WorldWideScience

Sample records for include bp royal

  1. High radiofrequency radiation at Stockholm Old Town: An exposimeter study including the Royal Castle, Supreme Court, three major squares and the Swedish Parliament.

    Science.gov (United States)

    Hardell, Lennart; Carlberg, Michael; Koppel, Tarmo; Hedendahl, Lena

    2017-04-01

    Exposure to radiofrequency (RF) radiation was classified as a possible human carcinogen, Group 2B, by the International Agency for Research on Cancer at WHO in 2011. The exposure pattern is changing due to the rapid development of technology. Outdoor RF radiation level was measured during five tours in Stockholm Old Town in April, 2016 using the EME Spy 200 exposimeter with 20 predefined frequencies. The results were based on 10,437 samples in total. The mean level of the total RF radiation was 4,293 µW/m 2 (0.4293 µW/cm 2 ). The highest mean levels were obtained for global system for mobile communications (GSM) + universal mobile telecommunications system (UMTS) 900 downlink and long-term evolution (LTE) 2600 downlink (1,558 and 1,265 µW/m 2 , respectively). The town squares displayed highest total mean levels, with the example of Järntorget square with 24,277 µW/m 2 (min 257, max 173,302 µW/m 2 ). These results were in large contrast to areas with lowest total exposure, such as the Supreme Court, with a mean level of 404 µW/m 2 (min 20.4, max 4,088 µW/m 2 ). In addition, measurements in the streets surrounding the Royal Castle were lower than the total for the Old Town, with a mean of 756 µW/m 2 (min 0.3, max 50,967 µW/m 2 ). The BioInitiative 2012 Report defined the scientific benchmark for possible health risks as 30-60 µW/m 2 . Our results of outdoor RF radiation exposure at Stockholm Old Town are significantly above that level. The mean exposure level at Järntorget square was 405-fold higher than 60 µW/m 2 . Our results were below the reference level on 10,000,000 µW/m 2 established by the International Commission on Non-Ionizing Radiation Protection (ICNIRP), which, however, are less credible, as they do not take non-thermal effects into consideration and are not based on sound scientific evaluation. Our highest measured mean level at Järntorget was 0.24% of the ICNIRP level. A number of studies have found adverse, non-thermal (no measurable

  2. A royal visit

    CERN Multimedia

    2006-01-01

    King Harald V and Queen Sonja of Norway made a trip to CERN on Tuesday 4 April, taking a tour of part of the LHC and greeting the Norwegian students and scientists at the Laboratory. Norway's King Harald V and Queen Sonja take a tour of the ATLAS detector with CERN Director-General Robert Aymar.King Harald V and Queen Sonja are greeted warmly by members of the Norwegian community at the CERN Globe. CERN Director-General Robert Aymar welcomed the royal party, which included the Norwegian Minister of Foreign Affairs, Jonas Gahr Støre, and provided an overview of CERN's history and current and future research. ATLAS deputy spokesperson Steinar Stapnes then quickly explained the concept and inner workings of the LHC, some LHC physics goals and ATLAS, which is one of the main experiments receiving Norwegian contributions. 'I don't think I've ever had so many distinguished students before,' Stapnes said jokingly to the crowd.The royal delegation was then escorted underground for a look at the LHC tunnel and the...

  3. Royal villas in Northern Europe

    OpenAIRE

    Iversen, Frode

    2009-01-01

    This paper concerns land use and peasant society relating to settlements, power, and state formation in Northern Europe in the period 500–1200 AD, combining archaeological and written evidence in spatial landscape studies. In the mainly rural society in the Middle Ages, political and economic power seems to have been based on control over land, including people, land, and estates. The king and his followers travelled between a limited numbers of royal villas, located in the coastal areas ...

  4. Hawaiian Royal Incest

    Directory of Open Access Journals (Sweden)

    Joanne Carando

    2006-03-01

    Full Text Available When early navigators reported on Hawaii, its practices and customs, one of the most often mentioned features of the archipelago was the practice of incest among members of the royal families. Though it was restricted to a limited number of people, it was such an openly practiced tradition that it could not go unnoticed, all the more so as it concerned the rulers of the islands. What struck these first observers was also the fact that it was not considered as a sin nor as a peculiar custom by...

  5. BP's emissions trading system

    International Nuclear Information System (INIS)

    Victor, David G.; House, Joshua C.

    2006-01-01

    Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate

  6. UK Royal Navy WWII Logbooks

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — In 2006, the UK and NOAA's Climate Database Modernization Program (CDMP) funded the imaging of approximately 8,000 Royal Navy logbooks in the UK National Archives...

  7. A royal visit

    CERN Multimedia

    Katarina Anthony

    2014-01-01

    On Wednesday, 21 May, CERN received His Majesty Philippe, King of the Belgians, for a full-day visit of the Laboratory.   From left to right: Tiziano Camporesi, CMS Spokesperson; François Englert, Nobel Prize in Physics 2013; Rolf Heuer, CERN Director-General; His Majesty Philippe, King of the Belgians; Philippe Courard, Belgium's State Secretary for Scientific Policy and Walter Van Doninck, CERN Council Vice-President. Director-General Rolf Heuer welcomed King Philippe to CERN at Point 5 (Cessy). This was to be no small visit, with His Majesty accompanied by a host of diplomats, prominent Belgian physicists - including François Englert - and even members of Belgium's press corps. After quick introductions, the morning began with a tour of the CMS underground experimental area and the LHC tunnel at Point 5, guided by the CMS Collaboration Spokesperson, Tiziano Camporesi, and the Director for Accelerators and Technology, Frédérick Bord...

  8. Identification of a Novel Heterozygous De Novo 7-bp Frameshift Deletion in PBX1 by Whole-Exome Sequencing Causing a Multi-Organ Syndrome Including Bilateral Dysplastic Kidneys and Hypoplastic Clavicles

    Directory of Open Access Journals (Sweden)

    Korbinian Maria Riedhammer

    2017-11-01

    Full Text Available IntroductionCongenital anomalies of the kidney and urinary tract (CAKUT represent the primary cause of chronic kidney disease in children. Many genes have been attributed to the genesis of this disorder. Recently, haploinsufficiency of PBX1 caused by microdeletions has been shown to result in bilateral renal hypoplasia and other organ malformations.Materials and methodsHere, we report on a 14-year-old male patient with congenital bilateral dysplastic kidneys, cryptorchidism, hypoplastic clavicles, developmental delay, impaired intelligence, and minor dysmorphic features. Presuming a syndromic origin, we performed SNP array analysis to scan for large copy number variations (CNVs followed by whole-exome sequencing (WES. Sanger sequencing was done to confirm the variant’s de novo status.ResultsSNP array analysis did not reveal any microdeletions or -duplications larger than 50 or 100 kb, respectively. WES identified a novel heterozygous 7-bp frameshift deletion in PBX1 (c.413_419del, p.Gly138Valfs*40 resulting in a loss-of-function. The de novo status could be confirmed by Sanger sequencing.DiscussionBy WES, we identified a novel heterozygous de novo 7-bp frameshift deletion in PBX1. Our findings expand the spectrum of causative variants in PBX1-related CAKUT. In this case, WES proved to be the apt technique to detect the variant responsible for the patient’s phenotype, as single gene testing is not feasible given the multitude of genes involved in CAKUT and SNP array analysis misses rare single-nucleotide variants and small Indels.

  9. Royal Commissions into Policing: Australia

    Directory of Open Access Journals (Sweden)

    Alan Beckley

    2013-03-01

    Full Text Available Royal Commissions and Inquiries have investigated every police force in Australia in relation to their integrity, accountability and effectiveness—a factor of major importance to every citizen in maintaining their freedom, safety and security. The crucial question this paper poses is whether such tribunals are effective or otherwise in terms of the benefits and outcomes accrued from their findings. The paper is in the form of a critical discussion which investigates and analyses the Inquiries using the method of desk research of official documents over the last 50 years from which it identifies common findings and recommendations contained in the official discourse. The research concludes that lessons have not been learned in relation to policing operations, accountability and integrity in a number of cases and highlights a variety of adverse issues that persist into current policing practice.

  10. Jean Lesaulnier, Images de Port-Royal

    OpenAIRE

    Pavesio, Monica

    2017-01-01

    Il volume di Jean Lesaulnier completa e precisa il precedente, pubblicato nel 2002 con il titolo di Images de Port-Royal I, che ha inaugurato la collezione Univers Port-Royal delle edizioni Classiques Garnier. Seguendo l’esempio del primo tomo, il presente saggio è suddiviso in tre sezioni che raggruppano venticinque studi: «Autour de Port-Royal des Champs» (cap. I-XI), «Questions d’historiographie port-royaliste» (cap. XII-XVII), «Figures discrètes de Port-Royal» (cap. XVIII-XXIV), con in ag...

  11. Efficacy of royal jelly on methotrexate-induced systemic oxidative ...

    African Journals Online (AJOL)

    The aim of this present study is to investigate the mucositis caused by methotrexate (MTX), as well as whether the application of royal jelly (RJ) has a protective effect on oxidative stress. This present study included six groups each consisted of 12 Wistar rats. Distilled water (po: peroral) was given to the 1st group as placebo ...

  12. Does Royal jelly affect tumor cells?

    Directory of Open Access Journals (Sweden)

    Shirzad Maryam

    2013-04-01

    Full Text Available Introduction: Royal jelly is a substance that appears to be effective on immune system and it appears to be effective on both prevention and growth of cancer cells. In this study, we aimed to carry out a research to investigate the effect of royal jelly on the growth of WEHI-164 fibrosarcoma cell in syngenic Balb/c mice. Methods: In an experimental study, 28 male Balb/c mice were designated into four equal groups. The mice were subcutaneously injected with 5x105 WEHI-164 tumor cells on the day zero in the chest area of the animal. Animals in groups 1 to 4 were orally given 100, 200, 300 mg/kg of royal jelly or vehicle, respectively. In every individual mouse, the tumour size was measured every 2 days from day 5 (days 5, 7, 9, 11, 13, 15 and 17. Data were statistically analyzed using Kruskal-Wallis and Mann Whitney-U tests. Result: Our results showed that the mean size of tumor in case group was significantly smaller than the control group in days 11, 13, 15 and 17 (P<0.05. No metastasis was seen in test and control groups. Conclusion: With emphasize on antitumor effect of royal jelly, it seems that royal jelly has important role in control and regression of fibrosarcoma cells. Since royal jelly showed a delayed effect in control of fibrosarcoma, we suggest that royal jelly be used at least 10 days before tumor inoculation.

  13. 77 FR 62311 - Culturally Significant Objects Imported for Exhibition Determinations: “Royal Treasures From the...

    Science.gov (United States)

    2012-10-12

    ... DEPARTMENT OF STATE [Public Notice 8061] Culturally Significant Objects Imported for Exhibition Determinations: ``Royal Treasures From the Louvre: Louis XIV to Marie- Antoinette'' SUMMARY: Notice is hereby... objects to be included in the exhibition ``Royal Treasures from the Louvre: Louis XIV to Marie-Antoinette...

  14. Key Royale bridge five year evaluation.

    Science.gov (United States)

    2013-06-01

    This report describes the design, construction, instrumentation, and five-year evaluation of the Key Royale Bridge substructure. The primary focus was the evaluation of the implementation of highly reactive supplementary cementitious materials (SCM) ...

  15. Biological Activities of Royal Jelly - Review

    Directory of Open Access Journals (Sweden)

    Crenguţa I. Pavel

    2011-10-01

    Full Text Available Royal jelly is a secretion product of the cephalic glands of nurse bees that has been used for centuries for itsextraordinary properties and health effects. This bibliographic study aims to review many of the scientific findingsand research that prove many of the remarkable various actions, effects and some uses of royal jelly. There are takeninto consideration numerous biological properties and effects of royal jelly: antioxidant, neurotrophic, hipoglicemiant, hipocholesterolemiant and hepatoprotective, hypotensive and blood pressure regulatory, antitumor, antibiotic, anti-inflammatory, immunomodulatory and anti-allergic, general tonic and antiaging. Royal jelly is one ofthe most studied bee products, but there still remains much to reveal about its biochemistry and biological activity infuture research for our health and life benefit.

  16. The Magnetic Observatory Buildings at the Royal Observatory, Cape

    Science.gov (United States)

    Glass, I. S.

    2015-10-01

    During the 1830s there arose a strong international movement, promoted by Carl Friedrich Gauss and Alexander von Humboldt, to characterise the earth's magnetic field. By 1839 the Royal Society in London, driven by Edward Sabine, had organised a "Magnetic Crusade" - the establishment of a series of magnetic and meteorological observatories around the British Empire, including New Zealand, Australia, St Helena and the Cape. This article outlines the history of the latter installation, its buildings and what became of them.

  17. Quality Parameters for Commercial Royal Jelly

    Directory of Open Access Journals (Sweden)

    Carmen Ioana Muresan

    2016-01-01

    Full Text Available Royal jelly has become a high-value commercial product and the standardization of this product is required to guarantee its quality on the market. The objective of the research activity was to pursue the chemical composition of commercial samples of Royal Jelly in Romania in order to propose standardization for this product. The physico-chemical composition of commercial Royal Jelly samples was analysed by determining quality parameters like: carbohydrates, lipids, proteins, 10-hydroxy-2-decenoic acid (10-HDA and mineral elements. Carbohydrates analysis showed values between 3.4 % and 5.87 % for fructose, 4.12 % and 7.05 % for glucose, while for sucrose the values ranged between 0.95 % and 2.56 % (determined by HPLC-RI. The lipids content ranged between 1.85 % and 6.32 % (determined by the Soxhlet method. The protein values extended from 13.10 % (RJ2 to 17.04 % (RJ10 (the total protein content was determined by the Kjeldahl method. The values for the major fatty acid in Royal Jelly, 10-HDA, ranged between 1.35 % (RJ8 and 2.03 % (RJ10 (determined by high-performance liquid chromatography. The concentration of minerals varied between 3188.70 mg/kg and 4023.39 mg/kg (the concentration of minerals was measured using flame atomic absorption spectrometry. Potassium, followed by magnesium, sodium and calcium, occurs in the highest concentrations. The commercial Royal Jelly samples analysed presented variable physico-chemical characteristics that correspond with the values given by international quality standard proposals for Royal Jelly.

  18. Royal Dutch Petroleum Company annual report 1992

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    The Royal Dutch Petroleum Company has no operations of its own and virtually the whole of its income derives from its 60% interest in the companies known collectively as the Royal Dutch/Shell Group of Companies; the other 40% is owned by the Shell Transport and Trading Company, p.l.c. The company is engaged in the oil, natural gas, chemicals, coal and metals businesses throughout the world. The annual report summarises the year's results and analyses earnings in each industry segment. Financial statements for the year ended 31 December 1992 are presented. The Group companies' estimated net quantities of crude oil, natural gas and coal are given

  19. Expanding the BP1-BP2 15q11.2 Microdeletion Phenotype: Tracheoesophageal Fistula and Congenital Cataracts

    Directory of Open Access Journals (Sweden)

    D. Wong

    2013-01-01

    Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.

  20. Geohydrologic data from Port Royal Sound, Beaufort County, South Carolina

    Science.gov (United States)

    Burt, R.A.; Belval, D.L.; Crouch, Michael; Hughes, W.B.

    1986-01-01

    Nine offshore wells were drilled through overlying sediments into the Upper Floridan aquifer in Port Royal Sound, South Carolina and the adjacent Atlantic Ocean, to obtain geologic, hydrologic, and water quality data. The Upper Floridan aquifer consists predominantly of light-gray, poorly consolidated, fossiliferous limestone. In the Port Royal Sound area, the Upper Floridan is overlain by olive-gray, medium to course sand and silty sand. Falling-head permeability tests on these overlying clastic sediments indicate permeabilities of 1,100 to 4.3 x 10 to the 7th power centimeters/sec. Other geologic and hydrologic data, including geophysical logs, sieve analyses, and detailed core descriptions were obtained, along with continuous water level records of the wells, tidal records, and barometric pressure records. Water collected from the Upper Floridan aquifer beneath Port Royal Sound and the ocean ranged in concentration of chloride from 54 to 12,000 mg/l. Measured pH ranged from 6.8 to 8.4, and alkalinity ranged from 122 to 368 mg/l as CaC03. Other water quality data obtained include temperature, specific conductance, carbon-13, carbon-14, tritium , deuterium, oxygen-18, dissolved oxygen, dissolved solids, nitrogen species, phosphorus, organic carbon, cyanide, sulfide, calcium, magnesium, sodium, potassium, sulfate, fluoride, silica , bromide, iodide, and selected trace metals. (USGS)

  1. Margaret Cavendish and the Royal Society.

    Science.gov (United States)

    Wilkins, Emma

    2014-09-20

    It is often claimed that Margaret Cavendish was an anti-experimentalist who was deeply hostile to the activities of the early Royal Society--particularly in relation to Robert Hooke's experiments with microscopes. Some scholars have argued that her views were odd or even childish, while others have claimed that they were shaped by her gender-based status as a scientific 'outsider'. In this paper I examine Cavendish's views in contemporary context, arguing that her relationship with the Royal Society was more nuanced than previous accounts have suggested. This contextualized approach reveals two points: first, that Cavendish's views were not isolated or odd when compared with those of her contemporaries, and second, that the early Royal Society was less intellectually homogeneous than is sometimes thought. I also show that, although hostile to some aspects of experimentalism, Cavendish nevertheless shared many of the Royal Society's ambitions for natural philosophy, especially in relation to its usefulness and the importance of plain language as a means to disseminate new ideas.

  2. Isaac Newton and the Royal Mint

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 11; Issue 12. Isaac Newton and the Royal Mint. Biman Nath. Article-in-a-Box Volume 11 Issue 12 December 2006 pp 6-7. Fulltext. Click here to view fulltext PDF. Permanent link: https://www.ias.ac.in/article/fulltext/reso/011/12/0006-0007 ...

  3. ANTIBACTERIAL EFFECTS OF FRESH AND PRESERVED ROYAL JELLY

    Directory of Open Access Journals (Sweden)

    Zinka Maksimović

    2013-10-01

    Full Text Available Antibacterial effects of the fresh royal jelly, royal jelly stored at 4 °C and -40 °C for a period of 12 months against reference and isolated bacterial strains from the different clinical samples, were tested and compared by the diffusion test. Royal jelly shows antibacterial effects against both tested gram-positive and gram-negative bacteria. Fresh royal jelly has the most effective antibacterial activity. Storage temperature at -40 oC slightly affects antibacterial activity of royal jelly, while storage temperature at 4 oC decreases its antibacterial activity.Key words: royal jelly, antibacterial effects, storage temperature, storage duration

  4. Inca Royal Estates in the Sacred Valley

    Science.gov (United States)

    McKim Malville, J.

    The royal estates lying between Cusco and Machu Picchu illustrate the remarkable variety by which the sun was honored and worshipped in the Inca Empire. The terraced basins of Moray combine the sun at both solstices and, perhaps, the zenith sun, with flowing water and offerings to Pachamama. The complex astronomy at Urubamba involves the palace of Quespiwanka, horizon pillars, solstices, and mountain worship. Ollantaytambo contains horizontal shadow-casting gnomons with a major water shrine.

  5. Lake Duortnus, Royal Science, and Nomadic Practices

    OpenAIRE

    Schough, Katarina

    2007-01-01

    What happens when a dominant mode of knowledge colonises a life world, i.e. when Royal Science encounters Nomadic Practices? Science and colonisation have always been resisted and contested, not least by its supposed “objects”. Questions of geography, space and orlding have been at the centre of such resistances and contestations. This book details one such encounter. It is a register of the interplays of power, knowledge, and space as manifested in the multiple constructions of Lake Duortnos...

  6. Clinical correlates of ambulatory BP monitoring among patients with CKD.

    Science.gov (United States)

    Iimuro, Satoshi; Imai, Enyu; Watanabe, Tsuyoshi; Nitta, Kosaku; Akizawa, Tadao; Matsuo, Seiichi; Makino, Hirofumi; Ohashi, Yasuo; Hishida, Akira

    2013-05-01

    Ambulatory BP monitoring (ABPM) allows a better risk stratification than office BP in hypertensive patients. However, the clinical relevance of ABPM has not been extensively investigated in the CKD population. Within the Chronic Kidney Disease Japan Cohort study, 2977 patients enrolled (62% men, aged 60.8±11.6 years) and ABPM was conducted in a subgroup of patients from September 2007 to April 2010. Data from 1075 patients (682 men) were analyzed to determine BP control and factors associated with the ABPM parameters. The prevalence of masked hypertension was 30.9%, whereas that of white-coat hypertension was 5.6%. With advancing CKD stage, the percentage of persistent hypertension increased from 21.7% to 36.1%. Diabetes, antihypertensive medicine use, and low estimated GFR (eGFR) were significantly associated with the difference between office BP and ambulatory BP (1.7 mmHg, 2.6 mmHg, and 0.6 mmHg per 10 ml/min per 1.73 m(2), respectively). There tended to be fewer nondippers and risers in stage 3 than in stages 4 and 5. In the nocturia-negative group, low eGFR, diabetes, and summer season were identified as factors associated with lower nocturnal BP change (-0.5 mmHg, -2.0 mmHg, and -2.8 mmHg, respectively). Morning BP change was greater with older age (0.2 mmHg per 10 years) and higher body mass index (0.6 mmHg per 1 kg/m(2)), and in winter (4.5 mmHg) versus summer. Various factors including eGFR, diabetes, antihypertensive medication use, and season are associated with higher BP and abnormal BP patterns in CKD patients.

  7. The Bali bombing: the Royal Darwin Hospital response.

    Science.gov (United States)

    Palmer, Didier J; Stephens, Dianne; Fisher, Dale A; Spain, Brian; Read, David J; Notaras, Len

    2003-10-06

    After the Bali bombing on 12 October 2002, injured Australians were evacuated to Darwin. The first patients arrived at the Royal Darwin Hospital (RDH) 26 hours after the blasts. RDH assessed and resuscitated 61 patients (including 20 intensive care patients, with 15 requiring ventilation, 19 surgery and more than 20 escharotomies). RDH evacuated 48 patients to burns centres around Australia within 36 hours of the first patient arrivals at the hospital and 62 hours after the bomb blasts. The response was successful, but improvements are needed in coordination between the different groups involved in such operations.

  8. 76 FR 80433 - In the Matter of Royal Oak Capital Management, LLC, 6173 Bellevue Road, Royal Oak, MD 21662...

    Science.gov (United States)

    2011-12-23

    ... No. 3340] In the Matter of Royal Oak Capital Management, LLC, 6173 Bellevue Road, Royal Oak, MD 21662...''), cancelling the registration of Royal Oak Capital Management, LLC, hereinafter referred to as the registrant... investment adviser from registering with the Commission unless it maintained assets under management of at...

  9. Rare royal families in honeybees, Apis mellifera

    Science.gov (United States)

    Moritz, Robin F. A.; Lattorff, H. Michael G.; Neumann, Peter; Kraus, F. Bernhard; Radloff, Sarah E.; Hepburn, H. Randall

    2005-10-01

    The queen is the dominant female in the honeybee colony, Apis mellifera, and controls reproduction. Queen larvae are selected by the workers and are fed a special diet (royal jelly), which determines caste. Because queens mate with many males a large number of subfamilies coexist in the colony. As a consequence, there is a considerable potential for conflict among the subfamilies over queen rearing. Here we show that honeybee queens are not reared at random but are preferentially reared from rare “royal” subfamilies, which have extremely low frequencies in the colony's worker force but a high frequency in the queens reared.

  10. [The Royal Protomedicato in Spanish Naples].

    Science.gov (United States)

    Gentilcore, D

    1996-01-01

    Rather than having any established bureaucracy or magistracy of its own, the Royal Neapolitan Protomedicato was based around the person who was its pro tempore head - the protomedico. The position was very prestigious, involving the Kingdom's most powerful physicians, but the office itself made little impact on public health. In fact, the Protomedicato's functions were primarily fiscal: the collecting of duties and fines from non-graduate medical practitioners and the inspections of apothecaries shops, carried out by tax renters on behalf of the state.

  11. Oral Allergy Syndrome in a Child Provoked by Royal Jelly

    Directory of Open Access Journals (Sweden)

    Fantini Paola

    2014-01-01

    Full Text Available Royal jelly has been demonstrated to have several physiological activities. However, in the literature, different reactions induced by royal jelly are reported. We describe a case of seven-year-old child that was referred to our observation for two episodes of oral allergy syndrome (OAS that appeared ten minutes after ingestion of royal jelly. Skin prick test with standard panel of inhalant and food allergens, a prick-to-prick test using the royal jelly’s extract responsible for patient’s reactions, and royal jelly patch test with extemporaneous preparation were performed. The specific IgE by ImmunoCAP System method versus Hymenoptera venom, inhalant allergens, food allergens, and lipid transfer proteins was dosed. According to the positive reactions to royal jelly both by prick-by-prick test and by a first reading patch test, royal jelly immediate hypersensitivity was diagnosed. According to the positive response for almond in both in vivo and in vitro tests we can think of the royal jelly contamination with almond pollen as possible cause of patient’s reaction. Moreover, from the results of specific IgE titers versus Compositae pollens, we have argued the possibility that this case of royal jelly allergy could be explained also by the mechanism of cross-reaction with Compositae pollens.

  12. The Royal pilgrimage of the Goddess Nanda

    Directory of Open Access Journals (Sweden)

    William S. Sax

    2010-01-01

    Full Text Available Once every twelve years, when it is thought that some calamity has taken place because of the curse of the goddess Nanda Devi, a four-horned ram is born in the fields of the former king of Garhwal, an erstwhile Central Himalayan kingdom in north India (see map of Garhwal. This four-horned ram leads a procession of priests and pilgrims on the most dangerous and spectacular pilgrimage in all of India: a three-week, barefoot journey of one-hundred and sixty-four miles, during some of the worst weather of the year, at the end of the rainy season. The procession reaches Rupkund, a small pond located at an altitude of more than 5,000 metres, which is surrounded by human­ skeletons, and from there it goes yet further, to Homkund, the ‘Lake of the Fire Sacrifice’. According to the faithful, the four-horned ram leaves the procession at that point and finds its way, unaided, to the summit of Mount Trishul. As its name suggests, the Royal Procession is closely associated with the ruler of this erstwhile Himalayan kingdom: he attends its inaugural rituals, the bones that litter the shores of Rupkund are believed to be those of one of his ancestors, and the chief sponsor of the event is a local ‘Prince’ who is thought to be descended from the first kings of Garhwal. This Prince traverses the domain of his ancestors and thereby lays claim to it in the name of the goddess Nanda, who is not only his lineage goddess but was also the royal goddess of the neighbouring kingdom of Kumaon, in pre-colonial times. Although the Royal Procession ideally fosters social integration, it was disrupted in 1987 by a quarrel between two factions of priests. The goddess’s itinerary, the culminating date of the pilgrimage, the type of sacrifice to be performed, the order of procession, the participation of previously excluded persons, and the competency of certain ritual specialists—all were subjects of heated dispute between the rival groups. What was the reason for

  13. Fibrous osteodystrophy in two Northern Royal albatross chicks (Diomedea sanfordi).

    Science.gov (United States)

    Morgan, K J; Alley, M R; Gartrell, B D; Thompson, K G; Perriman, L

    2011-09-01

    In February 2004, two Northern Royal albatross chicks aged 20 and 25 days old were presented for necropsy. Both chicks had been hand-fed in situ at a breeding colony, from 2-3 days post-hatch. The hand-rearing diet consisted of boneless hoki fillets (Macraronus novaezelandiae), electrolytes, and sooty shearwater (Puffinus griseus) proventricular oil obtained as a by-product of cultural harvest. Routine necropsies on the affected chicks revealed many bones were soft and easily bent. Radiography and histopathology revealed decreased bone density, pathological fractures, and extensive remodelling suggestive of fibrous osteodystrophy. Nutritional secondary hyperparathyroidism, resulting from an imbalance in the dietary Ca:P ratio. The imbalance in the dietary Ca:P ratio was a result of feeding deboned and eviscerated fish. This investigation also highlighted potential health risks associated with the practice of feeding stored rancid proventricular oil, including the destruction of fat-soluble vitamins. It is therefore possible that oxidative degradation of vitamin D may have contributed to the development of nutritional secondary hyperparathyroidism. Subsequently, dietary recommendations for supplementary feeding of orphaned Northern Royal albatross chicks include the feeding of whole human-grade fish with an appropriate Ca:P ratio, and the exclusion of proventricular oil. These cases highlight the need for scientific input into wildlife conservation projects, as lack of appropriate nutritional advice resulted in the feeding of a nutritionally inadequate diet. Following the recommended changes in diet, no further cases of osteodystrophy have been diagnosed in hand-raised chicks in the albatross colony.

  14. 36 CFR 7.38 - Isle Royale National Park.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Isle Royale National Park. 7.38 Section 7.38 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR SPECIAL REGULATIONS, AREAS OF THE NATIONAL PARK SYSTEM § 7.38 Isle Royale National Park. (a) Aircraft...

  15. The fauna of the Port Royal mangal, Kingston, Jamaica

    NARCIS (Netherlands)

    Alleng, Gerard P.

    1997-01-01

    ALLENG, Gerard P., 1997. The fauna of the Port Royal mangal, Kingston, Jamaica. Studies Nat. Hist. Caribbean Region 73, Amsterdam 1997: 23-42. An analysis and a characterization are presented of the Port Royal mangrove fauna. The existing literature on the subject is extensively reviewed and a fauna

  16. history repeats itself : saddam and the ancient mesopotamian royal

    African Journals Online (AJOL)

    harkhu

    Mesopotamian history, and how it could be used to stress continuity with a more glorious past …'. Hundreds of years later, Neo-Babylonian king Nebuchadnezzar II also revived the ancient practice of installing a royal daughter as priestess. The king miraculously 'found' an earlier royal text providing him with the details of ...

  17. The last Viking King: a royal maternity case solved by ancient DNA analysis

    DEFF Research Database (Denmark)

    Dissing, Jørgen; Binladen, Jonas; Hansen, Anders

    2006-01-01

    doubts among historians whether the woman entombed was indeed Estrid. To shed light on this problem, we have extracted and analysed mitochondrial DNA (mtDNA) from pulp of teeth from each of the two royals. Four overlapping DNA-fragments covering about 400bp of hypervariable region 1 (HVR-1) of the D...... Estridsen to haplogroup H; Estrid's sequence differed from that of Sven at two positions in HVR-1, 16093T-->C and 16304T-->C, indicating that she belongs to subgroup H5a. Given the maternal inheritance of mtDNA, offspring will have the same mtDNA sequence as their mother with the exception of rare cases...

  18. Physicochemical composition of pure and adulterated royal jelly

    Directory of Open Access Journals (Sweden)

    Luis Henrique Garcia-Amoedo

    2007-04-01

    Full Text Available The physicochemical composition of pure royal jelly as well as of some adulterated samples was analyzed by determining moisture, ash, lipids, nitrogen/proteins, carbohydrates, starch and 10- HDA (10-hydroxy-2-decenoic acid. The solubility in alkaline medium was used to detect the main frauds for adulterating royal jelly which comprise addition of yogurt, water, egg white, sweet condensed milk mixed with propolis, unripe banana and corn starch slurry.

  19. Port-Royal et l'Histoire : Notes de lecture

    OpenAIRE

    Brancourt, Isabelle

    1999-01-01

    Compte-rendu de "Port-Royal et l'histoire", Chroniques de Port-Royal, n° 46, 1997, 372 p. dans Histoire et archives, n° 5, janvier-juin 1999, ISNN : 1278-382X; Recension préparatrice du compte rendu critique (qui a été résumé) donné à Histoire et Archives, n° 5, janvier-juin 1999.

  20. Based on BP Neural Network Stock Prediction

    Science.gov (United States)

    Liu, Xiangwei; Ma, Xin

    2012-01-01

    The stock market has a high profit and high risk features, on the stock market analysis and prediction research has been paid attention to by people. Stock price trend is a complex nonlinear function, so the price has certain predictability. This article mainly with improved BP neural network (BPNN) to set up the stock market prediction model, and…

  1. Predialysis Systolic BP Variability and Outcomes in Hemodialysis Patients

    Science.gov (United States)

    Sozio, Stephen M.; Bandeen-Roche, Karen J.; Ephraim, Patti L.; Luly, Jason R.; St. Peter, Wendy L.; McDermott, Aidan; Scialla, Julia J.; Crews, Deidra C.; Tangri, Navdeep; Miskulin, Dana C.; Michels, Wieneke M.; Jaar, Bernard G.; Herzog, Charles A.; Zager, Philip G.; Meyer, Klemens B.; Wu, Albert W.; Boulware, L. Ebony

    2014-01-01

    BP variability (BPV) is an important predictor of outcomes in the general population, but its association with clinical outcomes in hemodialysis patients is not clear. We identified 11,291 patients starting dialysis in 2003–2008 and followed them through December 31, 2008 (median=22 months). Predialysis systolic BPV was assessed over monthly intervals. Outcomes included factors associated with BPV, mortality (all-cause and cardiovascular), and first cardiovascular event (cardiovascular death or hospitalization). Patients' mean age was 62 years, 55% of patients were men, and 58% of patients were white. Modifiable factors associated with higher BPV included obesity, higher calcium–phosphate product levels, and lower hemoglobin concentration; factors associated with lower BPV included greater fluid removal, achievement of prescribed dry weight during dialysis, higher hemoglobin concentration, and antihypertensive regimens without β-blockers or renin-angiotensin system blocking agents. In total, 3200 deaths occurred, including 1592 cardiovascular deaths. After adjustment for demographics, comorbidities, and clinical factors, higher predialysis BPV was associated with increased risk of all-cause mortality (hazard ratio [HR], 1.18; 95% confidence interval [95% CI] per 1 SD increase in BPV, 1.13 to 1.22), cardiovascular mortality (HR, 1.18; 95% CI, 1.12 to 1.24), and first cardiovascular event (HR, 1.11; 95% CI, 1.07 to 1.15). Results were similar when BPV was categorized in tertiles and patients were stratified by baseline systolic BP. In summary, predialysis systolic BPV is an important, potentially modifiable risk factor for death and cardiovascular outcomes in incident hemodialysis patients. Studies of BP management in dialysis patients should focus on both absolute BP and BPV. PMID:24385593

  2. Royal Jelly Modulates Hepatotoxic Effect of Rats Treated with Cisplatin

    International Nuclear Information System (INIS)

    Ashry, K.; Elkady, A.A.

    2014-01-01

    isplatin (CP) is one of the most active cytotoxic agents in the treatment of cancer and has adverse side effects such as hepatotoxicity and nephrotoxicity. The aim of this study was focused on investigating the possible protective effect of royal jelly (RJ) against oxidative stress caused by CP injury of the liver and inflammatory changes in male albino rats. Twenty four albino rats were divided into four equal groups as follows: control group, cisplatin group : (rats injected i.p. with single dose from cisplatin (CP, 7 mg / kg body weight,), royal jelly RJ group : rats treated for 15 consecutive days by gavage with RJ (300 mg/kg/day/orally), royal jelly-cisplatin group, rats treated with royal jelly orally for 15 consecutive days by gavage (300 mg/kg/day) followed by a single injection i.p. from CP (7 mg / kg body weight). The obtained results revealed that the administration of royal jelly with cisplatin in rats significantly ameliorated the changes occurred in the biochemical parameters (GSH, GPx and CAT were significantly decreased in liver of cisplatin-treated rats and increasing ALT and AST). The histopathological results showed distinctive pattern of hepatotoxic changes in cisplatin group, while in the royal jelly-cisplatin group the liver tissues showed reductions lesions. In conclusion, royal jelly acts in the liver as a potent scavenger of free radicals to prevent or ameliorates the toxic effects of CP as shown by biochemical and histopathological investigations and might provide substantial protection against cisplatin-induced hepatotoxicity and inflammatory

  3. Recovering the royal cuisine in Chosun Dynasty and its esthetics

    Directory of Open Access Journals (Sweden)

    Hae-Kyung Chung

    2017-12-01

    Full Text Available We believe that researching the cuisine consumed by the royal family, in particular the king, during the 500-year long Chosun Dynasty is an interesting and meaningful endeavor. This task is an important part of unraveling the cultural significance of Korean cuisine in the 21st century, a new age of gastronomy. Until now, research has largely focused on recreating Chosun royal cuisine based on oral statements from staff in the last royal kitchen or the Uikwe (儀軌, the Royal Protocols which recorded food consumed at banquets. However, little research has been conducted on ordinary royal cuisine consumed by the king, mainly because of a lack of materials to study. This article aims to shed light on this topic and recreate what every day royal cuisine looked like in the late stages of the Chosun Dynasty by examining joseoksangsikbalgi (朝夕上食撥記, memos of morning and evening ancestral rites table and judaryebalgi (晝茶禮撥記, memos of daytime tea ceremonies. The memos are similar to the chanpumdanja (饌品單子, literally meaning “a list of dishes served on the table” that recorded national banquets and therefore do not contain records of ordinary royal cuisine. However, the memos of morning and evening ancestral rites table still remain. These documents describe food offered to the deceased, which was the same as the meals they regularly ate while alive. Accordingly, we attempted to reproduce the traditional table setting for ordinary royal cuisine served to King Kojong (高宗 by analyzing these memos. King Kojong (1852–1919 was the 26th king of the Chosun Dynasty, and a detailed description of the sangsik (上食, ancestral rites table prepared following his death in January 1919 is present in the morning and evening sangsik memos and daytime tea ceremony memos from October 11, 1919. After analyzing the memos from after King Kojong's death in 1919, we were able to determine that the cuisine consisted of rice as bap (a

  4. AcEST: BP911840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G07 495 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G07. BP911840 - Show BP91184...is mRNA. clone: YMU001_000009_G07. Accession BP911840 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91184...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911840|Adiantum capillu

  5. AcEST: BP918406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

  6. AcEST: BP919841 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G06 496 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G06. BP919841 - Show BP91984...is mRNA. clone: YMU001_000129_G06. Accession BP919841 Tissue type prothallium Developmental stage - Contig I...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum ca...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919841|Adiantum capi

  7. AcEST: BP920186 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A11 504 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A11. BP920186 - Show BP92018...is mRNA. clone: YMU001_000134_A11. Accession BP920186 Tissue type prothallium Developmental stage - Contig I...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920186|Adiantu

  8. Further phenotypic expansion of 15q11.2 BP1-BP2 microdeletion (Burnside-Butler) syndrome.

    Science.gov (United States)

    Jerkovich, Adria M; Butler, Merlin G

    2014-01-01

    We report a 10-year-old Caucasian male identified with copy number variation detected by microarray analysis including a maternally inherited 15q11.2 microdeletion involving 4 genes, paternally inherited 13q12.2 microdeletion with 10 genes, and a de novo 2q14.3 duplication involving 4 genes. He had a history of speech delay, cognitive deficits, attention deficit hyperactivity disorder and a posterior lenticonus cataract removed at 5 yr of age. The genes on chromosomes 2 and 13 are not known to be involved with cataract formation, which lends further support of the role of the 15q11.2 region and additional evidence for phenotypic expansion of the 15q11.2 BP1-BP2 microdeletion (termed Burnside-Butler) syndrome.

  9. BP and Renal Outcomes in Diabetic Kidney Disease: The Veterans Affairs Nephropathy in Diabetes Trial.

    Science.gov (United States)

    Leehey, David J; Zhang, Jane H; Emanuele, Nicholas V; Whaley-Connell, Adam; Palevsky, Paul M; Reilly, Robert F; Guarino, Peter; Fried, Linda F

    2015-12-07

    Proteinuric diabetic kidney disease frequently progresses to ESRD. Control of BP delays progression, but the optimal BP to improve outcomes remains unclear. The objective of this analysis was to evaluate the relationship between BP and renal outcomes in proteinuric diabetic kidney disease. BP data from all 1448 randomized participants in the Veterans Affairs Nephropathy in Diabetes Trial were included in a post hoc analysis. The associations of mean on-treatment BP with the primary end point (decline in eGFR, ESRD, or death), renal end point (decline in eGFR or ESRD), rate of eGFR decline, and mortality were measured. The median (25th, 75th percentile) follow-up time was 2.2 (1.2, 3.0) years. There were 284 primary end points. In univariate analyses, both mean systolic and mean diastolic BPs were strongly associated (Prenal end point and rate of eGFR decline were similar to those with the primary end point. No association of BP with mortality was observed, possibly because of the limited number of mortality events. In patients with proteinuric diabetic kidney disease, mean systolic BP ≥ 140 mmHg and mean diastolic BP ≥ 80 mmHg were associated with worse renal outcomes. Copyright © 2015 by the American Society of Nephrology.

