such, they persist even for circuit architectures that combine both IFF and FB features. Intriguingly, while the FB circuits are better suited in dealing with dynamic input variability, the most significant difference between the two topologies lies not in the structural features of the circuits, but in their practical implementation considerations.
Chin, A. W.; Mangaud, E.; Atabek, O.; Desouter-Lecomte, M.
2018-06-01
Engineering and harnessing coherent excitonic transport in organic nanostructures has recently been suggested as a promising way towards improving manmade light-harvesting materials. However, realizing and testing the dissipative system-environment models underlying these proposals is presently very challenging in supramolecular materials. A promising alternative is to use simpler and highly tunable "quantum simulators" built from programmable qubits, as recently achieved in a superconducting circuit by Potočnik et al. [A. Potočnik et al., Nat. Commun. 9, 904 (2018), 10.1038/s41467-018-03312-x]. We simulate the real-time dynamics of an exciton coupled to a quantum bath as it moves through a network based on the quantum circuit of Potočnik et al. Using the numerically exact hierarchical equations of motion to capture the open quantum system dynamics, we find that an ultrafast but completely incoherent relaxation from a high-lying "bright" exciton into a doublet of closely spaced "dark" excitons can spontaneously generate electronic coherences and oscillatory real-space motion across the network (quantum beats). Importantly, we show that this behavior also survives when the environmental noise is classically stochastic (effectively high temperature), as in present experiments. These predictions highlight the possibilities of designing matched electronic and spectral noise structures for robust coherence generation that do not require coherent excitation or cold environments.
Li, Guangqi; Govind, Niranjan; Ratner, Mark A; Cramer, Christopher J; Gagliardi, Laura
2015-12-17
The mechanism of charge transfer has been observed to change from tunneling to hopping with increasing numbers of DNA base pairs in polynucleotides and with the length of molecular wires. The aim of this paper is to investigate this transition by examining the population dynamics using a tight-binding Hamiltonian with model parameters to describe a linear donor-bridge-acceptor (D-B-A) system. The model includes a primary vibration and an electron-vibration coupling at each site. A further coupling of the primary vibration with a secondary phonon bath allows the system to dissipate energy to the environment and reach a steady state. We apply the quantum master equation (QME) approach, based on second-order perturbation theory in a quantum dissipative system, to examine the dynamical processes involved in charge-transfer and follow the population transfer rate at the acceptor, ka, to shed light on the transition from tunneling to hopping. With a small tunneling parameter, V, the on-site population tends to localize and form polarons, and the hopping mechanism dominates the transfer process. With increasing V, the population tends to be delocalized and the tunneling mechanism dominates. The competition between incoherent hopping and coherent tunneling governs the mechanism of charge transfer. By varying V and the total number of sites, we also examine the onset of the transition from tunneling to hopping with increasing length.
Energy Technology Data Exchange (ETDEWEB)
Lecler, Augustin [Fondation Ophtalmologique Adolphe de Rothschild, Department of Radiology, Paris (France); Cardiovascular Research Centre - PARCC, Universite Paris Descartes Sorbonne Paris Cite, INSERM UMR-S970, Paris (France); Savatovsky, Julien; Sadik, Jean-Claude; Charbonneau, Frederique; Berges, Olivier [Fondation Ophtalmologique Adolphe de Rothschild, Department of Radiology, Paris (France); Balvay, Daniel [Cardiovascular Research Centre - PARCC, Universite Paris Descartes Sorbonne Paris Cite, INSERM UMR-S970, Paris (France); Zmuda, Mathieu; Galatoire, Olivier [Fondation Ophtalmologique Adolphe de Rothschild, Department of Orbitopalpebral Surgery, Paris (France); Picard, Herve [Fondation Ophtalmologique Adolphe de Rothschild, Clinical Research Unit, Paris (France); Fournier, Laure [Cardiovascular Research Centre - PARCC, Universite Paris Descartes Sorbonne Paris Cite, INSERM UMR-S970, Paris (France); Universite Paris Descartes Sorbonne Paris Cite, Assistance Publique-Hopitaux de Paris, Hopital Europeen Georges Pompidou, Radiology Department, Paris (France)
2017-12-15
To evaluate repeatability of intravoxel incoherent motion (IVIM) diffusion-weighted imaging (DWI) parameters in the orbit. From December 2015 to March 2016, 22 patients were scanned twice using an IVIM sequence with 15b values (0-2,000 s/mm{sup 2}) at 3.0T. Two readers independently delineated regions of interest in an orbital mass and in different intra-orbital and extra-orbital structures. Short-term test-retest repeatability and inter-observer agreement were assessed using the intra-class correlation coefficient (ICC), the coefficient of variation (CV) and Bland-Altman limits of agreements (BA-LA). Test-retest repeatability of IVIM parameters in the orbital mass was satisfactory for ADC and D (mean CV 12% and 14%, ICC 95% and 93%), poor for f and D*(means CV 43% and 110%, ICC 90% and 65%). Inter-observer repeatability agreement was almost perfect in the orbital mass for all the IVIM parameters (ICC = 95%, 93%, 94% and 90% for ADC, D, f and D*, respectively). IVIM appeared to be a robust tool to measure D in orbital lesions with good repeatability, but this approach showed a poor repeatability of f and D*. (orig.)
Buzi, Gentian; Khammash, Mustafa
2016-01-01
Biological systems use a variety of mechanisms to deal with the uncertain nature of their external and internal environments. Two of the most common motifs employed for this purpose are the incoherent feedforward (IFF) and feedback (FB) topologies. Many theoretical and experimental studies suggest that these circuits play very different roles in providing robustness to uncertainty in the cellular environment. Here, we use a control theoretic approach to analyze two common FB and IFF architectures that make use of an intermediary species to achieve regulation. We show the equivalence of both circuits topologies in suppressing static cell-to-cell variations. While both circuits can suppress variations due to input noise, they are ineffective in suppressing inherent chemical reaction stochasticity. Indeed, these circuits realize comparable improvements limited to a modest 25% variance reduction in best case scenarios. Such limitations are attributed to the use of intermediary species in regulation, and as such, they persist even for circuit architectures that combine both IFF and FB features. Intriguingly, while the FB circuits are better suited in dealing with dynamic input variability, the most significant difference between the two topologies lies not in the structural features of the circuits, but in their practical implementation considerations. PMID:27257684
Vijayakumar, A; Rosen, Joseph
2017-06-12
Recording digital holograms without wave interference simplifies the optical systems, increases their power efficiency and avoids complicated aligning procedures. We propose and demonstrate a new technique of digital hologram acquisition without two-wave interference. Incoherent light emitted from an object propagates through a random-like coded phase mask and recorded directly without interference by a digital camera. In the training stage of the system, a point spread hologram (PSH) is first recorded by modulating the light diffracted from a point object by the coded phase masks. At least two different masks should be used to record two different intensity distributions at all possible axial locations. The various recorded patterns at every axial location are superposed in the computer to obtain a complex valued PSH library cataloged to its axial location. Following the training stage, an object is placed within the axial boundaries of the PSH library and the light diffracted from the object is once again modulated by the same phase masks. The intensity patterns are recorded and superposed exactly as the PSH to yield a complex hologram of the object. The object information at any particular plane is reconstructed by a cross-correlation between the complex valued hologram and the appropriate element of the PSH library. The characteristics and the performance of the proposed system were compared with an equivalent regular imaging system.
Energy Technology Data Exchange (ETDEWEB)
Spitale, G.C.; Bloom, S.D.
1976-05-12
Differential cross sections for incoherent scattering by K-shell electrons were measured, using coincidence techniques, for incident photons having energies of 662 keV, 320 keV, and 145 keV. The spectral distributions of the scattered photons emerging at scattering angles from 20/sup 0/ to about 140/sup 0/ are reported. Target materials were iron, tin, holmium, and gold at 320 keV; tin and gold at 662 keV; and iron and tin at 145 keV. A typical energy spectrum consists of a scattered peak that is much narrower than would be expected from the bound state electron motion. The peak also, typically, reaches a broad maximum width for scattering angles between 45/sup 0/ and 60/sup 0/. Rather than monotonically increasing with atomic number the peak width reaches a broad maximum, generally, between Z = 50 and Z = 67, and then decreases with increasing atomic number. No Compton defect appears in any of the peaks to within +- 20 keV. A discussion of the expected magnitude of the Compton defect is included. The peak is superimposed on a continuum that diverges at the low end of the scattered photon spectrum for the following cases: gold, holmium, and tin targets for 320-keV incident photons; gold and possibly tin targets for 662-keV photons incident. This infrared divergence is expected on theoretical grounds and has been predicted. It is very nearly isotropic.
Martini, M.; Chanfray, G.; Marteau, J.
2009-01-01
We present a theory of neutrino interactions with nuclei aimed at the description of the partial cross-sections, namely quasi-elastic and multi-nucleon emission, coherent and incoherent single pion production. For this purpose, we use the theory of nuclear responses treated in the random phase approximation, which allows a unified description of these channels. It is particularly suited for the coherent pion production where collective effects are important whereas they are moderate in the other channels. We also study the evolution of the neutrino cross-sections with the mass number from carbon to calcium. We compare our approach to the available neutrino experimental data on carbon. We put a particular emphasis on the multi-nucleon channel, which at present is not easily distinguishable from the quasi-elastic events. This component turns out to be quite relevant for the interpretation of experiments (K2K, MiniBooNE, SciBooNE). It can account in particular for the unexpected behavior of the quasi-elastic cro...
Directory of Open Access Journals (Sweden)
D. L. Hysell
2004-09-01
Full Text Available Common-volume observations of sporadic E-layers made on 14-15 June 2002 with the Arecibo incoherent scatter radar and a 30MHz coherent scatter radar imager located on St. Croix are described. Operating in dual-beam mode, the Arecibo radar detected a slowly descending sporadic E-layer accompanied by a series of dense E-region plasma clouds at a time when the coherent scatter radar was detecting quasi-periodic (QP echoes. Using coherent radar imaging, we collocate the sources of the coherent scatter with the plasma clouds observed by Arecibo. In addition to patchy, polarized scattering regions drifting through the radar illuminated volume, which have been observed in previous imaging experiments, the 30MHz radar also detected large-scale electrostatic waves in the E-region over Puerto Rico, with a wavelength of about 30km and a period of about 10min, propagating to the southwest. Both the intensity and the Doppler shifts of the coherent echoes were modulated by the wave.
International Nuclear Information System (INIS)
Lecler, Augustin; Savatovsky, Julien; Sadik, Jean-Claude; Charbonneau, Frederique; Berges, Olivier; Balvay, Daniel; Zmuda, Mathieu; Galatoire, Olivier; Picard, Herve; Fournier, Laure
2017-01-01
To evaluate repeatability of intravoxel incoherent motion (IVIM) diffusion-weighted imaging (DWI) parameters in the orbit. From December 2015 to March 2016, 22 patients were scanned twice using an IVIM sequence with 15b values (0-2,000 s/mm 2 ) at 3.0T. Two readers independently delineated regions of interest in an orbital mass and in different intra-orbital and extra-orbital structures. Short-term test-retest repeatability and inter-observer agreement were assessed using the intra-class correlation coefficient (ICC), the coefficient of variation (CV) and Bland-Altman limits of agreements (BA-LA). Test-retest repeatability of IVIM parameters in the orbital mass was satisfactory for ADC and D (mean CV 12% and 14%, ICC 95% and 93%), poor for f and D*(means CV 43% and 110%, ICC 90% and 65%). Inter-observer repeatability agreement was almost perfect in the orbital mass for all the IVIM parameters (ICC = 95%, 93%, 94% and 90% for ADC, D, f and D*, respectively). IVIM appeared to be a robust tool to measure D in orbital lesions with good repeatability, but this approach showed a poor repeatability of f and D*. (orig.)
Lumpkin, Alex H; Berg, W J; Lewellen, J W; Sereno, N S; Happek, U
2000-01-01
The Advanced Photon Source (APS) injector linac has been reconfigured with a low-emittance RF thermionic gun and a photocathode (PC) RF gun to support self-amplified spontaneous emission (SASE) free-electron laser (FEL) experiments. One of the most critical parameters for optimizing SASE performance (gain length) is the electron beam peak current, which requires a charge measurement and a bunch length measurement capability. We report here initial measurements of the latter using both incoherent optical transition radiation (OTR) and coherent transition radiation (CTR). A visible light Hamamatsu C5680 synchroscan streak camera was used to measure the thermionic RF gun beam's bunch length (sigma approx 2-3 ps) via OTR generated by the beam at 220 MeV and 200 mA macropulse average current. In addition, a CTR monitor (Michelson Interferometer) based on a Golay cell as the far-infrared (FIR) detector has been installed at the 40-MeV station in the beamline. Initial observations of CTR signal strength variation wi...
International Nuclear Information System (INIS)
Sanz, Alejandro; Ruppel, Markus; Cabral, Joao T; Douglas, Jack F
2008-01-01
We utilize inelastic incoherent neutron scattering (INS) to quantify how fullerenes affect the 'fast' molecular dynamics of a family of polystyrene related macromolecules. In particular, we prepared bulk nanocomposites of (hydrogenous and ring-deuterated) polystyrene and poly(4-methyl styrene) using a rapid precipitation method where the C 60 relative mass fraction ranged from 0% to 4%. Elastic window scan measurements, using a high resolution (0.9 μeV) backscattering spectrometer, are reported over a wide temperature range (2-450 K). Apparent Debye-Waller (DW) factors 2 >, characterizing the mean-square amplitude of proton displacements, are determined as a function of temperature, T. We find that the addition of C 60 to these polymers leads to a progressive increase in 2 > relative to the pure polymer value over the entire temperature range investigated, where the effect is larger for larger nanoparticle concentration. This general trend seems to indicate that the C 60 nanoparticles plasticize the fast (∼10 -15 s) local (∼1 A) dynamics of these polymer glasses. Generally, we expect nanoparticle additives to affect polymer dynamics in a similar fashion to thin films in the sense that the high interfacial area may cause both a speeding up and slowing down of the glass state dynamics depending on the polymer-surface interaction
International Nuclear Information System (INIS)
Klotz, S.; Strassle, Th.; Philippe, J.; Salzmann, C.G.; Parker, S.F.