  10. CacyBP/SIP promotes the proliferation of colon cancer cells.

    Directory of Open Access Journals (Sweden)

    Huihong Zhai

    Full Text Available CacyBP/SIP is a component of the ubiquitin pathway and is overexpressed in several transformed tumor tissues, including colon cancer, which is one of the most common cancers worldwide. It is unknown whether CacyBP/SIP promotes the proliferation of colon cancer cells. This study examined the expression level, subcellular localization, and binding activity of CacyBP/SIP in human colon cancer cells in the presence and absence of the hormone gastrin. We found that CacyBP/SIP was expressed in a high percentage of colon cancer cells, but not in normal colonic surface epithelium. CacyBP/SIP promoted the cell proliferation of colon cancer cells under both basal and gastrin stimulated conditions as shown by knockdown studies. Gastrin stimulation triggered the translocation of CacyBP/SIP to the nucleus, and enhanced interaction between CacyBP/SIP and SKP1, a key component of ubiquitination pathway which further mediated the proteasome-dependent degradation of p27kip1 protein. The gastrin induced reduction in p27kip1 was prevented when cells were treated with the proteasome inhibitor MG132. These results suggest that CacyBP/SIP may be promoting growth of colon cancer cells by enhancing ubiquitin-mediated degradation of p27kip1.

  11. Positive Direct Immunofluorescence Is of Better Value than ELISA-BP180 and ELISA-BP230 Values for the Prediction of Relapse after Treatment Cessation in Bullous Pemphigoid: A Retrospective Study of 97 Patients.

    Science.gov (United States)

    Ingen-Housz-Oro, Saskia; Plée, Julie; Belmondo, Thibaut; Maizières, Michaël; Pham, Bach-Nga; Hüe, Sophie; Ortonne, Nicolas; Durlach, Anne; Wolkenstein, Pierre; Chosidow, Olivier; Bernard, Philippe

    2015-01-01

    ELISA-BP180 values and direct immunofluorescence (DIF) are prognostic factors for relapse after treatment cessation in bullous pemphigoid (BP). To determine the relevance of ELISA-BP230 antibodies for predicting relapse 6 months after treatment cessation. We retrospectively selected patients with BP and available data from ELISA-BP180 and -BP230 and DIF performed at treatment cessation. The rate of relapse was calculated at 6 months. We compared ELISA-BP180 and -BP230 values and DIF in patients with relapse and remission. We included 97 patients. At 6 months, 25.6% of patients showed relapse. The proportion of patients with an ELISA-BP230 value ≥27 UA/ml was higher, but not significantly, for those with relapse than for those with remission (p = 0.11). The frequency of positive DIF findings was significantly higher for patients with relapse (p = 0.005). DIF is of better value than ELISA-BP180 and -230 tests to predict relapse after treatment cessation in BP. © 2015 S. Karger AG, Basel.

  12. The Accounting Register of a Royal Secretary in Aragonese Naples

    Directory of Open Access Journals (Sweden)

    Enza Russo

    2013-04-01

    Full Text Available In the crucial years of the succession war that involved the Kingdom of Naples after Alfonso the Magnanimous’death (1459-1464, a secretary of the new king Ferrante I of Aragon, Antonello Petrucci, was entrusted with royal financial charges. He therefore compiled an account book, where receipts and payments of the royal finances were carefully recorded. It has been recently discovered: this paper aims at examining its actual framework as well as the relative volume of the state budget. Because of its new and comprehensive body of evidence, Petrucci’s account book is a very useful source, which may provide additional informations not only on the bulk of the state funds and expenditure but also on the structure of the king’s household and on the system of the royal financial administration, which appears now as characterized by a more complex organization than it was supposed to be in the past.

  13. Octanoic acid confers to royal jelly varroa-repellent properties

    Science.gov (United States)

    Nazzi, Francesco; Bortolomeazzi, Renzo; Della Vedova, Giorgio; Del Piccolo, Fabio; Annoscia, Desiderato; Milani, Norberto

    2009-02-01

    The mite Varroa destructor Anderson & Trueman is a parasite of the honeybee Apis mellifera L. and represents a major threat for apiculture in the Western world. Reproduction takes place only inside bee brood cells that are invaded just before sealing; drone cells are preferred over worker cells, whereas queen cells are not normally invaded. Lower incidence of mites in queen cells is at least partly due to the deterrent activity of royal jelly. In this study, the repellent properties of royal jelly were investigated using a lab bioassay. Chemical analysis showed that octanoic acid is a major volatile component of royal jelly; by contrast, the concentration is much lower in drone and worker larval food. Bioassays, carried out under lab conditions, demonstrated that octanoic acid is repellent to the mite. Field studies in bee colonies confirmed that the compound may interfere with the process of cell invasion by the mite.

  14. BOOK REVIEW: Robert Hooke and the Royal Society

    Science.gov (United States)

    Brown, Neil

    2000-01-01

    Many physics students only come across Hooke when they learn his law of stretching springs, which is a pity because it is just one of his contributions to progress in science, and a minor one at that. His, Micrographia, the first great book of microscopical observations, arouses admiration to this day. He was also active in horology, astronomy, geology and surveying, and he took part in biological experiments, transfusing blood between animals. Much of his work was done while he was curator of experiments for the Royal Society, in which he was involved almost from its foundation. This was by no means a full-time occupation, however. After the Great Fire of London, Hooke was appointed one of the three surveyors for the rebuilding of the city. One of the others was Christopher Wren, a lifelong friend. In this role Hooke was responsible for the design of several buildings, including the Monument. Nichols writes about all these activities, as well as Hooke's childhood, his education at Westminster School, the University of Oxford when Hooke was an undergraduate, and the founding of the Royal Society. The book draws on research for a master's degree. Turning a dissertation into a popular book is risky. The author has avoided the pitfall of making it too academic, but the result is not satisfying. Nichols seems overawed by Hooke and his work, frequently seeming to credit Hooke with a far-reaching influence that he did not necessarily have. There may be a case for lauding Hooke as the father of English microscopy, the father of English meteorology, and the founder of English geology and earth sciences, but it needs to be made much more critically, even in a popular work. Hooke was full of good ideas, but he rarely continued long enough to put them into practice. There is no doubt that Hooke proposed using a balance wheel and spring to improve the timekeeping of a watch, for example, but he did not have a watch made to his design until after Christiaan Huygens had

  15. The HLA-G 14-bp polymorphism and recurrent implantation failure: a meta-analysis.

    Science.gov (United States)

    Fan, Wei; Huang, Zhongying; Li, Shangwei; Xiao, Zhun

    2017-11-01

    The human leucocyte antigen-G (HLA-G) 14-bp insertion/deletion polymorphism was implicated in recurrent implantation failure (RIF), but individual published studies showed inconclusive results. Thus, a meta-analysis was performed to clarify the effect of HLA-G 14-bp polymorphism on RIF risk. A comprehensive search for relevant articles was conducted. The odds ratios (ORs) and 95% confidence intervals (CIs) for HLA-G 14-bp polymorphism and RIF were calculated. A total of five studies were included. In studies conducted in RIF patients and controls who had at least one spontaneous pregnancy, meta-analysis revealed no statistically significant association between the HLA-G 14-bp polymorphism and RIF in allele contrast and all genetic models in the overall population, but significant association was found in the population of Caucasian origin under allele contrast (OR = 1.73, 95% CI, 1.20, 2.50) and genetic models of +14 bp/+14 bp vs. -14 bp/-14 bp (OR = 3.09, 95% CI, 1.43, 6.65). In studies conducted in RIF patients and controls who had successful pregnancy following IVF-ET, the meta-analysis showed that there was statistically significant association between the HLA-G 14 bp polymorphism and RIF in allele contrast (OR = 1.74, 95% CI, 1.13, 2.67) and genetic models of +14 bp/+14 bp vs. -14 bp/-14 bp (OR = 10.20, 95% CI, 2.47, 42.14) and dominant model (OR = 4.34, 95% CI, 1.72, 10.92). No publication bias was found in the present studies. This meta-analysis suggested that the HLA-G 14-bp insertion allele may increase the risk of RIF in Caucasians. Further studies with large sample size of different ethnic populations are necessary.

  16. Royal Murders in the Danish Middle Ages

    DEFF Research Database (Denmark)

    Petersen, Nils Holger

    2017-01-01

    Liner notes for an audio recording of music in medieval Denmark, including chants from the office of St Knud Lavard, martyred in 1131, and songs by Meister Rumelant about the murder of King Erik V "Klipping" (1286). The essay gives historical information about the murders and their later musical...

  17. RanBP9 Plays a Critical Role in Neonatal Brain Development in Mice.

    Science.gov (United States)

    Palavicini, Juan Pablo; Lloyd, Brandon Noel; Hayes, Crystal D; Bianchi, Elisabetta; Kang, David E; Dawson-Scully, Ken; Lakshmana, Madepalli K

    2013-01-01

    RanBP9 is known to act as a scaffolding protein bringing together a variety of cell surface receptors and intracellular targets thereby regulating functions as diverse as neurite and axonal outgrowth, cell morphology, cell proliferation, myelination, gonad development, myofibrillogenesis and migration of neuronal precursors. Though RanBP9 is ubiquitously expressed in all tissues, brain is one of the organs with the highest expression levels of RanBP9. In the neurons, RanBP9 is localized mostly in the cytoplasm but also in the neurites and dendritic processes. We recently demonstrated that RanBP9 plays pathogenic role in Alzheimer's disease. To understand the role of RanBP9 in the brain, here we generated RanBP9 null mice by gene-trap based strategy. Most of Ran-/- mice die neonatally due to defects in the brain growth and development. The major defects include smaller cortical plate (CP), robustly enlarged lateral ventricles (LV) and reduced volume of hippocampus (HI). The lethal phenotype is due to a suckling defect as evidenced by lack of milk in the stomachs even several hours after parturition. The complex somatosensory system which is required for a behavior such as suckling appears to be compromised in Ran-/- mice due to under developed CP. Most importantly, RanBP9 phenotype is similar to ERK1/2 double knockout and the neural cell adhesion receptor, L1CAM knockout mice. Both ERK1 and L1CAM interact with RanBP9. Thus, RanBP9 appears to control brain growth and development through signaling mechanisms involving ERK1 and L1CAM receptor.

  18. RanBP9 Plays a Critical Role in Neonatal Brain Development in Mice.

    Directory of Open Access Journals (Sweden)

    Juan Pablo Palavicini

    Full Text Available RanBP9 is known to act as a scaffolding protein bringing together a variety of cell surface receptors and intracellular targets thereby regulating functions as diverse as neurite and axonal outgrowth, cell morphology, cell proliferation, myelination, gonad development, myofibrillogenesis and migration of neuronal precursors. Though RanBP9 is ubiquitously expressed in all tissues, brain is one of the organs with the highest expression levels of RanBP9. In the neurons, RanBP9 is localized mostly in the cytoplasm but also in the neurites and dendritic processes. We recently demonstrated that RanBP9 plays pathogenic role in Alzheimer's disease. To understand the role of RanBP9 in the brain, here we generated RanBP9 null mice by gene-trap based strategy. Most of Ran-/- mice die neonatally due to defects in the brain growth and development. The major defects include smaller cortical plate (CP, robustly enlarged lateral ventricles (LV and reduced volume of hippocampus (HI. The lethal phenotype is due to a suckling defect as evidenced by lack of milk in the stomachs even several hours after parturition. The complex somatosensory system which is required for a behavior such as suckling appears to be compromised in Ran-/- mice due to under developed CP. Most importantly, RanBP9 phenotype is similar to ERK1/2 double knockout and the neural cell adhesion receptor, L1CAM knockout mice. Both ERK1 and L1CAM interact with RanBP9. Thus, RanBP9 appears to control brain growth and development through signaling mechanisms involving ERK1 and L1CAM receptor.

  19. Royal Order of 5 December 1975 amending the Royal Order of 11 May 1971 embodying the general Military Regulations for Protection Against the Hazards of Ionizing Radiations

    International Nuclear Information System (INIS)

    1975-01-01

    This Royal Order amends the Royal Order on general Military Regulations for Protection against the Hazards of Ionizing Radiations to bring it into line with the Royal Order of 23 December 1970, amending the general Regulations for Protection of the Population and Workers against the Hazards of Ionizing Radiations of 28 February 1963, subject to certain adaptations specific to military activities. (NEA) [fr

  20. The Case of the Royal School of Library and Information Science

    DEFF Research Database (Denmark)

    Borlund, Pia

    2010-01-01

    The present paper forms the basis of the invited talk to be given by the author at the International Symposium on the Transformation and Innovation of Library and Information Science, November 16-17, 2010, Taipei, Taiwan. The paper introduces the Royal School of Library and Information Science......, Denmark, as a European School of Library and Information Science and a member of iSchool Caucus. The paper outlines some of the current challenges of the Royal School of Library and Information Science and how these challenges are met, including how the membership of the iSchool movement is considered...... beneficial with respect to the mentioned challenges. The paper also touches upon some of the challenges, which the iSchool movement is facing – at least from the perspective of the author....

  1. Sir William Burnett (1779-1861), professional head of the Royal Naval Medical Department and entrepreneur.

    Science.gov (United States)

    Penn, Christopher

    2004-08-01

    Sir William Burnett (1779-1861) had an active career as a Royal Navy surgeon in the French Revolutionary and Napoleonic Wars, including service at the battles of St Vincent, the Nile and Trafalgar. From 1822 to 1855 he was professional head of the Royal Naval Medical Department, when he provided effective leadership in a time of great change. Although his official work earned him the reputation of a "hard-working, unimaginative, somewhat harsh man", his correspondence shows a very humane centre under the official carapace. His official performance and reputation were both eroded towards the end of his career by his determined promotion of zinc chloride, for which he held lucrative patents.

  2. AcEST: BP919751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_G01 537 Adiantum capillus-veneris mRNA. clone: YMU001_000128_G01. BP919751 - Show BP9197...is mRNA. clone: YMU001_000128_G01. Accession BP919751 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...N=TP53BP1 PE=1 SV=2 Length = 1972 Score = 33.9 bits (76), Expect = 0.51 Identitie...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919751|Adiantum capillus-veneris mRNA, clone:

  3. The zoonotic implications of pentastomiasis in the royal python ...

    African Journals Online (AJOL)

    The parasite was confirmed to be Armillifer spp (Pentastomid); this is the first recorded case of pentastomiasis in the royal python (Python regius) in Nigeria. This report may be an alert of the possibility of on-going zoonotic transmission of pentastomiasis from snake to man, especially in the sub-urban/rural areas of Nigeria ...

  4. Royal Numico N.V. : Resurrecting shareholder value

    NARCIS (Netherlands)

    Lachotzki, F.; Olson, M.A.

    2008-01-01

    This case presents the extraordinary turn-around engineered at Royal Numico (a specialized nutrition company, previously covered in another Nyenrode case under its old name Nutricia) by a team of managers formed and led by Jan Bennink. Company fortunes were at a low ebb by the beginning of 2002, as

  5. Doctrine and Fleet Tactics in the Royal Navy.

    Science.gov (United States)

    1994-11-02

    otherwise captured by the spirit of Nelson. While Corbett served as a lecturer at the Royal Naval College at Greenwich, he published his more mainstream ...Madrid, SP: Instituto de Historia y Cultura Naval, 1983 [original version written from 1520-1538]. 5. "Traditional tactics, 1530: ’A book of orders for the

  6. Evaluation of the antioxidant potential of royal jelly during storage

    Directory of Open Access Journals (Sweden)

    Renata Galhardo Borguini

    2012-09-01

    Full Text Available Royal jelly is a creamy substance produced by young nurse worker bees, which has a color that ranges from white to slightly yellow, and is secreted by the hypopharingeal and mandibular glands of the bees. The objective of this work was to assess the in vitro antioxidant potential of royal jelly while in storage. The physical-chemical parameters analyzed were moisture, ascorbic acid and total phenolic content. Alcohol extracts were made and used to evaluate the 1.1-diphenyl-2-picrylhydrazyl (DPPH radical scavenging activity. The ascorbic acid (to 0.75 from 1.31mg.100g-1wet base and total phenolic content (to 14.26 from 28.30mg GAE.100g-1 wet base of the royal jelly were low. The percentages of DPPH discoloration of the samples were above 50%, except for the samples stored for 90 days. Considering the reduced ascorbic acid and total phenolic content, and the low alcohol DPPH scavenging activity of the samples, it can be concluded that royal jelly presents relatively low antioxidant potential. The storage time did not determine the changes found.

  7. Book Review: Royal Air Force 1939-1945 | Cornwell | Scientia ...

    African Journals Online (AJOL)

    Book Title: Royal Air Force 1939-1945. Book Author: Denis Richards & Hilary St George. Volume 1: The Fight at Odds, by Denis Richards, Her Majesty's Stationery Office, London, 1974, pp xii 430. Volume 2: The Fight Avails, by Denis Richards and Hilary St George Saunders. Her Majesty's Stationery Office, London, 1975.

  8. Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  9. Air Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  10. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  11. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  12. Surface Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  13. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  14. Looking Behind the Scenes. The History of the Royal Court Theatre Through the Lens of Prominent Productions

    OpenAIRE

    Milisavljevic, Maria (M.A.)

    2018-01-01

    An investigative study of newly released archive material representing six decades of Royal Court Theatre history including analyses of the productions of John Osborne’s Look Back in Anger, Edward Bond’s Early Morning, Caryl Churchill’s Cloud Nine, Jim Allen’s Perdition, Sarah Kane’s Blasted, and debbie tucker green’s Stoning Mary. Sixty years after the first season of the English Stage Company was launched at the Royal Court Theatre there is no theatre maker and theatre scholar in the w...

  15. CtBP1 overexpression in keratinocytes perturbs skin homeostasis.

    Science.gov (United States)

    Deng, Hui; Li, Fulun; Li, Hong; Deng, Yu; Liu, Jing; Wang, Donna; Han, Gangwen; Wang, Xiao-Jing; Zhang, Qinghong

    2014-05-01

    Carboxyl-terminal-binding protein-1 (CtBP1) is a transcriptional corepressor with multiple in vitro targets, but its in vivo functions are largely unknown. We generated keratinocyte-specific CtBP1 transgenic mice with a keratin-5 promoter (K5.CtBP1) to probe the pathological roles of CtBP1. At transgene expression levels comparable to endogenous CtBP1 in acute skin wounds, the K5.CtBP1 epidermis displayed hyperproliferation, loss of E-cadherin, and failed terminal differentiation. Known CtBP1 target genes associated with these processes, e.g., p21, Brca1, and E-cadherin, were downregulated in K5.CtBP1 skin. Surprisingly, K5.CtBP1 pups also exhibited a hair loss phenotype. We found that expression of the Distal-less 3 (Dlx3), a critical regulator of hair follicle differentiation and cycling, was decreased in K5.CtBP1 mice. Molecular studies revealed that CtBP1 directly suppressed Dlx3 transcription. Consistently, K5.CtBP1 mice displayed abnormal hair follicles with decreased expression of Dlx3 downstream targets Gata3, Hoxc13, and hair keratins. In summary, this CtBP1 transgenic model provides in vivo evidence for certain CtBP1 functions predicted from in vitro studies, reveals--to our knowledge--previously unreported functions and transcriptional activities of CtBP1 in the context of epithelial-mesenchymal interplay, and suggests that CtBP1 has a pathogenic role in hair follicle morphogenesis and differentiation.

  16. Use of Royal Darwin Hospital emergency department by immigration detainees in 2011.

    Science.gov (United States)

    Deans, Adrienne K; Boerma, Clare J; Fordyce, James; De Souza, Mark; Palmer, Didier J; Davis, Joshua S

    2013-12-16

    To describe the number and nature of emergency department (ED) attendances by immigration detainees in Darwin, in the Northern Territory, over a 12-month period. Retrospective observational study of immigration detainees attending the Royal Darwin Hospital ED during the 2011 calendar year. Number of ED attendances and primary diagnoses. In 2011, there were 770 ED attendances by 518 individual detainees at Royal Darwin Hospital. Those who attended the ED had a mean (SD) age of 27.6 (12.2) years, and 112 of them (21.6%) were children. Most (413, 79.7%) were male, and Iran and Afghanistan were the two most common countries of birth. We estimate that 50.1% (95% CI, 47.0%-53.2%) of immigration detainees in Darwin (mean, 776 per month; total, 1034), attended the Royal Darwin Hospital ED at least once in 2011. The most common primary diagnosis was psychiatric problems (187 attendances, 24.3%), including self-harm (138 attendances, 17.9%). In 2011, asylum seekers in immigration detention in Darwin had a high prevalence of unmet health needs and substantial levels of psychiatric morbidity. The primary health care provided to them was inadequate.

  17. AcEST: BP911846 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_H02 62 Adiantum capillus-veneris mRNA. clone: YMU001_000009_H02. BP911846 - Show BP91184... mRNA. clone: YMU001_000009_H02. Accession BP911846 Tissue type prothallium Developmental stage - Contig ID

  18. AcEST: BP919848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H02 84 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H02. BP919848 - Show BP91984... mRNA. clone: YMU001_000129_H02. Accession BP919848 Tissue type prothallium Developmental stage - Contig ID

  19. Sperm abnormality toxicity due to cyclosporine A and the ameliorative effect of royal jelly in male rats

    Directory of Open Access Journals (Sweden)

    Azza M. Gawish

    2016-08-01

    Full Text Available The immunosuppressive drug, utilized widely in Egypt, cyclosporine A was studied to evaluate its toxicity in male rats. Animals were divided into a control (untreated, 3 groups treated intraperitoneally with 20, 40 and 60 m/kg cyclosporine A for 5, 10 and 15 days, respectively and 3 groups treated intraperitoneally with 20, 40 and 60 mg/kg of cyclosporine A plus 100 mg/kg royal jelly administrated orally. Toxicity evaluation was carried out using two main endpoints: reproductive study (sperm morphology and count abnormalities and biochemical changes in liver and testis (DNA amounts. The aim of this work is to study the protective role of royal jelly against sperm abnormalities in shape and count, and changes in DNA contents in liver and testis tissue induced in rats when treated by cyclosporine A with different doses (20–40–60 mg/kg/day for 5, 10, and 15 days in male rats and how the royal jelly can repair this changes. Our results showed that sperm abnormalities induced by cyclosporine A included deviation from normal shape in head and tail. Abnormal heads contained amorphous head and banana-shaped head, whereas the abnormal tails included divided and coiled tails. It also induced an insignificant effect on the total sperm counts after 5 days of injection with the drug combined with royal jelly. DNA contents were determined in rat liver and testis cells to illustrate the mutagenic effect of cyclosporine A and how the royal jelly can modulate this effect. From these results we concluded that cyclosporine A toxicity was dose and time dependent and should be administrated under special precautions and medical supervision. Using of royal jelly in combination with cyclosporine A drug decreased its toxic effect, so it's considered as protector.

  20. AcEST: BP920006 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H08 454 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H08. BP92000...6 CL749Contig1 Show BP920006 Clone id YMU001_000131_H08 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_H08. Accession BP920006 Tissue type prothallium Developmental stage...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920006|Adiantum capillus-...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920006|Adiantum capillus-ve

  1. AcEST: BP920008 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H10 566 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H10. BP920008 - Show BP92000...is mRNA. clone: YMU001_000131_H10. Accession BP920008 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920008|Adiantum capillus-veneris mRNA,...Acids Res. 25:3389-3402. Query= BP920008|Adiantum capillus-veneris mRNA, clone: YMU001_000131_H10. (566 lett

  2. AcEST: BP920004 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H06 151 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H06. BP920004 - Show BP92000...is mRNA. clone: YMU001_000131_H06. Accession BP920004 Tissue type prothallium Developmental stage - Contig I...ds Res. 25:3389-3402. Query= BP920004|Adiantum capillus-veneris mRNA, clone: YMU0...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920004|

  3. AcEST: BP920000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G10 490 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G10. BP920000 - Show BP92000...is mRNA. clone: YMU001_000131_G10. Accession BP920000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92000...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920000|Adiantum capil

  4. AcEST: BP920002 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G12 513 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G12. BP92000...2 CL642Contig1 Show BP920002 Clone id YMU001_000131_G12 Library YMU01 Length 513 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_G12. Accession BP920002 Tissue type prothallium Developmental stage...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92000...new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920002|Adiantu

  5. AcEST: BP918489 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_B02 201 Adiantum capillus-veneris mRNA. clone: YMU001_000114_B02. BP918489 - Show BP9184...is mRNA. clone: YMU001_000114_B02. Accession BP918489 Tissue type prothallium Developmental stage - Contig I...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918489|Adiantum capillus-veneris m

  6. AcEST: BP918402 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B01. BP9184...02 CL402Contig1 Show BP918402 Clone id YMU001_000113_B01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000113_B01. Accession BP918402 Tissue type prothallium Developmental stage...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918402|A

  7. AcEST: BP918412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B12 606 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B12. BP918412 - Show BP9184...is mRNA. clone: YMU001_000113_B12. Accession BP918412 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918412|Adiantum capillus-veneris mRNA, clone: YMU0

  8. AcEST: BP913184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000027_D12 485 Adiantum capillus-veneris mRNA. clone: YMU001_000027_D12. BP913184... CL748Contig1 Show BP913184 Clone id YMU001_000027_D12 Library YMU01 Length 485 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000027_D12. Accession BP913184 Tissue type prothallium Developmental stage...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913184|Ad...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP913184|Adiantum capillus-ve

  9. AcEST: BP918421 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C09 541 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C09. BP9184...21 CL2140Contig1 Show BP918421 Clone id YMU001_000113_C09 Library YMU01 Length 541 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C09. Accession BP918421 Tissue type prothallium Developmental stag...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918421|Adiantum capillus-ve

  10. AcEST: BP915184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000067_E05 573 Adiantum capillus-veneris mRNA. clone: YMU001_000067_E05. BP915184 - Show BP915184...is mRNA. clone: YMU001_000067_E05. Accession BP915184 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915184|Adiantum capillus-veneris mRN...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP915184|Adiantum capillus-veneris mRNA, clone: YMU0

  11. AcEST: BP918451 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F06 261 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F06. BP918451 - Show BP9184...is mRNA. clone: YMU001_000113_F06. Accession BP918451 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918451|Adiantum capillus-veneris mRNA, clone: YMU001_...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918451|Adiantum capillus-veneris mRNA, clo

  12. AcEST: BP918444 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E11 570 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E11. BP918444 - Show BP9184...is mRNA. clone: YMU001_000113_E11. Accession BP918444 Tissue type prothallium Developmental stage - Contig I...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918444|Adiantum capillus...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918444|Adiantum capillus-veneris mRNA, clone

  13. AcEST: BP918475 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_H07 490 Adiantum capillus-veneris mRNA. clone: YMU001_000113_H07. BP918475 - Show BP9184...is mRNA. clone: YMU001_000113_H07. Accession BP918475 Tissue type prothallium Developmental stage - Contig I...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918475|Adiantum capillus-vene...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  14. AcEST: BP918435 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E01 558 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E01. BP918435 - Show BP9184...is mRNA. clone: YMU001_000113_E01. Accession BP918435 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP918435|Adiantum capillus-veneris mRNA, clone: YMU001_0... BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  15. AcEST: BP911848 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_H04 372 Adiantum capillus-veneris mRNA. clone: YMU001_000009_H04. BP911848 - Show BP91184...is mRNA. clone: YMU001_000009_H04. Accession BP911848 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911848|Adiantum capillus-veneris...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911848|Adiantum capillus-ve

  16. AcEST: BP918425 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D02 396 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D02. BP9184...25 CL2176Contig1 Show BP918425 Clone id YMU001_000113_D02 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D02. Accession BP918425 Tissue type prothallium Developmental stag...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918425|Ad...ic Acids Res. 25:3389-3402. Query= BP918425|Adiantum capillus-veneris mRNA, clone

  17. AcEST: BP918468 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_G12 202 Adiantum capillus-veneris mRNA. clone: YMU001_000113_G12. BP918468 - Show BP9184...is mRNA. clone: YMU001_000113_G12. Accession BP918468 Tissue type prothallium Developmental stage - Contig I...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918468|Ad...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918468|Adiantum capillus

  18. AcEST: BP918411 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B11 488 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B11. BP9184...11 CL3724Contig1 Show BP918411 Clone id YMU001_000113_B11 Library YMU01 Length 488 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_B11. Accession BP918411 Tissue type prothallium Developmental stag...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918411|Adiantum capillus-...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  19. AcEST: BP918431 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D08 339 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D08. BP9184...31 CL1749Contig1 Show BP918431 Clone id YMU001_000113_D08 Library YMU01 Length 339 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D08. Accession BP918431 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918431|Adiantum capillus-v...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  20. AcEST: BP918449 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F04 232 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F04. BP918449 - Show BP9184...is mRNA. clone: YMU001_000113_F04. Accession BP918449 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918449|Adiantum cap...s. 25:3389-3402. Query= BP918449|Adiantum capillus-veneris mRNA, clone: YMU001_000113_F04. (232 letters) Dat

  1. AcEST: BP918459 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_G02 467 Adiantum capillus-veneris mRNA. clone: YMU001_000113_G02. BP918459 - Show BP9184...is mRNA. clone: YMU001_000113_G02. Accession BP918459 Tissue type prothallium Developmental stage - Contig I...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918459|Adiantum c..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  2. AcEST: BP911842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G09 574 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G09. BP91184...2 CL578Contig1 Show BP911842 Clone id YMU001_000009_G09 Library YMU01 Length 574 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000009_G09. Accession BP911842 Tissue type prothallium Developmental stage...AST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911842|...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91184

  3. AcEST: BP918184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_E05 469 Adiantum capillus-veneris mRNA. clone: YMU001_000110_E05. BP918184... CL72Contig1 Show BP918184 Clone id YMU001_000110_E05 Library YMU01 Length 469 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000110_E05. Accession BP918184 Tissue type prothallium Developmental stage ...ic Acids Res. 25:3389-3402. Query= BP918184|Adiantum capillus-veneris mRNA, clone... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918184|Adiantum capillus-veneris mRNA, clone: YM

  4. AcEST: BP911843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G10 434 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G10. BP911843 - Show BP91184...is mRNA. clone: YMU001_000009_G10. Accession BP911843 Tissue type prothallium Developmental stage - Contig I...SI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91184...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911843|Adiantum capillus-veneris mRNA, clone: YMU0

  5. AcEST: BP911847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_H03 495 Adiantum capillus-veneris mRNA. clone: YMU001_000009_H03. BP911847 - Show BP91184...is mRNA. clone: YMU001_000009_H03. Accession BP911847 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911847|...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911847|Adiantum capillus-veneris...ogen synthase kinase-3 beta OS=Homo sa... 80 7e-15 sp|P51136|GSK3_DICDI Glycogen synthase kinase-3 OS=Dictyo

  6. AcEST: BP917184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000097_D02 514 Adiantum capillus-veneris mRNA. clone: YMU001_000097_D02. BP917184 - Show BP917184...is mRNA. clone: YMU001_000097_D02. Accession BP917184 Tissue type prothallium Developmental stage - Contig I...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917184...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917184|Adiantum capillus-veneris mRNA, clone: Y

  7. AcEST: BP918416 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C04 557 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C04. BP918416 - Show BP9184...is mRNA. clone: YMU001_000113_C04. Accession BP918416 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918416|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C0...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  8. AcEST: BP918458 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_G01 479 Adiantum capillus-veneris mRNA. clone: YMU001_000113_G01. BP9184...58 CL2714Contig1 Show BP918458 Clone id YMU001_000113_G01 Library YMU01 Length 479 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_G01. Accession BP918458 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918458|Adian...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918458|Adiantum capillus-v

  9. AcEST: BP919184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000122_B11 566 Adiantum capillus-veneris mRNA. clone: YMU001_000122_B11. BP919184 - Show BP919184...is mRNA. clone: YMU001_000122_B11. Accession BP919184 Tissue type prothallium Developmental stage - Contig I...eic Acids Res. 25:3389-3402. Query= BP919184|Adiantum capillus-veneris mRNA, clone: YMU001_000122_B11. (566 ...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919184|Adiantum capillu

  10. AcEST: BP918441 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E08 487 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E08. BP9184...41 CL3521Contig1 Show BP918441 Clone id YMU001_000113_E08 Library YMU01 Length 487 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_E08. Accession BP918441 Tissue type prothallium Developmental stag...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918441|Adiant...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918441|Adiantum capillus-vener

  11. AcEST: BP919406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c

  12. AcEST: BP914061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c

  13. AcEST: BP914068 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:

  14. AcEST: BP913406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM

  15. AcEST: BP915406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433

  16. AcEST: BP914064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi

  17. AcEST: BP912406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406

  18. AcEST: BP916406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c

  19. AcEST: BP917406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,

  20. AcEST: BP914406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406

  1. AcEST: BP911984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_F07 566 Adiantum capillus-veneris mRNA. clone: YMU001_000011_F07. BP911984... CL2332Contig1 Show BP911984 Clone id YMU001_000011_F07 Library YMU01 Length 566 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_F07. Accession BP911984 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984|Adiantum capillus-veneris mR...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911984

  2. AcEST: BP919843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G09 473 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G09. BP91984...3 CL2697Contig1 Show BP919843 Clone id YMU001_000129_G09 Library YMU01 Length 473 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G09. Accession BP919843 Tissue type prothallium Developmental stag...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Ad...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919843|Adiantum capillus-veneris

  3. AcEST: BP919847 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H01 512 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H01. BP919847 - Show BP91984...is mRNA. clone: YMU001_000129_H01. Accession BP919847 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91984...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919847|Adiantum capillus-veneris mRNA, clone: YMU0

  4. AcEST: BP919842 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G07 567 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G07. BP919842 - Show BP91984...is mRNA. clone: YMU001_000129_G07. Accession BP919842 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris m...c Acids Res. 25:3389-3402. Query= BP919842|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G07. (567 le

  5. AcEST: BP919840 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G05 476 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G05. BP919840 - Show BP91984...is mRNA. clone: YMU001_000129_G05. Accession BP919840 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_...es. 25:3389-3402. Query= BP919840|Adiantum capillus-veneris mRNA, clone: YMU001_0

  6. AcEST: BP919849 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_H04 454 Adiantum capillus-veneris mRNA. clone: YMU001_000129_H04. BP919849 - Show BP91984...is mRNA. clone: YMU001_000129_H04. Accession BP919849 Tissue type prothallium Developmental stage - Contig I...s. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_00...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919849|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  7. AcEST: BP919845 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G11 376 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G11. BP919845 - Show BP91984...is mRNA. clone: YMU001_000129_G11. Accession BP919845 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G1...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919845|Adiantum capillus

  8. AcEST: BP920183 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A07 427 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A07. BP920183 - Show BP92018...is mRNA. clone: YMU001_000134_A07. Accession BP920183 Tissue type prothallium Developmental stage - Contig I...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183...programs, Nucleic Acids Res. 25:3389-3402. Query= BP920183|Adiantum capillus-veneris mRNA, clone: YMU001_000

  9. AcEST: BP920180 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A04 428 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A04. BP920180 - Show BP92018...is mRNA. clone: YMU001_000134_A04. Accession BP920180 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920180|Adia... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018

  10. AcEST: BP920184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A08 470 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A08. BP920184 - Show BP92018...is mRNA. clone: YMU001_000134_A08. Accession BP920184 Tissue type prothallium Developmental stage - Contig I...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920184|Adiantum capillus-veneri...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920184|Adiantum capill

  11. AcEST: BP912018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_B01 519 Adiantum capillus-veneris mRNA. clone: YMU001_000012_B01. BP912018 - Show BP912018...is mRNA. clone: YMU001_000012_B01. Accession BP912018 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912018.... 25:3389-3402. Query= BP912018|Adiantum capillus-veneris mRNA, clone: YMU001_000012_B01. (519 letters) Data

  12. AcEST: BP920187 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A12 506 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A12. BP920187 - Show BP92018...is mRNA. clone: YMU001_000134_A12. Accession BP920187 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP920187|Adiantum capillus-vene...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920187|Adiantum capillus-veneris mRNA, clone: YMU001_00013

  13. AcEST: BP913467 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000030_E10 288 Adiantum capillus-veneris mRNA. clone: YMU001_000030_E10. BP913467 - Show BP913467...is mRNA. clone: YMU001_000030_E10. Accession BP913467 Tissue type prothallium Developmental stage - Contig I... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913467|Adiantum capillus-veneris mRNA, ...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913467|Adiantum capillus-vene

  14. AcEST: BP919791 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C01 537 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C01. BP9197...91 CL2749Contig1 Show BP919791 Clone id YMU001_000129_C01 Library YMU01 Length 537 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_C01. Accession BP919791 Tissue type prothallium Developmental stag...Nucleic Acids Res. 25:3389-3402. Query= BP919791|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C01. (...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919791|Adiantum capillus-veneris m

  15. AcEST: BP919765 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_H07 531 Adiantum capillus-veneris mRNA. clone: YMU001_000128_H07. BP919765 - Show BP9197...is mRNA. clone: YMU001_000128_H07. Accession BP919765 Tissue type prothallium Developmental stage - Contig I... Res. 25:3389-3402. Query= BP919765|Adiantum capillus-veneris mRNA, clone: YMU001_000128_H07. (516 letters) ...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919765|Adiantum capillus-veneris mRNA, clone

  16. AcEST: BP919795 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C05 446 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C05. BP919795 - Show BP9197...is mRNA. clone: YMU001_000129_C05. Accession BP919795 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP919795|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C05. (446 lett...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  17. AcEST: BP919705 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C01 300 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C01. BP919705 - Show BP9197...is mRNA. clone: YMU001_000128_C01. Accession BP919705 Tissue type prothallium Developmental stage - Contig I...ation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919705|Adiantum capillu..., Positives = 31/61 (50%) Frame = +3 Query: 18 YSLVVVVGAQKLSYFLNFAQSLIPHQSVAFFLGS*YWKIPQGVHLQSLCLKLLQPPLMII 197...es. 25:3389-3402. Query= BP919705|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C01. (300 letters) Da

  18. AcEST: BP919748 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_F10 483 Adiantum capillus-veneris mRNA. clone: YMU001_000128_F10. BP919748 - Show BP9197...is mRNA. clone: YMU001_000128_F10. Accession BP919748 Tissue type prothallium Developmental stage - Contig I...c Acids Res. 25:3389-3402. Query= BP919748|Adiantum capillus-veneris mRNA, clone:...ams, Nucleic Acids Res. 25:3389-3402. Query= BP919748|Adiantum capillus-veneris mRNA, clone: YMU001_000128_F

  19. AcEST: BP919757 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_G07 557 Adiantum capillus-veneris mRNA. clone: YMU001_000128_G07. BP919757 - Show BP9197...is mRNA. clone: YMU001_000128_G07. Accession BP919757 Tissue type prothallium Developmental stage - Contig I...rams, Nucleic Acids Res. 25:3389-3402. Query= BP919757|Adiantum capillus-veneris mRNA, clone: YMU001_000128_...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919757|Adia

  20. AcEST: BP918197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000110_F07 474 Adiantum capillus-veneris mRNA. clone: YMU001_000110_F07. BP918197... CL3144Contig1 Show BP918197 Clone id YMU001_000110_F07 Library YMU01 Length 474 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000110_F07. Accession BP918197 Tissue type prothallium Developmental stag...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918197...25:3389-3402. Query= BP918197|Adiantum capillus-veneris mRNA, clone: YMU001_000110_F07. (474 letters) Databa

  1. AcEST: BP916197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_D10 446 Adiantum capillus-veneris mRNA. clone: YMU001_000084_D10. BP916197... CL1434Contig1 Show BP916197 Clone id YMU001_000084_D10 Library YMU01 Length 446 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000084_D10. Accession BP916197 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916197|Adiantum capillus-veneris mRNA, clone: YMU0...grams, Nucleic Acids Res. 25:3389-3402. Query= BP916197|Adiantum capillus-veneris mRNA, clone: YMU001_000084

  2. AcEST: BP919704 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_B12 260 Adiantum capillus-veneris mRNA. clone: YMU001_000128_B12. BP9197...04 CL1786Contig1 Show BP919704 Clone id YMU001_000128_B12 Library YMU01 Length 260 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_B12. Accession BP919704 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP919704|Adiantum capillus-veneris mRNA, clone: YMU001_0001...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919704|Adia

  3. AcEST: BP912197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_C05 570 Adiantum capillus-veneris mRNA. clone: YMU001_000016_C05. BP912197 - Show BP912197...is mRNA. clone: YMU001_000016_C05. Accession BP912197 Tissue type prothallium Developmental stage - Contig I...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912197|Adiantum capillus-veneris mRNA, clo...grams, Nucleic Acids Res. 25:3389-3402. Query= BP912197|Adiantum capillus-veneris mRNA, clone: YMU001_000016...+T+SL G IAA ++S KG T Sbjct: 197 SDTWVAEYRKWMDKVGHGMPYHFGHRTISLPKVPPVVEHAPAGLIAALS

  4. AcEST: BP919724 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_D08 331 Adiantum capillus-veneris mRNA. clone: YMU001_000128_D08. BP919724 - Show BP9197...is mRNA. clone: YMU001_000128_D08. Accession BP919724 Tissue type prothallium Developmental stage - Contig I...s Res. 25:3389-3402. Query= BP919724|Adiantum capillus-veneris mRNA, clone: YMU001_000128_D08. (331 letters)...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919724|Adiantum capi

  5. AcEST: BP919725 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_D09 385 Adiantum capillus-veneris mRNA. clone: YMU001_000128_D09. BP919725 - Show BP9197...is mRNA. clone: YMU001_000128_D09. Accession BP919725 Tissue type prothallium Developmental stage - Contig I...e search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919725|Adiantum capillus-veneris mRNA, clone: Y...P A GR+ YA S++ Sbjct: 2 SGASNDGYGQYPPQQP--GDHQQQPPYPDQAYDNAAPVAPGHAADHGRKKKRQYAASAFD 59 Query: 197 ATQGGHVKQ...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919725|Adiantum capillus-veneris mRNA, clone: YMU

  6. AcEST: BP919707 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C03 461 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C03. BP919707 - Show BP9197...is mRNA. clone: YMU001_000128_C03. Accession BP919707 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP919707|Adiantum capillus-veneris mRNA, clone: YMU001_000128...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  7. AcEST: BP919700 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_B06 521 Adiantum capillus-veneris mRNA. clone: YMU001_000128_B06. BP919700 - Show BP9197...is mRNA. clone: YMU001_000128_B06. Accession BP919700 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919700|Adiantum capillus-veneris mRNA, clone: YMU001_0...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  8. AcEST: BP919708 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C04 482 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C04. BP9197...08 CL642Contig1 Show BP919708 Clone id YMU001_000128_C04 Library YMU01 Length 482 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000128_C04. Accession BP919708 Tissue type prothallium Developmental stage...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP919708|Adiantum capillus-veneri...ds Res. 25:3389-3402. Query= BP919708|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C04. (482 letters

  9. AcEST: BP919749 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_F11 461 Adiantum capillus-veneris mRNA. clone: YMU001_000128_F11. BP9197...49 CL155Contig1 Show BP919749 Clone id YMU001_000128_F11 Library YMU01 Length 461 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000128_F11. Accession BP919749 Tissue type prothallium Developmental stage... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919749|Adiantum capillus-ven... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919749|Adiantum capillus-veneris mRNA, clone: YMU001_00

  10. AcEST: BP919730 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_E03 520 Adiantum capillus-veneris mRNA. clone: YMU001_000128_E03. BP919730 - Show BP9197...is mRNA. clone: YMU001_000128_E03. Accession BP919730 Tissue type prothallium Developmental stage - Contig I... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  11. AcEST: BP919729 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_E02 423 Adiantum capillus-veneris mRNA. clone: YMU001_000128_E02. BP9197...29 CL3847Contig1 Show BP919729 Clone id YMU001_000128_E02 Library YMU01 Length 423 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_E02. Accession BP919729 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP919729|Adiantum capillus-veneris mRNA, clone: YMU001_000...Res. 25:3389-3402. Query= BP919729|Adiantum capillus-veneris mRNA, clone: YMU001_

  12. AcEST: BP919794 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C04 349 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C04. BP9197...94 CL2626Contig1 Show BP919794 Clone id YMU001_000129_C04 Library YMU01 Length 349 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_C04. Accession BP919794 Tissue type prothallium Developmental stag... programs, Nucleic Acids Res. 25:3389-3402. Query= BP919794|Adiantum capillus-veneris mRNA, clone: YMU001_00...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  13. AcEST: BP919775 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A08 507 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A08. BP919775 - Show BP9197...is mRNA. clone: YMU001_000129_A08. Accession BP919775 Tissue type prothallium Developmental stage - Contig I...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919775|Adiantum capillus-ve... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919775|Adiantum capillus-veneris mRNA,

  14. AcEST: BP914197 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000056_B07 509 Adiantum capillus-veneris mRNA. clone: YMU001_000056_B07. BP914197... CL4229Contig1 Show BP914197 Clone id YMU001_000056_B07 Library YMU01 Length 509 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000056_B07. Accession BP914197 Tissue type prothallium Developmental stag...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914197...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914197|Adiantum ca

  15. AcEST: BP919721 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_D05 520 Adiantum capillus-veneris mRNA. clone: YMU001_000128_D05. BP919721 - Show BP9197...is mRNA. clone: YMU001_000128_D05. Accession BP919721 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP919721|Adiantum capillus-veneris mRNA, clone: YMU001_0

  16. AcEST: BP919770 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A01 565 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A01. BP919770 - Show BP9197...is mRNA. clone: YMU001_000129_A01. Accession BP919770 Tissue type prothallium Developmental stage - Contig I...ucleic Acids Res. 25:3389-3402. Query= BP919770|Adiantum capillus-veneris mRNA, clone: YMU001_000129_A01. (5...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919770|Adiantum capillus-veneris mRNA

  17. AcEST: BP919774 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A06 275 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A06. BP9197...74 CL74Contig1 Show BP919774 Clone id YMU001_000129_A06 Library YMU01 Length 275 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000129_A06. Accession BP919774 Tissue type prothallium Developmental stage ...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919774|Adiantum capillus-veneris mR...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919774|Adiantum capillus-veneris

  18. Effect of turmeric and curcumin on BP-DNA adducts.

    Science.gov (United States)

    Mukundan, M A; Chacko, M C; Annapurna, V V; Krishnaswamy, K

    1993-03-01

    Many human cancers that are widely prevalent today can be prevented through modifications in life-styles, of which diet appears to be an important agent. Several dietary constituents modulate the process of carcinogenesis and prevent genotoxicity. Many plant constituents including turmeric appear to be potent antimutagens and antioxidants. Therefore the modulatory effects of turmeric and curcumin on the levels of benzo[a]pyrene induced DNA adducts in the livers of rats were studied by the newly developed 32P-postlabelling assay method. Turmeric when fed at 0.1, 0.5 and 3% and the active principle of turmeric (curcumin) when fed at a level of 0.03% in the diet for 4 weeks significantly reduced the level of BP-DNA adducts including the major adduct dG-N2-BP, formed within 24 h in response to a single i.p. injection of benzo[a]pyrene. The significance of these effects in terms of the potential anticarcinogenic effects of turmeric is discussed. Further, these results strengthen the various other biological effects of turmeric which have direct relevance to anticarcinogenesis and chemoprevention.

  19. Prediction of BP Reactivity to Talking Using Hybrid Soft Computing Approaches

    Directory of Open Access Journals (Sweden)

    Gurmanik Kaur

    2014-01-01

    Full Text Available High blood pressure (BP is associated with an increased risk of cardiovascular diseases. Therefore, optimal precision in measurement of BP is appropriate in clinical and research studies. In this work, anthropometric characteristics including age, height, weight, body mass index (BMI, and arm circumference (AC were used as independent predictor variables for the prediction of BP reactivity to talking. Principal component analysis (PCA was fused with artificial neural network (ANN, adaptive neurofuzzy inference system (ANFIS, and least square-support vector machine (LS-SVM model to remove the multicollinearity effect among anthropometric predictor variables. The statistical tests in terms of coefficient of determination (R2, root mean square error (RMSE, and mean absolute percentage error (MAPE revealed that PCA based LS-SVM (PCA-LS-SVM model produced a more efficient prediction of BP reactivity as compared to other models. This assessment presents the importance and advantages posed by PCA fused prediction models for prediction of biological variables.

  20. The Ursula Faince Dinnerware Series by Royal Copenhagen

    DEFF Research Database (Denmark)

    Moeran, Brian

    This working paper is a case study about the development of a faience product line in Royal Copenhagen and illustrates several aspects of how, at what stages of development, and by whom, cultural products in general are evaluated. Three theoretical issues emerge. One concerns the constraints...... imposed upon design and production by the use of materials and, to a lesser extent, technology. Another argues that product development has to take place within a particular brand and genre – in this case, those of Royal Copenhagen. A third reveals the way in which the design and manufacture...... of a particular cultural product had to be negotiated within a particular organizational world embracing both management and workers, with differentiated skills. These issues lead to a more general discussion of craftsmanship and storytelling....

  1. The Royal College of Psychiatrists and the death penalty.

    Science.gov (United States)

    Gunn, John

    2004-01-01

    The Royal College of Psychiatrists recently issued a revised statement on its position concerning capital punishment. The College proposes to support psychiatrists who refuse to be involved in the capital process, but accepts that some may take up limited involvement in the manner set out in the document. The Royal College is the professional body for psychiatric practitioners in the United Kingdom and Ireland. Almost no public statements are issued from the College without first being deliberated on within at least two of its three major committees. The new document on capital punishment remains in the spirit of the previous ones. The topic of capital punishment is noncontroversial within the British medical profession. In all European countries, capital punishment is against the law, because there is an overarching directive from the Council of Europe (a wide group of nations, wider than the European Union) insisting that it be abolished.

  2. Genetic royal cheats in leaf-cutting ant societies

    DEFF Research Database (Denmark)

    Hughes, William O H; Boomsma, Jacobus J

    2008-01-01

    Social groups are vulnerable to cheating because the reproductive interests of group members are rarely identical. All cooperative systems are therefore predicted to involve a mix of cooperative and cheating genotypes, with the frequency of the latter being constrained by the suppressive abilities...... queens whereas their nestmates will generally maximize fitness by forcing larvae to become workers. However, evolutionary constraints are thought to prevent cheating by removing genetic variation in caste propensity. Here, we show that one-fifth of leaf-cutting ant patrilines cheat their nestmates...... predicts, these "royal" genotypes are rare both in the population and within individual colonies. The rarity of royal cheats is best explained as an evolutionary strategy to avoid suppression by cooperative genotypes, the efficiency of which is frequency-dependent. The results demonstrate that cheating can...

  3. The Royal Summer Palace, Ferdinand I and Anne

    Directory of Open Access Journals (Sweden)

    Sylva Dobalová

    2015-12-01

    Full Text Available This essay examines the iconography of the best-known relief from the renaissance Royal Summer Palace at the Prague Castle, depicting Ferdinand I of Habsburg and his wife Anne Jagiello. It highlights its marriage symbolism and the question of the dowry. In the relief Anne, heiress to the Czech Lands, gives her husband an olive branch symbolising peace. In the context of the political significance of the palace’s decoration the relief expresses Ferdinand’s view of his claim to the Bohemian throne, based on his marriage to the heiress. Due to opposition from the Bohemian Estates, this finally became his lawful right in 1545, 24 years after the royal wedding. The Italian sculptor Paolo della Stella expressed a search for a peaceful solution to Ferdinand’s succession. The relief was carved between 1540 and 1550. The interpretations do not rule out the possibility that it was made after Anne had died (1547.

  4. How Honeybees Defy Gravity with Royal Jelly to Raise Queens.

    Science.gov (United States)

    Buttstedt, Anja; Mureşan, Carmen I; Lilie, Hauke; Hause, Gerd; Ihling, Christian H; Schulze, Stefan-H; Pietzsch, Markus; Moritz, Robin F A

    2018-03-02

    The female sex in honeybees (Apis spp.) comprises a reproductive queen and a sterile worker caste. Nurse bees feed all larvae progressively with a caste-specific food jelly until the prepupal stage. Only those larvae that are exclusively fed a large amount of royal jelly (RJ) develop into queens [1]. RJ is a composite secretion of two specialized head glands: the mandibular glands, which produce mainly fatty acids [2], and the hypopharyngeal glands, which contribute proteins, primarily belonging to the major royal jelly protein (MRJP) family [3]. Past research on RJ has focused on its nutritional function and overlooked its central role with regard to the orientation of the larva in the royal brood cell. Whereas workers are reared in the regular horizontal cells of the comb, the queen cells are specifically built outside of the normal comb area to accommodate for the larger queen [4, 5]. These cells hang freely along the bottom of the comb and are vertically oriented, opening downward [6]. Queen larvae are attached by their RJ diet to the cell ceiling. Thus, the physical properties of RJ are central to successful retention of larvae in the cell. Here, we show that the main protein of RJ (MRJP1) polymerizes in complex with another protein, apisimin, into long fibrous structures that build the basis for the high viscosity of RJ to hold queen larvae on the RJ surface. Copyright © 2018 The Author(s). Published by Elsevier Ltd.. All rights reserved.

  5. Apparent 85Kr ages of groundwater within the Royal watershed, Maine, USA.

    Science.gov (United States)

    Sidle, W C

    2006-01-01

    Specific 85Kr activity is mapped from 264 domestic and municipal wells sampled during 2002-2004 in the Royal watershed (361 km2), Maine. Gas samples are collected at 20 m, 40 m, and > 50 m interval depths within the unconfined aquifers. Gas extraction for 85Kr from wells is obtained directly via a wellhead methodology avoiding conventional collection of large sample volumes. Atmospheric 85Kr input to the recharge environment is estimated at 1.27 Bq m(-3) by time-series analyses of weighted monthly precipitation (2001-2004). Numerical simulation of Kr gas transport through the variable unsaturated zones to the water table suggests up to 12-year time lags locally, thus biasing the 85Kr groundwater ages. Apparent 85Kr ages suggest that approximately 70% of groundwater near 20 m depth was recharged less than 30 years BP (2004). Mass-age transport modeling suggests that post mid-1950s recharge penetrates to part of the basin's floor and that older groundwater seeps from the underlying fractured bedrock may occur.

  6. Royal Decree-Law 1302/1986 of 28 June 1986 on environmental impact studies

    International Nuclear Information System (INIS)

    1986-01-01

    This Royal Decree-Law (No 1302/1986) of 28th June 1986 was published in the Official Gazette of 30th June 1986. The purpose of this Decree-Law is to provide for assessments of the environmental impact of certain projected installations and activities. The installations and activities requiring environmental impact studies are listed in the Annex to the Decree-Law and include nuclear power plants and other nuclear reactors (excluding those whose thermal power does not exceed 1 kW) as well as installations for the disposal and final storage of radioactive waste (NEA) [fr

  7. Longevity extension of worker honey bees (Apis mellifera) by royal jelly: optimal dose and active ingredient

    OpenAIRE

    Yang, Wenchao; Tian, Yuanyuan; Han, Mingfeng; Miao, Xiaoqing

    2017-01-01

    In the Western honey bee, Apis mellifera, queens and workers have different longevity although they share the same genome. Queens consume royal jelly (RJ) as the main food throughout their life, including as adults, but workers only eat worker jelly when they are larvae less than 3 days old. In order to explore the effect of RJ and the components affecting longevity of worker honey bees, we first determined the optimal dose for prolonging longevity of workers as 4% RJ in 50% sucrose solution,...

  8. Face recognition based on improved BP neural network

    Directory of Open Access Journals (Sweden)

    Yue Gaili

    2017-01-01

    Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.

  9. AcEST: BP918439 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E06 535 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E06. BP9184...39 CL1216Contig1 Show BP918439 Clone id YMU001_000113_E06 Library YMU01 Length 535 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_E06. Accession BP918439 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918439|Adiantum capillus-veneris mRNA,...A Trafficking protein particle complex subunit 5 OS=Plasmodium falciparum PE=3 SV=1 Length = 184 Score = 81.

  10. AcEST: BP918438 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E05 620 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E05. BP918438 - Show BP9184...is mRNA. clone: YMU001_000113_E05. Accession BP918438 Tissue type prothallium Developmental stage - Contig I... Res. 25:3389-3402. Query= BP918438|Adiantum capillus-veneris mRNA, clone: YMU001_000113_E05. (620 letters) ...jct: 125 MMNSGISPDKYTFPFGLSACAKSRAKGNGIQIHGLIVKMGYAKDLFVQNSLVHFYAECGE 184 Query: ...LVKGLEPDEFSVTTALTACAQVGALAQGK 238 Query: 184 QHFENMINHGIVPTVEHV-NCLSELLSRSGCLKEAEKILQSMPASGDVAGWVSLLTACKA 8

  11. AcEST: BP918404 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B04 576 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B04. BP9184...04 CL3745Contig1 Show BP918404 Clone id YMU001_000113_B04 Library YMU01 Length 576 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_B04. Accession BP918404 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918404|Adiantum capillus-v...(39%), Gaps = 4/151 (2%) Frame = +2 Query: 5 QQDRSTIQQPHKASHSQRLKQKN*TLKNFLKVCETDLMTLPIAAGTYIRKSSLCFQPSYN 184

  12. AcEST: BP921843 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000154_G09 483 Adiantum capillus-veneris mRNA. clone: YMU001_000154_G09. BP921843 - Show BP92184...is mRNA. clone: YMU001_000154_G09. Accession BP921843 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP921843|Adiantum capillus-veneris mRNA, clone: YMU001_000...RLDEAEQLALKGGKK---QIQKLETRIRELEFELEGEQKRNTESVKGLRK 1843 Query: 190 REAELSDLKASQDELVDSIVSCRQCMDKLRMEAVSYKR 30...3 E + +L +E +++ + +DKL+++ SYKR Sbjct: 1844 YERRVKELTYQSEEDRKNVLRLQDLVDKLQVKVKSYKR 1881 >sp|P13541|MYH3_MOUSE

  13. AcEST: BP918456 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F11 456 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F11. BP9184...56 CL2911Contig1 Show BP918456 Clone id YMU001_000113_F11 Library YMU01 Length 456 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_F11. Accession BP918456 Tissue type prothallium Developmental stag...base search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918456|Adiantum c...2 +EI+ ++DSDPRAAYFRQA+ G+YIRMA Sbjct: 2184 NEISREIDSDPRAAYFRQAEYGMYIRMA 2211 TrEMBL (release 39.9) Link to B

  14. AcEST: BP918499 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_C01 514 Adiantum capillus-veneris mRNA. clone: YMU001_000114_C01. BP9184...99 CL2926Contig1 Show BP918499 Clone id YMU001_000114_C01 Library YMU01 Length 514 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000114_C01. Accession BP918499 Tissue type prothallium Developmental stag...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2...es. 25:3389-3402. Query= BP918499|Adiantum capillus-veneris mRNA, clone: YMU001_0

  15. AcEST: BP918436 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_E02 514 Adiantum capillus-veneris mRNA. clone: YMU001_000113_E02. BP918436 - Show BP9184...is mRNA. clone: YMU001_000113_E02. Accession BP918436 Tissue type prothallium Developmental stage - Contig I...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184... + Sbjct: 1782 EVLPIKIKLDYKPKRVDYNLLRQGKTIELMNFFHFEGSEMVLRHVTLRGINGWARLFDTL 1841 ... EQY +D R+L+G+++GA Sbjct: 1842 NDIWTPDVKANQLADFLSGLGPIRSLVNVGAGLADLVLLPIEQYHKD-GRVLRGVQRGAA 1900 Query: 147

  16. AcEST: BP912612 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

  17. AcEST: BP912712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

  18. AcEST: BP912126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

  19. AcEST: BP912212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

  20. AcEST: BP912312 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

  1. AcEST: BP912128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

  2. AcEST: BP912012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t

  3. AcEST: BP912123 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

  4. AcEST: BP912912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

  5. AcEST: BP919734 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_E07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000128_E07. BP919734 - Show BP9197...is mRNA. clone: YMU001_000128_E07. Accession BP919734 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...N+ +QP+E+HIP+LLQ+ IDYNL GM ++L+ +KFR+ K+ N + Sbjct: 141 QSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAVKFRKARRKS---NTLHATGS 197...SSSSPSSSSTTTTTSPSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS 199 Query: 197 LRHNISIRLPIANRAS 244 + S +PI + S

  6. AcEST: BP919745 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_F07 520 Adiantum capillus-veneris mRNA. clone: YMU001_000128_F07. BP9197...45 CL4239Contig1 Show BP919745 Clone id YMU001_000128_F07 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_F07. Accession BP919745 Tissue type prothallium Developmental stag.... 25:3389-3402. Query= BP919745|Adiantum capillus-veneris mRNA, clone: YMU001_000128_F07. (520 letters) Data...NSLETYVYNMKNTINDKDKLAVXXXXXXXXXXXXXXXXXXXXXXENQSAEKEDYDEKL 340 ARNSLETYVYNM+N INDKDKLA +NQSAEKEDY+EKL Sbjct: 197

  7. AcEST: BP919728 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_E01 528 Adiantum capillus-veneris mRNA. clone: YMU001_000128_E01. BP919728 - Show BP9197...is mRNA. clone: YMU001_000128_E01. Accession BP919728 Tissue type prothallium Developmental stage - Contig I... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...YQDAHMQEGFLPRIYLTGDKLFEAGRCWEDISDAISAARIFIYIAGWSV 197 F+QRR C V LYQDAH+ F+P+I L G...376 FTQRRRCHVKLYQDAHMQEGFLPRIYLTGDKLFEAGRCWEDISDAISAARIFIYIAGWSV 197 F+QR+ C V LYQ AH+ + F+P+I L G K +E RCWE

  8. Background submission to the Royal Commission on Nuclear Power Generation

    International Nuclear Information System (INIS)

    1976-12-01

    The Royal Commission on Nuclear Power Generation in New Zealand is required to inquire into and report upon the likely consequences of a nuclear power programme. The New Zealand Electricity Department would have prime responsibilty for implementing the construction, operation and maintenance of nuclear power plants should the need be established and should this be acceptable to the Government. In this submission the Department has attempted to present the issues raised by the introduction of nuclear power in relatively simple terms on the assumption that elaboration can be provided later if necessary

  9. The Royal Society and the decline of magic.

    Science.gov (United States)

    Hunter, Michael

    2011-06-20

    Whereas some have asserted that the early Royal Society actively sought to discredit magical beliefs, others have seen ideas of this kind as integral to the Society's 'nature' in its early years. This paper argues that, whatever the magical commitments of individual Fellows, the Society's corporate policy simply sidelined such pursuits. Yet, insofar as the result was that magic was excluded by default from the proper realm of scientific enquiry, this attitude was to prove paradoxically influential (although its roots have been retrospectively misconstrued to an extent that is significant in itself).

  10. Visit of Her Royal Highness Princess Maha Chakri Sirindhorn, Thailand

    CERN Multimedia

    Patrice Loïez

    2000-01-01

    Her Royal Highness Princess Maha Chakri Sirindhorn of Thailand (left) visiting DELPHI with Spokesman, Tiziano Camporesi, and Prapol Assavavirulhakarn, Pattaratorn Chirapravati, Claude Détraz, CERN Director for Fixed Target andFuture Programmes and Richard Breedon, University of California. No. 05: Princess Maha Chakri Sirindhorn and Daniel Treille, former spokesman of Delphi. No. 31: in Delphi experiment. No. 35: H.E. Mr. Virasakdi Futrakul, Ambassador, Permanent Representative ofThailand, Geneva with H.E. Dr. Ronarong Nopakun, Ambassador of the Thai Embassy in Bern

  11. Mycelium characterization of the Amauroderma sp collected from Royal Belum

    International Nuclear Information System (INIS)

    Hassan Hamdani Mutaat; Mat Rasol Awang; Fauzi Daud; Rosnani Rashid; Meswan Maskom; Arfah Sumeri

    2010-01-01

    Etnobotanical study carried on the native community in the Royal Belum Forest areas had identified many potentially valuable spices that could be further explored for its medicinal and health purposes. The mushrooms, Amauroderma sp. was one of the resources that had been screened and collected for further investigation. In this works, the mycelium characterization of the mushroom was carried out in order to develop suitable seed or spawn for cultivation. The Amauroderma sp. mycelium, cultured from the fruit body tissue was found to grow well on the PDA plate. While on the potato extract liquid medium the mushroom could grow and produce stalk like fruit body. (author)

  12. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    International Nuclear Information System (INIS)

    Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia

    2012-01-01

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.

  13. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Energy Technology Data Exchange (ETDEWEB)

    Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others

    2012-06-15

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

  14. Historic Royal events and the male to female ratio at birth in the United Kingdom.

    Science.gov (United States)

    Grech, Victor

    2015-08-01

    The male to female ratio of live births is expressed as the ratio of male live births divided by total live births (M/T). Factors which reduce M/T include toxins, stress and privation. Britain remains enamoured of the Monarchy. This study was carried out in order to ascertain whether Royal events influenced M/T in the UK. Live births were analysed in relation to the birth of Prince Charles (1948), the Coronation of Queen Elizabeth II (1952), the Silver Jubilee (1977), the wedding of Diana Spencer to Charles, Prince of Wales (July 1981), the birth of Prince William (1982), the death of Lady Diana (August 1997), the wedding of Kate Middleton to Prince William (2011) and the Golden Jubilee (2002). This study analysed 29,293,240 live births. There was a significant dip in M/T in the Coronation year (p=0.03). M/T dipped significantly in relation to the Royal Wedding, commencing a year before (p<0.0001). There were no significant M/T changes in relation to the Silver and Golden Jubilees. The birth of Prince William in 1982 resulted in a rise in M/T in the following year only (p=0.016). Analysis by quarter in relation to Lady Diana's death showed a decline in M/T 4-5 months later in the first quarter of 1998 (p=0.046). The anticipation and stress leading to the Coronation and Royal Wedding may have depressed M/T. Increased coital rates associated with exuberance in relation to Prince William's birth may have raised M/T. Lady Diana's death was temporally associated with a decline in M/T. Royalty events may affect M/T ratios in Britain. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  15. Humphry Davy and the Royal Institution of Great Britain.

    Science.gov (United States)

    Unwin, Patrick R; Unwin, Robert W

    2009-03-20

    The abortive attempts of Sir Humphry Davy to introduce modest reforms at the Royal Society of London during his Presidency (1820-27) contrast with his (largely unstudied) earlier experience of administration at the Royal Institution of Great Britain (RI). Davy's attempts to combat the systemic weaknesses in governance and funding, and his role in effecting changes at the RI, in association with a core group of reformers, merit consideration. This paper analyses important aspects of the early management and social structure of the RI and examines the inner workings of the institution. It shows how and why the Library, its most valuable financial asset, and its celebrated Laboratory, developed along distinctive lines, each with its own support structures and intra-institutional interests. While acknowledging the roles traditionally ascribed to Count Rumford and Sir Joseph Banks, the paper highlights the contributions of other early patrons such as Thomas Bernard, son of a colonial governor of Massachusetts, and Earl Spencer, a leading European bibliophile and RI President from 1813 to 1825. The promotion of a Bill in Parliament in 1810, designed to transform the RI from a proprietary body politic into a corporation of members, and the subsequent framing of the bye-laws, provided opportunities to establish a more democratic structure of elected committees for the conduct of science.

  16. BP Cherry Point Cogeneration Project, Draft Environmental Impact Statement

    Energy Technology Data Exchange (ETDEWEB)

    N/A

    2003-09-19

    BP West Coast Products, LLC (BP or the Applicant) proposes to construct and operate a nominal 720-megawatt (MW), natural-gas-fired, combined-cycle cogeneration facility next to the existing BP Cherry Point Refinery in Whatcom County, Washington. The Applicant also owns and operates the refinery, but the cogeneration facility and the refinery would be operated as separate business units. The cogeneration facility and its ancillary infrastructure would provide steam and 85 MW of electricity to meet the operating needs of the refinery and 635 MW of electrical power for local and regional consumption. The proposed cogeneration facility would be located between Ferndale and Blaine in northwestern Whatcom County, Washington. The Canadian border is approximately 8 miles north of the proposed project site. The Washington State Energy Facility Site Evaluation Council (EFSEC) has jurisdiction over the evaluation of major energy facilities including the proposed project. As such, EFSEC will recommend approval or denial of the proposed cogeneration facility to the governor of Washington after an environmental review. On June 3, 2002, the Applicant filed an Application for Site Certification (ASC No. 2002-01) with EFSEC in accordance with Washington Administrative Code (WAC) 463-42. On April 22, 2003, the Applicant submitted an amended ASC that included, among other things, a change from air to water cooling. With the submission of the ASC and in accordance with the State Environmental Policy Act (SEPA) (WAC 463-47), EFSEC is evaluating the siting of the proposed project and conducting an environmental review with this Environmental Impact Statement (EIS). Because the proposed project requires federal agency approvals and permits, this EIS is intended to meet the requirements under both SEPA and the National Environmental Policy Act (NEPA). The Bonneville Power Administration (Bonneville) and U.S. Army Corps of Engineers (Corps) also will use this EIS as part of their

  17. Making Kew Observatory: the Royal Society, the British Association and the politics of early Victorian science.

    Science.gov (United States)

    Macdonald, Lee T

    2015-09-01

    Built in 1769 as a private observatory for King George III, Kew Observatory was taken over in 1842 by the British Association for the Advancement of Science (BAAS). It was then quickly transformed into what some claimed to be a 'physical observatory' of the sort proposed by John Herschel - an observatory that gathered data in a wide range of physical sciences, including geomagnetism and meteorology, rather than just astronomy. Yet this article argues that the institution which emerged in the 1840s was different in many ways from that envisaged by Herschel. It uses a chronological framework to show how, at every stage, the geophysicist and Royal Artillery officer Edward Sabine manipulated the project towards his own agenda: an independent observatory through which he could control the geomagnetic and meteorological research, including the ongoing 'Magnetic Crusade'. The political machinations surrounding Kew Observatory, within the Royal Society and the BAAS, may help to illuminate the complex politics of science in early Victorian Britain, particularly the role of 'scientific servicemen' such as Sabine. Both the diversity of activities at Kew and the complexity of the observatory's origins make its study important in the context of the growing field of the 'observatory sciences'.

  18. A central role for R7bp in the regulation of itch sensation.

    Science.gov (United States)

    Pandey, Mritunjay; Zhang, Jian-Hua; Mishra, Santosh K; Adikaram, Poorni R; Harris, Benjamin; Kahler, John F; Loshakov, Anna; Sholevar, Roxanne; Genis, Allison; Kittock, Claire; Kabat, Juraj; Ganesan, Sundar; Neubig, Richard R; Hoon, Mark A; Simonds, William F

    2017-05-01

    Itch is a protective sensation producing a desire to scratch. Pathologic itch can be a chronic symptom of illnesses such as uremia, cholestatic liver disease, neuropathies and dermatitis, however current therapeutic options are limited. Many types of cell surface receptors, including those present on cells in the skin, on sensory neurons and on neurons in the spinal cord, have been implicated in itch signaling. The role of G protein signaling in the regulation of pruriception is poorly understood. We identify here 2 G protein signaling components whose mutation impairs itch sensation. R7bp (a.k.a. Rgs7bp) is a palmitoylated membrane anchoring protein expressed in neurons that facilitates Gαi/o -directed GTPase activating protein activity mediated by the Gβ5/R7-RGS complex. Knockout of R7bp diminishes scratching responses to multiple cutaneously applied and intrathecally-administered pruritogens in mice. Knock-in to mice of a GTPase activating protein-insensitive mutant of Gαo (Gnao1 G184S/+) produces a similar pruriceptive phenotype. The pruriceptive defect in R7bp knockout mice was rescued in double knockout mice also lacking Oprk1, encoding the G protein-coupled kappa-opioid receptor whose activation is known to inhibit itch sensation. In a model of atopic dermatitis (eczema), R7bp knockout mice showed diminished scratching behavior and enhanced sensitivity to kappa opioid agonists. Taken together, our results indicate that R7bp is a key regulator of itch sensation and suggest the potential targeting of R7bp-dependent GTPase activating protein activity as a novel therapeutic strategy for pathological itch.

  19. AcEST: BP912000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_H04 558 Adiantum capillus-veneris mRNA. clone: YMU001_000011_H04. BP912000... CL1118Contig1 Show BP912000 Clone id YMU001_000011_H04 Library YMU01 Length 558 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000011_H04. Accession BP912000 Tissue type prothallium Developmental stag... Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912000...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP912000|Adiantum capillus-veneris mRNA, clone: YMU001_00001

  20. AcEST: BP920001 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G11 534 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G11. BP92000...1 CL197Contig1 Show BP920001 Clone id YMU001_000131_G11 Library YMU01 Length 534 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_G11. Accession BP920001 Tissue type prothallium Developmental stage... Nucleic Acids Res. 25:3389-3402. Query= BP920001|Adiantum capillus-veneris mRNA, clone: YMU001_000131_G11. ...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92000

  1. AcEST: BP920007 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H09 516 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H09. BP92000...7 CL346Contig1 Show BP920007 Clone id YMU001_000131_H09 Library YMU01 Length 516 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_H09. Accession BP920007 Tissue type prothallium Developmental stage... Nucleic Acids Res. 25:3389-3402. Query= BP920007|Adiantum capillus-veneris mRNA, clone: YMU001_000131_H09. ...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920007|Adiantum capillus-veneris

  2. AcEST: BP920005 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H07 540 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H07. BP92000...5 CL654Contig1 Show BP920005 Clone id YMU001_000131_H07 Library YMU01 Length 540 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000131_H07. Accession BP920005 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920005|Adiantum capillus-veneris mRNA, clone: YMU001_0001...s. 25:3389-3402. Query= BP920005|Adiantum capillus-veneris mRNA, clone: YMU001_00

  3. AcEST: BP920003 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H02 477 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H02. BP920003 - Show BP92000...is mRNA. clone: YMU001_000131_H02. Accession BP920003 Tissue type prothallium Developmental stage - Contig I...ids Res. 25:3389-3402. Query= BP920003|Adiantum capillus-veneris mRNA, clone: YMU...s Res. 25:3389-3402. Query= BP920003|Adiantum capillus-veneris mRNA, clone: YMU001_000131_H02. (477 letters)...SCAF14633, whole genome shotgun sequence OS=Tetraodon nigroviridis GN=GSTENG00019920001 PE=4 SV=1 Length = 2

  4. AcEST: BP920009 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_H11 521 Adiantum capillus-veneris mRNA. clone: YMU001_000131_H11. BP92000...9 CL2261Contig1 Show BP920009 Clone id YMU001_000131_H11 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_H11. Accession BP920009 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920009|Adiantum capillus-veneris mRNA, cl...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920009|Adiantum capillus-veneris mRNA, clone: YMU001_000131_H1

  5. AcEST: BP918424 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D01 540 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D01. BP918424 - Show BP9184...is mRNA. clone: YMU001_000113_D01. Accession BP918424 Tissue type prothallium Developmental stage - Contig I...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP918424|Adiantum capillus-veneris mRNA, clone: YMU001_0001...component response regulator-like APRR3 OS=Arabidopsis thaliana GN=APRR3 PE=1 SV=1 Length = 495 Score = 75.5 bits (184...T: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918424|Ad

  6. AcEST: BP918400 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_A11 368 Adiantum capillus-veneris mRNA. clone: YMU001_000113_A11. BP918400 - Show BP9184...is mRNA. clone: YMU001_000113_A11. Accession BP918400 Tissue type prothallium Developmental stage - Contig I...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918400|Adiantum capillus-veneris mRNA, clone: YMU001_000113_A1...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...aining ... 62 1e-08 tr|A2FI37|A2FI37_TRIVA SNF2 family N-terminal domain containing ... 58 2e-07 tr|O61845|O6184

  7. AcEST: BP918428 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D05 431 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D05. BP9184...28 CL2013Contig1 Show BP918428 Clone id YMU001_000113_D05 Library YMU01 Length 431 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D05. Accession BP918428 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP918428|Adiantum capillus-veneris mRNA, clone: YMU001_00...c Acids Res. 25:3389-3402. Query= BP918428|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D05. (431 le

  8. AcEST: BP918414 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C02 507 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C02. BP9184...14 CL2905Contig1 Show BP918414 Clone id YMU001_000113_C02 Library YMU01 Length 507 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C02. Accession BP918414 Tissue type prothallium Developmental stag...cleic Acids Res. 25:3389-3402. Query= BP918414|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C02. (50...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918414|Adiantum capillus

  9. AcEST: BP916184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_C08 242 Adiantum capillus-veneris mRNA. clone: YMU001_000084_C08. BP916184... CL2444Contig1 Show BP916184 Clone id YMU001_000084_C08 Library YMU01 Length 242 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000084_C08. Accession BP916184 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916184|Adiantum capillus-veneris mR... Acids Res. 25:3389-3402. Query= BP916184|Adiantum capillus-veneris mRNA, clone: YMU001_000084_C08. (242 let

  10. AcEST: BP918410 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B10 582 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B10. BP9184...10 CL3949Contig1 Show BP918410 Clone id YMU001_000113_B10 Library YMU01 Length 582 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_B10. Accession BP918410 Tissue type prothallium Developmental stag...I-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  11. AcEST: BP918434 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D12 545 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D12. BP9184...34 CL3700Contig1 Show BP918434 Clone id YMU001_000113_D12 Library YMU01 Length 545 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_D12. Accession BP918434 Tissue type prothallium Developmental stag...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184... Acids Res. 25:3389-3402. Query= BP918434|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D12. (545 let

  12. AcEST: BP918429 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D06 512 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D06. BP9184...29 CL402Contig1 Show BP918429 Clone id YMU001_000113_D06 Library YMU01 Length 512 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000113_D06. Accession BP918429 Tissue type prothallium Developmental stage...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918429|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D0...ic Acids Res. 25:3389-3402. Query= BP918429|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D06. (512 l

  13. AcEST: BP918422 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C10 543 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C10. BP9184...22 CL2380Contig1 Show BP918422 Clone id YMU001_000113_C10 Library YMU01 Length 543 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C10. Accession BP918422 Tissue type prothallium Developmental stag...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918422|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C... Res. 25:3389-3402. Query= BP918422|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C10. (543 letters)

  14. AcEST: BP918455 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F10 230 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F10. BP9184...55 CL2414Contig1 Show BP918455 Clone id YMU001_000113_F10 Library YMU01 Length 230 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_F10. Accession BP918455 Tissue type prothallium Developmental stag...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  15. AcEST: BP918419 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C07 404 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C07. BP9184...19 CL2365Contig1 Show BP918419 Clone id YMU001_000113_C07 Library YMU01 Length 404 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C07. Accession BP918419 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918419|Adiantum capillus-veneris mRNA, clo

  16. AcEST: BP918446 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F01 537 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F01. BP9184...46 CL722Contig1 Show BP918446 Clone id YMU001_000113_F01 Library YMU01 Length 537 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000113_F01. Accession BP918446 Tissue type prothallium Developmental stage... search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918446|Adiantum capillus-veneris mRNA, clone: YM...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918446|Adiantum capillus-veneris mRNA, c

  17. AcEST: BP918426 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_D03 504 Adiantum capillus-veneris mRNA. clone: YMU001_000113_D03. BP9184...26 CL2Contig2 Show BP918426 Clone id YMU001_000113_D03 Library YMU01 Length 504 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000113_D03. Accession BP918426 Tissue type prothallium Developmental stage -...c Acids Res. 25:3389-3402. Query= BP918426|Adiantum capillus-veneris mRNA, clone: YMU001_000113_D03. (504 le...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  18. AcEST: BP918485 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000114_A10 537 Adiantum capillus-veneris mRNA. clone: YMU001_000114_A10. BP9184...85 CL964Contig1 Show BP918485 Clone id YMU001_000114_A10 Library YMU01 Length 537 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000114_A10. Accession BP918485 Tissue type prothallium Developmental stage...s, Nucleic Acids Res. 25:3389-3402. Query= BP918485|Adiantum capillus-veneris mRNA, clone: YMU001_000114_A10...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184

  19. AcEST: BP918418 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C06 558 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C06. BP9184...18 CL2832Contig1 Show BP918418 Clone id YMU001_000113_C06 Library YMU01 Length 558 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C06. Accession BP918418 Tissue type prothallium Developmental stag...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918418|Adiantum capillus-veneris mRNA, clone:...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918418|Adiantum capillus-veneris mRNA, clone: YMU0

  20. AcEST: BP914065 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette

  1. AcEST: BP914069 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001

  2. AcEST: BP914060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett

  3. AcEST: BP919846 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G12 545 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G12. BP91984...6 CL2640Contig1 Show BP919846 Clone id YMU001_000129_G12 Library YMU01 Length 545 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G12. Accession BP919846 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919846|Adiantum capillus-veneris mRNA...cleic Acids Res. 25:3389-3402. Query= BP919846|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G12. (54

  4. AcEST: BP919844 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_G10 527 Adiantum capillus-veneris mRNA. clone: YMU001_000129_G10. BP91984...4 CL4143Contig1 Show BP919844 Clone id YMU001_000129_G10 Library YMU01 Length 527 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_G10. Accession BP919844 Tissue type prothallium Developmental stag... Nucleic Acids Res. 25:3389-3402. Query= BP919844|Adiantum capillus-veneris mRNA, clone: YMU001_000129_G10. ...LAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9198

  5. AcEST: BP920182 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A06 426 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A06. BP92018...2 CL587Contig1 Show BP920182 Clone id YMU001_000134_A06 Library YMU01 Length 426 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000134_A06. Accession BP920182 Tissue type prothallium Developmental stage...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920182|Adiantum capillus-veneris mRNA, clone:

  6. AcEST: BP920185 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A09 543 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A09. BP92018...5 CL2147Contig1 Show BP920185 Clone id YMU001_000134_A09 Library YMU01 Length 543 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_A09. Accession BP920185 Tissue type prothallium Developmental stag...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920185|Adiantum capillus-veneris...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018

  7. AcEST: BP920188 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_B01 399 Adiantum capillus-veneris mRNA. clone: YMU001_000134_B01. BP92018...8 CL3114Contig1 Show BP920188 Clone id YMU001_000134_B01 Library YMU01 Length 399 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_B01. Accession BP920188 Tissue type prothallium Developmental stag...d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018... PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018

  8. AcEST: BP920181 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000134_A05 379 Adiantum capillus-veneris mRNA. clone: YMU001_000134_A05. BP92018...1 CL3929Contig1 Show BP920181 Clone id YMU001_000134_A05 Library YMU01 Length 379 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000134_A05. Accession BP920181 Tissue type prothallium Developmental stag...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920181|Adiantum capillus-veneris m...apped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92018

  9. AcEST: BP919792 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C02 517 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C02. BP9197...92 CL23Contig1 Show BP919792 Clone id YMU001_000129_C02 Library YMU01 Length 517 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000129_C02. Accession BP919792 Tissue type prothallium Developmental stage ...ms, Nucleic Acids Res. 25:3389-3402. Query= BP919792|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C0...eic Acids Res. 25:3389-3402. Query= BP919792|Adiantum capillus-veneris mRNA, clon

  10. AcEST: BP919710 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C06 540 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C06. BP9197...10 CL1009Contig1 Show BP919710 Clone id YMU001_000128_C06 Library YMU01 Length 540 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000128_C06. Accession BP919710 Tissue type prothallium Developmental stag...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919710|Adiantum capillus-veneris mRNA, clone:...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919710|Adiantum capillus-vener

  11. AcEST: BP919798 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C08 534 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C08. BP919798 - Show BP9197...is mRNA. clone: YMU001_000129_C08. Accession BP919798 Tissue type prothallium Developmental stage - Contig I... Res. 25:3389-3402. Query= BP919798|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C08. (534 letters) ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP919798|Adiantum capillus-veneris mRNA, clone: YMU0...racterized protein OS=Toxop... 49 2e-04 tr|Q91973|Q91973_COTCO Slow myosin heavy chain 3 OS=Coturnix cot...