2005-01-01
We report the vibrational spectrum of recovered ice VII measured by inelastic incoherent neutron scattering and compare this to similar data of its fully hydrogen-ordered form, ice VIII, under exactly the same conditions (15 K, 1 bar). The spectra of the two phases have their principal features at similar energies, in both the translational and vibrational bands, with a substantial disorder-related broadening in ice VII. In particular, we find no evidence for a peak at 49 meV in ice VII which earlier was associated with the possible existence of two kinds of hydrogen bonds. Additional Raman measurements in ice VII and ice VIII show that the O-H stretching frequencies in the two phases are almost identical. Therefore, the presence of split molecular-optic bands in ice phases, including ordinary ice Ih, is likely related to an incomplete description of the phonon dispersion rather than to a fundamentally new feature in the nature of the hydrogen bond. (authors)
Fink, J.; Rienks, E. D. L.; Thirupathaiah, S.; Nayak, J.; van Roekeghem, A.; Biermann, S.; Wolf, T.; Adelmann, P.; Jeevan, H. S.; Gegenwart, P.; Wurmehl, S.; Felser, C.; Büchner, B.
2017-04-01
Angle-resolved photoemission spectroscopy is used to study the scattering rates of charge carriers from the hole pockets near Γ in the iron-based high-Tc hole-doped superconductors KxBa1 -xFe2As2 , x =0.4 , and KxEu1 -xFe2As2 , x =0.55 , and the electron-doped compound Ba (Fe1-xCox) 2As2 , x =0.075 . The scattering rate for any given band is found to depend linearly on the energy, indicating a non-Fermi-liquid regime. The scattering rates in the hole-doped compound are considerably higher than those in the electron-doped compounds. In the hole-doped systems the scattering rate of the charge carriers of the inner hole pocket is about three times higher than the binding energy, indicating that the spectral weight is heavily incoherent. The strength of the scattering rates and the difference between electron- and hole-doped compounds signals the importance of Hund's exchange coupling for correlation effects in these iron-based high-Tc superconductors. The experimental results are in qualitative agreement with theoretical calculations in the framework of combined density functional dynamical mean-field theory.
A situational analysis of child and adolescent mental health services ...
African Journals Online (AJOL)
findings of a situational analysis of CA mental health policy and services in ... are part of a 5 year study, the Mental Health and Poverty Project, which aims to provide new knowledge regarding ..... children, they think its bad omen” (SSI, key.
Diehl, Manfred; Hay, Elizabeth L
2010-09-01
This study observed young, middle-aged, and older adults (N = 239; Mage = 49.6 years; range = 18-89 years) for 30 consecutive days to examine the association between daily stress and negative affect, taking into account potential risk (i.e., self-concept incoherence) and resilience (i.e., age, perceived personal control) factors. Results indicated that younger individuals and individuals with a more incoherent self-concept showed higher average negative affect across the study. As well, individuals reported higher negative affect on days that they experienced more stress than usual and on days that they reported less control than usual. These main effects were qualified by significant interactions. In particular, the association between daily stress and negative affect was stronger on days on which adults reported low control compared with days on which they reported high control (i.e., perceptions of control buffered stress). Reactivity to daily stress did not differ for individuals of different ages or for individuals with different levels of self-concept incoherence. Although all individuals reported higher negative affect on days on which they reported less control than usual, this association was more pronounced among younger adults. The current study helps to elucidate the role of risk and resilience factors when adults are faced with daily stress.
OVERVIEW ON BNL ASSESSMENT OF SEISMIC ANALYSIS METHODS FOR DEEPLY EMBEDDED NPP STRUCTURES
International Nuclear Information System (INIS)
XU, J.; COSTANTINO, C.; HOFMAYER, C.; GRAVES, H.
2007-01-01
A study was performed by Brookhaven National Laboratory (BNL) under the sponsorship of the U. S. Nuclear Regulatory Commission (USNRC), to determine the applicability of established soil-structure interaction analysis methods and computer programs to deeply embedded and/or buried (DEB) nuclear power plant (NPP) structures. This paper provides an overview of the BNL study including a description and discussions of analyses performed to assess relative performance of various SSI analysis methods typically applied to NPP structures, as well as the importance of interface modeling for DEB structures. There are four main elements contained in the BNL study: (1) Review and evaluation of existing seismic design practice, (2) Assessment of simplified vs. detailed methods for SSI in-structure response spectrum analysis of DEB structures, (3) Assessment of methods for computing seismic induced earth pressures on DEB structures, and (4) Development of the criteria for benchmark problems which could be used for validating computer programs for computing seismic responses of DEB NPP structures. The BNL study concluded that the equivalent linear SSI methods, including both simplified and detailed approaches, can be extended to DEB structures and produce acceptable SSI response calculations, provided that the SSI response induced by the ground motion is very much within the linear regime or the non-linear effect is not anticipated to control the SSI response parameters. The BNL study also revealed that the response calculation is sensitive to the modeling assumptions made for the soil/structure interface and application of a particular material model for the soil
International Nuclear Information System (INIS)
NIE, J.; XU, J.; COSTANTINO, C.; THOMAS, V.
2007-01-01
Brookhaven National Laboratory (BNL) undertook an effort to revise the CARES (Computer Analysis for Rapid Evaluation of Structures) program under the auspices of the US Nuclear Regulatory Commission (NRC). The CARES program provided the NRC staff a capability to quickly check the validity and/or accuracy of the soil-structure interaction (SSI) models and associated data received from various applicants. The aim of the current revision was to implement various probabilistic simulation algorithms in CARES (referred hereinafter as P-CARES [1]) for performing the probabilistic site response and soil-structure interaction (SSI) analyses. This paper provides an overview of the development process of P-CARES, including the various probabilistic simulation techniques used to incorporate the effect of site soil uncertainties into the seismic site response and SSI analyses and an improved graphical user interface (GUI)
Oaida, CM; Xue, Y; Flanner, MG; Skiles, SMK; De Sales, F; Painter, TH
2015-01-01
© 2015. American Geophysical Union. All Rights Reserved. Two important factors that control snow albedo are snow grain growth and presence of light-absorbing impurities (aerosols) in snow. However, current regional climate models do not include such processes in a physically based manner in their land surface models. We improve snow albedo calculations in the Simplified Simple Biosphere (SSiB) land surface model coupled with the Weather Research and Forecasting (WRF) regional climate model (R...
International Nuclear Information System (INIS)
Sagar, Budhi; Egan, Michael; Roehlig, Klaus-Juergen; Chapman, Neil; Wilmot, Roger
2008-03-01
In 2006, SKB published a safety assessment (SR-Can) as part of its work to support a licence application for the construction of a final repository for spent nuclear fuel. The purposes of the SR-Can project were stated in the main project report to be: 1. To make a first assessment of the safety of potential KBS-3 repositories at Forsmark and Laxemar to dispose of canisters as specified in the application for the encapsulation plant. 2. To provide feedback to design development, to SKB's research and development (R and D) programme, to further site investigations and to future safety assessments. 3. To foster a dialogue with the authorities that oversee SKB's activities, i.e. the Swedish Nuclear Power Inspectorate, SKI, and the Swedish Radiation Protection Authority, SSI, regarding interpretation of applicable regulations, as a preparation for the SR-Site project. To help inform their review of SKB's proposed approach to development of the longterm safety case, the authorities appointed three international expert review teams to carry out a review of SKB's SR-Can safety assessment report. Comments from one of these teams - the Safety Assessment Methodology (SAM) review team - are presented in this document. The SAM review team's scope of work included an examination of SKB's documentation of the assessment ('Long-term safety for KBS-3 Repositories at Forsmark and Laxemar - a first evaluation' and several supporting reports) and hearings with SKB staff and contractors, held in March 2007. As directed by SKI and SSI, the SAM review team focused on methodological aspects and sought to determine whether SKB's proposed safety assessment methodology is likely to be suitable for use in the future SR-Site and to assess its consistency with the Swedish regulatory framework. No specific evaluation of long-term safety or site acceptability was undertaken by any of the review teams. SKI and SSI's Terms of Reference for the SAM review team requested that consideration be given
International Nuclear Information System (INIS)
Dverstorp, Bjoern; Moberg, Leif; Wiebert, Anders; Xu Shulan; Stroemberg, Bo; Kautsky, Fritz; Lilja, Christina; Simic, Eva; Sundstroem, Benny; Toverud, Oeivind
2005-07-01
This report presents the findings of a review of the Swedish Nuclear Fuel and Waste Management Co.'s (SKB) interim report of the safety assessment SR-Can (SKB TR 04-11), conducted by the Swedish Radiation Protection Authority (SSI) and the Swedish Nuclear Power Inspectorate (SKI). SKB's interim report describes and exemplifies the safety assessment methodology that SKB plans to use in the oncoming licence applications for an encapsulation plant and a final repository for spent nuclear fuel. The authorities' review takes into account the findings of an international peer review of SKB's interim report. The authorities conclude that SKB has improved its safety assessment methodology in several aspects compared to earlier safety reports. Among other things the authorities commend SKB for giving a comprehensive account of relevant regulations and guidance, and for the systematic approach to identification and documentation of features, events and processes that need to be considered in the safety assessment. However, the authorities also conclude that important parts of SKB's method need to be further developed before they are mature enough to be used as a basis for a license application. The authorities' overall assessment is summarised in chapter 8 of this report
International Nuclear Information System (INIS)
Paeivioe Jonsson, Josefin
2008-01-01
Many activities will cease at the closure of a repository, but not responsibilities. The candidate municipalities in Sweden expressed concern about who will take over after the implementer is released from responsibility for the facility. The government thus commissioned SKI (Swedish Nuclear Power Inspectorate) and SSI (Swedish Radiation Protection Authority) to review the legal obligations of institutional players as laid out today in legislation in Sweden. After closure of the repository in about 100 years there will be post-closure monitoring, possibly for a few hundred years. This will be a part of the conditions on SKB (Swedish Nuclear Fuel and Waste Management Company) which will be set out at the time. Some activities will end at the closure of the facility but monitoring and safeguards obligations may continue. The exact nature of this monitoring and safeguard work needs to be discussed and agreed upon. With the proposed approach most of the liabilities rest with the state in the long term, the waste producers only have liabilities in the short term but their decisions could have big impacts on long term liabilities
Optimization of intra-voxel incoherent motion imaging at 3.0 Tesla for fast liver examination.
Leporq, Benjamin; Saint-Jalmes, Hervé; Rabrait, Cecile; Pilleul, Frank; Guillaud, Olivier; Dumortier, Jérôme; Scoazec, Jean-Yves; Beuf, Olivier
2015-05-01
Optimization of multi b-values MR protocol for fast intra-voxel incoherent motion imaging of the liver at 3.0 Tesla. A comparison of four different acquisition protocols were carried out based on estimated IVIM (DSlow , DFast , and f) and ADC-parameters in 25 healthy volunteers. The effects of respiratory gating compared with free breathing acquisition then diffusion gradient scheme (simultaneous or sequential) and finally use of weighted averaging for different b-values were assessed. An optimization study based on Cramer-Rao lower bound theory was then performed to minimize the number of b-values required for a suitable quantification. The duration-optimized protocol was evaluated on 12 patients with chronic liver diseases No significant differences of IVIM parameters were observed between the assessed protocols. Only four b-values (0, 12, 82, and 1310 s.mm(-2) ) were found mandatory to perform a suitable quantification of IVIM parameters. DSlow and DFast significantly decreased between nonadvanced and advanced fibrosis (P < 0.05 and P < 0.01) whereas perfusion fraction and ADC variations were not found to be significant. Results showed that IVIM could be performed in free breathing, with a weighted-averaging procedure, a simultaneous diffusion gradient scheme and only four optimized b-values (0, 10, 80, and 800) reducing scan duration by a factor of nine compared with a nonoptimized protocol. Preliminary results have shown that parameters such as DSlow and DFast based on optimized IVIM protocol can be relevant biomarkers to distinguish between nonadvanced and advanced fibrosis. © 2014 Wiley Periodicals, Inc.
Mudanyali, Onur; Tseng, Derek; Oh, Chulwoo; Isikman, Serhan O.; Sencan, Ikbal; Bishara, Waheb; Oztoprak, Cetin; Seo, Sungkyu; Khademhosseini, Bahar; Ozcan, Aydogan
2010-01-01
Despite the rapid progress in optical imaging, most of the advanced microscopy modalities still require complex and costly set-ups that unfortunately limit their use beyond well equipped laboratories. In the meantime, microscopy in resource-limited settings has requirements significantly different from those encountered in advanced laboratories, and such imaging devices should be cost-effective, compact, light-weight and appropriately accurate and simple to be usable by minimally trained personnel. Furthermore, these portable microscopes should ideally be digitally integrated as part of a telemedicine network that connects various mobile health-care providers to a central laboratory or hospital. Toward this end, here we demonstrate a lensless on-chip microscope weighing ~46 grams with dimensions smaller than 4.2cm × 4.2cm × 5.8cm that achieves sub-cellular resolution over a large field of view of ~24 mm2. This compact and light-weight microscope is based on digital in-line holography and does not need any lenses, bulky optical/mechanical components or coherent sources such as lasers. Instead, it utilizes a simple light-emitting-diode (LED) and a compact opto-electronic sensor-array to record lensless holograms of the objects, which then permits rapid digital reconstruction of regular transmission or differential interference contrast (DIC) images of the objects. Because this lensless incoherent holographic microscope has orders-of-magnitude improved light collection efficiency and is very robust to mechanical misalignments it may offer a cost-effective tool especially for telemedicine applications involving various global health problems in resource limited settings. PMID:20401422
Lysaker, Paul H; Wickett, Amanda M; Wilke, Neil; Lysaker, John
2003-01-01
It is widely known that people with schizophrenia have difficulty telling a coherent story of their lives and that this is linked to impoverished function. But what specifically has gone wrong in the narratives in schizophrenia? Is it the case that some elements of narrative remain intact in schizophrenia while others are uniquely affected? To address these questions, we qualitatively analyze the personal narratives of three persons with schizophrenia, which have emerged in psychotherapy. Based on this analysis we suggest that narratives in schizophrenia uniquely fail to situate agency within the narrator resulting in a story that is missing an agent-protagonist. While the narratives we present contain coherent accounts of how others are connected to one another, they fail to evolve into a story about the self as an agent that others could associate with the narrator. We speculate that this may reflect neuro-cognitively based difficulties maintaining the internal dialogue that propels agency as well as fears that any emergent subjectivity may be appropriated or objectified by others. Implications for psychotherapy are discussed.
ON A SUPPOSED INCOHERENCE BETWEEN KANT’S VIEW ON HOMOSEXUALITY AND HIS VIEW ON AUTONOMY
Directory of Open Access Journals (Sweden)
Cinara Nahra
2015-07-01
Full Text Available There are some very respectable Kant commentators who argue that Kant was not justified in using his own theory to reach the conclusions that he reached in relation to the immorality of homosexuality and some sex-related matters such as marriage and prostitution. Guyer argues that the principle that every natural organ and capacity has one and only one proper use (the teleological principle of living beings has no fundamental normative role within Kant’s moral philosophy and although Kant does use this principle, in some aspects of his treatment of human sexuality and in some of his arguments against suicide, he has no justification for doing so. From Guyer’s viewpoint, the adoption of this principle seems to be incompatible with his fundamental principle of the unconditional value of human freedom. Denis believes that appeals to nature’s purpose for particular drives constitute a limited part of Kant’s arguments for duties to ourselves, concluding that there seems to be no support for the view that homosexual sex is wrong and that it cannot, like heterosexual sex, be made permissible by being put into a context of a mutually respectful relationship. But are these the correct interpretations of Kant’s views? Is it true that a the teleological principle of living beings has no normative role in Kant’s philosophy, b that appeals to nature and the ends of nature have only a limited role in Kant’s moral philosophy and c that the right application of the Categorical imperative would never lead to the conclusions that Kant draws, that homosexuality is immoral? Here in this article it will be discussed Kant’s view on homosexuality and how Kant justifies it. The analysis carried out will show (contrarily to Guyer and Denis that the role of the teleological principle and the Formule of the Universal Law of Nature (FLUN - act as if the maxim of your action were to become by your will a universal law of nature - in Kant´s discussion of
Iima, Mami; Kataoka, Masako; Kanao, Shotaro; Onishi, Natsuko; Kawai, Makiko; Ohashi, Akane; Sakaguchi, Rena; Toi, Masakazu; Togashi, Kaori
2018-05-01
Purpose To investigate the performance of integrated approaches that combined intravoxel incoherent motion (IVIM) and non-Gaussian diffusion parameters compared with the Breast Imaging and Reporting Data System (BI-RADS) to establish multiparameter thresholds scores or probabilities by using Bayesian analysis to distinguish malignant from benign breast lesions and their correlation with molecular prognostic factors. Materials and Methods Between May 2013 and March 2015, 411 patients were prospectively enrolled and 199 patients (allocated to training [n = 99] and validation [n = 100] sets) were included in this study. IVIM parameters (flowing blood volume fraction [fIVIM] and pseudodiffusion coefficient [D*]) and non-Gaussian diffusion parameters (theoretical apparent diffusion coefficient [ADC] at b value of 0 sec/mm 2 [ADC 0 ] and kurtosis [K]) by using IVIM and kurtosis models were estimated from diffusion-weighted image series (16 b values up to 2500 sec/mm 2 ), as well as a synthetic ADC (sADC) calculated by using b values of 200 and 1500 (sADC 200-1500 ) and a standard ADC calculated by using b values of 0 and 800 sec/mm 2 (ADC 0-800 ). The performance of two diagnostic approaches (combined parameter thresholds and Bayesian analysis) combining IVIM and diffusion parameters was evaluated and compared with BI-RADS performance. The Mann-Whitney U test and a nonparametric multiple comparison test were used to compare their performance to determine benignity or malignancy and as molecular prognostic biomarkers and subtypes of breast cancer. Results Significant differences were found between malignant and benign breast lesions for IVIM and non-Gaussian diffusion parameters (ADC 0 , K, fIVIM, fIVIM · D*, sADC 200-1500, and ADC 0-800 ; P < .05). Sensitivity and specificity for the validation set by radiologists A and B were as follows: sensitivity, 94.7% and 89.5%, and specificity, 75.0% and 79.2% for sADC 200-1500 , respectively; sensitivity, 94.7% and 96.1%, and
International Nuclear Information System (INIS)
Jafarzadeh, Hossein; Asadpour, Seyyed Hossein; Soleimani, H Rahimpour
2015-01-01
The effect of Er 3+ ion concentration and incoherent pumping field on the refractive index and group index in an Er 3+ : YAG crystal is investigated. It is shown that under different concentrations of Er 3+ ion in the crystal, the index of refraction and absorption can be changed and a high index of refraction is accompanied by amplification in the medium. Also, it is shown that with the switching from subluminal to superluminal, or vice versa, light propagation can be obtained by different concentrations of Er 3+ ions in the crystal. (paper)
International Nuclear Information System (INIS)
Dyvorne, Hadrien; Jajamovich, Guido; Kakite, Suguru; Kuehn, Bernd; Taouli, Bachir
2014-01-01
Highlights: • We assess the precision and reproducibility of liver IVIM diffusion parameters. • Liver IVIM DWI can be performed with 4 b-values with good parameter precision. • Liver IVIM DWI can be performed with 4 b-values with good parameter reproducibility. - Abstract: Purpose: To increase diffusion sampling efficiency in intravoxel incoherent motion (IVIM) diffusion-weighted imaging (DWI) of the liver by reducing the number of diffusion weightings (b-values). Materials and methods: In this IRB approved HIPAA compliant prospective study, 53 subjects (M/F 38/15, mean age 52 ± 13 y) underwent IVIM DWI at 1.5 T using 16 b-values (0–800 s/mm 2 ), with 14 subjects having repeat exams to assess IVIM parameter reproducibility. A biexponential diffusion model was used to quantify IVIM hepatic parameters (PF: perfusion fraction, D: true diffusion and D*: pseudo diffusion). All possible subsets of the 16 b-values were probed, with number of b values ranging from 4 to 15, and corresponding parameters were quantified for each subset. For each b-value subset, global parameter estimation error was computed against the parameters obtained with all 16 b-values and the subsets providing the lowest error were selected. Interscan estimation error was also evaluated between repeat exams to assess reproducibility of the IVIM technique in the liver. The optimal b-values distribution was selected such that the number of b-values was minimal while keeping parameter estimation error below interscan reproducibility error. Results: As the number of b-values decreased, the estimation error increased for all parameters, reflecting decreased precision of IVIM metrics. Using an optimal set of 4 b-values (0, 15, 150 and 800 s/mm 2 ), the errors were 6.5, 22.8 and 66.1% for D, PF and D* respectively. These values lie within the range of test–retest reproducibility for the corresponding parameters, with errors of 12.0, 32.3 and 193.8% for D, PF and D* respectively. Conclusion: A set
International Nuclear Information System (INIS)
Zhou, Nan; Chu, Chen; Dou, Xin; Li, Ming; Liu, Song; Zhu, Lijing; Liu, Baorui; Guo, Tingting; Chen, Weibo; He, Jian; Yan, Jing; Zhou, Zhengyang; Yang, Xiaofeng; Liu, Tian
2016-01-01
Radiation-induced parotid damage is one of the most common complications in patients with nasopharyngeal carcinoma (NPC) undergoing radiotherapy (RT). Intravoxel incoherent motion (IVIM) magnetic resonance (MR) imaging has been reported for evaluating irradiated parotid damage. However, the changes of IVIM perfusion-related parameters in irradiated parotid glands have not been confirmed by conventional perfusion measurements obtained from dynamic contrast-enhanced (DCE) MR imaging. The purposes of this study were to monitor radiation-induced parotid damage using IVIM and DCE MR imaging and to investigate the correlations between changes of these MR parameters. Eighteen NPC patients underwent bilateral parotid T1-weighted, IVIM and DCE MR imaging pre-RT (2 weeks before RT) and post-RT (4 weeks after RT). Parotid volume; IVIM MR parameters, including apparent diffusion coefficient (ADC), pure diffusion coefficient (D), pseudo-diffusion coefficient (D*), and perfusion fraction (f); and DCE MR parameters, including maximum relative enhancement (MRE), time to peak (TTP), Wash in Rate, and the degree of xerostomia were recorded. Correlations of parotid MR parameters with mean radiation dose, atrophy rate and xerostomia degree, as well as the relationships between IVIM and DCE MR parameters, were investigated. From pre-RT to post-RT, all of the IVIM and DCE MR parameters increased significantly (p < 0.001 for ADC, D, f, MRE, Wash in Rate; p = 0.024 for D*; p = 0.037 for TTP). Change rates of ADC, f and MRE were negatively correlated with atrophy rate significantly (all p < 0.05). Significant correlations were observed between the change rates of D* and MRE (r = 0.371, p = 0.026) and between the change rates of D* and TTP (r = 0.396, p = 0.017). The intra- and interobserver reproducibility of IVIM and DCE MR parameters was good to excellent (intraclass correlation coefficient, 0.633–0.983). Early radiation-induced changes of parotid glands could be evaluated by IVIM and
Measurement of Incoherent Scatter
National Oceanic and Atmospheric Administration, Department of Commerce — For radio waves transmitted through the ionosphere with frequencies much larger (50 to 1300MHz) than the plasma frequency (up to 15MHz), very small-scale...
Donne, A. J. H.
1996-01-01
Thomson scattering is a very powerful diagnostic which is applied at nearly every magnetic confinement device. Depending on the experimental conditions different plasma parameters can be diagnosed. When the wave vector is much larger than the plasma Debye length, the total scattered power is
Directory of Open Access Journals (Sweden)
Shpynev B.G.
2017-03-01
Full Text Available The FSUE Central Research Institute of Machine Building (TsNIIMash, Rocket and Space Corporation “Energia”, and Institute of Solar-Terrestrial Physics of Siberian Branch of the Russian Academy of Sciences (ISTP SB RAS jointly conducted the active space experiment “Radar-Progress” in 2007–2015. During this experiment, the Irkutsk Incoherent Scatter Radar was used to study space-time characteristics of ionospheric disturbances generated by exhaust products of Progress cargo spacecraft engines. As the basic effect during exhaust product injection we consider the formation of new centers for recombination of ambient ionospheric ions O+ on molecules of water and carbon dioxide. This produces an ionization “hole” in the region of injection. In nighttime conditions when the ma-jority of experiments were performed, this hole was filled with hydrogen ions from the plasmasphere, thus changing the ion composition in the vicinity of the hole and incoherent scatter spectra. For successful observation of the ioni-zation hole dynamics, the critical factors are the degree of filling of the antenna pattern with exhaust products and the velocity of the thermospheric neutral wind, which makes exhaust gases move from the antenna pattern. These two factors lead to poor repeatability of successful experiments. Successful experiments recorded a decrease in electron density up to 35 % in the hole that existed for 30 min. The lifetime of the region with high concentration of H+ ions can be as long as one hour.
International Nuclear Information System (INIS)
Kitsos, S.; Assad, A.; Diop, C.M.; Nimal, J.C.
1994-01-01
Exposure and energy absorption buildup factors for aluminum, iron, lead, and water are calculated by the SNID discrete ordinates code for an isotropic point source in a homogeneous medium. The calculation of the buildup factors takes into account the effects of both bound-electron Compton (incoherent) and coherent (Rayleigh) scattering. A comparison with buildup factors from the literature shows that these two effects greatly increase the buildup factors for energies below a few hundred kilo-electron-volts, and thus the new results are improved relative to the experiment. This greater accuracy is due to the increase in the linear attenuation coefficient, which leads to the calculation of the buildup factors for a mean free path with a smaller shield thickness. On the other hand, for the same shield thickness, exposure increases when only incoherent scattering is included and decreases when only coherent scattering is included, so that the exposure finally decreases when both effects are included. Great care must also be taken when checking the approximations for gamma-ray deep-penetration transport calculations, as well as for the cross-section treatment and origin
International Nuclear Information System (INIS)
Kitsos, S.; Diop, C.M.; Assad, A.; Nimal, J.C.; Ridoux, P.
1996-01-01
Improvements of gamma-ray transport calculations in S n codes aim at taking into account the bound-electron effect of Compton scattering (incoherent), coherent scattering (Rayleigh), and secondary sources of bremsstrahlung and fluorescence. A computation scheme was developed to take into account these phenomena by modifying the angular and energy transfer matrices, and no modification in the transport code has been made. The incoherent and coherent scatterings as well as the fluorescence sources can be strictly treated by the transfer matrix change. For bremsstrahlung sources, this is possible if one can neglect the charged particles path as they pass through the matter (electrons and positrons) and is applicable for the energy range of interest for us (below 10 MeV). These improvements have been reported on the kernel attenuation codes by the calculation of new buildup factors. The gamma-ray buildup factors have been carried out for 25 natural elements up to 30 mean free paths in the energy range between 15 keV and 10 MeV
SSI and the Environmental Code
International Nuclear Information System (INIS)
Loefgren, T.
1997-12-01
Radiation is, to some extent, included in the environmental code being prepared by the government. As a consequence both the Radiation Protection Institute and the proposed Environmental Court may set legal conditions concerning radiation protection for the proponent. Legal and other matters related to this issue are discussed in the report
International Nuclear Information System (INIS)
Tang, H.T.; Nakamura, N.
1995-01-01
A 1/4-scale cylindrical reactor containment model was constructed in Hualien, Taiwan for foil-structure interaction (SSI) effect evaluation and SSI analysis procedure verification. Forced vibration tests were executed before backfill (FVT-1) and after backfill (FVT-2) to characterize soil-structure system characteristics under low excitations. A number of organizations participated in the pre-test blind prediction and post-test correlation analyses of the forced vibration test using various industry familiar methods. In the current study, correlation analyses were performed using a three-dimensional flexible volume substructuring method. The results are reported and soil property sensitivities are evaluated in the paper. (J.P.N.)
Energy Technology Data Exchange (ETDEWEB)
Toverud, Oeivind (Bromma Geokonsult (Sweden))
2010-10-15
SKB has since 1986 submitted RDandD program every three years to former Nuclear Power Inspectorate (SKI) for review and evaluation. SKI and former Radiation Protection Inst. (SSI) have commented on a large number of issues in connection with the audits. The authorities' goal has been to influence the SKB's design of the RDandD programs, inter alia with a view to future repository applications to fulfill the requirements they are tested against. SKB plans to submit applications for the final repository for spent Fuel first quarter of 2011 and it is therefore important for Radiation Safety Authority (SSM) to follow up on SKB's handling of critical comments on RDandD programs. A starting point for this monitoring is to establish how SKB has dealt with major issues raised by authorities in the audits of the RDandD programs and in consultation process which has been linked to the programs. The follow-up is expected to be an important contribution to the planning and implementation of the examination of applications for nuclear fuel repository
Analysis of recorded earthquake response data at the Hualien large-scale seismic test site
International Nuclear Information System (INIS)
Hyun, C.H.; Tang, H.T.; Dermitzakis, S.; Esfandiari, S.