  12. AcEST: BP911976 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000011_E10 538 Adiantum capillus-veneris mRNA. clone: YMU001_000011_E10. BP911976 - Show BP91197...is mRNA. clone: YMU001_000011_E10. Accession BP911976 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP911976|Adiantum capillus-veneris mRNA, clone: YMU001_000011_E10. (538 lett...DIKAGTELTFNYNLECLGNGKTVCKCGAPNCSGF 1978 Query: 155 TG 150 G Sbjct: 1979 LG 1980 >sp|Q96L73|NSD1_HUMAN Histon...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP911976|Adiantum capillus-veneris mRNA, clone: YMU00

  13. AcEST: BP919709 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_C05 470 Adiantum capillus-veneris mRNA. clone: YMU001_000128_C05. BP919709 - Show BP9197...is mRNA. clone: YMU001_000128_C05. Accession BP919709 Tissue type prothallium Developmental stage - Contig I...Res. 25:3389-3402. Query= BP919709|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C05. (454 letters) D... 25:3389-3402. Query= BP919709|Adiantum capillus-veneris mRNA, clone: YMU001_000128_C05. (454 letters) Datab...va subsp. indica PE=2 SV=1 Length = 197 Score = 133 bits (335), Expect = 4e-30 Identities = 63/104 (60%), Po

  14. AcEST: BP919778 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_A11 511 Adiantum capillus-veneris mRNA. clone: YMU001_000129_A11. BP9197...78 CL23Contig1 Show BP919778 Clone id YMU001_000129_A11 Library YMU01 Length 511 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000129_A11. Accession BP919778 Tissue type prothallium Developmental stage ...cleic Acids Res. 25:3389-3402. Query= BP919778|Adiantum capillus-veneris mRNA, clone: YMU001_000129_A11. (51...c Acids Res. 25:3389-3402. Query= BP919778|Adiantum capillus-veneris mRNA, clone:

  15. AcEST: BP919769 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_H11 500 Adiantum capillus-veneris mRNA. clone: YMU001_000128_H11. BP9197...69 CL2Contig4 Show BP919769 Clone id YMU001_000128_H11 Library YMU01 Length 500 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000128_H11. Accession BP919769 Tissue type prothallium Developmental stage -...ids Res. 25:3389-3402. Query= BP919769|Adiantum capillus-veneris mRNA, clone: YMU001_000128_H11. (500 letter...pped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197

  16. Home and Online Management and Evaluation of Blood Pressure (HOME BP) digital intervention for self-management of uncontrolled, essential hypertension: a protocol for the randomised controlled HOME BP trial.

    Science.gov (United States)

    Band, Rebecca; Morton, Katherine; Stuart, Beth; Raftery, James; Bradbury, Katherine; Yao, Guiqing Lily; Zhu, Shihua; Little, Paul; Yardley, Lucy; McManus, Richard J

    2016-11-07

    Self-management of hypertension, including self-monitoring and antihypertensive medication titration, lowers blood pressure (BP) at 1 year compared to usual care. The aim of the current trial is to assess the effectiveness of the Home and Online Management and Evaluation of Blood Pressure (HOME BP) intervention for the self-management of hypertension in primary care. The HOME BP trial will be a randomised controlled trial comparing BP self-management-consisting of the HOME BP online digital intervention with self-monitoring, lifestyle advice and antihypertensive drug titration-with usual care for people with uncontrolled essential hypertension. Eligible patients will be recruited from primary care and randomised to usual care or to self-management using HOME BP. The primary outcome will be the difference in mean systolic BP (mm Hg) at 12-month follow-up between the intervention and control groups adjusting for baseline BP and covariates. Secondary outcomes (also adjusted for baseline and covariates where appropriate) will be differences in mean BP at 6 months and diastolic BP at 12 months; patient enablement; quality of life, and economic analyses including all key resources associated with the intervention and related services, adopting a broad societal perspective to include NHS, social care and patient costs, considered within trial and modelled with a lifetime horizon. Medication beliefs, adherence and changes; self-efficacy; perceived side effects and lifestyle changes will be measured for process analyses. Qualitative analyses will explore patient and healthcare professional experiences of HOME BP to gain insights into the factors affecting acceptability, feasibility and adherence. This study has received NHS ethical approval (REC reference 15/SC/0082). The findings from HOME BP will be disseminated widely through peer-reviewed publications, scientific conferences and workshops. If successful, HOME BP will be directly applicable to UK primary care

  17. Environmental survey of former royal artillery range hebrides

    International Nuclear Information System (INIS)

    Boltwood, M.

    2006-01-01

    Full text of publication follows: The former UK Royal Artillery Range, Hebrides had been used to store and use radioactive miss distance indicators (R.A.M.D.I.) in the testing of Rapier missiles. As part of the testing, missiles were fired out to sea between about 1970 and 1981. Concerns were expressed in early 2004 by some within the local community that there was an unknown, ongoing hazard to them from the impact on the local environment resulting from the use radioactive material in these trials. Accordingly Defence Science and Technology Laboratory, Environmental Science Department (D.s.t.l. E.S.D.) were tasked by the Ministry of Defence to carry out an Environmental Survey of the former Royal Artillery Range, Hebrides and surrounding areas; the environmental survey was carried between the dates of 18 28 May 2004. D.s.t.l. E.S.D. environmental survey focussed upon buildings and areas within and immediately adjacent to the Range Compound, launch areas, and the burial site used following the decontamination undertaken in 1980. Radiation measurements were taken, samples of biota, sediment and water were obtained from marine and inter-tidal areas from the western coast of South Uist, Benbecula and North Uist. Locally caught shellfish were purchased and analysed to identify if there had been uptake of radioactive material from the marine environment. To ensure that the sampling and analysis techniques employed by D.s.t.l. E.S.D. were commensurate with those used by other agencies, the Assistant Director of the Department for Sustainable Communities (Uist and Barra) observed the survey. Duplicate samples were taken from Loch Bee, Rangehead beach and Launch Area 1. The samples taken by the Department for Sustainable Communities were analysed by the U.K.A.S. Accredited Laboratories of Glasgow Scientific Services (G.S.S.). Results from this analysis were comparable with those produced by Ds.t.l. Radiological Protection Services. From the results of this comprehensive

  18. Role and function of a paediatric clinical ethics service: experiences at the Royal Children's Hospital, Melbourne.

    Science.gov (United States)

    Gold, Hugo; Hall, Georgina; Gillam, Lynn

    2011-09-01

    This article explores and analyses the role and functions of a clinical ethics service in paediatrics. It is based on the experiences of developing ethics capacity at the Royal Children's Hospital, Melbourne, which has evolved since 2002 from a multidisciplinary advisory panel into Australia's first dedicated paediatric Children's Bioethics Centre, which opened in 2008. The ultimate goal is building ethics capacity and literacy across the hospital and continuing to support clinical staff managing patients and their families in ethically problematic cases. This is achieved through current case consultation, education and training, research and institutional policy, and guideline development. The experience of building a clinical ethics service has led to many changes to its structure over the years, with issues like timeliness of meeting, constitution of the group and referral and reporting structures arising as key elements of evolution. Challenges include resourcing and structure, institutional support, and family involvement in ethics consultations. © 2011 The Authors. Journal of Paediatrics and Child Health © 2011 Paediatrics and Child Health Division (Royal Australasian College of Physicians).

  19. Three intervention levels for improving smoking behavior among Royal Thai Army conscripts.

    Science.gov (United States)

    Pantaewan, Pannee; Kengganpanich, Mondha; Tanasugarn, Chanuantong; Tansakul, Supreya; Termsirikulchai, Lakkhana; Nityasuddhi, Dechavudh

    2012-07-01

    We evaluated a smoking cessation program based on an ecological model among Royal Thai Army conscripts with three levels of behavioral change intervention: intrapersonal level, interpersonal level and organizational level. The program applied processes of change in the Transtheoretical Model for intervention at the intrapersonal level; social support from the family at the interpersonal level; strengthening policies and activities to support quitting, including providing a smoke-free workplace at the organizational level. Eighty-nine participants were purposively selected from the first regiment of conscripts at the King's Royal Guard, recruited into the Army in 2009. The behavioral change intervention was conducted during their first six months of duty. A self-administered questionnaire was used to collect data between May and November 2009. Individual interviews and checklist observations were employed to collect data. Data was analyzed using inferential statistics, comparing means by paired t-test and the chi-square test was used to analyze correlations. Qualitative data were analyzed thematically. Sixty-three percent of participants significantly (pimprovement in self-efficacy for improving smoking behavior (p=0.002) and making an effort to quit (p<0.001).

  20. Improving the beam quality of the neutron radiography facility using the SLOWPOKE-2 at the Royal Military College of Canada

    International Nuclear Information System (INIS)

    Lewis, W.J.; Bennett, L.G.I.; Teshima, P.

    1996-01-01

    At the SLOWPOKE-2 Facility at the Royal Military College of Canada, a neutron radiography facility has been designed and installed, and the beam quality has been improved by performing a series of radiographs using American standard for testing and materials (ASTM) E 545 indicators. Other means of determining the progress such as bubble detectors and activation foils were used. Modifications to the nosepiece of the beam tube including shielding and linings for fast neutron and gamma radiation were made. (orig.)

  1. A royal visit : King Harald V and Queen Sonja of Norway made a trip to CERN on Tuesday 4 April

    CERN Multimedia

    Maximilien Brice

    2006-01-01

    CERN Director-General Robert Aymar welcomed the royal party, which included the Norwegian Minister of Foreign Affairs, Jonas Gahr Støre, and provided an overview of CERN's history and current and future research. ATLAS deputy spokesperson Steinar Stapnes then quickly explained the concept and inner workings of the LHC, some LHC physics goals and ATLAS, which is one of the main experiments receiving Norwegian contributions

  2. Compliance of Royal Naval ships with nitrogen oxide emissions legislation.

    Science.gov (United States)

    Blatcher, D J; Eames, I

    2013-09-15

    Nitrogen oxide (NOx) emissions from marine diesel engines pose a hazard to human health and the environment. From 2021, demanding emissions limits are expected to be applied to sea areas that the Royal Navy (RN) accesses. We analyze how these future constraints affect the choice of NOx abatement systems for RN ships, which are subject to more design constraints than civilian ships. A weighted matrix approach is used to facilitate a quantitative assessment. For most warships to be built soon after 2021 Lean Nitrogen Traps (LNT) in conjunction with Exhaust Gas Recirculation (EGR) represents a relatively achievable option with fewer drawbacks than other system types. Urea-selective catalytic reduction is likely to be most appropriate for ships that are built to civilian standards. The future technologies that are at an early stage of development are discussed. Copyright © 2013 Elsevier Ltd. All rights reserved.

  3. Nuclear submarines in the Royal Navy - the design challenge

    International Nuclear Information System (INIS)

    Betts, C.V.

    1999-01-01

    Since the early years of the century, submarines have been among the most potent contributors to naval power. Nuclear-powered submarines, with the ability to stay continuously submerged for months and capable of the high sustained speeds previously only achieved by surface warships, now vie with aircraft carriers as the capital ships of the major navies of the world. Indeed, their unsurpassed stealth has made them the prime choice for deploying a nuclear deterrent capability. After a brief historical survey, this paper reviews the current status of the Royal Navy's nuclear submarine fleet then describes the design and construction process for a nuclear submarine. The design of any submarine is a complex and highly integrated process and the particular and far-reaching effects of incorporating nuclear steam-raising plant are discussed, along with the key safety considerations involved in nuclear submarine design and operation. The paper concludes with some thoughts on the future development of submarines. (author)

  4. Virtual Learning Spaces at the Royal Danish Defence College

    DEFF Research Database (Denmark)

    Frølund, Gro

    study has used a series of qualitative interviews to map the learning experiences of officers from the Royal Danish Defence College. A number of questions animate the study. Firstly, can we identify certain factors that have created increased learning benefit when we come to evaluate the strategies......A growing proportion of today’s educational activity, civilian as well as military, takes place in virtual learning environments. A corollary of this growth is the emerging concern that the educational value of information and communication technology (ICT) is under-used by educators....... There are also professional concerns that ICT may even undermine the effectiveness of teaching in some instances. A recent report notes that our educational institutions are ill-prepared pedagogically for making the most of technology. It asserts that simply adding twenty first century technologies to twentieth...

  5. IgG autoantibodies from bullous pemphigoid (BP) patients bind antigenic sites on both the extracellular and the intracellular domains of the BP antigen 180.

    Science.gov (United States)

    Perriard, J; Jaunin, F; Favre, B; Büdinger, L; Hertl, M; Saurat, J H; Borradori, L

    1999-02-01

    Bullous pemphigoid (BP) and gestational pemphigoid (PG) are subepidermal blistering disorders associated with autoantibodies directed against two components of hemidesmosomes: the BP antigen 180 (BP180) and the BP antigen 230 (BP230). Autoantibodies against the extracellular domain (ECD) of BP180 are thought to play an initiatory role in subepidermal blister formation. To characterize the targeted antigenic sites on BP180, we have assessed the reactivity of sera from BP and PG patients against eukaryotic recombinant proteins encompassing various portions of the ECD and the intracellular domain (ICD) of BP180. Twenty-two of 22 (100%) BP sera that immunoblotted BP180 in keratinocyte extracts, bound a mutant form consisting of the entire ECD of BP180, whereas only three of these 22 sera (14%) reacted against the ECD of BP180 lacking the NC16A membrane proximal region. Thirteen out of the 22 (59%) BP sera recognized the ICD of BP180. Circulating IgG from a representative BP patient that was affinity purified against the ECD of BP180 did not bind the ICD when reblotted, indicating that there was no antigenic cross-reactivity between the ECD and the ICD of BP180. Reactivity against the ICD of BP180 was further ascertained by immunofluorescence microscopy studies showing that nine of the 22 (41%) BP sera stained COS-7 cells expressing the ICD of BP180. Using deletion mutants of the ICD of BP180, the majority of the sera was found to recognize the central region of the ICD of BP180. Specifically, an immunodominant region was localized to an 87-amino acid segment located towards the NH2-terminus of BP180. In contrast to BP sera, five of six (83%) PG sera contained IgG that recognized exclusively the NC16A region, whereas none bound to the ICD of BP180. Together, the results indicate that in BP, autoantibody reactivity to BP180 is not exclusively restricted to the NC16A region, but that additional antigenic determinants exist on the ICD of BP180. The observed heterogeneous

  6. Modelling and Analysis of Dynamic Reconfiguration in BP-Calculus

    DEFF Research Database (Denmark)

    Abouzaid, Faisal; Mullins, John; Mazzara, Manuel

    2012-01-01

    The BP-calculus is a formalism based on the π-calculus and encoded in WS-BPEL. The BP-calculus is intended to specificaly model and verify Service Oriented Applications. One important feature of SOA is the ability to compose services that may dynamically evolve along runtime. Dynamic...... reconfiguration of services increases their availability, but puts accordingly, heavy demands for validation, verification, and evaluation. In this paper we formally model and analyze dynamic reconfigurations and their requirements in BP-calculus and show how reconfigurable components can be modeled using...

  7. AcEST: BP911844 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_G11 340 Adiantum capillus-veneris mRNA. clone: YMU001_000009_G11. BP911844 - Show BP91184...is mRNA. clone: YMU001_000009_G11. Accession BP911844 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP911844|Adiantum capillus-veneris mRNA, clone: YMU001_000009_G11. (340 letters) Data...|SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio GN=setd1ba PE=1 SV=2 Length = 1844 S...KFPIE 1826 Query: 155 NKEVPCLCGADTCR 114 ++++PCLCGA+ CR Sbjct: 1827 DEKIPCLCGAENCR 1840 >sp|Q24742|TRX_DROVI

  8. AcEST: BP918448 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_F03 604 Adiantum capillus-veneris mRNA. clone: YMU001_000113_F03. BP9184...48 CL1738Contig1 Show BP918448 Clone id YMU001_000113_F03 Library YMU01 Length 604 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_F03. Accession BP918448 Tissue type prothallium Developmental stag...h programs, Nucleic Acids Res. 25:3389-3402. Query= BP918448|Adiantum capillus-veneris mRNA, clone: YMU001_0...1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res.

  9. AcEST: BP918469 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_H01 435 Adiantum capillus-veneris mRNA. clone: YMU001_000113_H01. BP9184...69 CL28Contig1 Show BP918469 Clone id YMU001_000113_H01 Library YMU01 Length 435 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000113_H01. Accession BP918469 Tissue type prothallium Developmental stage ...Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9184...L (release 39.9) Link to BlastX Result : TrEMBL tr_hit_id B4J7L9 Definition tr|B4J7L9|B4J7L9_DROGR GH21844 O

  10. AcEST: BP914184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000056_A06 602 Adiantum capillus-veneris mRNA. clone: YMU001_000056_A06. BP914184 - Show BP914184...is mRNA. clone: YMU001_000056_A06. Accession BP914184 Tissue type prothallium Developmental stage - Contig I...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914184|Adiantum capillus-veneris mRNA, clo...ycf2-A P... 31 4.2 sp|Q09FP8|YCF2_NANDO Protein ycf2 OS=Nandina domestica GN=ycf2-A... 31 5.5 sp|O18400|PITX...HDLLHRSSI 116 D S +LP+L + N +++FHD++H S I Sbjct: 1254 DTFSDLLPILSSSQNFVSIFHDIMHGSDI 1282 >sp|O184

  11. AcEST: BP918415 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_C03 548 Adiantum capillus-veneris mRNA. clone: YMU001_000113_C03. BP9184...15 CL1357Contig1 Show BP918415 Clone id YMU001_000113_C03 Library YMU01 Length 548 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000113_C03. Accession BP918415 Tissue type prothallium Developmental stag...s, Nucleic Acids Res. 25:3389-3402. Query= BP918415|Adiantum capillus-veneris mRNA, clone: YMU001_000113_C03...ate Australia) PE=3 SV=1 Length = 1844 Score = 31.6 bits (70), Expect = 2.6 Ident

  12. AcEST: BP914040 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_B12 523 Adiantum capillus-veneris mRNA. clone: YMU001_000039_B12. BP914040 - Show BP914040...is mRNA. clone: YMU001_000039_B12. Accession BP914040 Tissue type prothallium Developmental stage - Contig I...d BLAST and PSI-BLAST: a new generation of protein database search programs, Nucl...eic Acids Res. 25:3389-3402. Query= BP914040|Adiantum capillus-veneris mRNA, clone: YMU001_000039_B12. (523 ... ... 33 1.1 sp|Q758T8|SWC3_ASHGO SWR1-complex protein 3 OS=Ashbya gossypii G... 32 1.8 sp|P32583|SRP40_YEAST

  13. BP Spill in the Gulf of Mexico Sediment Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — In response to the BP oil spill, EPA monitored sediment near the spill. While emergency response data collection has ended, results continue to be available on this...

  14. AcEST: BP912124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total

  15. AcEST: BP912125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12

  16. AcEST: BP912120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412

  17. AcEST: BP921212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29

  18. AcEST: BP912812 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ

  19. AcEST: BP912122 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum

  20. AcEST: BP912127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi

  1. AcEST: BP912112 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765

  2. AcEST: BP912412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot

  3. AcEST: BP912512 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear

  4. AcEST: BP912129 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett

  5. AcEST: BP912121 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D03 516 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D03. BP912121 - Show BP91212...is mRNA. clone: YMU001_000015_D03. Accession BP912121 Tissue type prothallium Developmental stage - Contig I...ATH Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana Align length 122 Score (bit) 85.5 E-value 1.0e-1...neration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...1|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D03. (516 letters) Database: uniprot_sprot.fasta 412

  6. AcEST: BP913939 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP

  7. Evaluation of the Specificity of BP3385 for Bordetella pertussis

    Science.gov (United States)

    BP3385 has been proposed as a diagnostic PCR target for discriminating between Bordetella pertussis and other Bordetella species that also infect humans. Our results demonstrate this gene is also present in some strains of Bordetella hinzii and Bordetella bronchiseptica....

  8. AcEST: BP919750 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_F12 507 Adiantum capillus-veneris mRNA. clone: YMU001_000128_F12. BP919750 - Show BP9197...is mRNA. clone: YMU001_000128_F12. Accession BP919750 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...-protein kinase W... 30 4.4 sp|Q2M197|PYRG_DROPS CTP synthase OS=Drosophila pseudoobscura ps... 30 5.7 sp|Q5...0 Identities = 24/95 (25%), Positives = 40/95 (42%) Frame = +2 Query: 197 AACLHNFWSLSHSLQYVCKMQLSRRQ*PCTYYID

  9. AcEST: BP919754 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_G04 524 Adiantum capillus-veneris mRNA. clone: YMU001_000128_G04. BP9197...54 CL899Contig1 Show BP919754 Clone id YMU001_000128_G04 Library YMU01 Length 524 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000128_G04. Accession BP919754 Tissue type prothallium Developmental stage...eic Acids Res. 25:3389-3402. Query= BP919754|Adiantum capillus-veneris mRNA, clone: YMU001_000128_G04. (501 ...KSTLLKLLAWRQIPVPKNI 95 KDI I++F + G+ +L NA L +S G RYGLV NG GKSTLL+ L+ R++ VPK++ Sbjct: 197 KDIHIDTFDLYVGDGQR

  10. AcEST: BP919790 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_B12 515 Adiantum capillus-veneris mRNA. clone: YMU001_000129_B12. BP9197...90 CL1946Contig1 Show BP919790 Clone id YMU001_000129_B12 Library YMU01 Length 515 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_B12. Accession BP919790 Tissue type prothallium Developmental stag...atabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919790|Adiantum capillus-veneris mRNA, cl...at-containing protein At1g19720 OS=Arabidopsis thaliana GN=DYW7 PE=2 SV=1 Length = 894 Score = 86.7 bits (21

  11. AcEST: BP919789 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_B11 548 Adiantum capillus-veneris mRNA. clone: YMU001_000129_B11. BP9197...89 CL1910Contig1 Show BP919789 Clone id YMU001_000129_B11 Library YMU01 Length 548 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000129_B11. Accession BP919789 Tissue type prothallium Developmental stag... Swiss-Prot sp_hit_id P29197 Definition sp|P29197|CH60A_ARATH Chaperonin CPN60, mitochondrial OS=Arabidopsis...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919789|Adiantum capillus-veneris mRNA, clo

  12. AcEST: BP919033 [AcEST

    Lifescience Database Archive (English)

    Full Text Available eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919033|Adiantum cap...(1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  13. AcEST: BP917547 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917547|Adiantum c

  14. AcEST: BP920739 [AcEST

    Lifescience Database Archive (English)

    Full Text Available J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic ...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9207

  15. AcEST: BP913125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913125|Adiantum

  16. AcEST: BP917518 [AcEST

    Lifescience Database Archive (English)

    Full Text Available of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91... David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, N

  17. The human element of right-sizing. BP experiences

    Energy Technology Data Exchange (ETDEWEB)

    Hollis, J.W. [BP Norge (Norway)

    1994-12-31

    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  18. BP/Mobil. Joint-venture directions for use

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)

  19. The human element of right-sizing. BP experiences

    International Nuclear Information System (INIS)

    Hollis, J.W.

    1994-01-01

    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  20. Environmental change in the Limfjord, Denmark (ca 7500-1500 cal yrs BP): a multiproxy study

    Science.gov (United States)

    Lewis, Jonathan P.; Ryves, David B.; Rasmussen, Peter; Knudsen, Karen L.; Petersen, Kaj S.; Olsen, Jesper; Leng, Melanie J.; Kristensen, Peter; McGowan, Suzanne; Philippsen, Bente

    2013-10-01

    The Limfjord region of northern Jutland, Denmark, supports a rich archaeological record dating back to the Mesolithic, which documents long-term change in human practices and utilisation of marine resources since approximately 7500 BP. The presence and availability of marine resources in the Limfjord is sensitively regulated by environmental parameters such as salinity, sedimentary regime, nutrient status and primary productivity, but long-term changes in these parameters are currently poorly understood. In this study a multiproxy approach (including sedimentary parameters, diatoms, molluscs, foraminifera, sedimentary pigments, C and O stable isotopes and plant macrofossils) has been adopted to assess environmental change over the period ca 7500-1500 cal yrs BP at Kilen, a coastal fjord (before AD 1856) situated in the Western Limfjord. A diatom-based salinity transfer function based on a pan-Baltic training set has been applied to the fossil diatom dataset for quantitative assessment of salinity change over the study period. This study demonstrates that large-scale shifts in salinity are a common feature of the Limfjord's long-term history and are driven by the level of connection with the North Sea and the Skagerrak respectively, which in turn is likely driven by the complex interplay between climate, sea-level change, current velocity and rates of erosion/sedimentary accretion. Three shifts in state at Kilen are identified over the study period: a deep, periodically stratified fjord with medium-high salinity (and high productivity) between ca 7500-5000 BP, followed by a gradual transition to a shallow benthic system with more oceanic conditions (i.e. higher salinity, lower productivity, slower sedimentary accumulation rate and poorer fossil preservation) after ca 5000 BP and no stratification after ca 4400 BP, and lastly, within this shallow phase, an abrupt shift to brackish conditions around 2000 BP. Environmental-societal interactions are discussed on the

  1. 4977-bp mitochondrial DNA deletion in infertile patients with varicocele.

    Science.gov (United States)

    Gashti, N G; Salehi, Z; Madani, A H; Dalivandan, S T

    2014-04-01

    Varicocele is the abnormal inflexion and distension of veins of the pampiniform plexus within spermatic cord and is one of the amendable causes of male infertility. It can increase reactive oxygen species (ROS) production in semen and cause oxidative stress. The purpose of this study was to analyse spermatozoa mtDNA 4977-bp deletion in infertile men with varicocele. To detect 4977-bp deletion in spermatozoa mtDNA, semen samples of 60 infertile patients with clinical varicocele and 90 normal men from northern Iran were prepared. After extraction of spermatozoa total DNA, Gap polymerase chain reaction (Gap PCR) was performed. 4977-bp deletion was observed in 81.66% of patients with varicocele, while approximately 15.55% of controls had this deletion. As spermatozoa from patients with varicocele had a high frequency of occurrence of 4977-bp deletion in mtDNA [OR = 24.18, 95% confidence interval (CI) = 10.15-57.57, P deletion in spermatozoa and cause infertility in north Iranian men. However, to determine the relation between sperm mtDNA 4977-bp deletion and varicocele-induced infertility, larger population-based studies are needed. It is concluded that there is an association between sperm mtDNA 4977-bp deletion and varicocele-induced infertility in the population studied. © 2013 Blackwell Verlag GmbH.

  2. Comparison of the reorganisations of BP and Shell and possible opportunities for Middle East and North African Oil companies

    Energy Technology Data Exchange (ETDEWEB)

    Jenkins, Gilbert

    1999-07-01

    A critical analysis is provided of the recent reorganisations of the downstream and petrochemical activities of BP and Shell. BP (or BP Amoco including Arco) and Shell are preparing for the next decade anticipating the environment and changing the companies to maximise their profitability in that environment. For the oil producing countries of the Middle East and North Africa (MENA), there are lessons to be learned both from the forecasts which BP Amoco and Shell are making and from the way these companies intend to operate. BP Amoco's view of oil refining is that the surplus capacity is endemic; Shell's view is that it is transient. BP Amoco will market oil products selectively across the world; Shell is still intent on a global approach. Both BP Amoco and Shell will minimise their wholesaling activities in the retail market and expand their merchandising with ever better quality sites. In the petrochemicals sector, the companies are taking similar actions, ie concentrating on positions of strength and selling business activities with low market shares or poor profitability. Petrochemical sites will be favoured when they have access to company produced hydrocarbon feedstocks. From the analysis, it is suggested that MENA oil companies will need to consider carefully the timing of any new refinery building. The reorganisation of the major OECD-based oil companies should offer opportunities for MENA companies to secure outlets for LPG and condensates, to form marketing alliances in OECD markets and to become involved in OECD-based petrochemical businesses.

  3. Comparison of the reorganisations of BP and Shell and possible opportunities for Middle East and North African Oil companies

    International Nuclear Information System (INIS)

    Jenkins, Gilbert

    1999-01-01

    A critical analysis is provided of the recent reorganisations of the downstream and petrochemical activities of BP and Shell. BP (or BP Amoco including Arco) and Shell are preparing for the next decade anticipating the environment and changing the companies to maximise their profitability in that environment. For the oil producing countries of the Middle East and North Africa (MENA), there are lessons to be learned both from the forecasts which BP Amoco and Shell are making and from the way these companies intend to operate. BP Amoco's view of oil refining is that the surplus capacity is endemic; Shell's view is that it is transient. BP Amoco will market oil products selectively across the world; Shell is still intent on a global approach. Both BP Amoco and Shell will minimise their wholesaling activities in the retail market and expand their merchandising with ever better quality sites. In the petrochemicals sector, the companies are taking similar actions, ie concentrating on positions of strength and selling business activities with low market shares or poor profitability. Petrochemical sites will be favoured when they have access to company produced hydrocarbon feedstocks. From the analysis, it is suggested that MENA oil companies will need to consider carefully the timing of any new refinery building. The reorganisation of the major OECD-based oil companies should offer opportunities for MENA companies to secure outlets for LPG and condensates, to form marketing alliances in OECD markets and to become involved in OECD-based petrochemical businesses

  4. Key Enablers of Effective Implementation of TQM in Royal Jet Airways

    Directory of Open Access Journals (Sweden)

    Moza Tahnoon Al Nahyan

    2017-01-01

    Full Text Available Total quality management (TQM is a unified management approach that concentrates on the consecutive improvement of processes, products, and methods to surpass client expectations. This paper aims to highlight the advantages of implementing TQM in the airline industry by examining the key enablers of TQM. This study was based on a research model including six factors that were found to have a profound influence in implementing TQM. The data needed for the study was collected with the aid of questionnaires and secondary sources. The study discovered that procedures, policies, and a culture of knowledge transfer were the most significant enablers of successful TQM initiatives in Royal Jet Airways. In order to effectively implement TQM, the study suggests that management should offer appropriate recognition and rewards to employees. This will motivate them to adopt and practice TQM initiatives. Apart from that, management should also arrange seminars or workshops to accustom the employees to the basic procedures and objectives of effective TQM.

  5. The Correspondence of Mary Stuart, Princess Royal and Princess of Orange (currently 352 letters)

    NARCIS (Netherlands)

    Huysman, E.C.M.

    2016-01-01

    Currently this catalogue contains the metadata for 352 letters, 273 of which are conserved in the Royal Collections at The Hague. The letters are written in German, French, and Dutch, and they date from 1641 to 1660. Mary’s outgoing letters are kept in a letter book which is held at the Dutch Royal

  6. Port Royal and the Seventeenth-Century Paradigm Shift in Language Teaching.

    Science.gov (United States)

    Benson, Malcolm J.

    2002-01-01

    Focuses on a scholarly, seventeenth century, religious society of Jansenists who founded the Port-Royal des Champs in Paris (France). States their writings and teachings were considered heretical. Finds Port-Royal's ideas later became popular culminating in the acceptance of Latin and language translation curricula. (KDR)

  7. Evaluation of royal jelly as an alternative to fetal bovine serum in cell ...

    African Journals Online (AJOL)

    Background: Royal jelly is a nutritious substance produced by the young nurse bees and contains significant amounts of proteins which are important for cell growth ... In the Alamar Blue assay, 0.156 and 0.078 mg/ml of royal jelly produced greater percentage of reduction at day 3 even though no significant difference was ...

  8. Improved ovulation rate and implantation in rats treated with royal jelly

    African Journals Online (AJOL)

    The ovaries and uteris of 12 mature female rats (Rattus norvegicus) were examined to determine the effect of commercial royal jelly on ovulation, ovarian weight and implantation rates. Rats were split in two groups of 6 each. Group one served as the treatment and group two the control. A daily dose of 25mg of royal jelly ...

  9. A STUDY ABOUT PHYSICOCHEMICAL COMPOSITION OF FRESH AND LYOPHILIZED ROYAL JELLY

    Directory of Open Access Journals (Sweden)

    OLIMPIA POPESCU

    2008-10-01

    Full Text Available This paper contents a summery about physicochemical composition of frash and lyophilized royal jelly. Royal jelly (RJ is a yellowish and creamy secretion from hypo pharyngeal and mandibular glands of young worker bees (Apis mellifera L. to feed all larvae for the first three days of their life and the queen bee for both her larval life and adulthood.. Royal jelly is a honey bee secretion that is used in the nutrition of the larvae. Queen bees are made, not born, and their feeding with royal jelly is the key to that process. The geographical authenticity of royal jelly can be determined also by pollen analysis (Ricciardelli d'Albore et al., 1978; Ricciardelli d'Albore, 1986. The physicochemical composition of pure royal jelly are analyzed by determining moisture, ash, lipids, proteins, carbohydrates, 10-HDA; and for lyophilized royal jelly are analyzed by determining ash, lipids, protein, carbohydrates, 10-HDA, sugars. 10-HDA content is the criteria of royal jelly quality analysis and it is a freshness parameter(Antinelli J.F., Sarah Zeggane, Renee Davico, Catherine Rognone, Jean Paul Faucon, Louisette Lizzani.

  10. 76 FR 33019 - Waiver of Restriction on Assistance to the Royal Government of Cambodia

    Science.gov (United States)

    2011-06-07

    ... DEPARTMENT OF STATE [Public Notice: 7491] Waiver of Restriction on Assistance to the Royal Government of Cambodia Pursuant to Section 7086(c)(2) of the Department of State, Foreign Operations, and... waive the requirements of Section 7086(c)(1) of the Act with respect to the Royal Government of Cambodia...

  11. The Relationship Between Soils and Foliar Nutrition For Planted Royal Paulownia

    Science.gov (United States)

    James E. Johnson; David O. Mitchem; Richard E. Kreh

    2002-01-01

    Royal paulownia is becoming an important hardwood plantation species in the southern U.S. A study was done to investigate two novel site preparation techniques for aiding the establishment of royal paulownia seedlings in the Virginia Piedmont. The effects of these treatments on the foliar nutrition of first year seedlings was determined, as was the relationship...

  12. Effect of different levels of royal jelly on biochemical parameters of ...

    African Journals Online (AJOL)

    This study aims to investigate the effects of different levels of royal jelly supplementation on biochemical parameters in swimmers. Randomly selected 40 male swimmers aged 18 to 25 years attending the same trainings were recruited. Swimmers were assigned to 4 groups each with 10 subjects. Varying amounts of royal ...

  13. Domingos Vandelli and the deficit in royal Portuguese treasury

    Directory of Open Access Journals (Sweden)

    Ricardo Dalla Costa

    2015-12-01

    Full Text Available This work aims to discuss the economic situation and policy recommendations of Vandelli to solve the difficulties in economic situation in Portugal at the end of seven hundred. Starting with a prior proposal for Vandelli on institutionalization of knowledge in Sciencia of Finance to further expose the difficulties in maintaining the Kingdom in not justifiable times as costly ordered and even military expenditures, investments in manufacturing, arts and science without there being at that time a real war economy. As a result, it failed to materialize the idea of a Portuguese Economic Society since it was transmuted into a Science Academy. With regard to the deficit in the Royal Treasury, there was an increase of Portuguese State spending concurrently with the drop in revenue from overseas, and finally opportunism behind the financial difficulties of the metropolis led Vandelli to do harsh criticism to financial managers and usurers who took advantage of an emblematic situation and suggest economic policies to balance public finances

  14. Conventual Writing and Context: The Case of Port-Royal

    Directory of Open Access Journals (Sweden)

    John J. Conley

    2018-03-01

    Full Text Available Many of the spiritual texts produced in the early modern period were written by nuns. To teach these texts adequately, it is not sufficient to study the work itself or the biography of the author. Effective exegesis of the texts requires detailed attention to the conventual culture in which these works were written, since this culture is foreign to the vast majority of contemporary students and readers. This contextual analysis operates on three levels. The first level introduces the students to the general nature of the convent and the life of a nun: the evangelical vows, the rule/constitution of the order, and the different types of religious orders. The second level focuses on the specific culture of the convent where the texts were composed. This involves analysis of the convent’s particular spirituality, apostolate, literary genres of communication, and relationship to broader ecclesiastical and political movements of the times. The third level studies the gendered nature of the nuns’ writings. This contextualist-cultural method of teaching écriture couventuelle is illustrated through analysis of the writings of the prolific Port-Royal abbess, Angélique de Saint-Jean Arnauld d’Andilly.

  15. Dietary patterns, nutrition knowledge and lifestyle: associations with blood pressure in a sample of Australian adults (the Food BP study).

    Science.gov (United States)

    Khalesi, S; Sharma, S; Irwin, C; Sun, J

    2016-10-01

    This study examined the association between dietary patterns, nutrition knowledge and lifestyle with blood pressure (BP) in a sample of Australian adults. Adults with normal and high BP were included in a cross-sectional study. Dietary intake data was collected using a Food Frequency Questionnaire. Nutrition knowledge and lifestyle surveys were included in the questionnaire. Dietary patterns were extracted using factor analysis followed by cluster analysis. Associations were analysed using logistic regression. Four hundred and seven participants were included. Three dietary patterns were identified: Western; Snack and alcohol; and Balanced. Participants with high BP had a higher intake of Western and a lower intake of Balanced dietary pattern. A significant and higher frequency of discretionary foods and oils consumption, as well as lower nutrition knowledge score and activity frequency, were observed in the high BP group. Regression analysis indicated that the intake of Western and Snack and alcohol dietary patterns increases the likelihood of having high BP by 2.40 (95% confidence interval (CI): 1.28-4.49) and 2.76 (95% CI: 1.52-5.00), respectively, when nutrition knowledge and lifestyle were controlled for as moderator variables. The likelihood of high BP was not associated with nutrition knowledge, but increased with physical inactivity. This study indicates that poor dietary patterns and inactivity are associated with increases in the likelihood of high BP, and the association is not influenced by nutrition knowledge. These findings indicate the importance of developing public health strategies with an emphasis on improving the dietary patterns of individuals to prevent and control high BP in Australian adults.

  16. Quality of royal jelly produced by Africanized honeybees fed a supplemented diet

    Directory of Open Access Journals (Sweden)

    Maria Josiane Sereia

    2013-06-01

    Full Text Available This study was carried out to evaluate the effect of artificial supplements prepared with soybean protein isolate, brewer's yeast, mixture of soybean protein isolate with brewer's yeast, linseed oil, palm oil, and a mixture of linseed oil with palm oil on the physicochemical and microbiological composition of royal jelly produced by Africanized honey bee colonies. Considering these results, providing supplements for Africanized honeybee colonies subjected to royal jelly production can help and strengthen the technological development of the Brazilian beekeeping industry increasing its consumption in the national market. This research presents values of royal jelly a little different from those established by the Brazilian legislation. This fact shows that is important to discuss or change the official method for royal jelly analysis. The characterization of physicochemical and microbiological parameters is important in order to standardize fresh, frozen, and lyophilized royal jelly produced by Africanized honeybees.

  17. Flamsteed's stars. New perspectives on the life and work of the first Astronomer Royal (1646 - 1719).

    Science.gov (United States)

    Willmoth, F.