1997-01-01
A soil-structure interaction (SSI) experiment is being conducted in a seismically active region in Hualien, Taiwan. To obtain earthquake data for quantifying SSI effects and providing a basis to benchmark analysis methods, a 1/4-th scale cylindrical concrete containment model similar in shape to that of a nuclear power plant containment was constructed in the field where both the containment model and its surrounding soil, surface and sub-surface, are extensively instrumented to record earthquake data. In between September 1993 and May 1995, eight earthquakes with Richter magnitudes ranging from 4.2 to 6.2 were recorded. The author focuses on studying and analyzing the recorded data to provide information on the response characteristics of the Hualien soil-structure system, the SSI effects and the ground motion characteristics. An effort was also made to directly determine the site soil physical properties based on correlation analysis of the recorded data. No modeling simulations were attempted to try to analytically predict the SSI response of the soil and the structure. These will be the scope of a subsequent study
Shokravi, H.; Bakhary, NH
2017-11-01
Subspace System Identification (SSI) is considered as one of the most reliable tools for identification of system parameters. Performance of a SSI scheme is considerably affected by the structure of the associated identification algorithm. Weight matrix is a variable in SSI that is used to reduce the dimensionality of the state-space equation. Generally one of the weight matrices of Principle Component (PC), Unweighted Principle Component (UPC) and Canonical Variate Analysis (CVA) are used in the structure of a SSI algorithm. An increasing number of studies in the field of structural health monitoring are using SSI for damage identification. However, studies that evaluate the performance of the weight matrices particularly in association with accuracy, noise resistance, and time complexity properties are very limited. In this study, the accuracy, noise-robustness, and time-efficiency of the weight matrices are compared using different qualitative and quantitative metrics. Three evaluation metrics of pole analysis, fit values and elapsed time are used in the assessment process. A numerical model of a mass-spring-dashpot and operational data is used in this research paper. It is observed that the principal components obtained using PC algorithms are more robust against noise uncertainty and give more stable results for the pole distribution. Furthermore, higher estimation accuracy is achieved using UPC algorithm. CVA had the worst performance for pole analysis and time efficiency analysis. The superior performance of the UPC algorithm in the elapsed time is attributed to using unit weight matrices. The obtained results demonstrated that the process of reducing dimensionality in CVA and PC has not enhanced the time efficiency but yield an improved modal identification in PC.
Energy Technology Data Exchange (ETDEWEB)
Shi, L.; Skinner, J. L. [Theoretical Chemistry Institute and Department of Chemistry, University of Wisconsin, Madison, Wisconsin 53706 (United States)
2015-07-07
OH-stretch inelastic incoherent neutron scattering (IINS) has been measured to determine the vibrational density of states (VDOS) in the OH-stretch region for liquid water, supercooled water, and ice Ih, providing complementary information to IR and Raman spectroscopies about hydrogen bonding in these phases. In this work, we extend the combined electronic-structure/molecular-dynamics (ES/MD) method, originally developed by Skinner and co-workers to simulate OH-stretch IR and Raman spectra, to the calculation of IINS spectra with small k values. The agreement between theory and experiment in the limit k → 0 is reasonable, further validating the reliability of the ES/MD method in simulating OH-stretch spectroscopy in condensed phases. The connections and differences between IINS and IR spectra are analyzed to illustrate the advantages of IINS over IR in estimating the OH-stretch VDOS.
International Nuclear Information System (INIS)
Shi, L.; Skinner, J. L.
2015-01-01
OH-stretch inelastic incoherent neutron scattering (IINS) has been measured to determine the vibrational density of states (VDOS) in the OH-stretch region for liquid water, supercooled water, and ice Ih, providing complementary information to IR and Raman spectroscopies about hydrogen bonding in these phases. In this work, we extend the combined electronic-structure/molecular-dynamics (ES/MD) method, originally developed by Skinner and co-workers to simulate OH-stretch IR and Raman spectra, to the calculation of IINS spectra with small k values. The agreement between theory and experiment in the limit k → 0 is reasonable, further validating the reliability of the ES/MD method in simulating OH-stretch spectroscopy in condensed phases. The connections and differences between IINS and IR spectra are analyzed to illustrate the advantages of IINS over IR in estimating the OH-stretch VDOS
International Nuclear Information System (INIS)
Hagan, M.E.; Sipler, D.P.
1991-01-01
The authors introduce a methodology to calculate the effects of frictional heating associated with geomagnetic activity using simultaneous incoherent scatter radar and Fabry-Perot interferometer measurements. Vector measurements of ion drift from radar backscatter and neutral wind from optical shifts in the atomic oxygen red line over Millstone Hill, Massachusetts (43 degree N) for the nights of March 7-10, 1989 are presented and are characterized by the magnetic storm activity which prevailed. They combine these measurements to calculate differences in the ion and neutral velocity fields which approach 350 m/s during the most geomagnetically active period that they monitored near 01 UT on March 9. This velocity difference results in a 110 degree K heating of the ion gas at that time
Energy Technology Data Exchange (ETDEWEB)
Halm, Simon
2009-05-19
In this thesis it is demonstrated that fringe fields of nanostructured ferromagnets provide the opportunity to manipulate both incoherent and coherent spin ensembles in a dilute magnetic semiconductor (DMS). Fringe fields of Fe/Tb ferromagnets with a remanent out-of-plane magnetization induce a local magnetization in a (Zn,Cd,Mn)Se DMS. Due to the sp-d exchange interaction, optically generated electron-hole pairs align their spin along the DMS magnetization. One obtains a local, remanent spin polarization which was probed by spatially resolved, polarization sensitive photoluminescence spectroscopy. Fringe fields from in-plane magnetized Co ferromagnets allow to locally modify the precession frequency of the Manganese magnetic moments of the DMS in an external magnetic field. This was probed by time-resolved Kerr rotation technique. The inhomogeneity of the fringe field leads to a shortening of the ensemble decoherence time and to the effect of a time-dependent ensemble precession frequency. (orig.)
International Nuclear Information System (INIS)
Meinhold, Lars; Clement, David; Tehei, M.; Daniel, R.M.; Finney, J.L.; Smith, Jeremy C.
2008-01-01
The temperature dependence of the dynamics of mesophilic and thermophilic dihydrofolate reductase is examined using elastic incoherent neutron scattering. It is demonstrated that the distribution of atomic displacement amplitudes can be derived from the elastic scattering data by assuming a (Weibull) functional form that resembles distributions seen in molecular dynamics simulations. The thermophilic enzyme has a significantly broader distribution than its mesophilic counterpart. Furthermore, although the rate of increase with temperature of the atomic mean-square displacements extracted from the dynamic structure factor is found to be comparable for both enzymes, the amplitudes are found to be slightly larger for the thermophilic enzyme. Therefore, these results imply that the thermophilic enzyme is the more flexible of the two
International Nuclear Information System (INIS)
Smirnov, L.S.; Natkaniec, I.; Ollivier, J.; Dianoux, J.A.; Martinez Sarrion, M.L.; Mestres, L.
2010-01-01
The study of ammonium dynamics in Rb 1-x (NH 4 ) x I mixed crystals was carried out by inelastic incoherent neutron scattering in the concentration region of orientationally disordered α-phase, 0.0< x<0.40, at the temperature range from 2 to 150 K. The observed resonance modes correspond to three energy regions: 0.19-0.481 (I), 0.56-3.0 (II) and 4.0-10.0 (III) meV. The modes of region I could be described by rotational tunneling energies of the multipole moments of ammonium ions. The modes within energy region II correspond to the calculated rotational tunneling energies between splitted levels of the ground librational level of ammonium ion. The modes of region III can be described as local gap modes of ammonium ion because they are located between acoustic and optic branches of RbI phonon density of states
Directory of Open Access Journals (Sweden)
N. K. Sethi
2002-06-01
Full Text Available High resolution electron density profiles (Ne measured with the Arecibo (18.4 N, 66.7 W, Incoherent Scatter radar (I. S. are used to obtain the bottomside shape parameters B0, B1 for a solar maximum period (1989–90. Median values of these parameters are compared with those obtained from the IRI-2001 model. It is observed that during summer, the IRI values agree fairly well with the Arecibo values, though the numbers are somewhat larger during the daytime. Discrepancies occur during winter and equinox, when the IRI underestimates B0 for the local times from about 12:00 LT to about 20:00 LT. Furthermore, the IRI model tends to generally overestimate B1 at all local times. At Arecibo, B0 increases by about 50%, and B1 decreases by about 30% from solar minimum to solar maximum.Key words. Ionosphere (equational ionosphere; modeling and forecasting
Directory of Open Access Journals (Sweden)
P. Guio
Full Text Available The plasma dispersion function and the reduced velocity distribution function are calculated numerically for any arbitrary velocity distribution function with cylindrical symmetry along the magnetic field. The electron velocity distribution is separated into two distributions representing the distribution of the ambient electrons and the suprathermal electrons. The velocity distribution function of the ambient electrons is modelled by a near-Maxwellian distribution function in presence of a temperature gradient and a potential electric field. The velocity distribution function of the suprathermal electrons is derived from a numerical model of the angular energy flux spectrum obtained by solving the transport equation of electrons. The numerical method used to calculate the plasma dispersion function and the reduced velocity distribution is described. The numerical code is used with simulated data to evaluate the Doppler frequency asymmetry between the up- and downshifted plasma lines of the incoherent-scatter plasma lines at different wave vectors. It is shown that the observed Doppler asymmetry is more dependent on deviation from the Maxwellian through the thermal part for high-frequency radars, while for low-frequency radars the Doppler asymmetry depends more on the presence of a suprathermal population. It is also seen that the full evaluation of the plasma dispersion function gives larger Doppler asymmetry than the heat flow approximation for Langmuir waves with phase velocity about three to six times the mean thermal velocity. For such waves the moment expansion of the dispersion function is not fully valid and the full calculation of the dispersion function is needed.
Key words. Non-Maxwellian electron velocity distribution · Incoherent scatter plasma lines · EISCAT · Dielectric response function
Directory of Open Access Journals (Sweden)
P. Guio
1998-10-01
Full Text Available The plasma dispersion function and the reduced velocity distribution function are calculated numerically for any arbitrary velocity distribution function with cylindrical symmetry along the magnetic field. The electron velocity distribution is separated into two distributions representing the distribution of the ambient electrons and the suprathermal electrons. The velocity distribution function of the ambient electrons is modelled by a near-Maxwellian distribution function in presence of a temperature gradient and a potential electric field. The velocity distribution function of the suprathermal electrons is derived from a numerical model of the angular energy flux spectrum obtained by solving the transport equation of electrons. The numerical method used to calculate the plasma dispersion function and the reduced velocity distribution is described. The numerical code is used with simulated data to evaluate the Doppler frequency asymmetry between the up- and downshifted plasma lines of the incoherent-scatter plasma lines at different wave vectors. It is shown that the observed Doppler asymmetry is more dependent on deviation from the Maxwellian through the thermal part for high-frequency radars, while for low-frequency radars the Doppler asymmetry depends more on the presence of a suprathermal population. It is also seen that the full evaluation of the plasma dispersion function gives larger Doppler asymmetry than the heat flow approximation for Langmuir waves with phase velocity about three to six times the mean thermal velocity. For such waves the moment expansion of the dispersion function is not fully valid and the full calculation of the dispersion function is needed.Key words. Non-Maxwellian electron velocity distribution · Incoherent scatter plasma lines · EISCAT · Dielectric response function
Soil-structure interaction analysis of large scale seismic test model at Hualien in Taiwan
International Nuclear Information System (INIS)
Jang, J. B.; Ser, Y. P.; Lee, J. L.
2001-01-01
The issue of SSI in seismic analysis and design of NPPs is getting important, as it may be inevitable to build NPPs at sites with soft foundation due to ever-increasing difficulty in acquiring new construction sites for NPPs. And, the improvement of seismic analysis technique including soil-structure interaction analysis essential to achieve reasonable seismic design for structures and equipments, etc. of NPPs. Therefore, among the existing SSI analysis programs, the most prevalent SASSI is verified through the comparison numerical analysis results with recorded response results of Hualien project in this study. As a result, SASSI accurately estimated the recorded response results for the fundamental frequency and peak acceleration of structure and was proved to be reliable and useful for the seismic analysis and design of NPPs
Energy Technology Data Exchange (ETDEWEB)
Ding, Y; Fuller, C; Mohamed, A; Wang, J; Hazle, J [UT MD Anderson Cancer Center, Houston, TX (United States)
2015-06-15
Purpose: Many published studies have recently demonstrated the potential value of intravoxel incoherent motion (IVIM) analysis for disease evaluation. However, few have questioned its measurement repeatability/reproducibility when applied. The purpose of this study was to determine the short-term measurement repeatability of apparent diffusion coefficient ADC, true diffusion coefficient D, pseudodiffusion coefficient D* and perfusion fraction f, in head and neck squamous cell carcinoma (HNSCC) primary tumors and metastatic nodes. Methods: Ten patients with known HNSCC were examined twice using echo-planar DW-MRI with 12 b values (0 to 800 s/mm2) 1hour to 24 hours apart before radiation treatment. All patients were scanned with the customized radiation treatment immobilization devices to reduce motion artifacts and to improve image registration in repeat scans. Regions of interests were drawn in primary tumor and metastases node in each patient (Fig. 1). ADC and IVIM parameters D, D* and f were calculated by least squares data fitting. Short-term test–retest repeatability of ADC and IVIM parameters were assessed by measuring Bland–Altman limits of agreements (BA-LA). Results: Sixteen HNSCC lesions were assessed in 10 patients. Repeatability of perfusion-sensitive parameters, D* and f, in HNSCC lesions was poor (BA-LA: -144% to 88% and −57% to 96% for D* and f, respectively); a lesser extent was observed for the diffusion-sensitive parameters of ADC and D (BA-LA: −34% to 39% and −37% to 40%, for ADC and D, respectively) (Fig. 2). Conclusion: Poor repeatability of D*/f and good repeatability for ADC/D were observed in HNSCC primary tumors and metastatic nodes. Efforts should be made to improve the measurement repeatability of perfusion-sensitive IVIM parameters.
Energy Technology Data Exchange (ETDEWEB)
Bengtson, P.; Larsson, C.M.; Simenstad, P.; Suomela, J.