    Contents: 1. Introduction: the King's "astronomical observer". 2. Flamsteed's career in astronomy: nobility, morality and public utility (J. Bennett). 3. Astronomy and strife: John Flamsteed and the Royal Society (M. Feingold). 4. Models for the practice of astronomy: Flamsteed, Horrocks and Tycho (F. Willmoth). 5. Flamsteed's optics and the identity of the astronomical observer (A. Johns). 6. Equipping an observatory: Flamsteed and Molyneux discuss an astronomical quadrant (H. Higton). 7. Mathematical characters: Flamsteed and Christ's Hospital Royal Mathematical School (R. Iliffe). 8. "Professor" John Flamsteed (I. G. Stewart). 9. Edmond Halley and John Flamsteed at the Royal Observatory (A. Cook). 10. A unique copy of Flamsteed's Historia coelestis (1712) (O. Gingerich). 11. "Labour harder than thrashing": John Flamsteed, property and intellectual labour in nineteenth-century England (W. J. Ashworth). 12. The Flamsteed papers in the archives of the Royal Greenwich Observatory. (A. Perkins). A summary catalogue of Flamsteed's papers in the Royal Greenwich Observatory archives (compiled by F. Willmoth).

  18. Assessing Specific Oligonucleotides and Small Molecule Antibiotics for the Ability to Inhibit the CRD-BP-CD44 RNA Interaction

    Science.gov (United States)

    Thomsen, Dana; Lee, Chow H.

    2014-01-01

    Studies on Coding Region Determinant-Binding Protein (CRD-BP) and its orthologs have confirmed their functional role in mRNA stability and localization. CRD-BP is present in extremely low levels in normal adult tissues, but it is over-expressed in many types of aggressive human cancers and in neonatal tissues. Although the exact role of CRD-BP in tumour progression is unclear, cumulative evidence suggests that its ability to physically associate with target mRNAs is an important criterion for its oncogenic role. CRD-BP has high affinity for the 3′UTR of the oncogenic CD44 mRNA and depletion of CRD-BP in cells led to destabilization of CD44 mRNA, decreased CD44 expression, reduced adhesion and disruption of invadopodia formation. Here, we further characterize the CRD-BP-CD44 RNA interaction and assess specific antisense oligonucleotides and small molecule antibiotics for their ability to inhibit the CRD-BP-CD44 RNA interaction. CRD-BP has a high affinity for binding to CD44 RNA nts 2862–3055 with a Kd of 645 nM. Out of ten antisense oligonucleotides spanning nts 2862–3055, only three antisense oligonucleotides (DD4, DD7 and DD10) were effective in competing with CRD-BP for binding to 32P-labeled CD44 RNA. The potency of DD4, DD7 and DD10 in inhibiting the CRD-BP-CD44 RNA interaction in vitro correlated with their ability to specifically reduce the steady-state level of CD44 mRNA in cells. The aminoglycoside antibiotics neomycin, paramomycin, kanamycin and streptomycin effectively inhibited the CRD-BP-CD44 RNA interaction in vitro. Assessing the potential inhibitory effect of aminoglycoside antibiotics including neomycin on the CRD-BP-CD44 mRNA interaction in cells proved difficult, likely due to their propensity to non-specifically bind nucleic acids. Our results have important implications for future studies in finding small molecules and nucleic acid-based inhibitors that interfere with protein-RNA interactions. PMID:24622399

  19. Phase 1 remedial investigation report for 200-BP-1 operable unit. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    1993-09-01

    The US Department of Energy (DOE) Hanford Site, in Washington State is organized into numerically designated operational areas including the 100, 200, 300, 400, 600, and 1100 Areas. The US Environmental Protection Agency (EPA), in November 1989 included the 200 Areas of the Hanford Site on the National Priority List (NPL) under the Comprehensive Environmental Response, Compensation and Liability Act of 1980 (CERCLA). Inclusion on the NPL initiated the remedial investigation (RD process for the 200-BP-1 operable unit. These efforts are being addressed through the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1989) which was negotiated and approved by the DOE, the EPA, and the State of Washington Department of Ecology (Ecology) in May 1989. This agreement, known as the Tri-Party Agreement, governs all CERCLA efforts at Hanford. In March of 1990, the Department of Energy, Richland Operations (DOE-RL) issued a Remedial Investigation/Feasibility Study (RI/FS) work plan (DOE-RL 1990a) for the 200-BP-1 operable unit. The work plan initiated the first phase of site characterization activities associated with the 200-BP-1 operable unit. The purpose of the 200-BP-1 operable unit RI is to gather and develop the necessary information to adequately understand the risks to human health and the environment posed by the site and to support the development and analysis of remedial alternatives during the FS. The RI analysis will, in turn, be used by Tri-Party Agreement signatories to make a risk-management-based selection of remedies for the releases of hazardous substances that have occurred from the 200-BP-1 operable unit.

  20. Phase 1 remedial investigation report for 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1993-09-01

    The US Department of Energy (DOE) Hanford Site, in Washington State is organized into numerically designated operational areas including the 100, 200, 300, 400, 600, and 1100 Areas. The US Environmental Protection Agency (EPA), in November 1989 included the 200 Areas of the Hanford Site on the National Priority List (NPL) under the Comprehensive Environmental Response, Compensation and Liability Act of 1980 (CERCLA). Inclusion on the NPL initiated the remedial investigation (RD process for the 200-BP-1 operable unit. These efforts are being addressed through the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1989) which was negotiated and approved by the DOE, the EPA, and the State of Washington Department of Ecology (Ecology) in May 1989. This agreement, known as the Tri-Party Agreement, governs all CERCLA efforts at Hanford. In March of 1990, the Department of Energy, Richland Operations (DOE-RL) issued a Remedial Investigation/Feasibility Study (RI/FS) work plan (DOE-RL 1990a) for the 200-BP-1 operable unit. The work plan initiated the first phase of site characterization activities associated with the 200-BP-1 operable unit. The purpose of the 200-BP-1 operable unit RI is to gather and develop the necessary information to adequately understand the risks to human health and the environment posed by the site and to support the development and analysis of remedial alternatives during the FS. The RI analysis will, in turn, be used by Tri-Party Agreement signatories to make a risk-management-based selection of remedies for the releases of hazardous substances that have occurred from the 200-BP-1 operable unit

  1. Antioxidant and protective effects of Royal jelly on histopathological changes in testis of diabetic rats

    Directory of Open Access Journals (Sweden)

    Elham Ghanbari

    2016-08-01

    Full Text Available Background: Diabetes is the most common endocrine disease. It has adverse effects on male reproductive function. Royal Jelly (RJ has antioxidant and anti-diabetic effects and show protective effects against diabetes. Objective: This study was conducted to evaluate the effect of RJ on histopathological alterations of the testicular tissue in streptozotocin (STZ-induced diabetic rats. Materials and Methods: In this experimental study, 28 adult Wistar rats were randomly divided into control (C, royal jelly (R, diabetic (D and RJ-treated diabetic (D+R groups. Diabetes was induced by a single intraperitoneal injection of STZ at 50 mg/kg body weight (BW. The rats from the R and D+R groups received daily RJ (100 mg/kg BW for 6 wks orally. Hematoxylin-Eosin staining was used to analyze histopathological changes including: tunica albuginea thickness (TAT, seminiferous tubules diameter (STsD, Johnsen’s score, tubular differentiation index (TDI, spermiogenesis index (SPI, Sertoli cell index (SCI, meiotic index (MI, and mononuclear immune cells (MICs in testes. The antioxidant status was examined by evaluating testicular levels of ferric reducing antioxidant power (FRAP and catalase (CAT activity. Results: Histological results of the testis from diabetic rats showed significant decrease in STsD, Johnsen’s score, TDI, SPI, SCI and MI, and significant increase in TAT and MICs, while administration of RJ significantly reverted these changes (p<0.05. RJ treatment markedly increased activity of CAT and FRAP. There were significant differences in FRAP levels among C (13.0±0.5, RJ (13.4±0.3, D (7.8±0.6 and D+R (12.4±0.7 groups (p<0.05. Conclusion: RJ improved diabetes-induced impairment in testis, probably through its antioxidant property.

  2. Preliminary Geological Findings on the BP-1 Simulant

    Science.gov (United States)

    Stoeser, D. B.; Rickman, D. L.; Wilson, S.

    2010-01-01

    A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.

  3. AcEST: BP919797 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C07 464 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C07. BP919797... CL111Contig1 Show BP919797 Clone id YMU001_000129_C07 Library YMU01 Length 464 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000129_C07. Accession BP919797 Tissue type prothallium Developmental stage...se cytoplasmic isozyme OS=Oryza sativa subsp. japonica Align length 97 Score (bit) 141.0 E-value 1.0e-33 Rep...nghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generat

  4. Concours annuels Academie Royale des Sciences d'Outre-mer

    Directory of Open Access Journals (Sweden)

    Royal Academy for Overseas Sciences

    2011-01-01

    Full Text Available Yearly competitions Royal Academy for Overseas Sciences. L'Organisation des Nations Unies, face aux inégalités croissantes a initié le processus des Objectifs du Millénaire pour le Développement (OMD qui doivent être réalisés d'ici 2015. L'atteinte des huit OMD devrait permettre de réduire la pauvreté et d'améliorer les conditions de vie des populations. L'élevage est pratiqué par une grande partie de la population mondiale surtout les plus pauvres. Il est pourvoyeur d'emplois et contribue à l'émancipation des femmes grâce aux revenus générés par la vente des produits animaux. Les animaux d'élevage sont également utilisés pour le transport et la culture attelée. La forte densité en nutriments des produits animaux en fait des aliments de choix pour améliorer l'état nutritionnel des enfants. La domestication des espèces animales sauvages et le développement de l'aquaculture contribuent à réduire les prélèvements dans la nature et à protéger la biodiversité. Le développement d'un élevage durable et raisonné peut donc positivement impacter plusieurs secteurs et doper la croissance économique des pays. Ce qui peut aider les pays en développement à se rapprocher des OMD d'ici 2015. La note présente également les pré-requis pour rendre effective la contribution de l'élevage aux.

  5. 200-BP-5 operable unit treatability test report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.

  6. Acute Toxicity and Ecological Risk Assessment of Benzophenone-3 (BP-3 and Benzophenone-4 (BP-4 in Ultraviolet (UV-Filters

    Directory of Open Access Journals (Sweden)

    Yang Du

    2017-11-01

    Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.

  7. Acute Toxicity and Ecological Risk Assessment of Benzophenone-3 (BP-3) and Benzophenone-4 (BP-4) in Ultraviolet (UV)-Filters.

    Science.gov (United States)

    Du, Yang; Wang, Wen-Qian; Pei, Zhou-Tao; Ahmad, Fahmi; Xu, Rou-Rou; Zhang, Yi-Min; Sun, Li-Wei

    2017-11-19

    Ultraviolet (UV)-absorbing chemicals (UV filters) are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3) and benzophenone-4 (BP-4) on Chlorella vulgaris , Daphnia magna , and Brachydanio rerio were analyzed in the present study. The EC 50 values (96 h) of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC 50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC 50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris , D. magna , and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10 -3 and 0.47 mg/L, respectively, by assessment factor (AF) method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.

  8. An aeolian sediment pulse at c. 28 kyr BP in southern Tasmania

    International Nuclear Information System (INIS)

    McIntosh, P.D.; Kiernan, K.; Price, D.M.

    2004-01-01

    Thick aeolian deposits are uncommon in Tasmania but a 7-m-thick aeolian deposit containing two stratigraphic breaks, including one palaeosol, occurs as a gully infill at Cradoc Hill, 5 km east of the lower Huon River floodplain in southern Tasmania. The deposit was sampled at six depths for dating by thermoluminescence (TL) techniques. The entire deposit gave TL ages in the range 25-32 kyr BP (mean 28 kyr BP). One date of 41.4 kyr BP was discounted as being probably erroneous. In contrast to loess deposits of similar thickness in New Zealand, which have been dated and correlated with entire glacial periods, the Cradoc Hill aeolian sediments are interpreted to have been deposited in two stages over a relatively short time. As the prevailing winds in the region are westerly, the aeolian material is presumed to be derived from the Huon River floodplain in the vicinity of Egg Island, when the floodplain was occupied by a braided river; some of the sand component may also have been derived from locally outcropping sandstone rocks. Aeolian sediments of this age have not previously been recognised in Tasmania. A significant climate event that might explain a short and intense period of river aggradation and aeolian sediment supply has not been noted in either the pollen or δ 18 O record. An alternative explanation for the erosion and subsequent aeolian deposition is that it resulted from natural or human-lit fires. Aboriginal settlement of Tasmania began around 35 kyr BP and the earliest recorded human settlement in the Huon catchment occurred at 28-29 kyr BP. A major erosion event in the mid-Huon Valley also occurred at about this time (27-29 kyr BP). Thus, Aboriginal settlement in the Huon catchment, erosion in the mid-Huon Valley, and deposition at Cradoc Hill are approximately contemporaneous. As older aeolian deposits are not present at Cradoc Hill, it is suggested that Aboriginal burning of vegetation rather than climatic influences may have caused both the middle

  9. Royal Jelly Inhibits Pseudomonas aeruginosa Adherence and Reduces Excessive Inflammatory Responses in Human Epithelial Cells

    Directory of Open Access Journals (Sweden)

    Heni Susilowati

    2017-01-01

    Full Text Available Pseudomonas aeruginosa is a Gram-negative bacterium and causes respiratory infection especially in elderly patients. Royal jelly has been used worldwide as a traditional remedy and as a nutrient; however, the effect against P. aeruginosa is unclear. The aim of this study was to analyze antibacterial, antiadherent, and anti-inflammatory effects of royal jelly against P. aeruginosa. Wild-type strain PAO1 and clinical isolates of P. aeruginosa were used for antibacterial assay and antiadherent assay to abiotic surface and epithelial cells, which are pharynx (Detroit 562 and lung (NCI-H292 epithelial cells. In anti-inflammatory assay, epithelial cells were pretreated with royal jelly before bacterial exposure to investigate its inhibitory effect on interleukin (IL-8 and macrophage inflammatory protein-3α/CCL20 overproduction. Although royal jelly did not have antibacterial activity at concentration of 50% w/v, antiadherent activity was confirmed on the abiotic surface and epithelial cells under concentration of 25%. Pretreatment with royal jelly significantly inhibited overproduction of IL-8 and CCL20 from both cells. These results demonstrated that royal jelly inhibits P. aeruginosa adherence and protects epithelial cells from excessive inflammatory responses against P. aeruginosa infection. Our findings suggested that royal jelly may be a useful supplement as complementary and alternative medicine for preventing respiratory infection caused by P. aeruginosa.

  10. Body-enlarging effect of royal jelly in a non-holometabolous insect species, Gryllus bimaculatus

    Directory of Open Access Journals (Sweden)

    Atsushi Miyashita

    2016-06-01

    Full Text Available Honeybee royal jelly is reported to have body-enlarging effects in holometabolous insects such as the honeybee, fly and silkmoth, but its effect in non-holometabolous insect species has not yet been examined. The present study confirmed the body-enlarging effect in silkmoths fed an artificial diet instead of mulberry leaves used in the previous literature. Administration of honeybee royal jelly to silkmoth from early larval stage increased the size of female pupae and adult moths, but not larvae (at the late larval stage or male pupae. We further examined the body-enlarging effect of royal jelly in a non-holometabolous species, the two-spotted cricket Gryllus bimaculatus, which belongs to the evolutionarily primitive group Polyneoptera. Administration of royal jelly to G. bimaculatus from its early nymph stage enlarged both males and females at the mid-nymph and adult stages. In the cricket, the body parts were uniformly enlarged in both males and females; whereas the enlarged female silkmoths had swollen abdomens. Administration of royal jelly increased the number, but not the size, of eggs loaded in the abdomen of silkmoth females. In addition, fat body cells were enlarged by royal jelly in the silkmoth, but not in the cricket. These findings suggest that the body-enlarging effect of royal jelly is common in non-holometabolous species, G. bimaculatus, but it acts in a different manner than in holometabolous species.

  11. Association of 25 bp deletion in MYBPC3 gene with left ventricle dysfunction in coronary artery disease patients.

    Directory of Open Access Journals (Sweden)

    Anshika Srivastava

    Full Text Available RATIONALE: Mutations in MYBPC3 encoding cardiac myosin binding protein C are common genetic cause of hereditary cardiac myopathies. An intronic 25-bp deletion in MYBPC3 at 3' region is associated with dilated (DCM and hypertrophic (HCM cardiomyopathies in Southeast Asia. However, the frequency of MYBPC3 25 bp deletion and associated clinical presentation has not been established in an unrelated cohort of left ventricular dysfunction (LVD secondary to coronary artery disease (CAD patients. OBJECTIVE: We sought to determine the role of MYBPC3 25 bp polymorphism on LVD in two cohorts of CAD patients. METHODS AND RESULTS: The study included 265 consecutive patients with angiographically confirmed CAD and 220 controls. MYBPC3 25 bp polymorphism was determined by polymerase chain reaction. Our results showed that carrier status of MYBPC3 25 bp deletion was associated with significant compromised left ventricle ejection fraction (LVEF ≤45 in CAD patients (p value  =  45 (p value  = 0.1; OR  = 2.3. CONCLUSION: The frequency of MYBPC3 DW genotype and D allele was associated with compromised LVEF implying that genetic variants of MYBPC3 encoding mutant structural sarcomere protein could increase susceptibility to left ventricular dysfunction. Therefore, 25 bp deletion in MYBPC3 may represent a genetic marker for cardiac failure in CAD patients from Southeast Asia.

  12. Cabinet chooses TNK-BP, but doors remain open

    Index Scriptorium Estoniae

    2005-01-01

    Leedu valitsus alustab Vene-Suurbritannia ühisfirmaga TNK-BP läbirääkimisi Mazeikiu Nafta aktsiaenamuse omandamiseks. Kuid samal ajal on võimalik alustada läbirääkimisi ka teiste võimalike investoritega

  13. PM : Cabinet likely to choose TNK-BP

    Index Scriptorium Estoniae

    2005-01-01

    Tõenäoliselt saab Mazeikiu Nafta aktsiate ostjaks Suurbritannia-Vene ettevõte TNK-BP. Endiselt soovib ka Leedu Jukose osa naftakompaniist osta, kuid selleks raha laenamine võib mõjutada riigi majandust ja üleminekut eurole

  14. Antiplasmodial Activity of Bp16524 and Su 2242 Against ...

    African Journals Online (AJOL)

    ... activity but was not effective against established infection. Significant (p<0.05) activity was observed in SU 2242 (both for early and established infections). Keywords: BP16524, SU 2242, Plasmodium berghei, early and established infections. West African Journal of Pharmacology and Drug Research Vol. 22/23 2007: pp.

  15. EST Table: BP123885 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123885 epV31590 10/09/28 57 %/174 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  16. EST Table: BP125106 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125106 fbpv0387 10/09/28 58 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/165 aa FBpp0212871|DsimGD14469-PA 10/08/28 n.h 10/09/1

  17. EST Table: BP123135 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123135 epV30626 10/09/28 55 %/243 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 51 %/241 aa FBpp0127246|DanaGF24054-PA 10/08/28 n.h 10/09/1

  18. EST Table: BP125521 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125521 fbpv0944 10/09/28 59 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/164 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  19. TopBP1-mediated DNA processing during mitosis.

    Science.gov (United States)

    Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H

    2016-01-01

    Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.

  20. EST Table: BP182279 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182279 NRPG0386 10/09/28 100 %/161 aa ref|NP_001040402.1| preimplantation protein... [Bombyx mori] gb|ABF51322.1| preimplantation protein [Bombyx mori] 10/08/29 87 %/162 aa FBpp0252287|DwilGK2

  1. EST Table: BP179826 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP179826 ovS307E02f 10/09/28 41 %/156 aa ref|XP_969699.1| PREDICTED: similar to fuzzy...-PA 10/09/10 41 %/156 aa gi|91081315|ref|XP_969699.1| PREDICTED: similar to fuzzy CG13396-PA [Tribolium castaneum] CK514734 ovS3 ...

  2. Note: Primer Amysat 001; Fragment size is 211bp

    Indian Academy of Sciences (India)

    Renuka

    Bhandara : Lanes 1–14 represent different strains of Bhandara Ecorace. Note: Primer Amysat 001; Fragment size is 211bp. Fig. 1. SSR profiles generated from genomic DNA of 16 strains from different individuals of (A.L, D. TV, D. BV, Modal, Sukinda, Raily, Bhandara) ecoraces of tasar silk worm, Antheraea mylitta using the.

  3. AcEST: BP914165 [AcEST

    Lifescience Database Archive (English)

    Full Text Available and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query=...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914165|Adiantum capillus-veneris mR..., and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of pro

  4. AcEST: BP912141 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Que...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912141|Adiantum capillus-veneris

  5. AcEST: BP921159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921159|Adiantum cap

  6. AcEST: BP921102 [AcEST

    Lifescience Database Archive (English)

    Full Text Available BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402.... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921102|Adiantum capillus-ven

  7. AcEST: BP914485 [AcEST

    Lifescience Database Archive (English)

    Full Text Available d PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= B...and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search progra...ms, Nucleic Acids Res. 25:3389-3402. Query= BP914485|Adiantum capillus-veneris mRNA

  8. AcEST: BP913047 [AcEST

    Lifescience Database Archive (English)

    Full Text Available generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913047|Adiantum ca...Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  9. AcEST: BP911682 [AcEST

    Lifescience Database Archive (English)

    Full Text Available eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911682|Adiantum cap...iller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs

  10. Treacher Collins Syndrome with a de Novo 5-bp Deletion in the TCOF1 Gene

    OpenAIRE

    Su, Pen-Hua; Chen, Jia-Yu; Chen, Suh-Jen; Yu, Ju-Shan

    2006-01-01

    Treacher Collins syndrome (TCS) is an autosomal dominant disorder of craniofacial development with features including malar hypoplasia, micrognathia, microtia, downward slanting palpebral fissures, lower eyelid coloboma, conductive hearing loss, and cleft palate. TCS is caused by mutations in the TCOF1 gene, which encodes the nuclear phosphoprotein treacle. Here, we describe a 1-day-old male infant with classical TCS presentation. A 5-bp deletion in exon 22 of the TCOF1 gene (3469del ACTCT) w...

  11. Identification of genes related to high royal jelly production in the honey bee (Apis mellifera) using microarray analysis

    OpenAIRE

    Nie, Hongyi; Liu, Xiaoyan; Pan, Jiao; Li, Wenfeng; Li, Zhiguo; Zhang, Shaowu; Chen, Shenglu; Miao, Xiaoqing; Zheng, Nenggan; Su, Songkun

    2017-01-01

    Abstract China is the largest royal jelly producer and exporter in the world, and high royal jelly-yielding strains have been bred in the country for approximately three decades. However, information on the molecular mechanism underlying high royal jelly production is scarce. Here, a cDNA microarray was used to screen and identify differentially expressed genes (DEGs) to obtain an overview on the changes in gene expression levels between high and low royal jelly producing bees. We developed a...

  12. Royal-Dutch Shell in Russia and Western Sanctions

    Directory of Open Access Journals (Sweden)

    Konstantin Kurilev

    2017-03-01

    Full Text Available This article reports on research based on three crucial aspects of the current global economic situation. First is the role of transnational corporations (TNCs in establishing and constructing international cooperation at the supranational level. Second is the policy of sanctions against Russia in connection with the situation in Ukraine. And third is the cooperation of Royal Dutch Shell with Russia’s Gazprom despite the political, economic and technological sanctions imposed on Russian companies and economic sectors.Analyzing Shell’s policy on the Russian energy market should reveal some kind of the managing principle that not only Shell but most TNCs follow in taking the political atmosphere into consideration, while striving to avoid any related restrictions. The research methodology uses analytical, ultimate analysis and functional methods. The analytical method helped to lay the theoretical foundation of the research. Modern TNCs are deeply engaged in the process of economic globalization. To expand their influence, such companies create economic conditions for organizing international production with local markets and for international markets for capital, labour, and scientific and consulting services. The ultimate analysis method revealed the following pattern: in struggling for the global market, TNCs raise the level of competition, which creates a permanent need for technical innovations and scientific progress. The functional analysis method demonstrated a casual relationship in modern economic development: by assisting capital turnover and labour and transport mobility, TNCs contribute significantly to economic growth and development. The first part of the article focuses on the history and methodology of the genesis and development of TNCs as actors in global economic relations. It also reviews the current role of TNCs in the global economy. The second part of the article examines the cooperation between Shell and Gazprom

  13. TeenBP: Development and Piloting of an EHR-Linked Clinical Decision Support System to Improve Recognition of Hypertension in Adolescents.

    Science.gov (United States)

    Kharbanda, Elyse O; Nordin, James D; Sinaiko, Alan R; Ekstrom, Heidi L; Stultz, Jerry M; Sherwood, Nancy E; Fontaine, Patricia L; Asche, Steve E; Dehmer, Steven P; Amundson, Jerry H; Appana, Deepika X; Bergdall, Anna R; Hayes, Marcia G; O'Connor, Patrick J

    2015-01-01

    Blood pressure (BP) is routinely measured in children and adolescents during primary care visits. However, elevated BP or hypertension is frequently not diagnosed or evaluated further by primary care providers. Barriers to recognition include lack of clinician buy-in, competing priorities, and complexity of the standard BP tables. We have developed and piloted TeenBP- a web-based, electronic health record (EHR) linked system designed to improve recognition of prehypertension and hypertension in adolescents during primary care visits. Important steps in developing TeenBP included the following: review of national BP guidelines, consideration of clinic workflow, engagement of clinical leaders, and evaluation of the impact on clinical sites. Use of a web-based platform has facilitated updates to the TeenBP algorithm and to the message content. In addition, the web-based platform has allowed for development of a sophisticated display of patient-specific information at the point of care. In the TeenBP pilot, conducted at a single pediatric and family practice site with six clinicians, over a five-month period, more than half of BPs in the hypertensive range were clinically recognized. Furthermore, in this small pilot the TeenBP clinical decision support (CDS) was accepted by providers and clinical staff. Effectiveness of the TeenBP CDS will be determined in a two-year cluster-randomized clinical trial, currently underway at 20 primary care sites. Use of technology to extract and display clinically relevant data stored within the EHR may be a useful tool for improving recognition of adolescent hypertension during busy primary care visits. In the future, the methods developed specifically for TeenBP are likely to be translatable to a wide range of acute and chronic issues affecting children and adolescents.

  14. The Royal College of Pathologists of Australasia Quality Assurance Program: Immunohistochemistry Breast Marker Audit Overview 2005-2015.

    Science.gov (United States)

    Haffajee, Zenobia Ayesha Mohamed; Kumar, Beena; Francis, Glenn; Peck, Martyn; Badrick, Tony

    2017-11-20

    The Royal College of Pathologists of Australasia Quality Assurance Program (RCPAQAP) Anatomical Pathology provides a comprehensive External Quality Assurance (EQA) exercise to review the reporting of immunohistochemistry (IHC) and in-situ hybridization (ISH) breast markers through an audit of clinical results. The aim of this exercise was to provide information regarding the quality of breast marker testing within clinical laboratories from 2005 to 2015. This comprehensive audit included estrogen, progesterone, and HER2 marker reporting. This was an important quality assurance activity established in response to ongoing difficulties experienced in laboratories in this area of testing.

  15. 26183 - Royal Decree 2519/1982 of 12 August approving the Regulations on Protection Against Ionizing Radiation

    International Nuclear Information System (INIS)

    1981-01-01

    This Royal Decree approves the Regulations on Protection against Ionizing Radiation. The purpose of the Regulations is to implement the radiation protection principles laid down in the framework Act on Nuclear Energy of 29th April 1964, as amended. They supersede all existing national rules in the same field and contain administrative and technical provisions governing nuclear and radioactive installations and activities, including the use of radiation-emitting equipment. They were made in compliance with the most recent international regulations on radiation protection and safety, in particular the Recommendations of the International Atomic Energy Agency (IAEA); the Regulations also take into account the recent Euratom Directives. (NEA) [fr

  16. Doctor William Gunn (1804-1890): From the South Pacific Islands to Chatham Royal Dockyard.

    Science.gov (United States)

    Biddle, Richard

    2016-11-24

    Doctor William Gunn had a long and varied career in the Royal Navy. After spending time on anti-slavery patrols along the west coast of Africa, he was posted to the south Pacific. At Pitcairn Island, he treated the inhabitants during an influenza epidemic, proving himself to be a determined and dedicated practitioner. Subsequently, he was appointed head of the medical department at Chatham Royal Dockyard (1859-1865), an appointment that coincided with the final stages of the Royal Navy's transition from sail and wood to steam and iron. The impact of these changes on the health of dockworkers was quickly felt at Chatham, and Gunn found himself in charge during the building of the first iron warship in a royal dockyard. His story thus offers a window through which to observe a practitioner confronting the health issues and medical uncertainties thrown up by technological change in the Victorian era. © The Author(s) 2016.

  17. 'Any style but gothic': Building a home for the Royal College of Physicians of Ireland.

    Science.gov (United States)

    Wheelock, H

    2016-06-01

    On 15 July 1864 the Royal College of Physicians of Ireland held its first business meeting in its newly built home at 6 Kildare Street, Dublin. Although the Royal College of Physicians of Ireland had been in existence for over 200 years this was the first occasion that a College meeting had been held in a building owned by the College. This paper looks at the history behind the construction of a home for the Royal College of Physicians of Ireland. It will examine why it took over 200 years for the Physicians to find a permanent home, how they ended up with the building they did, and what they borrowed from the Royal College of Physicians in Edinburgh in the process.

  18. Development of an Information Security Awareness Training Program for the Royal Saudi Naval Forces (RSNF)

    National Research Council Canada - National Science Library

    Alageel, Sami

    2003-01-01

    The Royal Saudi Naval Forces (RSNF) are vulnerable to the same kinds of threats to its information infrastructure as the rest of the industrialized nations, As an officer in the RSNF, I am familiar with the special information...

  19. Royal Service on Eesti mainekaim üritusturundusfirma / Eda-Liis Kann

    Index Scriptorium Estoniae

    Kann, Eda-Liis, 1979-

    2005-01-01

    Turu-uuringute AS-i korraldatud üritusturunduse ettevõtete maineuuringust selgus, et kõige mainekamad Eestis on Royal Service, Event Masters, Broadline ja Sinine Elevant. Kõige madalama mainega on Tequila

  20. Presence of women in Royal Economic Society of Friends of the Country (1775-1808

    Directory of Open Access Journals (Sweden)

    María Consolación Calderón España

    2010-11-01

    Full Text Available In this work we present the performance of women in the work of the Royal Economic Society of Friends of the Country, institutions of the eighteenth century who sought to lift the economy of Spain in that century. Women’s participation in the Royal Economic So- ciety was carried out by the Boards of Damas and supervisory work of the Schools «patriotism» and the first letters. The first schools to be named, according to Campomanes conceived of yarn and fabric and should be established in major cities throughout the kingdom. Participation in the Royal Economic Society from all social classes and genders with equal rights, was a fact. There is no comprehensive study on all of the Royal Economic Society of Friends of the Country, therefore there is no one on women in one way or another took part in them. With this work we present the work done by some.

  1. BP-5 Remedial Investigation Slug-Test Characterization Results for Well 699-52-55A

    Energy Technology Data Exchange (ETDEWEB)

    Newcomer, Darrell R.

    2008-07-21

    Pacific Northwest National Laboratory conducted slug-test characterization at the final, completed BP-5 Remedial Investigation well 699-52-55A near the 200-East Area at the Hanford Site on April 22, 2008. The slug-test characterization was in support of the BP-5 Remedial Investigation. The portion of the unconfined aquifer tested is composed of sediments of the lower Ringold Formation and the underlying Elephant Mountain basalt flowtop. The basalt flowtop unit was included as part of the effective test-interval length for the slug-test analysis because the flowtop unit is hydraulically communicative with the unconfined aquifer. Estimates of hydraulic conductivity for the effective test-interval length represent composite values for the lower Ringold Formation and the underlying Elephant Mountain basalt flow top.

  2. On-line dynamic monitoring automotive exhausts: using BP-ANN for distinguishing multi-components

    Science.gov (United States)

    Zhao, Yudi; Wei, Ruyi; Liu, Xuebin

    2017-10-01

    Remote sensing-Fourier Transform infrared spectroscopy (RS-FTIR) is one of the most important technologies in atmospheric pollutant monitoring. It is very appropriate for on-line dynamic remote sensing monitoring of air pollutants, especially for the automotive exhausts. However, their absorption spectra are often seriously overlapped in the atmospheric infrared window bands, i.e. MWIR (3 5μm). Artificial Neural Network (ANN) is an algorithm based on the theory of the biological neural network, which simplifies the partial differential equation with complex construction. For its preferable performance in nonlinear mapping and fitting, in this paper we utilize Back Propagation-Artificial Neural Network (BP-ANN) to quantitatively analyze the concentrations of four typical industrial automotive exhausts, including CO, NO, NO2 and SO2. We extracted the original data of these automotive exhausts from the HITRAN database, most of which virtually overlapped, and established a mixed multi-component simulation environment. Based on Beer-Lambert Law, concentrations can be retrieved from the absorbance of spectra. Parameters including learning rate, momentum factor, the number of hidden nodes and iterations were obtained when the BP network was trained with 80 groups of input data. By improving these parameters, the network can be optimized to produce necessarily higher precision for the retrieved concentrations. This BP-ANN method proves to be an effective and promising algorithm on dealing with multi-components analysis of automotive exhausts.

  3. Bcl3-dependent stabilization of CtBP1 is crucial for the inhibition of apoptosis and tumor progression in breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hee June; Lee, Ji Min; Kim, Hyunkyung; Nam, Hye Jin; Shin, Hi-Jai R.; Kim, Dongha [Department of Biological Sciences, Creative Research Initiative Center for Chromatin Dynamics, Seoul National University, Seoul 151-742 (Korea, Republic of); Ko, Enyoung; Noh, Dong-Young [Department of Surgery and Cancer Research Institute, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Kim, Keun Il [Department of Biological Sciences, Sookmyung Women' s University, Seoul 140-742 (Korea, Republic of); Kim, Jung Hwa [Department of Medical Sciences, Inha University, Incheon 402-751 (Korea, Republic of); Baek, Sung Hee, E-mail: sbaek@snu.ac.kr [Department of Biological Sciences, Creative Research Initiative Center for Chromatin Dynamics, Seoul National University, Seoul 151-742 (Korea, Republic of)

    2010-09-24

    Research highlights: {yields} CtBP1 as a new binding partner of Bcl3. {yields} Bcl3 stabilizes CtBP1 by inhibiting ubiquitination of CtBP1. {yields} Bcl3 antagonizes CtBP1-mediated apoptotic responses. {yields} Positive correlation between increased Bcl3 and CtBP1 protein levels in breast cancer tissues. -- Abstract: B-cell lymphoma 3 (Bcl3) is a proto-oncogene upregulated in a wide range of cancers, including breast cancer. Although Bcl3 is known to promote cell proliferation and inhibit apoptosis, the molecular mechanisms underlying the proto-oncogenic function of Bcl3 have not been completely elucidated. To gain insight into the oncogenic role of Bcl3, we applied a proteomic approach, which led to the identification of C-terminal binding protein 1 (CtBP1) as a binding partner of Bcl3. A PXDLS/R motif embedded in Bcl3 was found to mediate the interaction between Bcl3 and CtBP1, which caused the stabilization of CtBP1 by blocking proteasome-dependent degradation. Apoptotic stimuli-induced degradation of CtBP1 was significantly abolished by the upregulation of Bcl3, leading to the sustained repression of pro-apoptotic gene expression and subsequent inhibition of apoptosis. Intriguingly, a strong positive correlation between the protein levels of Bcl3 and CtBP1 was detected in breast cancer patient samples. Our study reveals a novel combinatorial role for Bcl3 and CtBP1, providing an explanation for the acquisition of resistance to apoptosis in cancer cells, which is a major requirement for cancer development.

  4. The Acoustics of the Double Elliptical Vault of the Royal Palace of Caserta (Italy

    Directory of Open Access Journals (Sweden)

    Umberto Berardi

    2017-03-01

    Full Text Available This work investigates the acoustic characteristics of the double elliptical vault, which overlooks the Grand Staircase of the Royal Palace of Caserta (Italy. The Royal Palace was built by the architect Luigi Vanvitelli in the Seventeenth Century and it is the largest royal building in Italy. The double elliptical vault presents a great scenography effect. Inside the vault, on the planking level, musicians used to play for the king and his guests when the royal procession, going up the grand staircase, entered the royal apartments, creating astonishment among the guests who heard the music without understanding from where it was coming. Since the musicians were inside the vault, the long reverberation made the listeners perceive the vault to be enveloped by the music. To investigate this effect, the acoustic characteristics of the double vault were measured, putting the sound source on the planking level of the vault, while the microphones were put along the staircase and in the vestibule towards the royal apartments. Finally, the spatial distribution of several acoustic parameters is evaluated also using architectural acoustic simulations.

  5. Effect of Honey and Royal Jelly against Cisplatin-Induced Nephrotoxicity in Patients with Cancer.

    Science.gov (United States)

    Osama, Hasnaa; Abdullah, Aya; Gamal, Bassma; Emad, Dina; Sayed, Doha; Hussein, Eman; Mahfouz, Eman; Tharwat, Joy; Sayed, Sally; Medhat, Shrouk; Bahaa, Treza; Abdelrahim, Mohamed E A

    2017-07-01

    Cisplatin constitutes one of the most potent antineoplastic drugs; however, nephrotoxicity limited its eligibility for optimal clinical use. This study was designed to evaluate the role of honey and royal jelly with antioxidant properties in the protection of cisplatin-induced acute kidney injury in patients with cancer. Patients with cancer assigned for cisplatin chemotherapy were randomly divided into bee honey and royal jelly groups pretreated before the initiation and during cisplatin chemotherapeutic regimen and control group on cisplatin only. Serum creatinine and urea levels were measured before and after the chemotherapeutic cycle and over 2 cycles. Patients on crude bee honey and royal jelly capsules showed lower serum levels of renal injury products (creatinine and urea) compared to those in the control group. The changes in kidney parameters were significantly (p cisplatin treatment. Royal jelly was found to be effective; however, the difference in creatinine and urea levels before and after chemotherapy was not statistically significant. The use of bee honey and royal jelly as natural compounds is effective in reducing cisplatin nephrotoxicity and may offer a promising chance for clinically meaningful prevention. This study has potentially important implications for the treatment of cisplatin kidney side effects and is considered to be the first to investigate this effect of honey and royal jelly in human subjects. However, due to its small sample size, we recommend further investigation using a larger sample size.

  6. BP-Mobil partnership. The common network takes place

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    After the partnership between BP and Mobil was signed, the program of transformation of the petrol stations network started in November 1996 in the UK and concern 3300 stations in Europe and 800 stations in France. About 9100 stations will be transformed by the end of 1998. BP France is the operator for petroleum products (petrol, fuel, bitumens, LPG..) with a 70% share holding (30% for Mobil) while Mobil is the major shareholder (51%) for the lubricants and special products activities. The chemical, aviation nd maritime activities are not concerned. Thanks to the fusion of their down-file activities in Europe, the benefits of the partnership should reach 600 to 700 million of US Dollars each year. However the restructuring cost should reach 740 millions of US Dollars in two years, which doubles the initial estimation. Short paper. (J.S.)

  7. CtBP1/BARS is an activator of phospholipase D1 necessary for agonist-induced macropinocytosis.

    Science.gov (United States)

    Haga, Yuki; Miwa, Noriko; Jahangeer, Saleem; Okada, Taro; Nakamura, Shun-ichi

    2009-05-06

    Vesicular trafficking such as macropinocytosis is a dynamic process that requires coordinated interactions between specialized proteins and lipids. A recent report suggests the involvement of CtBP1/BARS in epidermal growth factor (EGF)-induced macropinocytosis. Detailed mechanisms as to how lipid remodelling is regulated during macropinocytosis are still undefined. Here, we show that CtBP1/BARS is a physiological activator of PLD1 required in agonist-induced macropinocytosis. EGF-induced macropinocytosis was specifically blocked by 1-butanol but not by 2-butanol. In addition, stimulation of cells by serum or EGF resulted in the association of CtBP1/BARS with PLD1. Finally, CtBP1/BARS activated PLD1 in a synergistic manner with other PLD activators, including ADP-ribosylation factors as demonstrated by in vitro and intact cell systems. The present results shed light on the molecular basis of how the 'fission protein' CtBP1/BARS controls vesicular trafficking events including macropinocytosis.

  8. Validation of the Welch Allyn SureBP (inflation) and StepBP (deflation) algorithms by AAMI standard testing and BHS data analysis.

    Science.gov (United States)

    Alpert, Bruce S

    2011-04-01

    We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.