1995-09-01
Marine samples from the vicinity of the plants show elevated radionuclide concentrations, caused by discharges from the plants. Very low concentrations are noted in terrestrial samples. At several locations, the effects of the Chernobyl disaster still dominates. Control samples measured by SSI have confirmed the measurements performed by the operators. 8 refs, 6 tabs, 46 figs.
Mueller, Tara C; Loos, Martin; Haller, Bernhard; Mihaljevic, André L; Nitsche, Ulrich; Wilhelm, Dirk; Friess, Helmut; Kleeff, Jörg; Bader, Franz G
2015-02-01
Surgical site infection (SSI) remains to be one of the most frequent infectious complications following abdominal surgery. Prophylactic intra-operative wound irrigation (IOWI) before skin closure has been proposed to reduce bacterial wound contamination and the risk of SSI. However, current recommendations on its use are conflicting especially concerning antibiotic and antiseptic solutions because of their potential tissue toxicity and enhancement of bacterial drug resistances. To analyze the existing evidence for the effect of IOWI with topical antibiotics, povidone-iodine (PVP-I) solutions or saline on the incidence of SSI following open abdominal surgery, a systematic review and meta-analysis of randomized controlled trials (RCTs) was carried out according to the recommendations of the Cochrane Collaboration. Forty-one RCTs reporting primary data of over 9000 patients were analyzed. Meta-analysis on the effect of IOWI with any solution compared to no irrigation revealed a significant benefit in the reduction of SSI rates (OR = 0.54, 95 % confidence Interval (CI) [0.42; 0.69], p < 0.0001). Subgroup analyses showed that this effect was strongest in colorectal surgery and that IOWI with antibiotic solutions had a stronger effect than irrigation with PVP-I or saline. However, all of the included trials were at considerable risk of bias according to the quality assessment. These results suggest that IOWI before skin closure represents a pragmatic and economical approach to reduce postoperative SSI after abdominal surgery and that antibiotic solutions seem to be more effective than PVP-I solutions or simple saline, and it might be worth to re-evaluate their use for specific indications.
Time-domain soil-structure interaction analysis of nuclear facilities
International Nuclear Information System (INIS)
Coleman, Justin L.; Bolisetti, Chandrakanth; Whittaker, Andrew S.
2016-01-01
The Nuclear Regulatory Commission (NRC) regulation 10 CFR Part 50 Appendix S requires consideration of soil-structure interaction (SSI) in nuclear power plant (NPP) analysis and design. Soil-structure interaction analysis for NPPs is routinely carried out using guidance provided in the ASCE Standard 4-98 titled “Seismic Analysis of Safety-Related Nuclear Structures and Commentary”. This Standard, which is currently under revision, provides guidance on linear seismic soil-structure-interaction (SSI) analysis of nuclear facilities using deterministic and probabilistic methods. A new appendix has been added to the forthcoming edition of ASCE Standard 4 to provide guidance for time-domain, nonlinear SSI (NLSSI) analysis. Nonlinear SSI analysis will be needed to simulate material nonlinearity in soil and/or structure, static and dynamic soil pressure effects on deeply embedded structures, local soil failure at the foundation-soil interface, nonlinear coupling of soil and pore fluid, uplift or sliding of the foundation, nonlinear effects of gaps between the surrounding soil and the embedded structure and seismic isolation systems, none of which can be addressed explicitly at present. Appendix B of ASCE Standard 4 provides general guidance for NLSSI analysis but will not provide a methodology for performing the analysis. This paper provides a description of an NLSSI methodology developed for application to nuclear facilities, including NPPs. This methodology is described as series of sequential steps to produce reasonable results using any time-domain numerical code. These steps require some numerical capabilities, such as nonlinear soil constitutive models, which are also described in the paper.
Directory of Open Access Journals (Sweden)
J. Watermann
Full Text Available Coincident multi-instrument magnetospheric and ionospheric observations have made it possible to determine the position of the ionospheric footprint of the magnetospheric cusp and to monitor its evolution over time. The data used include charged particle and magnetic field measurements from the Earth-orbiting Viking and DMSP-F7 satellites, electric field measurements from Viking, interplanetary magnetic field and plasma data from IMP-8, and Sondrestrom incoherent scatter radar observations of the ionospheric plasma density, temperature, and convection. Viking detected cusp precipitation poleward of 75.5° invariant latitude. The ionospheric response to the observed electron precipitation was simulated using an auroral model. It predicts enhanced plasma density and elevated electron temperature in the upper E- and F-regions. Sondrestrom radar observations are in agreement with the predictions. The radar detected a cusp signature on each of five consecutive antenna elevation scans covering 1.2 h local time. The cusp appeared to be about 2° invariant latitude wide, and its ionospheric footprint shifted equatorward by nearly 2° during this time, possibly influenced by an overall decrease in the IMF Bz component. The radar plasma drift data and the Viking magnetic and electric field data suggest that the cusp was associated with a continuous, rather than a patchy, merging between the IMF and the geomagnetic field.
International Nuclear Information System (INIS)
Coffey, W.T.
1978-01-01
It is shown how three models (based on the theory of the Brownian movement) for the translational motion of an atom in a fluid may be used to calculate explicitly the intermediate scattering functions and differential cross-sections for the incoherent scattering of slow neutrons. In the first model the translational motion of the atom is represented by the motion of a particle in space subjected to no forces other than those arising from the thermal motion of its surroundings. The differential scattering cross-section for this model is then obtained as a continued fraction similar to that given by Sack (Proc. Phys. Soc.; B70:402 and 414 (1957)) for the electric polarisability in his investigation of the role of inertial effects in dielectric relaxation. The second model is a corrected version of the itinerant oscillator model of Sears (Proc. Phys. Soc.; 86:953 (1965)). Here the differential cross-section is obtained in the form of a series and a closed-form expression is found for the intermediate scattering function. The last model to be considered is the harmonically bound particle where again a closed form expression is obtained for the intermediate scattering function. In each case the intermediate scattering function has a mathematical form which is similar to the after-effect function describing the decay of electric polarisation for the rotational versions of the models. (author)
Kubota, Hideki; Kaneko, Fumitoshi; Kawaguchi, Tatsuya
2005-01-01
The thermodynamic properties of the two polytypes of n-hexatriacontane (n-C36H74), single-layered structure Mon and double-layered structure Orth II have been investigated by means of solubility measurements and incoherent inelastic neutron scattering. The solubility measurements reveal that Orth II is more stable than Mon by 1.2 kJ/mol because of the advantage of larger entropy. The neutron scattering measurements show that the vibrational modes of Orth II shift to the lower frequencies compared with those of Mon in the frequency region below 120 cm-1. The advantage of Orth II in vibrational entropy due to the low-frequency shifts is estimated to be 9.6 J K-1/mol at 288 K under the harmonic approximation, which nearly agrees with the entropy difference of 6.8 J K-1/mol between Mon and Orth II determined by solubility measurements. These results suggest that the difference in vibrational entropy due to low-frequency modes mainly contributes to the relative thermodynamic stabilities of polytypic structures of long-chain compounds. From the frequency of methyl torsional mode, it is suggested that the cohesive force at the lamellar interface is stronger in Mon than in Orth II.
Directory of Open Access Journals (Sweden)
T. Neubert
2002-06-01
Full Text Available In the autumn of the year 2000, four radio receivers capable of tracking various beacon satellites were set up along the southwestern coast of Greenland. They are used to reconstruct images of the ionospheric plasma density distribution via the tomographic method. In order to test and validate tomographic imaging under the highly variable conditions often prevailing in the high-latitude ionosphere, a time interval was selected when the Sondrestrom incoherent scatter radar conducted measurements of the ionospheric plasma density while the radio receivers tracked a number of beacon satellites. A comparison between two-dimensional images of the plasma density distribution obtained from the radar and the satellite receivers revealed generally good agreement between radar measurements and tomographic images. Observed discrepancies can be attributed to F region plasma patches moving through the field of view with a speed of several hundred meters per second, thereby smearing out the tomographic image. A notable mismatch occurred around local magnetic midnight when a magnetospheric substorm breakup occurred in the vicinity of southwest Greenland (identified from ground-based magnetometer observations. The breakup was associated with a sudden intensification of the westward auroral electrojet which was centered at about 69 and extended up to some 73 corrected geomagnetic latitude. Ground-based magnetometer data may thus have the potential of indicating when the tomographic method is at risk and may fail. We finally outline the application of tomographic imaging, when combined with magnetic field data, to estimate ionospheric Joule heating rates.
Energy Technology Data Exchange (ETDEWEB)
Liu, Chunling; Liu, Zaiyi; Zhang, Jine; He, Hui; Zhang, Shuixing; Liang, Changhong [Guangdong General Hospital/Guangdong Academy of Medical Sciences, Department of Radiology, GuangZhou (China); Wang, Kun [Guangdong General Hospital/Guangdong Academy of Medical Sciences, Department of Breast Cancer, Cancer Center, GuangZhou (China); Chan, Queenie [Philips Healthcare, 6/F, Core Building 1, 1 Science Park East Avenue, Hong Kong Science Park, Shatin, New Territories, Hong Kong (China)
2016-11-15
To compare diagnostic performance for breast lesions by quantitative parameters derived from intravoxel incoherent motion (IVIM) and dynamic contrast-enhanced (DCE) magnetic resonance imaging (MRI) and to explore whether correlations exist between these parameters. IVIM and DCE MRI were performed on a 1.5-T MRI scanner in patients with suspicious breast lesions. Thirty-six breast cancers and 23 benign lesions were included in the study. Quantitative parameters from IVIM (D, f and D*) and DCE MRI (K{sup trans}, K{sub ep}, V{sub e} and V{sub p}) were calculated and compared between malignant and benign lesions. Spearman correlation test was used to evaluate correlations between them. D, f, D* from IVIM and K{sup trans}, K{sub ep}, V{sub p} from DCE MRI were statistically different between breast cancers and benign lesions (p < 0.05, respectively) and D demonstrated the largest area under the receiver-operating characteristic curve (AUC = 0.917) and had the highest specificity (83 %). The f value was moderately statistically correlated with V{sub p} (r = 0.692) and had a poor correlation with K{sup trans} (r = 0.456). IVIM MRI is useful in the differentiation of breast lesions. Significant correlations were found between perfusion-related parameters from IVIM and DCE MRI. IVIM may be a useful adjunctive tool to standard MRI in diagnosing breast cancer. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Anadón, A., E-mail: anadonb@unizar.es; Lucas, I.; Morellón, L. [Instituto de Nanociencia de Aragón, Universidad de Zaragoza, E-50018 Zaragoza (Spain); Departamento de Física de la Materia Condensada, Universidad de Zaragoza, E-50009 Zaragoza (Spain); Ramos, R. [WPI Advanced Institute for Materials Research, Tohoku University, Sendai 980-8577 (Japan); Spin Quantum Rectification Project, ERATO, Japan Science and Technology Agency, Sendai 980-8577 (Japan); Algarabel, P. A. [Departamento de Física de la Materia Condensada, Universidad de Zaragoza, E-50009 Zaragoza (Spain); Instituto de Ciencia de Materiales de Aragón, Universidad de Zaragoza and Consejo Superior de Investigaciones Científicas, 50009 Zaragoza (Spain); Ibarra, M. R.; Aguirre, M. H. [Instituto de Nanociencia de Aragón, Universidad de Zaragoza, E-50018 Zaragoza (Spain); Departamento de Física de la Materia Condensada, Universidad de Zaragoza, E-50009 Zaragoza (Spain); Laboratorio de Microscopías avanzadas, Universidad de Zaragoza, 50018 Zaragoza (Spain)
2016-07-04
The dependence of Spin Seebeck effect (SSE) with the thickness of the magnetic materials is studied by means of incoherent thermal excitation. The SSE voltage signal in Fe{sub 3}O{sub 4}/Pt bilayer structure increases with the magnetic material thickness up to 100 nm, approximately, showing signs of saturation for larger thickness. This dependence is well described in terms of a spin current pumped in the platinum film by the magnon accumulation in the magnetic material. The spin current is generated by a gradient of temperature in the system and detected by the Pt top contact by means of inverse spin Hall effect. Calculations in the frame of the linear response theory adjust with a high degree of accuracy the experimental data, giving a thermal length scale of the magnon accumulation (Λ) of 17 ± 3 nm at 300 K and Λ = 40 ± 10 nm at 70 K.
Energy Technology Data Exchange (ETDEWEB)
Yan, Chenggong; Xiong, Wei; Wu, Yuankui; Li, Caixia; Xu, Yikai [Southern Medical University, Department of Medical Imaging Center, Nanfang Hospital, Guangzhou (China); Xu, Jun; Wei, Qi; Feng, Ru; Liu, Qifa [Southern Medical University, Department of Hematology, Nanfang Hospital, Guangzhou (China); Chan, Queenie [Philips Healthcare, New Territories, Hon Kong (China)
2017-01-15
The purpose of this study was to determine whether intravoxel incoherent motion (IVIM) -derived parameters and apparent diffusion coefficient (ADC) could act as imaging biomarkers for predicting antifungal treatment response. Forty-six consecutive patients (mean age, 33.9 ± 13.0 y) with newly diagnosed invasive fungal infection (IFI) in the lung according to EORTC/MSG criteria were prospectively enrolled. All patients underwent diffusion-weighted magnetic resonance (MR) imaging at 3.0 T using 11 b values (0-1000 sec/mm{sup 2}). ADC, pseudodiffusion coefficient D*, perfusion fraction f, and the diffusion coefficient D were compared between patients with favourable (n=32) and unfavourable response (n=14). f values were significantly lower in the unfavourable response group (12.6%±4.4%) than in the favourable response group (30.2%±8.6%) (Z=4.989, P<0.001). However, the ADC, D, and D* were not significantly different between the two groups (P>0.05). Receiver operating characteristic curve analyses showed f to be a significant predictor for differentiation, with a sensitivity of 93.8% and a specificity of 92.9%. IVIM-MRI is potentially useful in the prediction of antifungal treatment response to patients with IFI in the lung. Our results indicate that a low perfusion fraction f may be a noninvasive imaging biomarker for unfavourable response. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Hilbert, Fabian; Wech, Tobias; Neubauer, Henning; Veldhoen, Simon; Bley, Thorsten Alexander; Koestler, Herbert [Wuerzburg Univ. (Germany). Inst. fuer Diagnostische und Interventionelle Radiologie
2017-10-01
Echo Planar Imaging (EPI) is most commonly applied to acquire diffusion-weighted MR-images. EPI is able to capture an entire image in very short time, but is prone to distortions and artifacts. In diffusion-weighted EPI of the kidney severe distortions may occur due to intestinal gas. Turbo Spin Echo (TSE) is robust against distortions and artifacts, but needs more time to acquire an entire image compared to EPI. Therefore, TSE is more sensitive to motion during the readout. In this study we compare diffusion-weighted TSE and EPI of the human kidney with regard to intravoxel incoherent motion (IVIM) and diffusion tensor imaging (DTI). Images were acquired with b-values between 0 and 750 s/mm{sup 2} with TSE and EPI. Distortions were observed with the EPI readout in all volunteers, while the TSE images were virtually distortion-free. Fractional anisotropy of the diffusion tensor was significantly lower for TSE than for EPI. All other parameters of DTI and IVIM were comparable for TSE and EPI. Especially the main diffusion directions yielded by TSE and EPI were similar. The results demonstrate that TSE is a worthwhile distortion-free alternative to EPI for diffusion-weighted imaging of the kidney at 3 Tesla.
Deng, Han; Qi, Xingshun; Zhang, Tiansong; Qi, Xiaolong; Yoshida, Eric M; Guo, Xiaozhong
2018-01-01
The meta-analysis aimed to summarize the technical success rate of supersonic shear imaging (SSI) and to evaluate the diagnostic performance of liver and spleen stiffness measurement (LSM and SSM) with SSI for the detection of liver fibrosis, portal hypertension, and gastroesophageal varices in liver diseases. PubMed, EMBASE, and Cochrane Library databases were searched. Technical success rate of SSI was pooled. Area under curve (AUC), sensitivity, and specificity with corresponding 95% confidence interval (CI) were calculated. Included studies regarding the diagnostic performance of SSI for liver fibrosis, portal hypertension, and esophageal varices numbered 28, 4, and 4 respectively. The pooled technical success rates of LSM and SSM were 95.3% and 75.5%, respectively. The AUC, sensitivity, and specificity of LSM/SSM for different stages of liver fibrosis were 0.85-0.94, 0.7-0.89, and 0.82-0.92, respectively. The AUC, sensitivity, and specificity of LSM were 0.84 (95%CI = 0.8-0.86), 0.79 (95%CI = 0.7-0.85), and 0.82 (95%CI = 0.72-0.88) for clinically significant portal hypertension, 0.85 (95%CI = 0.82-0.88), 0.8 (95%CI = 0.68-0.88), and 0.8 (95%CI = 0.6-0.92) for any varices, and 0.86 (95%CI = 0.83-0.89), 0.86 (95%CI = 0.76-0.92), and 0.61 (95%CI = 0.35-0.83) for high-risk varices, respectively. LSM with SSI had a high diagnostic accuracy for liver fibrosis, but a moderate diagnostic accuracy for portal hypertension and esophageal varices.
Bruin, de R.; Lu, Y.; Brombacher, A.C.; Smith, M.J.; Salvendy, G.
2009-01-01
A growing number of products - particularly highly innovative and intelligent products - are being returned by customers, while analysis shows that many of these products are in fact functioning according to their technical specifications. Product developers are recognizing the need for information
Directory of Open Access Journals (Sweden)
Dookie Kim
Full Text Available This paper presents a probabilistic capacity spectrum strategy for the reliability analysis of a bridge pile shaft, accounting for uncertainties in design factors in the analysis and the soil-structure interaction (SSI. Monte Carlo simulation method (MCS is adopted to determine the probabilities of failure by comparing the responses with defined limit states. The analysis considers the soil structure interaction together with the probabilistic application of the capacity spectrum method for different types of limit states. A cast-in-drilledhole (CIDH extended reinforced concrete pile shaft of a bridge is analysed using the proposed strategy. The results of the analysis show that the SSI can lead to increase or decrease of the structure's probability of failure depending on the definition of the limit states.
Yang, W; Liu, Y; Zhang, Y; Zhao, Q-H; He, S-F
2016-08-01
Surgical site infection (SSI) causes significant mortality and morbidity. Administration of a high inspired oxygen fraction (FiO2) to patients undergoing surgery may represent a potential preventive strategy. To conduct a meta-analysis of randomized controlled trials in which high FiO2 was compared with normal FiO2 in patients undergoing surgery to estimate the effect on the development of SSI. A comprehensive search was undertaken for randomized controlled trials (until December 2015) that compared high FiO2 with normal FiO2 in adults undergoing surgery with general anaesthesia and reported on SSI. This study included 17 randomized controlled trials with 8093 patients. Infection rates were 13.11% in the control group and 11.53% in the hyperoxic group, while the overall risk ratio was 0.893 [95% confidence interval (CI) 0.794-1.003; P = 0.057]. Subgroup analyses stratified by country, definition of SSI, and type of surgery were also performed, and showed similar results. However, high FiO2 was found to be of significant benefit in patients undergoing colorectal surgery, with a risk ratio of 0.735 (95% CI 0.573-0.944; P=0.016). There is moderate evidence to suggest that administration of high FiO2 to patients undergoing surgery, especially colorectal surgery, reduces the risk of SSI. Further studies with better adherence to the intervention may affect the results of this meta-analysis. Copyright © 2016 The Healthcare Infection Society. Published by Elsevier Ltd. All rights reserved.
Bertleff, Marco; Domsch, Sebastian; Weingärtner, Sebastian; Zapp, Jascha; O'Brien, Kieran; Barth, Markus; Schad, Lothar R
2017-12-01
Artificial neural networks (ANNs) were used for voxel-wise parameter estimation with the combined intravoxel incoherent motion (IVIM) and kurtosis model facilitating robust diffusion parameter mapping in the human brain. The proposed ANN approach was compared with conventional least-squares regression (LSR) and state-of-the-art multi-step fitting (LSR-MS) in Monte-Carlo simulations and in vivo in terms of estimation accuracy and precision, number of outliers and sensitivity in the distinction between grey (GM) and white (WM) matter. Both the proposed ANN approach and LSR-MS yielded visually increased parameter map quality. Estimations of all parameters (perfusion fraction f, diffusion coefficient D, pseudo-diffusion coefficient D*, kurtosis K) were in good agreement with the literature using ANN, whereas LSR-MS resulted in D* overestimation and LSR yielded increased values for f and D*, as well as decreased values for K. Using ANN, outliers were reduced for the parameters f (ANN, 1%; LSR-MS, 19%; LSR, 8%), D* (ANN, 21%; LSR-MS, 25%; LSR, 23%) and K (ANN, 0%; LSR-MS, 0%; LSR, 15%). Moreover, ANN enabled significant distinction between GM and WM based on all parameters, whereas LSR facilitated this distinction only based on D and LSR-MS on f, D and K. Overall, the proposed ANN approach was found to be superior to conventional LSR, posing a powerful alternative to the state-of-the-art method LSR-MS with several advantages in the estimation of IVIM-kurtosis parameters, which might facilitate increased applicability of enhanced diffusion models at clinical scan times. Copyright © 2017 John Wiley & Sons, Ltd.
Forte, Biagio; Coleman, Chris; Skone, Susan; Häggström, Ingemar; Mitchell, Cathryn; Da Dalt, Federico; Panicciari, Tommaso; Kinrade, Joe; Bust, Gary
2017-01-01
Ionospheric scintillation originates from the scattering of electromagnetic waves through spatial gradients in the plasma density distribution, drifting across a given propagation direction. Ionospheric scintillation represents a disruptive manifestation of adverse space weather conditions through degradation of the reliability and continuity of satellite telecommunication and navigation systems and services (e.g., European Geostationary Navigation Overlay Service, EGNOS). The purpose of the experiment presented here was to determine the contribution of auroral ionization structures to GPS scintillation. European Incoherent Scatter (EISCAT) measurements were obtained along the same line of sight of a given GPS satellite observed from Tromso and followed by means of the EISCAT UHF radar to causally identify plasma structures that give rise to scintillation on the co-aligned GPS radio link. Large-scale structures associated with the poleward edge of the ionospheric trough, with auroral arcs in the nightside auroral oval and with particle precipitation at the onset of a substorm were indeed identified as responsible for enhanced phase scintillation at L band. For the first time it was observed that the observed large-scale structures did not cascade into smaller-scale structures, leading to enhanced phase scintillation without amplitude scintillation. More measurements and theory are necessary to understand the mechanism responsible for the inhibition of large-scale to small-scale energy cascade and to reproduce the observations. This aspect is fundamental to model the scattering of radio waves propagating through these ionization structures. New insights from this experiment allow a better characterization of the impact that space weather can have on satellite telecommunications and navigation services.
Zhan, Weijia; S. Rodrigues, Fabiano
2018-01-01
Previous studies have suggested that weakening downward plasma drifts can produce favorable conditions for the ionospheric Generalized Rayleigh-Taylor (GRT) instability and explain the occurrence of postmidnight equatorial spread F (ESF). We evaluated this hypothesis using numerical simulations aided by measurements and attempted to explain ESF events observed in the American sector during June solstice, low solar flux conditions. We analyzed plasma drifts and ESF measurements made by the incoherent scatter radar of the Jicamarca Radio Observatory (11.95° S, 76.87° W, ˜1° dip). We found adequate measurements during a prototypical, quiet time event on 4-5 June 2008 when the downward drifts weakened and a fully developed ESF appeared. The measured drifts were used as input for the SAMI2 model. SAMI2 reproduced an "apparent" uplift of the ionosphere based on h'F measurements that was consistent with expectations and observations. SAMI2 also provided parameters for estimation of the flux tube linear growth rates of GRT instability associated with the weakening drift event. We found that the weakening drifts did produce unstable conditions with positive growth rates. The growth rates, however, were slower than those obtained for typical, premidnight ESF events and those obtained for similar drift conditions in other longitude sectors. We show, however, that departures in the wind pattern, from climatological model predictions, can produce favorable conditions for instability development. Following the hypothesis of Huba and Krall (2013) and using SAMI2 simulations, we show that equatorward winds, when combined with weakening drifts, could have contributed to the unstable conditions responsible for the postmidnight ESF events.
Wiecki, P.; Taufour, V.; Chung, D. Y.; Kanatzidis, M. G.; Bud'ko, S. L.; Canfield, P. C.; Furukawa, Y.
2018-02-01
We present the results of 75As nuclear magnetic resonance (NMR), nuclear quadrupole resonance (NQR), and resistivity measurements in KFe2As2 under pressure (p ). The temperature dependence of the NMR shift, nuclear spin-lattice relaxation time (T1), and resistivity show a crossover between a high-temperature incoherent, local-moment behavior and a low-temperature coherent behavior at a crossover temperature (T*). T* is found to increase monotonically with pressure, consistent with increasing hybridization between localized 3 d orbital-derived bands with the itinerant electron bands. No anomaly in T* is seen at the critical pressure pc=1.8 GPa where a change of slope of the superconducting (SC) transition temperature Tc(p ) has been observed. In contrast, Tc(p ) seems to correlate with antiferromagnetic spin fluctuations in the normal state as measured by the NQR 1 /T1 data, although such a correlation cannot be seen in the replacement effects of A in the A Fe2As2 (A =K , Rb, Cs) family. In the superconducting state, two T1 components are observed at low temperatures, suggesting the existence of two distinct local electronic environments. The temperature dependence of the short T1 s indicates a nearly gapless state below Tc. On the other hand, the temperature dependence of the long component 1 /T1 L implies a large reduction in the density of states at the Fermi level due to the SC gap formation. These results suggest a real-space modulation of the local SC gap structure in KFe2As2 under pressure.
Fernandez, J. R.; Mertens, C. J.; Bilitza, D.; Xu, X.; Russell, J. M., III; Mlynczak, M. G.
2009-01-01
Broadband infrared limb emission at 4.3 microns is measured by the TIMED/SABER instrument. At night, these emission observations at E-region altitudes are used to derive the so called NO+(v) Volume Emission Rate (VER). NO+(v) VER can be derived by removing the background CO2(v3) 4.3 microns radiance contribution using SABER-based non-LTE radiation transfer models, and by performing a standard Abel inversion on the residual radiance. SABER observations show that NO+(v) VER is significantly enhanced during magnetic storms in accordance with increased ionization of the neutral atmosphere by auroral electron precipitation, followed by vibrational excitation of NO+ (i.e., NO+(v)) from fast exothermic ion-neutral reactions, and prompt infrared emission at 4.3 m. Due to charge neutrality, the NO+(v) VER enhancements are highly correlated with electron density enhancements, as observed for example by Incoherent Scatter Radar (ISR). In order to characterize the response of the storm-time E-region from both SABER and ISR measurements, a Storm/Quiet ratio (SQR) quantity is defined as a function of altitude. For SABER, the SQR is the ratio of the storm-to-quiet NO+(v) VER. SQR is the storm-to-quiet ratio of electron densities for ISR. In this work, we compare SABER and ISR SQR values between 100 to 120 km. Results indicate good agreement between these measurements. SQR values are intended to be used as a correction factor to be included in an empirical storm-time correction to the International Reference Ionosphere model at E-region altitudes.
Energy Technology Data Exchange (ETDEWEB)
Dverstorp, Bjoern; Moberg, Leif; Wiebert, Anders; Xu Shulan [Swedish Radiation Protection Authority, Stockholm (Sweden); Stroemberg, Bo; Kautsky, Fritz; Lilja, Christina; Simic, Eva; Sundstroem, Benny; Toverud, Oeivind [Swedish Nuclear Power Inspectorate, Stockholm (Sweden)
2005-07-01
This report presents the findings of a review of the Swedish Nuclear Fuel and Waste Management Co.'s (SKB) interim report of the safety assessment SR-Can (SKB TR 04-11), conducted by the Swedish Radiation Protection Authority (SSI) and the Swedish Nuclear Power Inspectorate (SKI). SKB's interim report describes and exemplifies the safety assessment methodology that SKB plans to use in the oncoming licence applications for an encapsulation plant and a final repository for spent nuclear fuel. The authorities' review takes into account the findings of an international peer review of SKB's interim report. The authorities conclude that SKB has improved its safety assessment methodology in several aspects compared to earlier safety reports. Among other things the authorities commend SKB for giving a comprehensive account of relevant regulations and guidance, and for the systematic approach to identification and documentation of features, events and processes that need to be considered in the safety assessment. However, the authorities also conclude that important parts of SKB's method need to be further developed before they are mature enough to be used as a basis for a license application. The authorities' overall assessment is summarised in chapter 8 of this report.