  9. Bank Organizational Structure Choice Dilemma. Case of PKO BP

    Directory of Open Access Journals (Sweden)

    Adam Szafarczyk

    2008-06-01

    Full Text Available Organizational structures are differing for different banks. They depend on individual bank economic situation, its technology, strategy and form of competition struggle. Usually the biggest EU banks are consists from formally or really independent divisions. The most common divisions are Retail Banking, Corporate Banking, Treasury and Investment, sometimes Insurance. PKO BP, the biggest Polish Bank, ought to change its structure due to implementation new IT system.

  10. EST Table: BP125370 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 10 56 %/150 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] FS906662 fbpv ... ...n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 55...BP125370 fbpv0758 10/09/28 56 %/150 aa ref|XP_967018.2| PREDICTED: similar to resti

  11. AcEST: BP921126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query=...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921126|Adiantum capillus-veneris mR...g, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of pro

  12. Demographic rates of northern royal albatross at Taiaroa Head, New Zealand.

    Science.gov (United States)

    Richard, Yvan; Perriman, Lyndon; Lalas, Chris; Abraham, Edward R

    2015-01-01

    Demographic rates, such as annual survival rate, are generally difficult to estimate for long-lived seabirds, because of the length of time required for this kind of study and the remoteness of colonies. However, a small colony of northern royal albatross (Diomedea sanfordi) established itself on the mainland of New Zealand at Taiaroa Head, making possible regular banding and monitoring of its individuals since the first chick fledged, in 1938. Data on the presence/absence of birds, as well as on breeding outcomes, were available for the period from 1989-90 to 2011-12, and included 2128 annual resightings of 355 banded individuals of known age. The main goal of the present study was to estimate the annual survival rate of juveniles, pre-breeders, and adults at Taiaroa Head. These rates were estimated simultaneously in a single Bayesian multi-state capture-recapture model. Several models were fitted to the data, with different levels of complexity. From the most parsimonious model, the overall annual adult survival rate was estimated as 0.950 (95% CI [0.941-0.959]). In this model, adult survival declined with age, from 0.976 (95% CI [0.963-0.988]) at 6 years, the minimum age at first breeding, to 0.915 (95% CI [0.879-0.946]) at 40 years. Mean annual survival of pre-breeders was 0.966 (95% CI [0.950-0.980]), and 0.933 (95% CI [0.908-0.966]) for juveniles. There was no discernible difference in survival between males and females, and there was no apparent trend in survival over time. Estimates of other demographic rates were also obtained during the estimation process. The mean age at first return of juveniles to the colony was estimated as 4.8 years (95% CI [4.6-5.1]), and the mean age at first breeding as 8.9 years (95% CI [8.5-9.3]). Because all the birds of the colony were banded, it was possible to estimate the total population size. The number of northern royal albatross present annually at the Taiaroa Head colony has doubled since 1989-90, and the current total

  13. Demographic rates of northern royal albatross at Taiaroa Head, New Zealand

    Directory of Open Access Journals (Sweden)

    Yvan Richard

    2015-04-01

    Full Text Available Demographic rates, such as annual survival rate, are generally difficult to estimate for long-lived seabirds, because of the length of time required for this kind of study and the remoteness of colonies. However, a small colony of northern royal albatross (Diomedea sanfordi established itself on the mainland of New Zealand at Taiaroa Head, making possible regular banding and monitoring of its individuals since the first chick fledged, in 1938. Data on the presence/absence of birds, as well as on breeding outcomes, were available for the period from 1989–90 to 2011–12, and included 2128 annual resightings of 355 banded individuals of known age. The main goal of the present study was to estimate the annual survival rate of juveniles, pre-breeders, and adults at Taiaroa Head. These rates were estimated simultaneously in a single Bayesian multi-state capture-recapture model. Several models were fitted to the data, with different levels of complexity. From the most parsimonious model, the overall annual adult survival rate was estimated as 0.950 (95% CI [0.941–0.959]. In this model, adult survival declined with age, from 0.976 (95% CI [0.963–0.988] at 6 years, the minimum age at first breeding, to 0.915 (95% CI [0.879–0.946] at 40 years. Mean annual survival of pre-breeders was 0.966 (95% CI [0.950–0.980], and 0.933 (95% CI [0.908–0.966] for juveniles. There was no discernible difference in survival between males and females, and there was no apparent trend in survival over time. Estimates of other demographic rates were also obtained during the estimation process. The mean age at first return of juveniles to the colony was estimated as 4.8 years (95% CI [4.6–5.1], and the mean age at first breeding as 8.9 years (95% CI [8.5–9.3]. Because all the birds of the colony were banded, it was possible to estimate the total population size. The number of northern royal albatross present annually at the Taiaroa Head colony has doubled since

  14. The Royal Courts of Equity in England in the 16-17 centuries.

    Directory of Open Access Journals (Sweden)

    Ilya Strizhakov

    2017-01-01

    Full Text Available УДК 340.15The subject of research are the courts of England in 16-17 centuries.The purpose of article is to answer the question which courts must be included to a number of "courts of equity".Methodology. Historical analysis of the scientific literature, of the English legislation and judicial practice of the 16-17 centuries.Results. The priority for the Court of Star Chamber was to protect the interests of Royal power and not the rights of people. Moreover, this court did not seek to bridge the gaps of common law. In this regard, his reference to the number of “courts of equity” is incorrect.Star Chamber had a close relationship with the Privy Council. There were no clear boundaries between them during the XVI century. The Star Chamber was the emergency Committee of the Privy CouncilThe purpose of the Court of Requests was to ease social tensions, to create the impression of caring filed emanating from the monarch and the nobility.Despite the fact that the Court of the Requests was conceived as "a court for poor people", it became popular wealthy people under the rule Henry VIII.The Court of High Commission was a court focused on the strengthening of Royal power. In its activities it has been focused on improving the rights of the Kingdom.The Court of Exchequer provided judicial protection for some types of transactions that are not recognized by the common law. In this it is similar to the Chancery Court. Initially, the Court of the Exchequer has been focused on protecting the interests of the crown. Therefore, the function to eliminate the gaps of the common law could not be implemented in full.The Chancery Court, unlike the special courts were required to consider complaints coming from citizens about the inability to get a fair trial.Conclusions. The criteria for judicial institutions to be considered as “courts of equity” are: the purpose of the establishment of the court was to fill gaps in the common law; interference with the

  15. Royal Australian and New Zealand College of Psychiatrists clinical practice guidelines for mood disorders.

    Science.gov (United States)

    Malhi, Gin S; Bassett, Darryl; Boyce, Philip; Bryant, Richard; Fitzgerald, Paul B; Fritz, Kristina; Hopwood, Malcolm; Lyndon, Bill; Mulder, Roger; Murray, Greg; Porter, Richard; Singh, Ajeet B

    2015-12-01

    To provide guidance for the management of mood disorders, based on scientific evidence supplemented by expert clinical consensus and formulate recommendations to maximise clinical salience and utility. Articles and information sourced from search engines including PubMed and EMBASE, MEDLINE, PsycINFO and Google Scholar were supplemented by literature known to the mood disorders committee (MDC) (e.g., books, book chapters and government reports) and from published depression and bipolar disorder guidelines. Information was reviewed and discussed by members of the MDC and findings were then formulated into consensus-based recommendations and clinical guidance. The guidelines were subjected to rigorous successive consultation and external review involving: expert and clinical advisors, the public, key stakeholders, professional bodies and specialist groups with interest in mood disorders. The Royal Australian and New Zealand College of Psychiatrists clinical practice guidelines for mood disorders (Mood Disorders CPG) provide up-to-date guidance and advice regarding the management of mood disorders that is informed by evidence and clinical experience. The Mood Disorders CPG is intended for clinical use by psychiatrists, psychologists, physicians and others with an interest in mental health care. The Mood Disorder CPG is the first Clinical Practice Guideline to address both depressive and bipolar disorders. It provides up-to-date recommendations and guidance within an evidence-based framework, supplemented by expert clinical consensus. Professor Gin Malhi (Chair), Professor Darryl Bassett, Professor Philip Boyce, Professor Richard Bryant, Professor Paul Fitzgerald, Dr Kristina Fritz, Professor Malcolm Hopwood, Dr Bill Lyndon, Professor Roger Mulder, Professor Greg Murray, Professor Richard Porter and Associate Professor Ajeet Singh. Professor Carlo Altamura, Dr Francesco Colom, Professor Mark George, Professor Guy Goodwin, Professor Roger McIntyre, Dr Roger Ng

  16. Looking back at the John Mitchell Crouch Fellowship: the most prestigious research award of the Royal Australasian College of Surgeons.

    Science.gov (United States)

    Boult, Margaret; Babidge, Wendy; Pleass, Susan; Scott, David

    2015-10-01

    The John Mitchell Crouch Fellowship is a generous endowment made to the Royal Australasian College of Surgeons (RACS) by the young neurosurgeon's family, following his death from a brain tumour. In this article, we examine the significance and legacy of the grant since its inception in 1979. This is the highest level of research fellowship awarded by the RACS recognizing early career excellence, as part of its significant research funding programme (over $1.7 million in 2015). John Mitchell Crouch recipients have been pioneers in various areas of medicine where they have developed new technologies, established research centres, improved patient safety and military surgery and embraced evidence-based medicine. The funds they received have directly contributed to research published in numerous highly respected peer-reviewed journals such as The New England Journal of Medicine; established new laboratories, helped fund clinical trials and allowed new directions of research to be pursued. Recipients of the John Mitchell Crouch Fellowship have been recognized with many awards including 11 Australian and New Zealand Honours to date. Many other significant research funds have been subsequently bestowed, including over 120 National Health Medical Research Council (NHMRC) grants to Australian and New Zealand recipients subsequent to their Fellowship. This article also shows the range of disciplines in which the award has supported cutting-edge research leading to benefits for patients and health care. © 2015 Royal Australasian College of Surgeons.

  17. Association between interleukin 1 receptor antagonist gene 86-bp VNTR polymorphism and sepsis: a meta-analysis.

    Science.gov (United States)

    Fang, Fang; Pan, Jian; Li, Yiping; Xu, Lixiao; Su, Guanghao; Li, Gang; Wang, Jian

    2015-01-01

    Many studies have focused on the relationship between interleukin 1 receptor antagonist (IL1RN) gene 86-bp VNTR polymorphism and sepsis, but the results remain inconsistent. Thus, a meta-analysis was carried out to derive a more precise estimation of the association between IL1RN 86-bp VNTR polymorphism and risk of sepsis and sepsis-related mortality. Relevant publications were searched in several widely used databases and six eligible studies were included in the meta-analysis. Pooled odds ratios (ORs) and 95% confidence intervals (CIs) were calculated to evaluate the strength of the association between IL1RN 86-bp VNTR polymorphism and risk of sepsis and sepsis-related mortality. Significant associations between IL1RN 86-bp VNTR polymorphism and sepsis risk were observed in both overall meta-analysis for L2 versus 22 (OR=0.75, 95% CI=0.59-0.94) and severe sepsis subgroup for LL+L2 versus 22 (OR=0.67, 95% CI=0.47-0.93). L stands for long alleles containing three to six repeats; 2 stands for short allele containing two repeats. However, no significant sepsis mortality variation was detected for all genetic models. According to the results of our meta-analysis, the IL1RN 86-bp VNTR polymorphism probably associates with sepsis risk but not with sepsis-related mortality. Copyright © 2014. Published by Elsevier Inc.

  18. Tracheostomy decannulation at the Royal Hospital for Sick Children in Glasgow: Predictors of success and failure.

    Science.gov (United States)

    Beaton, Fiona; Baird, Tracy-Anne; Clement, W Andrew; Kubba, Haytham

    2016-11-01

    Tracheostomy techniques, indications and care are extensively covered in the literature. However, little is written about the process of removing the tracheostomy tube. At the Royal Hospital for Sick Children in Glasgow we use a stepwise ward-based protocol for safe tracheostomy decannulation. Our aim therefore was to review all the paediatric tracheostomy decannulations that we attempted over the last 3 years to evaluate our protocol, to determine our success rate and to see whether any modifications to the protocol are required. We reviewed all patients who had undergone ward decannulation between January 2012 and May 2015. We extracted data from clinical records including patient characteristics, indications for tracheostomy, timing of decannulation and success or failure of the process. The 45 children in the study underwent 57 attempts at decannulation during the study period. 25 were male (56%) and 20 were female (44%), and they were aged between 1 day and 16 years 6 months at the time of the original tracheostomy operation. 33 attempts were successful (58%). 10 children had more than one attempt at decannulation. Children were found to fail at every stage of the protocol, with the commonest point of failure being day 2 when the tracheostomy tube was capped. We have demonstrated that our current protocol for ward decannulation is effective and safe, and that all five days of the protocol are required. Crown Copyright © 2016. Published by Elsevier Ireland Ltd. All rights reserved.

  19. The nuclear engineering programmes at the Royal Military College of Canada. Part I

    International Nuclear Information System (INIS)

    Bonin, H.W.

    2002-01-01

    The last years have been eventful for the staff and students in the nuclear engineering programmes at the Royal Military College of Canada (RMC) in Kingston, Ontario. Among the several changes is the accessibility of the graduate programmes to civilian (Canadian citizens) students, a fact that is little known outside RMC since, in the past, these graduate programmes were intended only for military personnel. Another major event is the accreditation of the graduate programmes offered by the Department of Chemistry and Chemical Engineering(chemical, nuclear and environmental science and engineering) by the Ontario Council of Graduate Studies. The teaching and research staff share the following research areas: radiochemistry and neutron activation analysis, radiation effects on materials, radiation processing of polymers, neutron radiography, nuclear reactor simulation, analysis and design, CANDU fuel bundle optimal design, nuclear fuel cycles and management, nuclear fuel engineering and behaviour, including fission product release modelling, artificial intelligence applications to nuclear systems, nuclear accident response, nuclear radiation detection and measurement, health physics, dosimetry and radiation protection and nuclear reactor control

  20. The nuclear engineering programmes at the Royal Military College of Canada. Part I

    Energy Technology Data Exchange (ETDEWEB)

    Bonin, H.W. [Royal Military College of Canada, Dept. of Chemistry and Chemical Engineering, Kingston, Ontario (Canada)

    2002-05-01

    The last years have been eventful for the staff and students in the nuclear engineering programmes at the Royal Military College of Canada (RMC) in Kingston, Ontario. Among the several changes is the accessibility of the graduate programmes to civilian (Canadian citizens) students, a fact that is little known outside RMC since, in the past, these graduate programmes were intended only for military personnel. Another major event is the accreditation of the graduate programmes offered by the Department of Chemistry and Chemical Engineering(chemical, nuclear and environmental science and engineering) by the Ontario Council of Graduate Studies. The teaching and research staff share the following research areas: radiochemistry and neutron activation analysis, radiation effects on materials, radiation processing of polymers, neutron radiography, nuclear reactor simulation, analysis and design, CANDU fuel bundle optimal design, nuclear fuel cycles and management, nuclear fuel engineering and behaviour, including fission product release modelling, artificial intelligence applications to nuclear systems, nuclear accident response, nuclear radiation detection and measurement, health physics, dosimetry and radiation protection and nuclear reactor control.

  1. Private finance initiative hospital architecture: towards a political economy of the Royal Liverpool University Hospital.

    Science.gov (United States)

    Jones, Paul

    2018-02-01

    Sociological analysis has done much to illuminate the architectural contexts in which social life takes place. Research on care environments suggests that the built environment should not be understood as a passive backdrop to healthcare, but rather that care is conditioned by the architecture in which it happens. This article argues for the importance of going beyond the hospital walls to include the politics that underwrite the design and construction of hospital buildings. The article assesses the case of the yet-to-be-realised Liverpool Royal University Hospital, and the private finance initiative (PFI) funding that underpins the scheme, which is suggested as a salient 'external' context for understanding architecture's role in the provision of healthcare of many kinds for many years to come. PFI has major implications for democratic accountability and local economy, as well as for the architecture of the hospital as a site of care. Critical studies can illuminate these paradoxically visible-but-opaque hospital spaces by going beyond that which is immediately empirically evident, so as to reveal the ways in which hospital architecture is conditioned by political and economic forces. © 2018 Foundation for the Sociology of Health & Illness.

  2. The Lyophilization Process Maintains the Chemical and Biological Characteristics of Royal Jelly

    Directory of Open Access Journals (Sweden)

    Andresa Piacezzi Nascimento

    2015-01-01

    Full Text Available The alternative use of natural products, like royal jelly (RJ, may be an important tool for the treatment of infections caused by antibiotic-resistant bacteria. RJ presents a large number of bioactive substances, including antimicrobial compounds. In this study, we carried out the chemical characterization of fresh and lyophilized RJ and investigated their antibacterial effects with the purpose of evaluating if the lyophilization process maintains the chemical and antibacterial properties of RJ. Furthermore, we evaluated the antibacterial efficacy of the main fatty acid found in RJ, the 10-hydroxy-2-decenoic acid (10H2DA. Chromatographic profile of the RJ samples showed similar fingerprints and the presence of 10H2DA in both samples. Furthermore, fresh and lyophilized RJ were effective against all bacteria evaluated; that is, the lyophilization process maintains the antibacterial activity of RJ and the chemical field of 10H2DA. The fatty acid 10H2DA exhibited a good antibacterial activity against Streptococcus pneumoniae. Therefore, it may be used as an alternative and complementary treatment for infections caused by antibiotic-resistant S. pneumoniae.

  3. Noise exposure and cognitive performance: A study on personnel on board Royal Norwegian Navy vessels

    Directory of Open Access Journals (Sweden)

    Kaja Irgens-Hansen

    2015-01-01

    Full Text Available Prior research shows that work on board vessels of the Royal Norwegian Navy (RNoN is associated with noise exposure levels above recommended standards. Further, noise exposure has been found to impair cognitive performance in environmental, occupational, and experimental settings, although prior research in naval and maritime settings is sparse. The aim of this study was to evaluate cognitive performance after exposure to noise among personnel working on board vessels in the RNoN. Altogether 87 Navy personnel (80 men, 7 women; 31 ± 9 years from 24 RNoN vessels were included. Noise exposure was recorded by personal noise dosimeters at a minimum of 4 h prior to testing, and categorized into 4 groups for the analysis: 85.2 dB(A. The participants performed a visual attention test based on the Posner cue-target paradigm. Multivariable general linear model (GLM analyses were performed to analyze whether noise exposure was associated with response time (RT when adjusting for the covariates age, alertness, workload, noise exposure in test location, sleep the night before testing, use of hearing protection device (HPD, and percentage of errors. When adjusting for covariates, RT was significantly increased among personnel exposed to >85.2 dB(A and 77.1-85.2 dB(A compared to personnel exposed to <72.6 dB(A.

  4. Noise exposure and cognitive performance: A study on personnel on board Royal Norwegian Navy vessels.

    Science.gov (United States)

    Irgens-Hansen, Kaja; Gundersen, Hilde; Sunde, Erlend; Baste, Valborg; Harris, Anette; Bråtveit, Magne; Moen, Bente E

    2015-01-01

    Prior research shows that work on board vessels of the Royal Norwegian Navy (RNoN) is associated with noise exposure levels above recommended standards. Further, noise exposure has been found to impair cognitive performance in environmental, occupational, and experimental settings, although prior research in naval and maritime settings is sparse. The aim of this study was to evaluate cognitive performance after exposure to noise among personnel working on board vessels in the RNoN. Altogether 87 Navy personnel (80 men, 7 women; 31 ± 9 years) from 24 RNoN vessels were included. Noise exposure was recorded by personal noise dosimeters at a minimum of 4 h prior to testing, and categorized into 4 groups for the analysis: 85.2 dB(A). The participants performed a visual attention test based on the Posner cue-target paradigm. Multivariable general linear model (GLM) analyses were performed to analyze whether noise exposure was associated with response time (RT) when adjusting for the covariates age, alertness, workload, noise exposure in test location, sleep the night before testing, use of hearing protection device (HPD), and percentage of errors. When adjusting for covariates, RT was significantly increased among personnel exposed to >85.2 dB(A) and 77.1-85.2 dB(A) compared to personnel exposed to <72.6 dB(A).

  5. The Royal Society of Chemistry and the delivery of chemistry data repositories for the community

    Science.gov (United States)

    Williams, Antony; Tkachenko, Valery

    2014-10-01

    Since 2009 the Royal Society of Chemistry (RSC) has been delivering access to chemistry data and cheminformatics tools via the ChemSpider database and has garnered a significant community following in terms of usage and contribution to the platform. ChemSpider has focused only on those chemical entities that can be represented as molecular connection tables or, to be more specific, the ability to generate an InChI from the input structure. As a structure centric hub ChemSpider is built around the molecular structure with other data and links being associated with this structure. As a result the platform has been limited in terms of the types of data that can be managed, and the flexibility of its searches, and it is constrained by the data model. New technologies and approaches, specifically taking into account a shift from relational to NoSQL databases, and the growing importance of the semantic web, has motivated RSC to rearchitect and create a more generic data repository utilizing these new technologies. This article will provide an overview of our activities in delivering data sharing platforms for the chemistry community including the development of the new data repository expanding into more extensive domains of chemistry data.

  6. Noise and sleep on board vessels in the Royal Norwegian Navy

    Directory of Open Access Journals (Sweden)

    Erlend Sunde

    2016-01-01

    Full Text Available Previous research indicates that exposure to noise during sleep can cause sleep disturbance. Seamen on board vessels are frequently exposed to noise also during sleep periods, and studies have reported sleep disturbance in this occupational group. However, studies of noise and sleep in maritime settings are few. This study′s aim was to examine the associations between noise exposure during sleep, and sleep variables derived from actigraphy among seamen on board vessels in the Royal Norwegian Navy (RNoN. Data were collected on board 21 RNoN vessels, where navy seamen participated by wearing an actiwatch (actigraph, and by completing a questionnaire comprising information on gender, age, coffee drinking, nicotine use, use of medication, and workload. Noise dose meters were used to assess noise exposure inside the seamen′s cabin during sleep. Eighty-three sleep periods from 68 seamen were included in the statistical analysis. Linear mixed-effects models were used to examine the association between noise exposure and the sleep variables percentage mobility during sleep and sleep efficiency, respectively. Noise exposure variables, coffee drinking status, nicotine use status, and sleeping hours explained 24.9% of the total variance in percentage mobility during sleep, and noise exposure variables explained 12.0% of the total variance in sleep efficiency. Equivalent noise level and number of noise events per hour were both associated with increased percentage mobility during sleep, and the number of noise events was associated with decreased sleep efficiency.

  7. Noise and sleep on board vessels in the Royal Norwegian Navy.

    Science.gov (United States)

    Sunde, Erlend; Bratveit, Magne; Pallesen, Stale; Moen, Bente Elisabeth

    2016-01-01

    Previous research indicates that exposure to noise during sleep can cause sleep disturbance. Seamen on board vessels are frequently exposed to noise also during sleep periods, and studies have reported sleep disturbance in this occupational group. However, studies of noise and sleep in maritime settings are few. This study's aim was to examine the associations between noise exposure during sleep, and sleep variables derived from actigraphy among seamen on board vessels in the Royal Norwegian Navy (RNoN). Data were collected on board 21 RNoN vessels, where navy seamen participated by wearing an actiwatch (actigraph), and by completing a questionnaire comprising information on gender, age, coffee drinking, nicotine use, use of medication, and workload. Noise dose meters were used to assess noise exposure inside the seamen's cabin during sleep. Eighty-three sleep periods from 68 seamen were included in the statistical analysis. Linear mixed-effects models were used to examine the association between noise exposure and the sleep variables percentage mobility during sleep and sleep efficiency, respectively. Noise exposure variables, coffee drinking status, nicotine use status, and sleeping hours explained 24.9% of the total variance in percentage mobility during sleep, and noise exposure variables explained 12.0% of the total variance in sleep efficiency. Equivalent noise level and number of noise events per hour were both associated with increased percentage mobility during sleep, and the number of noise events was associated with decreased sleep efficiency.

  8. Protective Role of Royal Jelly in Oxymetholone-induced Oxidative Injury in Mouse Testis

    Directory of Open Access Journals (Sweden)

    Gholamreza Najafi

    2014-06-01

    Full Text Available Background: An adverse effect of oxymetholone (OXM, an anabolic-androgenic steroid used as energetic medicine, is reproductive toxicity. Royal jelly (RJ is an efficient antioxidant that has been used to treat reproductive problems. In this study, we investigated the effects of RJ on OXM-induced oxidative injuries in mouse testes. Methods: Male mice were divided into four groups. Two groups of mice were administered OXM (5 mg/kg/day, p.o. for 28 days. One of these groups received RJ (100 mg/kg/day, p.o. concurrently. A vehicle-treated control group and a RJ control group were also included. Results: The OXM-treated group showed a significant decrease in the serum testosterone concentration and spermatogenic activities, along with many histological alterations. OXM treatment also caused a significant decrease in catalase activity with an increase in lipid peroxidation in the mouse testes. The above-noted parameters were restored to near normal levels by RJ co-administration. Conclusion: The results demonstrate that RJ protects against OXM-induced reproductive toxicities.

  9. The Effects of Royal Jelly on Fitness Traits and Gene Expression in Drosophila melanogaster.

    Directory of Open Access Journals (Sweden)

    John R Shorter

    Full Text Available Royal Jelly (RJ is a product made by honey bee workers and is required for queen differentiation and accompanying changes in queen body size, development time, lifespan and reproductive output relative to workers. Previous studies have reported similar changes in Drosophila melanogaster in response to RJ. Here, we quantified viability, development time, body size, productivity, lifespan and genome wide transcript abundance of D. melanogaster reared on standard culture medium supplemented with increasing concentrations of RJ. We found that lower concentrations of RJ do induce significant differences in body size in both sexes; higher concentrations reduce size, increase mortality, shorten lifespan and reduce productivity. Increased concentrations of RJ also consistently lengthened development time in both sexes. RJ is associated with changes in expression of 1,581 probe sets assessed using Affymetrix Drosophila 2.0 microarrays, which were enriched for genes associated with metabolism and amino acid degradation. The transcriptional changes are consistent with alterations in cellular processes to cope with excess nutrients provided by RJ, including biosynthesis and detoxification, which might contribute to accelerated senescence and reduced lifespan.

  10. Lessons learned from early rehabilitation of complex trauma at the Royal Centre for Defence Medicine.

    Science.gov (United States)

    Pope, Sue; Vickerstaff, A L; Wareham, A P

    2017-04-01

    During the recent conflicts in Iraq and Afghanistan, substantial numbers of service personnel survived devastating injuries, presenting significant challenges for early rehabilitation at Queen Elizabeth Hospital Birmingham. Royal Centre for Defence Medicine personnel augmented NHS therapy provision, gaining significant experience in rehabilitating complex trauma. Multidisciplinary working was key to delivering this service, with a unique rehabilitation coordinating officer position established to manage the rehabilitation pathway. A military exercise rehabilitation instructor provided daily gym-based rehabilitation, developing exercise tolerance. Emphasis was placed on early independence, reducing pain, eliminating complications and optimising function. Innovative solutions and non-standard combinations of rehabilitation were required, with therapy working practices redesigned that, we believe, exceed provision elsewhere, including novel applications such as unique patient transfers, specialist seating, additional equipment, problem-solving teaching and early upper limb prosthetic provision. Active pain management allowed engagement in rehabilitation. With limited evidence available, therapeutic modalities attempting to alleviate phantom limb pain centred on patients' ability to engage in treatment. Finally, the requirement to measure change in early trauma rehabilitation was identified, leading to the development of the preprosthetic functional outcome measure. This article aims to document advances made, lessons learned, encourage debate and identify priorities for future research for military complex trauma rehabilitation. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.

  11. Reel Royal Diversity? The Glass Ceiling in Disney’s Mulan and Princess and the Frog

    Directory of Open Access Journals (Sweden)

    Lauren Dundes

    2016-12-01

    Full Text Available Both in Mulan and Princess and the Frog, Disney eschews a traditional fairytale ending involving palatial opulence by substituting an alternative narrative for women of color. Mulan disguises herself as a male soldier in order to serve in her father’s place. After sharing victory with male companions, she willingly returns home to domesticity and the confines imposed by her gender. Tiana spends two thirds of the movie as a frog, substantially limiting her on-screen time as an African American female. Like Mulan, she is driven to please her father. She fulfills his dream of owning a high-end restaurant, ironically named Tiana’s Palace, the closest she comes to a royal lifestyle. Although protagonists with more realistic lives could potentially enhance viewers’ connection with them and model a work ethic or commitment to home life, the standard and more financially successful Disney narrative immerses viewers in a fantasy world of endless prospects including a life of royalty. These nonwhite heroines instead display a willingness to settle for more modest aspirations in stories replete with stereotypical gender and race-bound tropes. This divergent narrative suggests that protagonists of color are not entitled to a life of leisure and privilege that white Disney princesses enjoy.

  12. Longevity extension of worker honey bees (Apis mellifera by royal jelly: optimal dose and active ingredient

    Directory of Open Access Journals (Sweden)

    Wenchao Yang

    2017-03-01

    Full Text Available In the Western honey bee, Apis mellifera, queens and workers have different longevity although they share the same genome. Queens consume royal jelly (RJ as the main food throughout their life, including as adults, but workers only eat worker jelly when they are larvae less than 3 days old. In order to explore the effect of RJ and the components affecting longevity of worker honey bees, we first determined the optimal dose for prolonging longevity of workers as 4% RJ in 50% sucrose solution, and developed a method of obtaining long lived workers. We then compared the effects of longevity extension by RJ 4% with bee-collected pollen from rapeseed (Brassica napus. Lastly, we determined that a water soluble RJ protein obtained by precipitation with 60% ammonium sulfate (RJP60 contained the main component for longevity extension after comparing the effects of RJ crude protein extract (RJCP, RJP30 (obtained by precipitation with 30% ammonium sulfate, and RJ ethanol extract (RJEE. Understanding what regulates worker longevity has potential to help increase colony productivity and improve crop pollination efficiency.

  13. Longevity extension of worker honey bees (Apis mellifera) by royal jelly: optimal dose and active ingredient.

    Science.gov (United States)

    Yang, Wenchao; Tian, Yuanyuan; Han, Mingfeng; Miao, Xiaoqing

    2017-01-01

    In the Western honey bee, Apis mellifera , queens and workers have different longevity although they share the same genome. Queens consume royal jelly (RJ) as the main food throughout their life, including as adults, but workers only eat worker jelly when they are larvae less than 3 days old. In order to explore the effect of RJ and the components affecting longevity of worker honey bees, we first determined the optimal dose for prolonging longevity of workers as 4% RJ in 50% sucrose solution, and developed a method of obtaining long lived workers. We then compared the effects of longevity extension by RJ 4% with bee-collected pollen from rapeseed ( Brassica napus ). Lastly, we determined that a water soluble RJ protein obtained by precipitation with 60% ammonium sulfate (RJP 60 ) contained the main component for longevity extension after comparing the effects of RJ crude protein extract (RJCP), RJP 30 (obtained by precipitation with 30% ammonium sulfate), and RJ ethanol extract (RJEE). Understanding what regulates worker longevity has potential to help increase colony productivity and improve crop pollination efficiency.

  14. ARCHAEOLOGICAL AND ENVIRONMENTAL CHANGES BETWEEN 9500 BP AND 4500 BP: A CONTRIBUTION FROM THE SAHARA TO UNDERSTAND EXPANDING DROUGHTS IN THE “GREAT MEDITERRANEAN”

    Directory of Open Access Journals (Sweden)

    E. A.A. Garcea

    2013-03-01

    Full Text Available The Sahara is more connected to the Mediterranean than often assumed and palynology, in particular, has provided evidence of past interrelations between the Mediterranean and the Sahara with pollen spectra from prehistoric Saharan deposits including Mediterranean taxa. In order to show human-environment relationships and populations’ strategies in response to changing environments, this paper presents a case study from the southern Sahara. This region offered a natural laboratory for the study of human/climate interaction as the range of environmental change extended from flood to drought, forcing people to cope with periodic environmental instability. When the tropical rainfall belt migrated northward, watertable outcropped in interdunal depressions and formed permanent lakes, which alternated with severe arid spells. As a case study, this paper presents the results of interdisciplinary investigations on climate changes, human adaptations and subsistence strategies at Gobero, in the southern Sahara of Niger. Gobero is a restricted archaeological area comprising 8 sites that surround the shores of a palaeolake. It was intermittently occupied between about 9500 cal years BP and 4500 BP. Due to alternating environmental conditions it could only be occupied at the beginning and at the end of the most humid periods.

  15. Multiple-site mutations of phage Bp7 endolysin improves its activities against target bacteria.

    Science.gov (United States)

    Zhang, Can; Wang, Yuanchao; Sun, Huzhi; Ren, Huiying

    2015-10-01

    The widespread use of antibiotics has caused serious drug resistance. Bacteria that were once easily treatable are now extremely difficult to treat. Endolysin can be used as an alternative to antibiotics for the treatment of drug-resistant bacteria. To analyze the antibacterial activity of the endolysin of phage Bp7 (Bp7e), a 489-bp DNA fragment of endolysin Bp7e was PCR-amplified from a phage Bp7 genome and cloned, and then a pET28a-Bp7e prokaryotic expression vector was constructed. Two amino acids were mutated (L99A, M102E) to construct pET28a-Bp7Δe, with pET28a-Bp7e as a template. Phylogenetic analysis suggested that BP7e belongs to a T4-like phage endolysin group. Bp7e and its mutant Bp7Δe were expressed in Escherichia coli BL21(DE3) as soluble proteins. They were purified by affinity chromatography, and then their antibacterial activities were analyzed. The results demonstrated that the recombinant proteins Bp7e and Bp7Δe showed obvious antibacterial activity against Micrococcus lysodeikticus but no activity against Staphylococcus aureus. In the presence of malic acid, Bp7e and Bp7Δe exhibited an effect on most E. coli strains which could be lysed by phage Bp7, but no effect on Salmonella paratyphi or Pseudomonas aeruginosa. Moreover, Bp7Δe with double-site mutations showed stronger antibacterial activity and a broader lysis range than Bp7e.

  16. Protocol for Past BP: a randomised controlled trial of different blood pressure targets for people with a history of stroke of transient ischaemic attack (TIA in primary care

    Directory of Open Access Journals (Sweden)

    Greenfield Sheila

    2010-08-01

    Full Text Available Abstract Background Blood pressure (BP lowering in people who have had a stroke or transient ischaemic attack (TIA leads to reduced risk of further stroke. However, it is not clear what the target BP should be, since intensification of therapy may lead to additional adverse effects. PAST BP will determine whether more intensive BP targets can be achieved in a primary care setting, and whether more intensive therapy is associated with adverse effects on quality of life. Methods/Design This is a randomised controlled trial (RCT in patients with a past history of stroke or TIA. Patients will be randomised to two groups and will either have their blood pressure (BP lowered intensively to a target of 130 mmHg systolic, (or by 10 mmHg if the baseline systolic pressure is between 125 and 140 mmHg compared to a standard group where the BP will be reduced to a target of 140 mmHg systolic. Patients will be managed by their practice at 1-3 month intervals depending on level of BP and followed-up by the research team at six monthly intervals for 12 months. 610 patients will be recruited from approximately 50 general practices. The following exclusion criteria will be applied: systolic BP The primary outcome will be change in systolic BP over twelve months. Secondary outcomes include quality of life, adverse events and cardiovascular events. In-depth interviews with 30 patients and 20 health care practitioners will be undertaken to investigate patient and healthcare professionals understanding and views of BP management. Discussion The results of this trial will inform whether intensive blood pressure targets can be achieved in people who have had a stroke or TIA in primary care, and help determine whether or not further research is required before recommending such targets for this population. Trial Registration ISRCTN29062286

  17. Chemical Composition of Royal Jelly and Effects of Synbiotic with Two Different Locally Isolated Probiotic Strains on Antioxidant Activities

    Directory of Open Access Journals (Sweden)

    Nabas Zaid

    2014-09-01

    Full Text Available This study was carried out to investigate the antioxidant properties of synbiotic product, Lactobacillus acidophilus supplemented with 2.5% royal jelly in skim milk and Bifidobacterium bifidum supplemented with 7.5% royal jelly in skim milk, using DPPH (1,1-Diphenyl-2-picrylhydrazyl radical scavenging assay, reducing power, total antioxidant in linoleic acid system and formation of diene-conjugation assay. Results showed that the synbiotic effect of royal jelly and probiotic bacteria provided substantial antioxidant activities. Milk samples fermented by B. bifi dum supplemented with 7.5% royal jelly and L. acidophilus supplemented with 2.5% royal jelly exhibited high scavenging activity with 96.8 and 93.3%, respectively, at a concentration of 500 μg/mL. IC50 values were estimated at 226.7 μg/mL for B. bifidum supplemented with 7.5% royal jelly and at 210.2 μg/ml for L. acidophilus supplemented with 2.5% royal jelly. On the other hand, L. acidophilus supplemented with 2.5% royal jelly and B. bifidum supplemented with 7.5% royal jelly exhibited significantly high reducing power at a concentration of 1000 μg/mL. The percentages of peroxide inhibition of L. acidophilus supplemented with 2.5% royal jelly and B. bifidum with 7.5% royal jelly were 52% and 42%, respectively. Significant inhibitions were found in the formation of conjugated diene at 66.9% and 65.8% for L. acidophilus with 2.5% royal jelly and B. bifidum with 7.5% royal jelly, respectively. These results were compared with standards BHT, ascorbic acid and Trolox.

  18. Honey, Propolis, and Royal Jelly: A Comprehensive Review of Their Biological Actions and Health Benefits

    Directory of Open Access Journals (Sweden)

    Visweswara Rao Pasupuleti

    2017-01-01

    Full Text Available Background. There are several health benefits that honeybee products such as honey, propolis, and royal jelly claim toward various types of diseases in addition to being food. Scope and Approach. In this paper, the effects of honey, propolis, and royal jelly on different metabolic diseases, cancers, and other diseases have been reviewed. The modes of actions of these products have also been illustrated for purposes of better understanding. Key Findings and Conclusions. An overview of honey, propolis, and royal jelly and their biological potentials was highlighted. The potential health benefits of honey, such as microbial inhibition, wound healing, and its effects on other diseases, are described. Propolis has been reported to have various health benefits related to gastrointestinal disorders, allergies, and gynecological, oral, and dermatological problems. Royal jelly is well known for its protective effects on reproductive health, neurodegenerative disorders, wound healing, and aging. Nevertheless, the exact mechanisms of action of honey, propolis, and royal jelly on the abovementioned diseases and activities have not been not fully elucidated, and further research is warranted to explain their exact contributions.

  19. Feasibility study report for the 200-BP-1 operable unit

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9{times}10{sup {minus}5}.

  20. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9x10 -5

  1. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1994-01-01

    This feasibility study (FS) examines a range of alternatives and provides recommendations for selecting a preferred altemative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965-1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-:levels of contamination with cesium-137, radium-226, strontium-90, thorium-228 and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9 x 10 5

  2. BP floats on top of the German oil market

    Energy Technology Data Exchange (ETDEWEB)

    1980-02-01

    An excerpt from the background report of the Deutsche BP AG summarizing the situation in 1979 shows the developments on the German energy market in the year 1979. The report discusses the shift in the proportions of energy generated from the various energy sources as well the causes and consequences of the mineral oil shortage on the world market, especially the reactions of the Federal Government, the petroleum companies, and the consumers. The outlook on the near future points out that world-wide petroleum supply still remains uncertain and that more serious efforts have to be made in order to put an end to wasting mineral oil.

  3. BP and sustainable development and biodiversity in Azerbaijan

    International Nuclear Information System (INIS)

    Grant, Vidrine; Askerov, Faig

    2002-01-01

    Full text: BP takes its commitment to the environmental extremely seriously. BP believes it is essential to ensure that our operations and activities comply with the environmental standards in our PSAs and with the laws of Azerbaijan. To achieve this we have developed Environmental Operating Procedures. These procedures are currently being audited and we expect to receive ISO 14001 certification for all of our operations. Together with our Emergency Response and Oil Spill Response Plans we are able to manage our operations to ensure minimum impact and regulatory compliance. Additional, AIOC contributed to opening the Caspian Environmental Laboratory in 1999 to provide on a commercial basis, environmental services in Azerbaijan of an internationally recognized standard. We have conducted many other activities to promote biodiversity. In absence of the appropriate infrastructure we have built a waste management site at Serenja where we are currently disposing of synthetic based muds from our offshore drilling operations. We have also developed and implemented a Research and Monitoring Program in co-operation with representatives from SOCAR, Academy of Sciences, Azgipromorneftegaz and State Committee of Ecology. We have conducted Seals mortality investigation, Birds monitoring, Fish monitoring, Offshore surveys studying macrobenthos, water chemistry, sediments, groundwater monitoring, re-vegetation, etc. In developing our overall strategy BP has set some long term environmental aspirations or expectations: stop the use of halocarbons; to reduce Green House Gases by 10% by 20 lOin comparison with baseline data for 1990; stop venting and flaring; stop discharges to water of synthetic and oil based muds. BP recognizes that this is a goal. It is something we commit to and aspire to achieve and something we are wise enough to realize cannot be achieved overnight. None-the-less, it is something we constantly work towards. We also realize that this goal cannot be achieved in

  4. EST Table: BP183486 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 56...43 aa gnl|Amel|GB30360-PB 10/09/10 54 %/174 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expres...sed intermediate filament-associated protein) [Tribolium castaneum] FS906662 NRPG ... ...BP183486 NRPG1970 10/09/28 54 %/174 aa ref|XP_967018.2| PREDICTED: similar to resti

  5. Risk assessment of logistics outsourcing based on BP neural network

    Science.gov (United States)

    Liu, Xiaofeng; Tian, Zi-you

    The purpose of this article is to evaluate the risk of the enterprises logistics outsourcing. To get this goal, the paper first analysed he main risks existing in the logistics outsourcing, and then set up a risk evaluation index system of the logistics outsourcing; second applied BP neural network into the logistics outsourcing risk evaluation and used MATLAB to the simulation. It proved that the network error is small and has strong practicability. And this method can be used by enterprises to evaluate the risks of logistics outsourcing.

  6. Whole-genome resequencing of honeybee drones to detect genomic selection in a population managed for royal jelly.

    Science.gov (United States)

    Wragg, David; Marti-Marimon, Maria; Basso, Benjamin; Bidanel, Jean-Pierre; Labarthe, Emmanuelle; Bouchez, Olivier; Le Conte, Yves; Vignal, Alain

    2016-06-03

    Four main evolutionary lineages of A. mellifera have been described including eastern Europe (C) and western and northern Europe (M). Many apiculturists prefer bees from the C lineage due to their docility and high productivity. In France, the routine importation of bees from the C lineage has resulted in the widespread admixture of bees from the M lineage. The haplodiploid nature of the honeybee Apis mellifera, and its small genome size, permits affordable and extensive genomics studies. As a pilot study of a larger project to characterise French honeybee populations, we sequenced 60 drones sampled from two commercial populations managed for the production of honey and royal jelly. Results indicate a C lineage origin, whilst mitochondrial analysis suggests two drones originated from the O lineage. Analysis of heterozygous SNPs identified potential copy number variants near to genes encoding odorant binding proteins and several cytochrome P450 genes. Signatures of selection were detected using the hapFLK haplotype-based method, revealing several regions under putative selection for royal jelly production. The framework developed during this study will be applied to a broader sampling regime, allowing the genetic diversity of French honeybees to be characterised in detail.

  7. Etienne-François Geoffroy, entre la Royal Society et l’Académie royale des sciences : ni Newton, ni Descartes

    Directory of Open Access Journals (Sweden)

    Bernard Joly

    2012-02-01

    Full Text Available Etienne-François Geoffroy, l’un des chimistes français les plus importants du début du XVIIIe siècle, entretenait des relations régulières avec l’Angleterre. Il était chargé de développer les échanges entre l’Académie royale des sciences et la Royal Society de Londres. Quand il publia sa « Table des rapports entre les substances chimiques » en 1718, Fontenelle et quelques autres lui reprochèrent d’avoir introduit en chimie le système des attractions newtoniennes. Mais en fait, Geoffroy s’est toujours tenu à l’écart aussi bien du mécanisme cartésien que du newtonianisme, le recours aux expériences et à la littérature alchimique constituant ses seules sources d’inspiration. Geoffroy apparaît ainsi comme le représentant d’une chimie empirique, soucieuse de conserver l’autonomie de sa discipline.Etienne-François Geoffroy, one of the most famous chemists in France in the early eighteenth century, has constant contacts with English scientists. He was in charge of developing exchanges between the Académie royale des science and the Royal Society. When he published the « Table des rapports entre les substances chimiques » in 1718, he was said by Fontenelle and others to have introduced the newtonian attractions into chemistry. In fact, Geoffroy kept out just as well the cartesian mecanism as the newtonisnism : his inspiration came only from experiments and alchemical literature. Thus Geoffroy appears as a representative of an empirical chemistry which aims to retain chemistry as an independant discipline.

  8. BP-Broker use-cases in the UncertWeb framework

    Science.gov (United States)

    Roncella, Roberto; Bigagli, Lorenzo; Schulz, Michael; Stasch, Christoph; Proß, Benjamin; Jones, Richard; Santoro, Mattia

    2013-04-01

    The UncertWeb framework is a distributed, Web-based Information and Communication Technology (ICT) system to support scientific data modeling in presence of uncertainty. We designed and prototyped a core component of the UncertWeb framework: the Business Process Broker. The BP-Broker implements several functionalities, such as: discovery of available processes/BPs, preprocessing of a BP into its executable form (EBP), publication of EBPs and their execution through a workflow-engine. According to the Composition-as-a-Service (CaaS) approach, the BP-Broker supports discovery and chaining of modeling resources (and processing resources in general), providing the necessary interoperability services for creating, validating, editing, storing, publishing, and executing scientific workflows. The UncertWeb project targeted several scenarios, which were used to evaluate and test the BP-Broker. The scenarios cover the following environmental application domains: biodiversity and habitat change, land use and policy modeling, local air quality forecasting, and individual activity in the environment. This work reports on the study of a number of use-cases, by means of the BP-Broker, namely: - eHabitat use-case: implements a Monte Carlo simulation performed on a deterministic ecological model; an extended use-case supports inter-comparison of model outputs; - FERA use-case: is composed of a set of models for predicting land-use and crop yield response to climatic and economic change; - NILU use-case: is composed of a Probabilistic Air Quality Forecasting model for predicting concentrations of air pollutants; - Albatross use-case: includes two model services for simulating activity-travel patterns of individuals in time and space; - Overlay use-case: integrates the NILU scenario with the Albatross scenario to calculate the exposure to air pollutants of individuals. Our aim was to prove the feasibility of describing composite modeling processes with a high-level, abstract

  9. Varroa destructor mite in Africanized honeybee colonies Apis mellifera L. under royal jelly or honey production

    Directory of Open Access Journals (Sweden)

    Pedro da Rosa Santos

    2015-08-01

    Full Text Available This study evaluated the level of invasion of Varroa mite into worker brood cells, the infestation rate on adult worker honeybees, total and effective reproduction rates of the mite in Africanized honeybee colonies under royal jelly or honey production. Invasion and infestation rates were not statistically different between honeybee colonies producing honey or royal jelly and the averages for these parameters were 5.79 and 8.54%, respectively. Colonies producing honey presented a higher (p < 0.05 total and effective reproduction of Varroa than colonies producing royal jelly. There was a negative correlation between levels of invasion and infestation with minimum external temperature, relative humidity and rainfall. The variables month and season influenced the development of the mite, but rates were low and within the range normally found in Brazil for Africanized honeybee colonies, which confirm the greater resistance of these honeybees to Varroa destructor than European honeybees.

  10. Dimitrie Gusti and the Royal Cultural Foundations (1922-1948. Archive Documents

    Directory of Open Access Journals (Sweden)

    PhD Student Laura-Rodica Hîmpa

    2016-01-01

    Full Text Available This research aims to emphasize the activity of The "Prince Carol" Royal Cultural Foundation created in 1921 in order to lead to the emancipation especially of villages, but also the Romanian culture in a more general perspective. Overall, we may say that the period between the two world wars was marked, also due to the help of the Royal Cultural Foundation, by substantial progress in various fields of education, science and culture in general and thus contributed to changing Romania into a state with a high level of culture and the creation of an image and prestige that commanded worldwide respect. The research was done on the basis of the documents studied at the Service of the National Central Historical Archives, the Stock of the "Prince Carol" Royal Cultural Foundation and at the Library of the Romanian Academy.

  11. The Royal Entries of Henry VI in a London Civic Manuscript

    DEFF Research Database (Denmark)

    Bourassa, Kristin

    2016-01-01

    London Metropolitan Archives, MS Letter Book K, contains descriptions of Henry VI’s royal entries into both Paris (1431) and London (1432). Their placement one after the other in a London Letter Book was likely the work of the city’s common clerk, John Carpenter, who was the author of the descrip......London Metropolitan Archives, MS Letter Book K, contains descriptions of Henry VI’s royal entries into both Paris (1431) and London (1432). Their placement one after the other in a London Letter Book was likely the work of the city’s common clerk, John Carpenter, who was the author...... of the description of the London entry. The royal entry descriptions’ textual contents and manuscript context demonstrate a conscious effort to compare the two events and the king’s two capitals, and to promote the city of London over Paris....

  12. Research on AHP decision algorithms based on BP algorithm

    Science.gov (United States)

    Ma, Ning; Guan, Jianhe

    2017-10-01

    Decision making is the thinking activity that people choose or judge, and scientific decision-making has always been a hot issue in the field of research. Analytic Hierarchy Process (AHP) is a simple and practical multi-criteria and multi-objective decision-making method that combines quantitative and qualitative and can show and calculate the subjective judgment in digital form. In the process of decision analysis using AHP method, the rationality of the two-dimensional judgment matrix has a great influence on the decision result. However, in dealing with the real problem, the judgment matrix produced by the two-dimensional comparison is often inconsistent, that is, it does not meet the consistency requirements. BP neural network algorithm is an adaptive nonlinear dynamic system. It has powerful collective computing ability and learning ability. It can perfect the data by constantly modifying the weights and thresholds of the network to achieve the goal of minimizing the mean square error. In this paper, the BP algorithm is used to deal with the consistency of the two-dimensional judgment matrix of the AHP.

  13. SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Wei; Johns-Krull, Christopher M., E-mail: wc2@rice.edu, E-mail: cmj@rice.edu [Department of Physics and Astronomy, Rice University, Houston, TX 77005 (United States)

    2013-10-20

    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star.

  14. Treacher Collins Syndrome with a de Novo 5-bp Deletion in the TCOF1 Gene

    Directory of Open Access Journals (Sweden)

    Pen-Hua Su

    2006-01-01

    Full Text Available Treacher Collins syndrome (TCS is an autosomal dominant disorder of craniofacial development with features including malar hypoplasia, micrognathia, microtia, downward slanting palpebral fissures, lower eyelid coloboma, conductive hearing loss, and cleft palate. TCS is caused by mutations in the TCOF1 gene, which encodes the nuclear phosphoprotein treacle. Here, we describe a 1-day-old male infant with classical TCS presentation. A 5-bp deletion in exon 22 of the TCOF1 gene (3469del ACTCT was found to cause a premature stop codon. This is the first report of TCOF1 gene mutation in the Taiwanese population.

  15. Treacher Collins syndrome with a de Novo 5-bp deletion in the TCOF1 gene.

    Science.gov (United States)

    Su, Pen-Hua; Chen, Jia-Yu; Chen, Suh-Jen; Yu, Ju-Shan

    2006-06-01

    Treacher Collins syndrome (TCS) is an autosomal dominant disorder of craniofacial development with features including malar hypoplasia, micrognathia, microtia, downward slanting palpebral fissures, lower eyelid coloboma, conductive hearing loss, and cleft palate. TCS is caused by mutations in the TCOF1 gene, which encodes the nuclear phosphoprotein treacle. Here, we describe a 1-day-old male infant with classical TCS presentation. A 5-bp deletion in exon 22 of the TCOF1 gene (3469del ACTCT) was found to cause a premature stop codon. This is the first report of TCOF1 gene mutation in the Taiwanese population.

  16. Use of simulators for the continuation training of nuclear propulsion plant operators in the Royal Navy

    International Nuclear Information System (INIS)

    Burbridge, A.J.H.

    1985-01-01

    The Royal Navy now operates 17 submarines which are powered by Pressurised Water Reactors. In the training of the operators of these Nuclear Propulsion Plants, computer simulation is used widely, and ranges from simple analogue devices which present the dynamic response of single plant parameters, through more complex hybrid computers which allow some operator interaction, to the real-time full simulation Manoeuvring Room Trainers. This paper provides information on the use of this latter equipment for the Continuation Training of the Manoeuvring Room Watchkeepers of the Royal Navy's nuclear powered submarines. (author)

  17. Alternative sources of supplements for Africanized honeybees submitted to royal jelly production

    OpenAIRE

    Sereia, Maria Josiane; Toledo, Vagner de Alencar Arnaut de; Furlan, Antonio Claudio; Faquinello, Patrícia; Maia, Fabiana Martins Costa; Wielewski, Priscila

    2013-01-01

    This study was carried out to evaluate the effect of supplements with isolated soy protein, brewer's yeast, a mixture of isolated soy protein with brewer's yeast, linseed oil, palm oil and mixture of linseed oil with palm oil in the production of royal jelly by Africanized honeybee colonies. Total royal jelly production was higher (p < 0.05) in colonies fed with isolated soy protein and brewer's yeast (11.68 g colony-1), followed by linseed oil and palm oil (11.30 g colony-1) and palm oil (9....

  18. Weathered Oil and Tar Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  19. Creating Royal Australian Navy Standard Operating Procedures using Flow Diagrams

    Science.gov (United States)

    2015-08-01

    set it is important to determine writing and approval responsibilities, storage methods and publishing details before SOPs are written. This...5 4.1.1 Brainstorming ...managed accordingly. Key activities include scoping the set of SOPs, creating a team, developing a plan, writing , reviewing and approving procedures, and

  20. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Directory of Open Access Journals (Sweden)

    Azamat Aslanukov

    2006-10-01

    Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  1. CtBP1 over-expression in keratinocytes perturbs skin homeostasis

    Science.gov (United States)

    Deng, Hui; Li, Fulun; Li, Hong; Deng, Yu; Liu, Jing; Wang, Donna; Han, Gangwen; Wang, Xiao-Jing; Zhang, Qinghong

    2015-01-01

    Carboxyl-terminal binding protein-1 (CtBP1) is a transcriptional co-repressor with multiple in vitro targets, but its in vivo functions are largely unknown. We generated keratinocyte-specific CtBP1 transgenic mice with a keratin 5 promoter (K5.CtBP1) to probe the pathological roles of CtBP1. At transgene expression levels comparable with endogenous CtBP1 in acute skin wounds, K5.CtBP1 epidermis displayed hyperproliferation, loss of E-cadherin, and failed terminal differentiation. Known CtBP1 target genes associated with these processes, e.g., p21, Brca1, and E-cadherin were down-regulated in K5.CtBP1 skin. Surprisingly, K5.CtBP1 pups also exhibited a hair loss phenotype. We found that expression of the Distal-less 3 (Dlx3), a critical regulator of hair follicle differentiation and cycling, was decreased in K5.CtBP1 mice. Molecular studies revealed that CtBP1 directly suppressed Dlx3 transcription. Consistently, K5.CtBP1 mice displayed abnormal hair follicles with decreased expression of Dlx3 downstream targets Gata3, Hoxc13, and hair keratins. In sum, this first CtBP1 transgenic model provides in vivo evidence for certain CtBP1 functions predicted from in vitro studies, reveals to our knowledge previously unreported functions and transcriptional activities of CtBP1 in the context of epithelial-mesenchymal interplay, and suggest CtBP1 has a pathogenesis role in hair follicle morphogenesis and differentiation. PMID:24280726

  2. Climatic forcing before, during, and after the 8.2 Kyr BP global ...

    Indian Academy of Sciences (India)

    The flood of melt water in the N. Atlantic from glacial lakes during the demise of the Laurentide ice sheet, starting at ∼8.5Kyr B.P., adds to the atmospheric cooling. Climatic forcing events occurred at 8.5Kyr B.P., at 8.2Kyr B.P. and finally at 8.06Kyr B.P., leading to concurrent increases or decreases in the atmospheric 14C ...

  3. The Royal Treasury of the Kingdom of Majorca during the War of the Spanish Succession (1701-1715

    Directory of Open Access Journals (Sweden)

    Eduardo PASCUAL RAMOS

    2014-02-01

    Full Text Available The royal treasury of the kingdom of Majorca during the War of the Spanish Succession suffered an economic downturn caused mainly by its logistical contribution to the war. This article shows the evolution of the taxation carried out by the Royal Treasury of Majorca during the war, and is divided into three parts. The first one is a description of the Royal Treasury as an institution. The second one analyses revenues and expenses and shows the evolution of the institution’s finances during the conflict. The third part is a general inventory of the royal accounts during the war.

  4. Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage

    DEFF Research Database (Denmark)

    Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon

    2015-01-01

    damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...

  5. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Energy Technology Data Exchange (ETDEWEB)

    Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2015-04-15

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  6. Investigating the Role of the Arabidopsis Homologue of the Human G3BP in RNA Metabolism, Cellular Stress Responses and Innate Immunity

    KAUST Repository

    Abulfaraj, Aala A.

    2018-04-01

    Mitogen-activated protein kinases (MAPKs) belong to the most conserved signaling pathways and are found in all eukaryotes, including humans where they play important roles in various diseases and cancer. Stimulation of this signal transduction pathway by microbe-associated molecular patterns (MAMP) results in a multitude of events to regulate innate immune responses in Arabidopsis thaliana stimulating large-scale changes in gene expression. Starting from a phosphoproteomic screen in Arabidopsis thaliana wild type and mpk3, mpk4 and mpk6 mutants following microbe-associated molecular pattern (MAMP) treatment, several novel chromatin-associated proteins were identified that are differentially phosphorylated by stress-induced protein kinases. Arabidopsis Ras GTPase-activating protein SH3-domain-binding protein (AtG3BP-1) is a downstream putative substrate of the MAMP-stimulated MAPK pathway that is phosphorylated by MPK3, 4 and 6 in in vitro kinase assays. AtG3BP1 belongs to a highly conserved family of RNA-binding proteins in eukaryotes that link kinase receptormediated signaling to RNA metabolism. Here, we report the characterization of the Arabidopsis homolog of human G3BP1 in plant innate immunity. AtG3BP1 negatively regulates plant immunity and defense immune responses. Atg3bp1 mutant lines show constitutive stomata closure, expression of a number of key defense marker genes, and accumulate salicylic acid but not jasmonic acid. Furthermore, Atg3bp1 plants exhibit enhanced resistance to the biotrophic pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated by stomatal and apoplastic immunity in Atg3bp1. More generally, our data reinforce that AtG3BP1 is a key mediator of plant defense responses and transient expression of AtG3BP1 delivered striking disease resistance in the absence of yield penalty, highlighting a potential application of this gene in crop protection.

  7. BP and Mobil present a united front in Europe

    International Nuclear Information System (INIS)

    Jackson, Kim.

    1997-01-01

    BP and Mobil announced the pooling of their European refining, marketing and lubricants businesses in February last year in an unprecedented step to cut costs and improve their competitive position in what is becoming an increasingly cut-throat market. Like their competitors, the two companies had been battling to contented with the continuing surplus refining capacity throughout Europe as well as significantly reduced profit margins on gasoline and other products sold at the pumps. This was particularly the case in the United Kingdom which is still reeling from the effects of the petrol pump price war waged over the past year and in France, too, where the hypermarkets are fiercely battling to retain their market share. (author)

  8. Characterization of the Particulate Emissions from the BP ...

    Science.gov (United States)

    Opportunistic particle samples were gathered from the sail of a tethered aerostat during at-sea plume sampling of the purposely-burned surface oil during the BP Deepwater Horizon disaster in the Gulf of Mexico. Particles were analyzed for polycyclic aromatic hydrocarbons (PAHs), organic carbon (OC), elemental carbon (EC), metals, and polychlorinated dibenzodioxins/dibenzofurans (PCDDs/PCDFs). Emission factors were calculated using previous sampling values of background-adjusted CO2 and particulate matter (PM)-bound C. The mean of five thermal-optical analyses indicated that the burned crude oil particulate matter was 93% carbon (w/w) with the predominance being refractory elemental carbon (82% w/w) on average. PAHs accounted for roughly 60 ug/g of the PM mass or 4.5 mg/kg oil burned, at least an order of magnitude less than earlier laboratory based studies. Microscopy indicates that the soot from the in situ oil burns is distinct from more common soot by its aggregate size, primary particle size, and nanostructure within the primary particles. The PCDD/PCDF concentration of the PM was 1.5 to 3.3 ng toxic equivalency (TEQ)/kg PM sampled, about 10-fold lower than from a previous dedicated gas/solid sample, indicating loss of small particle-bound and more volatile PCDD/PCDF congeners through the aerostat sail. This work presents an analysis of smoke particles opportunistically caught during the in situ surface oil burns during the 2010 BP Deepwater Horizon di

  9. Visitors' perception of thermal comfort during extreme heat events at the Royal Botanic Garden Melbourne

    Science.gov (United States)

    Lam, Cho Kwong Charlie; Loughnan, Margaret; Tapper, Nigel

    2018-01-01

    Outdoor thermal comfort studies have mainly examined the perception of local residents, and there has been little work on how those conditions are perceived differently by tourists, especially tourists of diverse origins. This issue is important because it will improve the application of thermal indices in predicting the thermal perception of tourists. This study aims to compare the differences in thermal perception and preferences between local and overseas visitors to the Royal Botanic Garden (RBG) in Melbourne during summer. An 8-day survey was conducted in February 2014 at four sites in the garden ( n = 2198), including 2 days with maximum temperature exceeding 40 °C. The survey results were compared with data from four weather stations adjacent to the survey locations. One survey location, `Fern Gully', has a misting system and visitors perceived the Fern Gully to be cooler than other survey locations. As the apparent temperature exceeded 32.4 °C, visitors perceived the environment as being `warm' or `hot'. At `hot' conditions, 36.8 % of European visitors voted for no change to the thermal conditions, which is considerably higher than the response from Australian visitors (12.2 %) and Chinese visitors (7.5 %). Study results suggest that overseas tourists have different comfort perception and preferences compared to local Australians in hot weather based at least in part on expectations. Understanding the differences in visitors' thermal perception is important to improve the garden design. It can also lead to better tour planning and marketing to potential visitors from different countries.

  10. Characterisation of microRNAs from apple (Malus domestica 'Royal Gala') vascular tissue and phloem sap.

    Science.gov (United States)

    Varkonyi-Gasic, Erika; Gould, Nick; Sandanayaka, Manoharie; Sutherland, Paul; MacDiarmid, Robin M

    2010-08-04

    Plant microRNAs (miRNAs) are a class of small, non-coding RNAs that play an important role in development and environmental responses. Hundreds of plant miRNAs have been identified to date, mainly from the model species for which there are available genome sequences. The current challenge is to characterise miRNAs from plant species with agricultural and horticultural importance, to aid our understanding of important regulatory mechanisms in crop species and enable improvement of crops and rootstocks. Based on the knowledge that many miRNAs occur in large gene families and are highly conserved among distantly related species, we analysed expression of twenty-one miRNA sequences in different tissues of apple (Malus x domestica 'Royal Gala'). We identified eighteen sequences that are expressed in at least one of the tissues tested. Some, but not all, miRNAs expressed in apple tissues including the phloem tissue were also detected in the phloem sap sample derived from the stylets of woolly apple aphids. Most of the miRNAs detected in apple phloem sap were also abundant in the phloem sap of herbaceous species. Potential targets for apple miRNAs were identified that encode putative proteins shown to be targets of corresponding miRNAs in a number of plant species. Expression patterns of potential targets were analysed and correlated with expression of corresponding miRNAs. This study validated tissue-specific expression of apple miRNAs that target genes responsible for plant growth, development, and stress response. A subset of characterised miRNAs was also present in the apple phloem translocation stream. A comparative analysis of phloem miRNAs in herbaceous species and woody perennials will aid our understanding of non-cell autonomous roles of miRNAs in plants.

  11. Characterisation of microRNAs from apple (Malus domestica 'Royal Gala' vascular tissue and phloem sap

    Directory of Open Access Journals (Sweden)

    Varkonyi-Gasic Erika

    2010-08-01

    Full Text Available Abstract Background Plant microRNAs (miRNAs are a class of small, non-coding RNAs that play an important role in development and environmental responses. Hundreds of plant miRNAs have been identified to date, mainly from the model species for which there are available genome sequences. The current challenge is to characterise miRNAs from plant species with agricultural and horticultural importance, to aid our understanding of important regulatory mechanisms in crop species and enable improvement of crops and rootstocks. Results Based on the knowledge that many miRNAs occur in large gene families and are highly conserved among distantly related species, we analysed expression of twenty-one miRNA sequences in different tissues of apple (Malus x domestica 'Royal Gala'. We identified eighteen sequences that are expressed in at least one of the tissues tested. Some, but not all, miRNAs expressed in apple tissues including the phloem tissue were also detected in the phloem sap sample derived from the stylets of woolly apple aphids. Most of the miRNAs detected in apple phloem sap were also abundant in the phloem sap of herbaceous species. Potential targets for apple miRNAs were identified that encode putative proteins shown to be targets of corresponding miRNAs in a number of plant species. Expression patterns of potential targets were analysed and correlated with expression of corresponding miRNAs. Conclusions This study validated tissue-specific expression of apple miRNAs that target genes responsible for plant growth, development, and stress response. A subset of characterised miRNAs was also present in the apple phloem translocation stream. A comparative analysis of phloem miRNAs in herbaceous species and woody perennials will aid our understanding of non-cell autonomous roles of miRNAs in plants.

  12. Network Centric Warfare Concepts in the Royal Netherlands Army C2 Architecture

    NARCIS (Netherlands)

    Meijden, M.G. van der

    2004-01-01

    The Royal Netherlands Army (RNLA) has been working on its second generation C2 Information System since 2000. Its first generation Integrated Staff Information System (ISIS) that is currently deployed is based on ATCCIS specifications and uses the ATCCIS Replication Mechanism for database to

  13. Reflections on a Degree Initiative: The UK's Birmingham Royal Ballet Dancers Enter the University of Birmingham

    Science.gov (United States)

    Benn, Tansin

    2003-01-01

    This paper provides an opportunity to share experiences and perceptions of the first 5 years of a degree programme for professional dancers. A partnership developed in the mid-1990s between the UK's Birmingham Royal Ballet and the University of Birmingham, Westhill (now School of Education), to provide a part-time, post-experience, flexible study…

  14. Linguistica Neerlandica: a Dutch translation of the Port-Royal Grammar

    NARCIS (Netherlands)

    Noordegraaf, J.

    1978-01-01

    In this note it is pointed out that the first translation of the so-called Port-Royal Grammar, the Grammaire générale et raisonnée (1660), was a Dutch one. The translator was the Amsterdam Johanna Corleva (1698-1752); the translation appeared in Amsterdam in 1740.

  15. 78 FR 42512 - Application to Export Electric Energy; Royal Bank of Canada

    Science.gov (United States)

    2013-07-16

    ... Canada AGENCY: Office of Electricity Delivery and Energy Reliability, DOE. ACTION: Notice of application. SUMMARY: Royal Bank of Canada (RBC) has applied to renew its authority to transmit electric energy from the United States to Canada pursuant to section 202(e) of the Federal Power Act. DATES: Comments...

  16. Amateur Hour: Culture, Capital, and the Royal Shakespeare Company's Open Stages Initiative

    Science.gov (United States)

    Flynn, Molly

    2017-01-01

    In 2011, the Royal Shakespeare Company (RSC) began a series of collaborations with established amateur theatre groups from across the UK. The initiative now known as Open Stages became one of the most ambitious educational outreach programmes ever run by the RSC, engaging hundreds of amateur theatre practitioners in a process of skills sharing and…

  17. Gideon Fagan's studies at the Royal College of Music in London ...

    African Journals Online (AJOL)

    The South African composer Gideon Fagan (1904-1980) studied at the Royal College of Music (RCM) in London between 1922 and 1926. Fagan followed in the footsteps of his elder brother Johannes (1898-1920) who had committed suicide in 1920 while a student at the RCM. Considering his brother's tragic death, ...

  18. Field Philosophy: Environmental Learning and Moral Development in Isle Royale National Park

    Science.gov (United States)

    Goralnik, Lissy; Nelson, Michael Paul

    2017-01-01

    We conducted a qualitative analysis of 5 years of student writing data to understand learning and moral development on a field philosophy course in Isle Royale National Park. We were interested in the connection between physical experiences in the natural world and the way students care about or value nonhuman beings, natural systems, and place.…

  19. Effect of different levels of royal jelly on biochemical parameters of ...

    African Journals Online (AJOL)

    Administrator

    2011-09-12

    Sep 12, 2011 ... Forty (40) healthy male swimmers aged 18 to 25 years old performing the ... jelly capsules were administered 20 to 30 min before breakfast ..... mental groups. In a mouse study, ALT enzyme levels did not differ significantly (Kanbur et al., 2009). A 6 week royal jelly supplementation in different dosages (200,.

  20. The Case of the Royal School of Library and Information Science

    DEFF Research Database (Denmark)

    Borlund, Pia

    2010-01-01

    The present paper forms the basis of the invited talk to be given by the author at the International Symposium on the Transformation and Innovation of Library and Information Science, November 16-17, 2010, Taipei, Taiwan. The paper introduces the Royal School of Library and Information Science...

  1. Royal policies regarding common lands in late medieval castilian councils of realengo

    Directory of Open Access Journals (Sweden)

    Corina Luchía

    2008-12-01

    Full Text Available The aim of this study is to understand the oscillations of royal policy regarding common lands in the area of Castilian councils during the later Middle Ages. The relation between the central power and the dominant local groups is analysed, which reveals a set of policies ranging from negotiation to competence. Collective property, which is sometimes defended and sometimes attacked, is part of the complex framework of interests through which royal domination is articulated. The Crown need of support at the local level often contradicts the seigneurial attemps to invade common lands, which put at risk the political authority of the king as well as his base of social reproduction, inasmuch as both the privatization of commons and the imposition of coercive powers over communities imply a decrease in the level of royal revenues. The oscillations that royal behaviour shows with regard to common property protection responds to the delicate balance between the monarchy and the forces that supports feudal domination in the cities and villages.

  2. Dr. Steve Thompson, Chief Executive, The Royal Society of New Zealand

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    L. to r.: Dr Austin Ball, Deputy Technical Coordinator, CMS experiment; Dr Roland Horisberger, Paul Scherrer Institute and CERN, CMS experiment; Dr Steve Thompson, Chief Executive, The Royal Society of New Zealand; Dr Michel Della Negra, Spokesman, CMS experiment and Dr Alick Macpherson, Paul Scherrer Institute and CERN, CMS experiment, in the CMS Silicon Tracker assembly hall.

  3. Royal Ahold : A Failure of Corporate Governance and an Accounting Scandal

    NARCIS (Netherlands)

    de Jong, A.; DeJong, D.V.; Mertens, G.M.H.; Roosenboom, P.G.J.

    2005-01-01

    Royal Ahold (Koninklijke Ahold NV) was one of the major success stories in the 1990s and is one of the major failures, suffering a complete meltdown, in 2003.We investigate the strategy, accounting transparency and corporate governance of Ahold; elements which jointly drive the firm s performance

  4. Berta and Adelaide: the policy of consolidation of the royal power of Hugh of Arles

    Directory of Open Access Journals (Sweden)

    Giacomo Vignodelli

    2012-10-01

    Full Text Available Both twins dowers made up by Hugh of Provence, king of Italic Kingdom, for his betrothal with Berta and that of his son Lothair with Adelaide, have to be understood within the policy of strengthening the royal power led by the king in the Thirties of the Tenth century: the dowers are in fact the crown of that policy. The double dower constitution supplies the king of Italy the opportunity to reserve for himself (and for the new formed young royal couple a strong control of the center of the Po valley around Pavia and dismantles (for the benefit of the royal domain ducal bases of power in Tuscia. The analysis of the work of Hugh allows us to understand its policy towards the aristocracy and the mechanisms for the promotion of new families (Aleramici, Obertenghi, Canossa. The original documents of dower were kept in the monastery of St. Salvatore of Pavia, founded by Adelaide; this locations isn’t due to the goods endowment of the monastery but to their importance as instrument of political legitimacy of the new Ottonian royal family.

  5. Compromises in orchestra pit design: A ten-year trench war in The Royal Theatre, Copenhagen

    DEFF Research Database (Denmark)

    Gade, Anders Christian; Mortensen, Bo

    1998-01-01

    The ``old stage'' of The Royal Theatre in Copenhagen-a classical horseshoe theatre with an almost flat audience floor and four balcony levels—is the primary opera and ballet theatre in Denmark. In the early 1980s the orchestra pit was enlarged and its size made flexible. However, in the following...

  6. Royal Service tegutseb üheksas riigis / Paavo Pilv ; interv. Eda-Liis Kann

    Index Scriptorium Estoniae

    Pilv, Paavo

    2004-01-01

    Äripäeva üritusturundusfirmade TOP-is I koha saavutanud Royal Service-i juht ettevõtte edukuse põhjustest, olulisematest töödest 2003. aastal, üritusturunduse tulevikutrendidest ja EL-iga liitumise mõjust valdkonna arengule

  7. Depression riots and the calling of the 1897 West India Royal Commission

    Directory of Open Access Journals (Sweden)

    Bonham C. Richardson

    1992-07-01

    Full Text Available Questions why the West India Royal Commission of 1897 was considered necessary when serious distress already existed in the 1880s. Author argues that riots caught the government's attention much more readily than statistical data. Even minor disturbances could have distracted London from its preoccupation with the newer, more important parts of the Empire.

  8. Integrating Social Sustainability in Engineering Education at the KTH Royal Institute of Technology

    Science.gov (United States)

    Björnberg, Karin Edvardsson; Skogh, Inga-Britt; Strömberg, Emma

    2015-01-01

    Purpose: The purpose of this paper is to investigate what are perceived to be the main challenges associated with the integration of social sustainability into engineering education at the KTH Royal Institute of Technology, Stockholm. Design/methodology/approach: Semi-structured interviews were conducted with programme leaders and teachers from…

  9. Applying Lean to the AC-130 Maintenance Process for the Royal Saudi Air Force

    Science.gov (United States)

    2016-09-01

    Applying lean thinking in construction and performance improvement. Alexandria Engineering Journal, 52(4), 679–695. http://doi.org/10.1016/j.aej...APPLYING LEAN TO THE AC-130 MAINTENANCE PROCESS FOR THE ROYAL SAUDI AIR FORCE THESIS...Organization or any other defense organization. AFIT-ENS-MS-16-S-024 APPLYING LEAN TO THE

  10. Condensation system with seawater in the Royal Solaris Hotel of Cancun; Sistema de condensacion con agua salada en el hotel Royal Solaris de Cancun

    Energy Technology Data Exchange (ETDEWEB)

    Herrero, Juan F.; Hernandez A, David [Celsol, S.A. de C.V., Nuevo Leon (Mexico)

    1999-07-01

    After performing a technical study, during the month of September of 1998, in the facilities of Villas Solaris, S.A. de C.V., specifically in the Royal Solaris Hotel, towers Royal and Caribe, important opportunities of saving were found, which were evaluated technical and economically to be able to present to Villa Solaris, S.A. of C.V., an energy saving project highly profitable that allows to obtain great economic benefits, a better service for the hosts and an important step to the reduction of the operative expenses (energy), that guaranteed the future competitiveness of the hotel in the zone. The base of the energy saving opportunities is the substitution of the air conditioning equipment, since the installed ones in the Hotel, are very deficient equipment (piston in Caribbean Tower) or because of by International ecological Norms they will be obsolete in short time (centrifugal R-11 Torre Royal). In addition the service machine area of the Hotel was centralized in a single site. The substitution measure of the air conditioning systems, contemplated the installation of centrifugal equipment of high efficiency (0.65kW/Ton at full load) cooled with brackish water, that is a very abundant resource in the zone and does not represent any cost for the Hotel. The waste heat of the refrigeration machines is contemplated to be used to preheat the service water and the swimming pool water by means of heat exchange equipment. In order to arrive to the desired optimal temperatures the advantage of the installation of the already existing in the Hotel thermo solar systems was taken into consideration. When implementing this global system, the use of cooling towers was eliminated, that was the equipment that cools the condensation water of the air conditioning equipment. In addition the use of the steam boilers was eliminated that made the function of warming up the service water, reason why an important saving of fuel was generated. [Spanish] Despues de haber realizado un

  11. RanBP3 influences interactions between CRM1 and its nuclear protein export substrates

    OpenAIRE

    Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike

    2001-01-01

    We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...

  12. The Immune Signaling Adaptor LAT Contributes to the Neuroanatomical Phenotype of 16p11.2 BP2-BP3 CNVs

    NARCIS (Netherlands)

    Loviglio, Maria Nicla; Arbogast, Thomas; Jønch, Aia Elise; Collins, Stephan C.; Popadin, Konstantin; Bonnet, Camille S.; Giannuzzi, Giuliana; Maillard, Anne M.; Jacquemont, Sébastien; Loviglio, Maria Nicla; Jønch, Aia Elise; Popadin, Konstantin; Giannuzzi, Giuliana; Maillard, Anne M.; Fagerberg, Christina; Andersen, Charlotte Brasch; Doco-Fenzy, Martine; Delrue, Marie-Ange; Faivre, Laurence; Arveiler, Benoit; Geneviève, David; Schneider, Anouck; Gerard, Marion; Andrieux, Joris; El Chehadeh, Salima; Schaefer, Elise; Depienne, Christel; Van Haelst, Mieke; Brilstra, Eva H.; Van Binsbergen, Ellen; van Harssel, Jeske; van der Veken, Lars T.; Gusella, James F; Shen, Yiping; Mitchell, Elyse; Kini, Usha; Hawkes, Lara; Campbell, Carolyn; Butschi, Florence Niel; Addor, Marie Claude; Beckmann, Jacques S.; Jacquemont, Sébastien; Reymond, Alexandre; Yalcin, Binnaz; Katsanis, Nicholas; Golzio, Christelle; Reymond, Alexandre

    2017-01-01

    Copy-number changes in 16p11.2 contribute significantly to neuropsychiatric traits. Besides the 600 kb BP4-BP5 CNV found in 0.5%–1% of individuals with autism spectrum disorders and schizophrenia and whose rearrangement causes reciprocal defects in head size and body weight, a second distal 220 kb

  13. Pere Albert: Barcelona Canon, Royal Advocate, Feudal Theorist

    Directory of Open Access Journals (Sweden)

    Kagay, Donald K.

    2002-06-01

    Full Text Available In this article, the life and career of one of Catalonia's greatest medieval legists is discussed. Using notarial and court documentation, the author explores the work of Pere Albert as judge and advocate. The Customs of Catalonia and other of Pere Albert's treatises form the basis for the review of the legist's career as a theorist in feudal law. The basis for this article is the collection of documents pertaining to Pere Albert, which the author includes in an appendix.

    En este artículo se estudia la vida y la carrera de uno de los jurisconsultos medievales más importantes de Cataluña. Utilizando la documentación notarial y judicial, el autor analiza la labor de Pere Albert como juez y abogado. ElsCostums de Catalunya y otros tratados de Pere Albert constituyen la base para el estudio de la carrera del jurisconsulto, como teórico en ley feudal y real. El artículo se basa en una colección de documentos originales relativos a Pere Albert, que el autor incluye en un apéndice.

  14. Anti-inflammatory effects of royal jelly on ethylene glycol induced renal inflammation in rats

    Directory of Open Access Journals (Sweden)

    Zeyneb Aslan

    2015-10-01

    Full Text Available ABSTRACT Objective: In this study, anti-inflammatory effects of Royal Jelly were investigated by inducing renal inflammation in rats with the use of ethylene glycol. For this purpose, the calcium oxalate urolithiasis model was obtained by feeding rats with ethylene glycol in drinking water. Materials and Methods: The rats were divided in five study groups. The 1st group was determined as the control group. The rats in the 2nd group received ethylene glycol (1% in drinking water. The rats in the 3rd group were daily fed with Royal Jelly by using oral gavage. The 4th group was determined as the preventive group and the rats were fed with ethylene glycol (1% in drinking water while receiving Royal Jelly via oral gavage. The 5th group was determined as the therapeutic group and received ethylene glycol in drinking water during the first 2 weeks of the study and Royal Jelly via oral gavage during the last 2 weeks of the study. Results: At the end of the study, proinflammatory/anti-inflammatory cytokines, TNF-α, IL-1β and IL-18 levels in blood and renal tissue samples from the rats used in the application were measured. Conclusion: The results have shown that ethylene glycol does induce inflammation and renal damage. This can cause the formation of reactive oxygen species. Royal Jelly is also considered to have anti-inflammatory effects due to its possible antiradical and antioxidative effects. It can have positive effects on both the prevention of urolithiasis and possible inflammation during the existing urolithiasis and support the medical treatment.

  15. Evaluation of propolis, honey, and royal jelly in amelioration of peripheral blood leukocytes and lung inflammation in mouse conalbumin-induced asthma model.