Energy Technology Data Exchange (ETDEWEB)
Sagar, Budhi (Center for Nuclear Waste Regulatory Analyses, Southwest Research Inst., San Antonio, TX (US)); Egan, Michael (Quintessa Limited, Henley-on-Thames (GB)); Roehlig, Klaus-Juergen (Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH (DE)); Chapman, Neil (Independent Consultant (XX)); Wilmot, Roger (Galson Sciences Limited, Oakham (GB))
2008-03-15
In 2006, SKB published a safety assessment (SR-Can) as part of its work to support a licence application for the construction of a final repository for spent nuclear fuel. The purposes of the SR-Can project were stated in the main project report to be: 1. To make a first assessment of the safety of potential KBS-3 repositories at Forsmark and Laxemar to dispose of canisters as specified in the application for the encapsulation plant. 2. To provide feedback to design development, to SKB's research and development (R and D) programme, to further site investigations and to future safety assessments. 3. To foster a dialogue with the authorities that oversee SKB's activities, i.e. the Swedish Nuclear Power Inspectorate, SKI, and the Swedish Radiation Protection Authority, SSI, regarding interpretation of applicable regulations, as a preparation for the SR-Site project. To help inform their review of SKB's proposed approach to development of the longterm safety case, the authorities appointed three international expert review teams to carry out a review of SKB's SR-Can safety assessment report. Comments from one of these teams - the Safety Assessment Methodology (SAM) review team - are presented in this document. The SAM review team's scope of work included an examination of SKB's documentation of the assessment ('Long-term safety for KBS-3 Repositories at Forsmark and Laxemar - a first evaluation' and several supporting reports) and hearings with SKB staff and contractors, held in March 2007. As directed by SKI and SSI, the SAM review team focused on methodological aspects and sought to determine whether SKB's proposed safety assessment methodology is likely to be suitable for use in the future SR-Site and to assess its consistency with the Swedish regulatory framework. No specific evaluation of long-term safety or site acceptability was undertaken by any of the review teams. SKI and SSI's Terms of Reference for the SAM
Seismic analysis and structure capacity evaluation of the Belene nuclear power plant
International Nuclear Information System (INIS)
Johnson, J.J.; Hashimoto, P.S.; Campbell, R.D.; Baltus, R.S.
1993-01-01
The seismic analysis and structure capacity evaluation of the Belene Nuclear Power Plant, a two-unit WWER 1000, was performed. The principal objective of the study was to review the major aspects of the seismic design including ground motion specification, foundation concept and materials, and the Unit I main reactor building structure response and capacity. The main reactor building structure /foundation/soil were modeled and analyzed by a substructure approach to soil-structure interaction (SSI) analysis. The elements of the substructure approach, implemented in the family of computer programs CLASSI, are: Specification of the free-field ground motion; Modeling the soil profile; SSI parameters; Modeling the structure; SSI-response analyses. Each of these aspects is discussed. The Belene Unit 1 main reactor building structure was evaluated to verify the seismic design with respect to current western criteria. The structural capacity evaluation included criteria development, element load distribution analysis, structural element selection, and structural element capacity evaluation. Equipment and commodity design criteria were similarly reviewed and evaluated. Methodology results and recommendations are presented. (author)
DEFF Research Database (Denmark)
Bajrić, Anela; Høgsberg, Jan Becker; Rüdinger, Finn
2018-01-01
Reliable predictions of the lifetime of offshore wind turbine structures are influenced by the limited knowledge concerning the inherent level of damping during downtime. Error measures and an automated procedure for covariance driven Operational Modal Analysis (OMA) techniques has been proposed....... In order to obtain algorithmic independent answers, three identification techniques are compared: Eigensystem Realization Algorithm (ERA), covariance driven Stochastic Subspace Identification (COV-SSI) and the Enhanced Frequency Domain Decomposition (EFDD). Discrepancies between automated identification...... techniques are discussed and illustrated with respect to signal noise, measurement time, vibration amplitudes and stationarity of the ambient response. The best bias-variance error trade-off of damping estimates is obtained by the COV-SSI. The proposed automated procedure is validated by real vibration...
International Nuclear Information System (INIS)
Ichikawa, T.; Hayashi, Y.; Nakai, S.
1987-01-01
The effect of the wall-ground separation depends on the relation between the fundamental frequency of the SSI system and that of the surface layer. The maximum accelerations of the upper floors are increased if the side soil is soft. The building shear force is decreased below the ground level if the fundamental frequency of the SSI system is nearly equal to that of the surface layer. The floor response spectra are slightly increased in the high frequency range. Yielding of the soil occurred only in case that the side soil is soft, and the yield zone was restricted in the upper part of the surface layer. Therefore, the material nonlinearity did not affect the results so much. The results of the sway-rocking model (lumped mass model) analysis showed good agreements with those of the FEM models. (orig./HP)
International Nuclear Information System (INIS)
Park, Chi Seon; Lee, Sang Hoon; Yoo, Kwang Hoon
2004-01-01
Soil properties supporting structure may become criteria determining methodologies for seismic response analysis of a structure. Regulatory Guide describes that a fixed-base assumption is acceptable for structures supported on rock or rock-like materials defined by a shear wave velocity of 3,500 ft/sec or greater at a shear strain of 10 -3 percent or smaller when considering preloaded soil conditions due to the structure. Seismic analyses for the Korean nuclear power plant (NPP) structures satisfying the above site soil condition have been completed through the fixed-base analysis. However, dynamic responses for relatively stiff structures such as NPP structures still have soil-structure interaction (SSI) effects. In other words, the fixed-base analysis does not always yield conservative results to be compared with SSI analysis. The SSI effects due to different stiff soil properties for Turbine Generator Building (TGB) structure to be constructed at Kori site of South Korea are investigated in views of floor response spectra (FRS) and member forces
International Nuclear Information System (INIS)
Papa, Massimo; Cardella, Giuseppe; Bonanno, Antonio; Pappalardo, Giuseppe; Rizzo, Francesca; Amorini, Francesca; Bonasera, Aldo; Di Pietro, Alessia; Figuera, Pier Paolo; Tudisco, Salvatore; Maruyama, Toshiki
2003-01-01
Coherent and incoherent dipolar γ-ray emission is studied in a fully dynamical approach by means of the constrained molecular dynamics model. The study is focused on the system 40 Ca+ 48 Ca for which recently experimental data have been collected at 25 MeV/nucleon. The approach allows us to explain the experimental results in a self-consistent way without using statistical or hybrid models. Moreover, calculations performed at higher energy show interesting correlations between the fragment formation process, the degree of collectivity, and the coherence degree of the γ-ray emission process
Energy Technology Data Exchange (ETDEWEB)
Xu, Xiao Quan; Wu, Chen Jiang; Lu, Shan Shan; Gao, Qian Qian; Zu, Qing Quan; Liu, Xing Long; Shi, Hai Bin; Liu, Sheng [Dept. of Radiology, The First Affiliated Hospital of Nanjing Medical University, Nanjing (China)
2017-09-15
To determine the relationship between intravoxel incoherent motion (IVIM) imaging derived quantitative metrics and serum soluble CD40 ligand (sCD40L) level in an embolic canine stroke model. A middle cerebral artery occlusion model was established in 24 beagle dogs. Experimental dogs were divided into low- and high-sCD40L group according to serum sCD40L level at 4.5 hours after establishing the model. IVIM imaging was scanned at 4.5 hours after model establishment using 10 b values ranging from 0 to 900 s/mm{sup 2}. Quantitative metrics diffusion coefficient (D), pseudodiffusion coefficient (D{sup *}), and perfusion fraction (f) of ischemic lesions were calculated. Quantitative metrics of ischemic lesions were normalized by contralateral hemisphere using the following formula: normalized D = D{sub stroke} / D{sub contralateral}. Differences in IVIM metrics between the low- and high-sCD40L groups were compared using t test. Pearson's correlation analyses were performed to determine the relationship between IVIM metrics and serum sCD40L level. The high-sCD40L group showed significantly lower f and normalized f values than the low-sCD40L group (f, p < 0.001; normalized f, p < 0.001). There was no significant difference in D{sup *}, normalized D{sup *}, D, or normalized D value between the two groups (All p > 0.05). Both f and normalized f values were negatively correlated with serum sCD40L level (f, r = −0.789, p < 0.001; normalized f, r = −0.823, p < 0.001). However, serum sCD40L level had no significant correlation with D{sup *}, normalized D{sup *}, D, or normalized D (All p > 0.05). The f value derived from IVIM imaging was negatively correlated with serum sCD40L level. f value might serve as a potential imaging biomarker to assess the formation of microvascular thrombosis in hyperacute period of ischemic stroke.
Cinar, Süleyman; Al-Ayoubi, Samy; Sternemann, Christian; Peters, Judith; Winter, Roland; Czeslik, Claus
2018-01-31
Calmodulin (CaM) is a Ca 2+ sensor and mediates Ca 2+ signaling through binding of numerous target ligands. The binding of ligands by Ca 2+ -saturated CaM (holo-CaM) is governed by attractive hydrophobic and electrostatic interactions that are weakened under high pressure in aqueous solutions. Moreover, the potential formation of void volumes upon ligand binding creates a further source of pressure sensitivity. Hence, high pressure is a suitable thermodynamic variable to probe protein-ligand interactions. In this study, we compare the binding of two different ligands to holo-CaM as a function of pressure by using X-ray and neutron scattering techniques. The two ligands are the farnesylated hypervariable region (HVR) of the K-Ras4B protein, which is a natural binding partner of holo-CaM, and the antagonist trifluoperazine (TFP), which is known to inhibit holo-CaM activity. From small-angle X-ray scattering experiments performed up to 3000 bar, we observe a pressure-induced partial unfolding of the free holo-CaM in the absence of ligands, where the two lobes of the dumbbell-shaped protein are slightly swelled. In contrast, upon binding TFP, holo-CaM forms a closed globular conformation, which is pressure stable at least up to 3000 bar. The HVR of K-Ras4B shows a different binding behavior, and the data suggest the dissociation of the holo-CaM/HVR complex under high pressure, probably due to a less dense protein contact of the HVR as compared to TFP. The elastic incoherent neutron scattering experiments corroborate these findings. Below 2000 bar, pressure induces enhanced atomic fluctuations in both holo-CaM/ligand complexes, but those of the holo-CaM/HVR complex seem to be larger. Thus, the inhibition of holo-CaM by TFP is supported by a low-volume ligand binding, albeit this is not associated with a rigidification of the complex structure on the sub-ns Å-scale.
Sparse decompositions in 'incoherent' dictionaries
DEFF Research Database (Denmark)
Gribonval, R.; Nielsen, Morten
2003-01-01
a unique sparse representation in such a dictionary. In particular, it is proved that the result of Donoho and Huo, concerning the replacement of a combinatorial optimization problem with a linear programming problem when searching for sparse representations, has an analog for dictionaries that may...
Single beam stability, incoherent effects
International Nuclear Information System (INIS)
Autin, B.; Bassetti, M.; Faugeras, P.; Hilaire, A.; Montague, B.; Potaux, D.; Scandale, W.; Vos, L.; Zyngier, H.
1980-01-01
The group first realized that it was difficult in the available time to make an overall review of the many subjects implied by the group's heading. It therefore restricted itself to a few separate topics, which are: 1. Working point. 2. Non-linear coupling. 3. Effect of octupoles. 4. Chromaticity correction and tracking. 5. Vertical dispersion. 6. Beam separation. 7. Remark on non-linear lens experiments. (orig.)
The precautionary principle is incoherent
Peterson, M.B.
2006-01-01
This article argues that no version of the precautionary principle can be reasonably applied to decisions that may lead to fatal outcomes. In support of this strong claim, a number of desiderata are proposed, which reasonable rules for rational decision making ought to satisfy. Thereafter, two
Spatial incoherence of solar granulation
DEFF Research Database (Denmark)
Lund, Mikkel N.; Chaplin, William J.; Hale, Steven J.
2017-01-01
A poor understanding of the impact of convective turbulence in the outer layers of the Sun and Sun-like stars challenges the advance towards an improved understanding of their internal structure and dynamics. Assessing and calibrating these effects is therefore of great importance. Here, we study...
Analysis of Foundation of Tall R/C Chimney Incorporating Flexibility of Soil
Jayalekshmi, B. R.; Jisha, S. V.; Shivashankar, R.
2017-09-01
Three dimensional Finite Element (FE) analysis was carried out for 100 and 400 m high R/C chimneys having piled annular raft and annular raft foundations considering the flexibility of soil subjected to across-wind load. Stiffness of supporting soil and foundation were varied to evaluate the significance of Soil-Structure Interaction (SSI). The integrated chimney-foundation-soil system was analysed by finite element software ANSYS based on direct method of SSI assuming linear elastic material behaviour. FE analyses were carried out for two cases of SSI namely, (1) chimney with annular raft foundation and (2) chimney with piled annular raft foundation. The responses in raft such as bending moments and settlements were evaluated for both the cases and compared to those obtained from the conventional method of analysis of annular raft foundation. It is found that the responses in raft vary considerably depending on the stiffness of the underlying soil and the stiffness of foundation. Piled raft foundations are better suited for tall chimneys to be constructed in loose or medium sand.
Analysis and evaluation of seismic response of reactor building for Daya Bay Nuclear Power Plant
International Nuclear Information System (INIS)
Li Zhongcheng; China Guangdong Nuclear Power Company, Shenzhen; Li Zhongxian
2005-01-01
Daya Bay NPP has been operating safely and stably over 10 years since 1994, and its' seismic analysis of nuclear island was in accordance with the approaches in RCC-G standard for the model M310, in which the Simplified Impedance Matrix Method (SIMM) was employed for the consideration of SSI. Thanks to the rapid progress being made in upgrading the evaluation technology and the capability of data processing systems, methods and software tools for the SSI analysis have experienced significant development all over the world. Focused on the model of reactor building of the Daya Bay NPP, in his paper the more sophisticated 3D half-space continuum impedance method based on the Green functions is used to analyze the functions of the soil, and then the seismic responses of the coupled SSI system are calculated and compared with the corresponding design values. It demonstrates that the design method provides a set of conservatively safe results. The conclusions from the study is hopefully to provide some important references to the assessment of seismic safety margin for the operating NPPs. (authors)
Oaida, C. M.; Skiles, M.; Painter, T. H.; Xue, Y.
2015-12-01
The mountain snowpack is an essential resource for both the environment as well as society. Observational and energy balance modeling work have shown that dust on snow (DOS) in western U.S. (WUS) is a major contributor to snow processes, including snowmelt timing and runoff amount in regions like the Upper Colorado River Basin (UCRB). In order to accurately estimate the impact of DOS to the hydrologic cycle and water resources, now and under a changing climate, we need to be able to (1) adequately simulate the snowpack (accumulation), and (2) realistically represent DOS processes in models. Energy balance models do not capture the impact on a broader local or regional scale, nor the land-atmosphere feedbacks, while GCM studies cannot resolve orographic-related precipitation processes, and therefore snowpack accumulation, owing to coarse spatial resolution and smoother terrain. All this implies the impacts of dust on snow on the mountain snowpack and other hydrologic processes are likely not well captured in current modeling studies. Recent increase in computing power allows for RCMs to be used at higher spatial resolutions, while recent in situ observations of dust in snow properties can help constrain modeling simulations. Therefore, in the work presented here, we take advantage of these latest resources to address the some of the challenges outlined above. We employ the newly enhanced WRF/SSiB regional climate model at 4 km horizontal resolution. This scale has been shown by others to be adequate in capturing orographic processes over WUS. We also constrain the magnitude of dust deposition provided by a global chemistry and transport model, with in situ measurements taken at sites in the UCRB. Furthermore, we adjust the dust absorptive properties based on observed values at these sites, as opposed to generic global ones. This study aims to improve simulation of the impact of dust in snow on the hydrologic cycle and related water resources.
O'Neill, Patricia A; Kirton, Orlando C; Dresner, Lisa S; Tortella, Bartholomew; Kestner, Mark M
2004-02-01
Fecal contamination from colon injury has been thought to be the most significant factor for the development of surgical site infection (SSI) after trauma. However, there are increasing data to suggest that other factors may play a role in the development of postinjury infection in patients after colon injury. The purpose of this study was to determine the impact of gastric wounding on the development of SSI and nonsurgical site infection (NSSI) in patients with colon injury. Post hoc analysis was performed on data prospectively collected for 317 patients presenting with penetrating hollow viscus injury. One hundred sixty-two patients with colon injury were subdivided into one of three groups: patients with isolated colon wounds (C), patients with colon and stomach wounds with or without other organ injury (C+S), and patients with colon and other organ injury but no stomach injury (C-S) and assessed for the development of SSI and NSSI. Infection rates were also determined for patients who sustained isolated gastric injury (S) and gastric injury in combination with other injuries other than colon (S-C). Penetrating Abdominal Trauma Index, operative times, and transfusion were assessed. Discrete variables were analyzed by Cochran-Mantel-Haenszel chi2 test and Fisher's exact test. Risk factor analysis was performed by multivariate logistic regression. C+S patients had a higher rate of SSI infection (31%) than C patients (3.6%) (p=0.008) and C-S patients (13%) (p=0.021). Similarly, the incidence of NSSI was also significantly greater in the C+S group (37%) compared with the C patients (7.5%) (p=0.07) and the C-S patients (17%) (p=0.019). There was no difference in the rate of SSI or NSSI between the C and C-S groups (p=0.3 and p=0.24, respectively). The rate of SSI was significantly greater in the C+S patients when compared with the S-C patients (31% vs. 10%, p=0.008), but there was no statistical difference in the rate of NSSI in the C+S group and the S-C group (37
Postoperative prophylactic antibiotics for facial fractures: A systematic review and meta-analysis.
Habib, Andy M; Wong, Alexander D; Schreiner, Geoffrey C; Satti, Komal F; Riblet, Natalie B; Johnson, Heather A; Ossoff, Jacob P
2018-05-14
Perioperative antibiotic prophylaxis in patients undergoing surgery for maxillofacial fractures is standard practice. However, the use of postoperative antibiotic prophylaxis remains controversial. This systematic review and meta-analysis sought to evaluate the effect of postoperative antibiotic therapy on the incidence of surgical site infection (SSI) in patients with maxillofacial fractures. MEDLINE, Embase, and the Cochrane Library were searched from inception through October 2017. Randomized controlled trials (RCTs) and cohort studies evaluating the efficacy of pre-, peri-, and postoperative antibiotic prophylaxis in preventing SSI in maxillofacial fractures were included. Data were extracted from studies using a standardized data collection form, with two reviewers independently performing extraction and quality assessment for each study. Risk ratios (RRs) for SSI were pooled using a random-effects model. Among 2,150 potentially eligible citations, 13 studies met inclusion criteria and provided data to be included in a meta-analysis. The addition of postoperative antibiotic prophylaxis to a standard preoperative and/or perioperative antibiotic regimen showed no significant difference in the risk of SSI (RR = 1.11 [95% CI: 0.86-1.44], P > .1). There were also no differences in the risk of SSI when restricting the analysis to mandibular fractures (eight studies, RR = 1.22 [95% CI: 0.92-1.62]) or open surgical techniques (eight studies, RR = 1.02 [95% CI: 0.62-1.67]). A sensitivity analysis did not find any significant differences in risk when restricting to RCTs (seven trials, RR = 1.00 [95% CI: 0.61-1.67]) or cohort studies (six studies, RR = 1.21 [95% CI: 0.89-1.63]). Our findings, along with the available evidence, does not support the routine use of postoperative antibiotic prophylaxis in patients with maxillofacial fractures. Avoiding the unnecessary use of antibiotic therapy in the postoperative period could have important
International Nuclear Information System (INIS)
2008-03-01
As a first evaluation of long-term safety for KBS-3 repositories at Forsmark and Laxemar, the SIG (Site Investigation Group) found SR-Can to be a well-produced and generally well-argued safety assessment. Overall, SKB is to be complimented on this project. Members of of the two groups INSITE and OVERSITE within the SIG had somewhat differing views on how well SKB had made use of the site data available at the end of the SDM 1.2 stage of investigations. This difference is less to do with the extent of site characterisation than of its use and application, reflecting the different levels of maturity of SKB's geosphere and biosphere assessment programmes. The more recent and current work on the sites means that our concerns expressed in this review should, to a large extent, be addressable in or prior to SR-Site, provided SKB is so minded. However, we acknowledge that some of the issues we raise will not be fully resolved until underground rock characterisation from excavations or longer records of surface conditions are available. There are also some key aspects of SKB's methodology still under development that would benefit from review prior to their use in SR-Site. More space in the currently pressing schedule would allow for this review and a consequent increase in confidence. In any case, the authorities should be aware that SKB may face residual programmatic risks, associated principally with the underground design and layout (and their knockon effects into performance), even after SR-Site. An early understanding of some of these relationships would be helped by a plan (at least on an outline level) of the underground characterisation programme. We also note that many engineering matters are still to be confronted, not least the EBS design and its implementation, along with the treatment of high stresses, if Forsmark is selected. However, our views on the nature of the SR-Can analysis and the way in which site data have been utilised in it (our principal remit
International Nuclear Information System (INIS)
Chu, Chen; Zhou, Nan; Zhang, Huayong; Dou, Xin; Li, Ming; Liu, Song; Zhu, Yun; Chen, Weibo; Chan, Queenie; He, Jian; Sun, Lingyun; Zhou, Zhengyang
2017-01-01
Highlights: • Parotid glands at grade 0–3 had significant values from those in healthy glands. • Parotid D and f values were correlated with MR nodule grade significantly. • There were significant differences of D, f, and D * values among glands at grade 0–3. - Abstract: Purpose: To explore the correlation between intravoxel incoherent motion (IVIM) magnetic resonance (MR) parameters and MR nodular grade of parotid glands in patients with Sjögren’s syndrome (SS). Materials and methods: A total of 31 consecutive patients with SS and 28 gender- and age-matched healthy volunteers underwent bilateral parotid 3.0T MR examination including the IVIM sequence (9 b values, 0–800 s/mm 2 ). The apparent diffusion coefficient (ADC), diffusion coefficient D, pseudo-diffusion coefficient D * , and perfusion fraction f of bilateral parotid glands were obtained, and the nodular grade of each parotid gland was evaluated according to the MR morphological appearance. Results: Sixty-two parotid glands in 31 patients with SS consisted of 32, 14, 8, and 8 parotid glands at MR nodular grades 0, 1, 2, and 3, respectively. In parotid glands of grade 0, 1, 2, 3 and healthy volunteers, the ADC values were (1.13 ± 0.25, 1.11 ± 0.17, 1.05 ± 0.24, 0.89 ± 0.04 and 1.00 ± 0.21) × 10 −3 mm 2 /s, D values were (0.92 ± 0.13, 0.90 ± 0.19, 0.90 ± 0.03, 0.67 ± 0.03, 0.81 ± 0.03) × 10 −3 mm 2 /s, f values were 0.20 ± 0.04, 0.18 ± 0.02, 0.15 ± 0.01, 0.11 ± 0.01, 0.15 ± 0.06, and D * values were (53.89 ± 28.26, 41.78 ± 16.35, 51.24 ± 18.69, 31.83 ± 18.03, 36.83 ± 16.14) × 10 −3 mm 2 /s respectively. The ADC, D, f, and D * values of parotid glands in patients with SS at grade 0 were significantly higher than those in healthy volunteers (all P < 0.05). Significant differences were observed in the D and f values of parotid glands in patients with SS among different grades (P = 0.003, < 0.001, respectively). The IVIM parameters (D, f) of parotid glands at early
Energy Technology Data Exchange (ETDEWEB)
Chu, Chen, E-mail: chuchen19920905@163.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhou, Nan, E-mail: snscorpion@163.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhang, Huayong, E-mail: 13770560567@163.com [Department of Rheumatology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Dou, Xin, E-mail: douxin125@126.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Li, Ming, E-mail: lm069393@163.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Liu, Song, E-mail: liusongnj@126.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhu, Yun, E-mail: qqt111@hotmail.com [Department of Rheumatology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Chen, Weibo, E-mail: Weibo.Chen@philips.com [Philips Healthcare, Shanghai, 200233 (China); Chan, Queenie, E-mail: queenie.chan@philips.com [Philips Healthcare, Hong Kong (China); He, Jian, E-mail: hjxueren@126.com [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Sun, Lingyun, E-mail: lysun_nju@163.com [Department of Rheumatology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China); Zhou, Zhengyang, E-mail: zyzhou@nju.edu.cn [Department of Radiology, Nanjing Drum Tower Hospital, The Affiliated Hospital of Nanjing University Medical School, Nanjing, 210008 (China)
2017-01-15
Highlights: • Parotid glands at grade 0–3 had significant values from those in healthy glands. • Parotid D and f values were correlated with MR nodule grade significantly. • There were significant differences of D, f, and D{sup *} values among glands at grade 0–3. - Abstract: Purpose: To explore the correlation between intravoxel incoherent motion (IVIM) magnetic resonance (MR) parameters and MR nodular grade of parotid glands in patients with Sjögren’s syndrome (SS). Materials and methods: A total of 31 consecutive patients with SS and 28 gender- and age-matched healthy volunteers underwent bilateral parotid 3.0T MR examination including the IVIM sequence (9 b values, 0–800 s/mm{sup 2}). The apparent diffusion coefficient (ADC), diffusion coefficient D, pseudo-diffusion coefficient D{sup *}, and perfusion fraction f of bilateral parotid glands were obtained, and the nodular grade of each parotid gland was evaluated according to the MR morphological appearance. Results: Sixty-two parotid glands in 31 patients with SS consisted of 32, 14, 8, and 8 parotid glands at MR nodular grades 0, 1, 2, and 3, respectively. In parotid glands of grade 0, 1, 2, 3 and healthy volunteers, the ADC values were (1.13 ± 0.25, 1.11 ± 0.17, 1.05 ± 0.24, 0.89 ± 0.04 and 1.00 ± 0.21) × 10{sup −3} mm{sup 2}/s, D values were (0.92 ± 0.13, 0.90 ± 0.19, 0.90 ± 0.03, 0.67 ± 0.03, 0.81 ± 0.03) × 10{sup −3} mm{sup 2}/s, f values were 0.20 ± 0.04, 0.18 ± 0.02, 0.15 ± 0.01, 0.11 ± 0.01, 0.15 ± 0.06, and D{sup *}values were (53.89 ± 28.26, 41.78 ± 16.35, 51.24 ± 18.69, 31.83 ± 18.03, 36.83 ± 16.14) × 10{sup −3} mm{sup 2}/s respectively. The ADC, D, f, and D{sup *} values of parotid glands in patients with SS at grade 0 were significantly higher than those in healthy volunteers (all P < 0.05). Significant differences were observed in the D and f values of parotid glands in patients with SS among different grades (P = 0.003, < 0.001, respectively). The IVIM
Advanced Seismic Fragility Modeling using Nonlinear Soil-Structure Interaction Analysis
Energy Technology Data Exchange (ETDEWEB)
Bolisetti, Chandu [Idaho National Lab. (INL), Idaho Falls, ID (United States); Coleman, Justin [Idaho National Lab. (INL), Idaho Falls, ID (United States); Talaat, Mohamed [Simpson-Gupertz & Heger, Waltham, MA (United States); Hashimoto, Philip [Simpson-Gupertz & Heger, Waltham, MA (United States)
2015-09-01
The goal of this effort is to compare the seismic fragilities of a nuclear power plant system obtained by a traditional seismic probabilistic risk assessment (SPRA) and an advanced SPRA that utilizes Nonlinear Soil-Structure Interaction (NLSSI) analysis. Soil-structure interaction (SSI) response analysis for a traditional SPRA involves the linear analysis, which ignores geometric nonlinearities (i.e., soil and structure are glued together and the soil material undergoes tension when the structure uplifts). The NLSSI analysis will consider geometric nonlinearities.
Direct methods of soil-structure interaction analysis for earthquake loadings (IV)
Energy Technology Data Exchange (ETDEWEB)
Yoon, J B; Kim, D S; Choi, J S; Kwon, K C; Kim, Y J; Lee, H J; Kim, S B; Kim, D K [Korea Advanced Institute of Science and Technology, Taejon (Korea, Republic of)
1996-07-15
Methodologies of SSI analysis for earthquake loadings have been reviewed. Based on the finite element method incorporating infinite element technique for the unbounded exterior region, a computer program for the nonlinear seismic analysis named as 'KIESSI-QK' has been developed. The computer program has been verified using a free-field site-response problem. The Hualien FVT stochastic finite element analysis after backfill and the blind prediction of earthquake responses have been carried out utilizing the developed computer program. The earthquake response analysis for the LSST structure has also been performed and compared with the measured data.