    Science.gov (United States)

    El-Aidy, Waleed K; Ebeid, Ahmad A; Sallam, Abd El-Raouf M; Muhammad, Ibrahim E; Abbas, Ayman T; Kamal, M A; Sohrab, Sayed Sartaj

    2015-11-01

    Bee products have been used since ancient times to treat many diseases, including respiratory ailments. The present study aimed to examine the modulatory effect of honey, royal jelly, and propolis extract on peripheral blood leukocytes and lung inflammation in a mouse conalbumin-induced asthma model. The mice in group I were not sensitised or treated; they were kept as controls. The mice in group II were sensitised and challenged with conalbumin. Twenty-four hours after the first challenge with antigen, the mice in group III received 0.5 mg/kg of dexamethasone intraperitoneally per day for 18 consecutive days and kept as positive controls. The mice in groups IV, V, and VI received 650, 1000, and 30 mg/kg of honey, royal jelly, and propolis (aqueous and ethanolic extract), respectively, once per day for 18 consecutive days. Blood was collected from all of the mice for white blood cell differentiation, and the lungs were removed for histopathological studies. The groups treated with propolis extract exhibited considerable ameliorative effects against asthma, which might be explained by the flavonoids and phenolics found in propolis, which might have antioxidative effects. Otherwise, the sensitised and honey- or royal jelly-treated groups exhibited an increased incidence of asthma cascade events due to increased inflammatory cells. These results might be due to the immunostimulatory and vasodilatory effects of royal jelly and honey, which are antagonistic to bronchial asthma cases. Histopathological examination revealed that the sensitised treated propolis extract groups had significant decreases in inflammatory scores compared with other treatments and the sensitised untreated group. These results confirmed the previous data of peripheral blood cells.

  16. The Royal Book by Haly Abbas from the 10th century: one of the earliest illustrations of the surgical approach to skull fractures.

    Science.gov (United States)

    Aciduman, Ahmet; Arda, Berna; Kahya, Esin; Belen, Deniz

    2010-12-01

    Haly Abbas was one of the pioneering physicians and surgeons of the Eastern world in the 10th century who influenced the Western world by his monumental work, The Royal Book. The book was first partly translated into Latin by Constantinus Africanus in the 11th century without citing the author's name. Haly Abbas was recognized in Europe after full translation of The Royal Book by Stephen of Antioch in 1127. The Royal Book has been accepted as an early source of jerrah-names (surgical books) in the Eastern world. The chapters regarding cranial fractures in Haly Abbas' work include unique management strategies for his period with essential quotations from Paul of Aegina's work Epitome. Both authors preferred free bone flap craniotomy in cranial fractures. Although Paul of Aegina, a Byzantine physician and surgeon, was a connection between ancient traditions and Islamic interpretation, Haly Abbas seemed to play a bridging role between the Roman-Byzantine and the School of Salerno in Europe.

  17. The Effects of Royal Jelly on In-Vitro Cytotoxicity of K562 Cells and Peripheral Blood Mononuclear Cells

    Directory of Open Access Journals (Sweden)

    SE Hosseini

    2014-02-01

    Full Text Available Abstract Background & aim: Royal jelly, secreted by worker bees, has different biological activities on cells and tissues. The aim of this study was to evaluate the effects of royal jelly on peripheral blood mononuclear cells and on the tumor category of K562 cell line. Methods: In the present experimental study, three subjects were selected separately with three repetitions. K562 (104 cells and PBMC (105 cells with different concentrations of royal jelly (5, 10, 25, 50 and 100 mg/ml were cultured under standard conditions for 48 and 72 h separately. The fatality rate on PBMC cells and K562 cancer cells was evaluated by using MTT (Tetrazolium Dye-Reduction Assay. The number of viable cells in PBMC that were exposed for 48 hours with Royal Jelly was evaluated by trypan blue staining. Data were analyzed by ANOVA. Results: The royal jelly had no cytotoxicity effect on PBMC cells but at concentration of 50 and 100 mg/mL the cytotoxicity effect were observed on k562 cells whereas, at 10 and 25 mg/ml the number of PBMC viable cells increased. Conclusion: Due to the lack of lethality of royal jelly on PBMC cells and PBMC cell viability and an increase in the fatality rate of cancer cells in the future, royal jelly can be used as a potential candidate for treatment of leukemia. Keywords: Royal jelly, K562, peripheral blood mononuclear cell

  18. Determination of (2E-10-hydroxydec-2-enoic acid in Croatian royal jelly by high-performance liquid chromatography

    Directory of Open Access Journals (Sweden)

    Ivana Flanjak

    2017-01-01

    Full Text Available Although health-promoting properties of royal jelly are known for many years, the absence of quality standards and methods prescribed for their determination leads to royal jelly adulteration. Royal jelly is a source of unique unsaturated fatty acid, (2E-10-hydroxydec-2-enoic acid (10-HDA, and its content is considered as one of the freshness and authenticity parameter. In this study, high performance liquid chromatographic method (HPLC with UV detection was validated and 10-HDA content in fresh royal jelly samples produced in Eastern Croatia was determined. The data about Croatian royal jelly are not available, therefore the results presented in this study could be considered as pioneer results for Croatian royal jelly characterization in respect of the 10-HDA. Method performance characteristics showed that the used method is fit for purpose. The content of 10-HDA in analysed samples varied from 1.56% up to 3.78%. According to the international recommendations for royal jelly quality, samples were fresh and authentic regarding 10-HDA content. Furthermore, the effect of packaging material on 10-HDA content was observed. Based on the obtained results, the conclusion was reached that if the samples were collected at the same time and frozen after collection, collection and storage of fresh royal jelly in glass and plastic containers had no effect on 10-HDA content.

  19. BRCA1 Directs the Repair Pathway to Homologous Recombination by Promoting 53BP1 Dephosphorylation

    Directory of Open Access Journals (Sweden)

    Mayu Isono

    2017-01-01

    Full Text Available BRCA1 promotes homologous recombination (HR by activating DNA-end resection. By contrast, 53BP1 forms a barrier that inhibits DNA-end resection. Here, we show that BRCA1 promotes DNA-end resection by relieving the 53BP1-dependent barrier. We show that 53BP1 is phosphorylated by ATM in S/G2 phase, promoting RIF1 recruitment, which inhibits resection. 53BP1 is promptly dephosphorylated and RIF1 released, despite remaining unrepaired DNA double-strand breaks (DSBs. When resection is impaired by CtIP/MRE11 endonuclease inhibition, 53BP1 phosphorylation and RIF1 are sustained due to ongoing ATM signaling. BRCA1 depletion also sustains 53BP1 phosphorylation and RIF1 recruitment. We identify the phosphatase PP4C as having a major role in 53BP1 dephosphorylation and RIF1 release. BRCA1 or PP4C depletion impairs 53BP1 repositioning, EXO1 recruitment, and HR progression. 53BP1 or RIF1 depletion restores resection, RAD51 loading, and HR in PP4C-depleted cells. Our findings suggest that BRCA1 promotes PP4C-dependent 53BP1 dephosphorylation and RIF1 release, directing repair toward HR.

  20. Functional interaction between type III-secreted protein IncA of Chlamydophila psittaci and human G3BP1.

    Science.gov (United States)

    Borth, Nicole; Litsche, Katrin; Franke, Claudia; Sachse, Konrad; Saluz, Hans Peter; Hänel, Frank

    2011-01-31

    Chlamydophila (Cp.) psittaci, the causative agent of psittacosis in birds and humans, is the most important zoonotic pathogen of the family Chlamydiaceae. These obligate intracellular bacteria are distinguished by a unique biphasic developmental cycle, which includes proliferation in a membrane-bound compartment termed inclusion. All Chlamydiaceae spp. possess a coding capacity for core components of a Type III secretion apparatus, which mediates specific delivery of anti-host effector proteins either into the chlamydial inclusion membrane or into the cytoplasm of target eukaryotic cells. Here we describe the interaction between Type III-secreted protein IncA of Cp. psittaci and host protein G3BP1 in a yeast two-hybrid system. In GST-pull down and co-immunoprecipitation experiments both in vitro and in vivo interaction between full-length IncA and G3BP1 were shown. Using fluorescence microscopy, the localization of G3BP1 near the inclusion membrane of Cp. psittaci-infected Hep-2 cells was demonstrated. Notably, infection of Hep-2 cells with Cp. psittaci and overexpression of IncA in HEK293 cells led to a decrease in c-Myc protein concentration. This effect could be ascribed to the interaction between IncA and G3BP1 since overexpression of an IncA mutant construct disabled to interact with G3BP1 failed to reduce c-Myc concentration. We hypothesize that lowering the host cell c-Myc protein concentration may be part of a strategy employed by Cp. psittaci to avoid apoptosis and scale down host cell proliferation.

  1. Questionable accuracy of home blood pressure measurements in the obese population - Validation of the Microlife WatchBP O3®and Omron RS6®devices according to the European Society of Hypertension-International Protocol.

    Science.gov (United States)

    Azaki, Alaa; Diab, Reem; Harb, Aya; Asmar, Roland; Chahine, Mirna N

    2017-01-01

    Two oscillometric devices, the Microlife WatchBP O3 ® and the Omron RS6 ® , designed for self-blood pressure measurement were evaluated according to the European Society of Hypertension (ESH)-International Protocol (IP) Revision 2010 in the obese population. The Microlife WatchBP O3 measures blood pressure (BP) at the brachial level and the Omron RS6 measures BP at the wrist level. The ESH-IP revision 2010 includes a total of 33 subjects. The difference between observers' and device BP values was calculated for each measure. A total of 99 pairs of BP differences were classified into three categories (≤5, ≤10, and ≤15 mmHg). The protocol procedures were followed precisely in each of the two studies. Microlife WatchBP O3 and Omron RS6 failed to fulfill the criteria of the ESH-IP. The mean differences between the device and the mercury readings were: 0.3±7.8 mmHg and -1.9±6.4 mmHg for systolic BP and diastolic BP, respectively, for Microlife WatchBP O3, and 2.7±9.9 mmHg for SBP and 3.5±11.1 mmHg for diastolic BP for Omron RS6. Microlife WatchBP O3 and Omron RS6 readings differing from the mercury standard by more than 5, 10, and 15 mmHg failed to fulfill the ESH-IP revision 2010 requirements in obese subjects. Therefore, the two devices cannot be recommended for use in obese subjects.

  2. Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.

    Science.gov (United States)

    Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W

    2017-12-01

    We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.

  3. Mid-wavelength infrared unipolar nBp superlattice photodetector

    Science.gov (United States)

    Kazemi, Alireza; Myers, Stephen; Taghipour, Zahra; Mathews, Sen; Schuler-Sandy, Ted; Lee, Seunghyun; Cowan, Vincent M.; Garduno, Eli; Steenbergen, Elizabeth; Morath, Christian; Ariyawansa, Gamini; Scheihing, John; Krishna, Sanjay

    2018-01-01

    We report a Mid-Wavelength Infrared (MWIR) barrier photodetector based on the InAs/GaSb/AlSb type-II superlattice (T2SL) material system. The nBp design consists of a single unipolar barrier (InAs/AlSb SL) placed between a 4 μm thick p-doped absorber (InAs/GaSb SL) and an n-type contact layer (InAs/GaSb SL). At 80 K, the device exhibited a 50% cut-off wavelength of 5 μm, was fully turned-ON at zero bias and the measured QE was 50% (front side illumination with no AR coating) at 4.5 μm with a dark current density of 4.7 × 10-6 A/cm2 at Vb = 50 mV. At 150 K and Vb = 50 mV, the 50% cut-off wavelength increased to 5.3 μm, and the QE was 54% at 4.5 μm with a dark current of 5.0 × 10-4 A/cm2.

  4. Publication rate of General Surgery abstracts presented at the Royal Australasian College of Surgeons Annual Scientific Congress.

    Science.gov (United States)

    Khajehnoori, Masoomeh; Stupart, Douglas; Watters, David

    2017-07-06

    A commonly used metric for evaluating the quality and impact of presentations at a scientific meeting is the frequency with which the findings presented are published as full research papers in peer-reviewed journals. The purpose of this study was to determine the full article publication rates of abstract presentations for General Surgery and related sub-specialities at the Royal Australasian College of Surgeons Annual Scientific Congress (RACS ASC) from 2010 to 2014. All General Surgical (including its sub-speciality groups) abstracts presented at the RACS ASC from 2010 to 2014 were identified from the ANZ Journal of Surgery. We determined the rates of full paper publication, time to publication, journals of publication and specialty rates of conversion. Full article publications were identified using the PubMed, MEDLINE and Google Scholar databases. A total of 1386 abstracts were identified, of which 356 (26%) were converted to full paper publications. The number of abstracts presented annually increased from 206 in 2010 to 386 in 2014, but the percentage of abstracts converted to full paper publications did not follow any temporal trend. The majority (74%) of full papers were published within 2 years of the abstract presentation. In total, 26% of General Surgery abstracts presented at the RACS ASC from 2010 to 2014 were converted to full paper publications. This could provide a baseline against which to judge the quality of presentations at other national General Surgical congresses, as well as at future RACS ASC meetings. © 2017 Royal Australasian College of Surgeons.

  5. Pod-1/Capsulin shows a sex- and stage-dependent expression pattern in the mouse gonad development and represses expression of Ad4BP/SF-1.

    Science.gov (United States)

    Tamura, M; Kanno, Y; Chuma, S; Saito, T; Nakatsuji, N

    2001-04-01

    Mammalian sex-determination and differentiation are controlled by several genes, such as Sry, Sox-9, Dax-1 and Mullerian inhibiting substance (MIS), but their upstream and downstream genes are largely unknown. Ad4BP/SF-1, encoding a zinc finger transcription factor, plays important roles in gonadogenesis. Disruption of this gene caused disappearance of the urogenital system including the gonad. Ad4BP/SF-1, however, is also involved in the sex differentiation of the gonad at later stages, such as the regulation of steroid hormones and MIS. Pod-1/Capsulin, a member of basic helix-loop-helix transcription factors, is expressed in a pattern closely related but mostly complimentary to that of the Ad4BP/SF-1 expression in the developing gonad. In the co-transfection experiment using cultured cells, overexpression of Pod-1/Capsulin repressed expression of a reporter gene that carried the upstream regulatory region of the Ad4BP/SF-1 gene. Furthermore, forced expression of Pod-1/Capsulin repressed expression of Ad4BP/SF-1 in the Leydig cell-derived I-10 cells. These results suggest that Pod-1/Capsulin may play important roles in the development and sex differentiation of the mammalian gonad via transcriptional regulation of Ad4BP/SF-1.

  6. Structural diagnosis of historic timber structures: the Diplomatic Room of the of Royal Palace of Naples

    Directory of Open Access Journals (Sweden)

    Donato Calicchio

    2012-12-01

    Full Text Available The aim of this article is to describe the diagnosis process made on the timber structure that holds up the vault of the Diplomatic Room of the Royal Palace in Naples (Italy. After a brief historical description of the Royal Palace and the Diplomatic Room, it discusses the methodology according to Italian regulations and the speci­fic problems that arose during the works. To complete the diagnosis, a dendrochronological analysis of the wooden elements was performed. The results show the residual mechanical properties of each structural element and the main problems to be resolved by the restorers. The dendrochronological conclusions yield that the dating of the elements is compatible with that of the frescoes on the vault and therefore demonstrate that the elements have not been replaced.

  7. Observing the skies of Lisbon. Isaac de Sequeira Samuda, an estrangeirado in the Royal Society.

    Science.gov (United States)

    Vieira, Carla Costa

    2014-06-20

    Elected in 1723, Isaac de Sequeira Samuda (1681-1729) was the first Jewish Fellow of the Royal Society. He had arrived in London just a few years earlier, escaping from the Portuguese Inquisition. Despite his past, he had no difficulty in establishing links with his country's diplomatic representatives in London. A physician and adviser on scientific subjects, he became a conduit between the emerging world of Portuguese astronomy and the British scientific community. He reported to the Royal Society on astronomical observations made in the new observatories in Lisbon and helped with the acquisition of scientific instruments and books destined for Portugal. These activities were facets of Samuda's unusual career and the diverse though often converging associations that he established until his death. As the member of a network active in the diffusion of new ideas and in the modernization of Portuguese science, Samuda can be regarded as an estrangeirado, as this term has come to be used in the modern literature.

  8. The ICT-Integrated Pedagogy in the Colleges of Royal University of Bhutan

    DEFF Research Database (Denmark)

    Choeda, Par-Ola Zander; Penjor, Tandin; Dukpa, Dorji

    2014-01-01

    under Royal University of Bhutan. The study identifies the use of Virtual Learning Environments (VLE), used as part of ICT-integrated pedagogy. However, the use of VLE has been found to be confined to be a platform where activities such as work plan, module descriptors, uploading assignments have been......This paper reports a research study on the integration of ICT and pedagogy in the colleges of the Royal University of Bhutan. It investigates whether ICT is integrated into the pedagogy, and if so, in what way. The samples (Faculty members) of the study were picked up randomly from ten colleges...... done. The interactive teaching-learning via VLE is considerably low, where only a few of the lecturers are found to be using VLE for discussion, class tests and quizzes besides the activities mentioned. The concepts and application of learning design or instructional design are confined to a few...

  9. BpWrapper: BioPerl-based sequence and tree utilities for rapid prototyping of bioinformatics pipelines.

    Science.gov (United States)

    Hernández, Yözen; Bernstein, Rocky; Pagan, Pedro; Vargas, Levy; McCaig, William; Ramrattan, Girish; Akther, Saymon; Larracuente, Amanda; Di, Lia; Vieira, Filipe G; Qiu, Wei-Gang

    2018-03-02

    Automated bioinformatics workflows are more robust, easier to maintain, and results more reproducible when built with command-line utilities than with custom-coded scripts. Command-line utilities further benefit by relieving bioinformatics developers to learn the use of, or to interact directly with, biological software libraries. There is however a lack of command-line utilities that leverage popular Open Source biological software toolkits such as BioPerl ( http://bioperl.org ) to make many of the well-designed, robust, and routinely used biological classes available for a wider base of end users. Designed as standard utilities for UNIX-family operating systems, BpWrapper makes functionality of some of the most popular BioPerl modules readily accessible on the command line to novice as well as to experienced bioinformatics practitioners. The initial release of BpWrapper includes four utilities with concise command-line user interfaces, bioseq, bioaln, biotree, and biopop, specialized for manipulation of molecular sequences, sequence alignments, phylogenetic trees, and DNA polymorphisms, respectively. Over a hundred methods are currently available as command-line options and new methods are easily incorporated. Performance of BpWrapper utilities lags that of precompiled utilities while equivalent to that of other utilities based on BioPerl. BpWrapper has been tested on BioPerl Release 1.6, Perl versions 5.10.1 to 5.25.10, and operating systems including Apple macOS, Microsoft Windows, and GNU/Linux. Release code is available from the Comprehensive Perl Archive Network (CPAN) at https://metacpan.org/pod/Bio::BPWrapper . Source code is available on GitHub at https://github.com/bioperl/p5-bpwrapper . BpWrapper improves on existing sequence utilities by following the design principles of Unix text utilities such including a concise user interface, extensive command-line options, and standard input/output for serialized operations. Further, dozens of novel methods for

  10. Operation Bali assist--the Royal Darwin Hospital Intensive Care Unit.

    Science.gov (United States)

    Stephens, D P; De Keulenaer, B L; Collins, S; Harbison, P W; Weidmann, G; Potter, A W

    2003-06-01

    On October 12, 2002 the Bali bombing resulted in 62 severely injured patients being evacuated to Royal Darwin Hospital. This paper describes the planning and execution of the Intensive Care Unit disaster plan in the wake of the Bali bombing. There were a total of 20 patients from the Bali blast admitted to the Intensive Care Unit. The disaster operation was successful with all patients admitted, resuscitated, emergency treatment performed and then evacuated to interstate burns units in a timely and efficient manner.

  11. Effect of Royal Jelly on Improving Passive Avoidance Learning and Spatial Learning and Memory in Rats

    Directory of Open Access Journals (Sweden)

    H Alaei

    2012-06-01

    Full Text Available Introduction: Studies have proposed that royal jelly(RJ has various biological activities in different cells and tissues. Since it has been demonstrated that RJ contains compounds having desirable effects on central neurons system and neural functions, the present study aimed to investigate the effect of royal jelly on learning and memory in rats. Methods: Male wistar rats were divided into two groups, the royal jelly and the control. In the RJ group, the rats received a food that contained 3% RJ instead of regular food for 10 days. Then learning and memory were investigated in these animals through both passive avoidance learning test(1 day and 1 week after receiving electrical shock and Morris water maze test(1 day and 1 week after a 4-day learning period. Results: The study results indicated that the food containing RJ in the RJ group significantly increased the time of the first entrance to the dark room one week after the electrical shock in passive avoidance learning test. In other words, the findings suggest an improvement of learning and memory in RJ group. In the acquisition phase of Morris water maze test, rats receiving RJ found the underwater escape plate during less time and distance comparing with the control group. Furthermore, one week after the acquisition phase, in the retention phase, rats spent more time in the quadrant in which the escape plate was previously located. Conclusion: The present study findings propose that Royal Jelly can improve cognitive processes through positive effects on neural functions and probably has a significant influence on prevention and therapy of some neuronal disorders.

  12. Nagid: A re-examination in the light of the royal ideology in the ...

    African Journals Online (AJOL)

    p1243322

    Sm 5:2; cf Ps 23). The legitimacy of the Davidic kingship is pinpointed in. Psalm 72 where the king appears as one who brings righteousness (1 Ki 10:9;. Jr 22:3; see also Walton 2006:283) and peace. Zenger (2005:205) contended that Ps 72 reveals “this “mixture” of Egyptian and ancient Near Eastern royal ideology and its ...

  13. Making public ahead of print: Meetings and publications at the Royal Society, 1752?1892

    OpenAIRE

    Fyfe, Aileen; Moxham, Noah

    2016-01-01

    This essay examines the interplay between the meetings and publications of learned scientific societies during the eighteenth and nineteenth centuries, when journals were an established but not yet dominant form of scholarly communication. The practice of ‘making public’ research at meetings, long before actual ‘publication’ in society periodicals, enabled a complex of more-or-less formal sites of communication and discussion ahead of print. Using two case studies from the Royal Society of Lo...

  14. Royal power and space control: monarchs and monasteries of Castile (c. 1312-1390

    Directory of Open Access Journals (Sweden)

    Juan Antonio Prieto Sayagués

    2017-07-01

    Full Text Available In royal monasteries, monarchs not only projected their power, but they also reduced that of nobility and secular prelates through monastic foundations, the granting of privileges and their participation in reforms. Monarchs saw monasteries as a solution to depopulation, and in them kings and their guests were housed, and political ceremonies were held. Religious men occupied posts at court, served as ambassadors and participated in military confrontations.

  15. The dose management approach for a nuclear submarine decommission at Rosyth Royal Dockyard

    International Nuclear Information System (INIS)

    Parish, N.

    1996-01-01

    This paper describes the dose management approach applied to the decommissioning of the nuclear powered submarine HMS revenge at Rosyth Royal Dockyard. This is set within the context of the overall development of dose management policy and practice at Rosyth. The decommission provides a practical examples of how a major decision in relation to dose management was approached, and how the outcome of the decision shaped the further evaluation of dose management policy at Rosyth. (author)

  16. Royal Feuds and the Politics of Sanctity in Anglo-Saxon England and Ottonian Saxony

    OpenAIRE

    Wangerin, Laura

    2014-01-01

    This paper is an examination of sanctification and politics in Anglo-Saxon England and Ottonian Saxony. The evidence suggests that a feud culture and feuding behaviours were the reasons for the proliferation of sanctified murdered Anglo-Saxon kings in the late-eighth through mid-ninth centuries, a phenomenon unique to England in this time period. An investigation of the nature of royal feuds in England, in contrast to those in Saxony, further suggests that the sanctification and cult...

  17. The Avaldsnes Royal Manor Project’s Research Plan and Excavation Objectives

    OpenAIRE

    Skre, Dagfinn

    2017-01-01

    This chapter provides an outline of the scholarly problems that the Avaldsnes Royal Manor Project was designed to address, the central theme explored being the political institutions and processes in the first millennium AD. The research plan was developed during the 2007–9 pilot project phase, and was adjusted and supplemented during the 2011–12 excavations and the research and publication phase in the subsequent years. The first of the research plan’s two sections, the results of which are ...

  18. The transfer of the Portuguese royal family to Brazil: historical explanation in Portuguese and Brazilian students

    Directory of Open Access Journals (Sweden)

    Ronaldo Cardoso Alves

    2012-03-01

    Full Text Available Based on the relationship between the concept of Historical Consciousness, as Jörn Rüsen and Reinhart Koselleck proposed, and the concept of Historical Explanation, proposed by Isabel Barca, the article presents an analytical course that allows you to check levels of explanation in historical narratives produced by students Brazilian and Portuguese from the interpretation of sources related to a historical fact: the transfer of the Portuguese royal family to Brazil (1808.

  19. Royal Observatory extension will teach the wonder of the night sky

    CERN Multimedia

    Jury, L

    2004-01-01

    "The Royal Observatory in Greenwich is gearing up for a massive pounds 15m extension next year, to capitalise on growing interest in outer space. A Victorian building which has been used for administration for decades is to be renovated, with new galleries and a 120-seat planetarium to treble the space for visitors to gaze at the stars. The Observatory hopes to complete the extension by 2007" (1 page).

  20. A new BP Fourier algorithm and its application in English teaching evaluation

    Science.gov (United States)

    Pei, Xuehui; Pei, Guixin

    2017-08-01

    BP neural network algorithm has wide adaptability and accuracy when used in complicated system evaluation, but its calculation defects such as slow convergence have limited its practical application. The paper tries to speed up the calculation convergence of BP neural network algorithm with Fourier basis functions and presents a new BP Fourier algorithm for complicated system evaluation. First, shortages and working principle of BP algorithm are analyzed for subsequent targeted improvement; Second, the presented BP Fourier algorithm adopts Fourier basis functions to simplify calculation structure, designs new calculation transfer function between input and output layers, and conducts theoretical analysis to prove the efficiency of the presented algorithm; Finally, the presented algorithm is used in evaluating university English teaching and the application results shows that the presented BP Fourier algorithm has better performance in calculation efficiency and evaluation accuracy and can be used in evaluating complicated system practically.

  1. The Australian Royal Commission into Institutional Responses to Child Sexual Abuse.

    Science.gov (United States)

    Wright, Katie; Swain, Shurlee; McPhillips, Kathleen

    2017-12-01

    The Royal Commission into Institutional Responses to Child Sexual Abuse is the largest royal commission in Australia's history and one of the largest public inquiries into institutional child abuse internationally. With an investment from the Australian government of half a billion dollars, it examined how institutions with a responsibility for children, both historically and in the present, have responded to allegations of child sexual abuse. Announced in the wake of previous Australian and international inquiries, public scandals and lobbying by survivor groups, its establishment reflected increasing recognition of the often lifelong and intergenerational damage caused by childhood sexual abuse and a strong political commitment to improving child safety and wellbeing in Australia. This article outlines the background, key features and innovations of this landmark public inquiry, focusing in particular on its extensive research program. It considers its international significance and also serves as an introduction to this special edition on the Australian Royal Commission, exploring its implications for better understanding institutional child sexual abuse and its impacts, and for making institutions safer places for children in the future. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  2. [Residency in plastic surgery: comparison between the French and the Canadian Royal College programs].

    Science.gov (United States)

    Sinna, R; Harris, P G; Danino, A M

    2010-02-01

    Learning plastic surgery in Montreal is different from learning plastic surgery in a French university. In Canada, all residency programs are accredited by a national structure: the Royal College of Physicians and Surgeons. We tried to highlight the differences that exist between the French and a North American academic system. With the different rules and law that governs academic education in both countries, we analyzed the following elements: the residency selection, the program of plastic surgery (content and organisation), the system of evaluation and the diplomas. The training of a Canadian plastic surgeon is very controlled. The recommendations of the Royal College guarantee to the resident who enters a program to have the means to acquire a complete training in quantity and in quality. On the four studied items, none is completely similar between both countries. Each having advantages and inconveniences as, for example, the selection of residency by interview or by the classifying national exam. Actually, few French plastic surgery programs could satisfy the requirements of the Royal College on several points, however without failing the training of French plastic surgeons. Nevertheless, we could be inspired by several elements (rotation in private practice,grouping together several academic hospitals. . .) to improve our system of training.

  3. The efficacy of topical Royal Jelly on diabetic foot ulcers healing: A case series

    Directory of Open Access Journals (Sweden)

    Mansour Siavash

    2011-01-01

    Full Text Available Background: Foot ulcers and infections are the major sources of morbidity in individuals with diabetes mellitus. This study aimed to evaluate the efficacy of topical Royal Jelly (a worker honey bee product on healing diabetic foot ulcers. Methods: Diabetic patients with foot ulcers that were referred to our clinic at Khorshid Hospital, Isfahan, Iran; were evaluated three times a week and treated according to standard treatments consisted of offloading, infection control, vascular improvement and debridement if required. In addition, all ulcers were measured and then topical sterile 5% Royal Jelly was applied on the total surface area of the wounds. Eventually, they were covered with sterile dressings. Each patient was followed for a period of three months or until the complete healing. Results: A total of eight patients were enrolled in this study. Of these, two had two ulcers and, therefore, ten ulcers were evaluated. Two ulcers were excluded. Seven of the remained eight ulcers healed. Mean duration of complete healing was 41 days. One ulcer did not completely heal but improved to 40% smaller in length, 32% in width and 28% in depth. The mean length, width and depth reduction rates were 0.35 mm/day, 0.28 mm/day and 0.11 mm/day, respectively. Conclusions: Royal Jelly dressing may be an effective method for treating diabetic foot ulcers besides standard treatments.

  4. The factors that influence job satisfaction among royal Malaysian customs department employee

    Science.gov (United States)

    Ammar Shafi, Muhammad; Saifullah Rusiman, Mohd; Nor, Maria Elena; Khamis, Azme; Nabilah Syuhada Abdullah, Siti; Syafiq Azmi, Mohd; Sakinah Zainal Abidin, Munirah; Ali, Maselan

    2018-04-01

    This research aims to spot the factors that influence job satisfaction among Royal Malaysian Customs Department employees. Primary data was used in this research and it was collected from the employees who work in five different departments at Royal Malaysian Customs Department Tower Johor. Those departments were customs department, Internal Taxes, Technical Services, Management and Prevention. The research used stratified random sampling to collect the sample and Structural Equation Modelling (SEM) to measure the relationship between variables using AMOS software. About 127 employees are selected as the respondents from five departments to represent the sample. The result showed that ‘Organizational Commitment’ (p-value = 0.001) has significant and direct effect toward job satisfaction compared to the ‘Stress Condition’ (p-value = 0.819) and ‘Motivation’ factor (p-value = 0.978). It was also concluded that ‘Organizational Commitment’ was the most influential factor toward job satisfaction among Royal Malaysian Customs Department employees at Tower Custom Johor, Johor Bahru.

  5. Identification of genes related to high royal jelly production in the honey bee (Apis mellifera) using microarray analysis.

    Science.gov (United States)

    Nie, Hongyi; Liu, Xiaoyan; Pan, Jiao; Li, Wenfeng; Li, Zhiguo; Zhang, Shaowu; Chen, Shenglu; Miao, Xiaoqing; Zheng, Nenggan; Su, Songkun

    2017-01-01

    China is the largest royal jelly producer and exporter in the world, and high royal jelly-yielding strains have been bred in the country for approximately three decades. However, information on the molecular mechanism underlying high royal jelly production is scarce. Here, a cDNA microarray was used to screen and identify differentially expressed genes (DEGs) to obtain an overview on the changes in gene expression levels between high and low royal jelly producing bees. We developed a honey bee gene chip that covered 11,689 genes, and this chip was hybridised with cDNA generated from RNA isolated from heads of nursing bees. A total of 369 DEGs were identified between high and low royal jelly producing bees. Amongst these DEGs, 201 (54.47%) genes were up-regulated, whereas 168 (45.53%) were down-regulated in high royal jelly-yielding bees. Gene ontology (GO) analyses showed that they are mainly involved in four key biological processes, and pathway analyses revealed that they belong to a total of 46 biological pathways. These results provide a genetic basis for further studies on the molecular mechanisms involved in high royal jelly production.

  6. Identification of genes related to high royal jelly production in the honey bee (Apis mellifera using microarray analysis

    Directory of Open Access Journals (Sweden)

    Hongyi Nie

    2017-10-01

    Full Text Available Abstract China is the largest royal jelly producer and exporter in the world, and high royal jelly-yielding strains have been bred in the country for approximately three decades. However, information on the molecular mechanism underlying high royal jelly production is scarce. Here, a cDNA microarray was used to screen and identify differentially expressed genes (DEGs to obtain an overview on the changes in gene expression levels between high and low royal jelly producing bees. We developed a honey bee gene chip that covered 11,689 genes, and this chip was hybridised with cDNA generated from RNA isolated from heads of nursing bees. A total of 369 DEGs were identified between high and low royal jelly producing bees. Amongst these DEGs, 201 (54.47% genes were up-regulated, whereas 168 (45.53% were down-regulated in high royal jelly-yielding bees. Gene ontology (GO analyses showed that they are mainly involved in four key biological processes, and pathway analyses revealed that they belong to a total of 46 biological pathways. These results provide a genetic basis for further studies on the molecular mechanisms involved in high royal jelly production.

  7. Crisis strategies in BP's Deepwater Horizon response : An image repair and situational crisis communication study

    OpenAIRE

    Johansson, Mikael

    2017-01-01

    The BP Deepwater Horizon crisis in 2010 was one the largest catastrophes in the history of the oil industry. BP was sued over the disaster, and lost several billion dollars. This study examines the crisis response strategies and/or image repair strategies, which can be found in BP's press releases following the Deepwater Horizon crisis. In particular, the study looks closer at what established crisis communication strategies could be discerned in the material, and how they are used discursive...

  8. Flood Risk Mapping Using LiDAR for Annapolis Royal, Nova Scotia, Canada

    Directory of Open Access Journals (Sweden)

    Tim L. Webster

    2010-09-01

    Full Text Available A significant portion of the Canadian Maritime coastline has been surveyed with airborne Light Detection and Ranging (LiDAR. The purpose of these surveys has been to map the risk of flooding from storm surges and projected long-term sea‑level rise from climate change and to include projects in all three Maritime Provinces: Prince Edward Island, New Brunswick, and Nova Scotia. LiDAR provides the required details in order to map the flood inundation from 1 to 2 m storm surge events, which cause coastal flooding in many locations in this region when they occur at high tide levels. The community of Annapolis Royal, Nova Scotia, adjacent to the Bay of Fundy, has been surveyed with LiDAR and a 1 m DEM (Digital Elevation Model was constructed for the flood inundation mapping. Validation of the LiDAR using survey grade GPS indicates a vertical accuracy better than 30 cm. A benchmark storm, known as the Groundhog Day storm (February 1–3, 1976, was used to assess the flood maps and to illustrate the effects of different sea-level rise projections based on climate change scenarios if it were to re-occur in 100 years time. Near shore bathymetry has been merged with the LiDAR and local wind observations used to model the impact of significant waves during this benchmark storm. Long-term (ca. greater than 30 years time series of water level observations from across the Bay of Fundy in Saint John, New Brunswick, have been used to estimate return periods of water levels under present and future sea-level rise conditions. Results indicate that under current sea-level rise conditions this storm has a 66 year return period. With a modest relative sea-level (RSL rise of 80 cm/century this decreases to 44 years and, with a possible upper limit rise of 220 cm/century, this decreases further to 22 years. Due to the uncertainty of climate change scenarios and sea-level rise, flood inundation maps have been constructed at 10 cm increments up to the 9 m contour

  9. Adapting the botanical landscape of Melbourne Gardens (Royal Botanic Gardens Victoria in response to climate change

    Directory of Open Access Journals (Sweden)

    Timothy J. Entwisle

    2017-12-01

    Full Text Available Botanic gardens around the world maintain collections of living plants for science, conservation, education, beauty and more. These collections change over time – in scope and content – but the predicted impacts of climate change will require a more strategic approach to the succession of plant species and their landscapes. Royal Botanic Gardens Victoria has recently published a ‘Landscape Succession Strategy’ for its Melbourne Gardens, a spectacular botanical landscape established in 1846. The strategy recognizes that with 1.6 million visitors each year, responsibility for a heritage-listed landscape and the need to care for a collection of 8500 plant species of conservation and scientific importance, planting and planning must take into account anticipated changes to rainfall and temperature. The trees we plant today must be suitable for the climate of the twenty-second century. Specifically, the Strategy sets out the steps needed over the next twenty years to transition the botanic garden to one resilient to the climate modelled for 2090. The document includes a range of practical measures and achievable (and at times somewhat aspirational targets. Climate analogues will be used to identify places in Australia and elsewhere with conditions today similar to those predicted for Melbourne in 2090, to help select new species for the collection. Modelling of the natural and cultivated distribution of species will be used to help select suitable growth forms to replace existing species of high value or interest. Improved understanding of temperature gradients within the botanic garden, water holding capacity of soils and plant water use behaviour is already resulting in better targeted planting and irrigation. The goal is to retain a similar diversity of species but transition the collection so that by 2036 at least 75% of the species are suitable for the climate in 2090. Over the next few years we hope to provide 100% of irrigation water

  10. Effects of royal jelly on genotoxicity and nephrotoxicity induced by valproic acid in albino mice

    Directory of Open Access Journals (Sweden)

    Sanaa R. Galaly

    2014-03-01

    Full Text Available Epilepsy is one of the most common neurological diseases affecting at least 50 million people worldwide. Valproic acid (VPA is a widely used antiepileptic medication for both generalized and partial seizures of epilepsy. The objective of the study was to investigate the anti-mutagenic and anti-histopathologic effects of royal jelly (RJ on VPA-induced genotoxicity and nephrotoxicity in male albino mice (Mus musculus. 80 Mice were used for 21 days; they were divided into eight groups, (G1 served as normal control group, G2 received VPA (100 mg/kg and (G3–G5 received RJ at doses 50, 100 and 200 mg/kg respectively. While (G6–G8 were administrated RJ simultaneously with VPA. In RJ treated mice at doses of 50 and 100 mg/kg, the kidney sections showed normal histological structure with non significant changes in chromosomal aberrations (CA and mitotic index (MI, while RJ at dose of 200 mg/kg showed mild inflammatory cells infiltration and hyperemic glomeruli but not highly significant changes in CA and MI. The cortex of VPA treated mice revealed congested glomeruli with inflammatory cells infiltration, and marked degeneration of almost structures of the glomeruli including some vacuoles in mesangial cells with dark mesangial substances on the ultrastructure level. Some proximal tubules showed degeneration of microvilli on the apical parts of some cells. Cells of the distal tubules attained obliterated lumen and vacuolated lining epithelium. The results also revealed that valproic acid induced a high frequency of CA in bone marrow cells of mice and MI was significantly decreased indicating bone marrow cytotoxicity. The treatment of mice with RJ at doses 50, 100 and 200 mg/kg for 21 days simultaneously with VPA resulted in abating the histological alterations in renal tissues with significant reduction in chromosomal aberrations, for doses of 50 and 100 mg/kg, and elevation in mitotic index (P < 0.05. RJ at doses 50 and 100 mg/kg appeared

  11. The quandary of local people—Park relations in Nepal's Royal Chitwan National Park

    Science.gov (United States)

    Nepal, Sanjay K.; Weber, Karl E.

    1995-11-01

    This paper analyzes five major causes of park-people conflicts that have occurred in Nepal's Royal Chitwan National Park. The causes include illegal transactions of forest products from the park, livestock grazing in the park, illegal hunting and fishing, crop damage, and threats to human and animal life caused by wild animals from the park. The conflicts indicate a reciprocal relationship between the park and local people. They reflect the attitudes of local people and representatives of the park authority whose priorities and objectives largely diverge. The results show that people settled adjacent to the park are heavily dependent on its resources. Even in places where some, albeit few alternative sources exist, local people continue to trespass the park boundary as these sources are inadequate to ensure the fulfillment of local people's resource needs. Illegal transactions of resources continue throughout the year; however, they are less intense during summer due to flooding caused by the Rapti River, which forms the park boundary towards the northern section where this study is conducted. The frequency of local people's visits to the park is mainly determined by their age, distance between homesteads and park, and volume of crop loss caused by wild animals. Crop damage is the function of size of landholding, distance, and frequency of crop raid. Local people claim that they have no intention of letting their livestock graze in the park; however, the dense vegetation of the park attracts livestock grazing on riverbanks just outside the open park boundary. Many head of livestock are killed by carnivores of the park. Human casualties are mainly caused by sloth bear ( Melursus ursinus), tiger ( Panthera tigris), wild pig ( Sug scrofa), and rhinoceros ( Rhinoceros unicornis). There had been some earlier attempts to reconcile the conflicts by offering local people different kinds of compensations; however, these were unsuccessful measures. An integrated approach is

  12. Microbial monitoring in treated stone at the Royal Chapel of Granada

    Science.gov (United States)

    Jroundi, Fadwa; Pinar, Guadalupe; González-Muñoz, Maria Theresa; Sterflinger, Katja

    2014-05-01

    Biomineralization processes have been applied in situ to protect and consolidate decayed ornamental stone of the Royal Chapel in Granada (Spain). In few years, this conservation treatment has gained worth attention as environmentally friendly methodology for protection and consolidation of limestone because of the compatibilities shown between the new calcium carbonate cement and the original stone substrate. Moreover, the success of this approach may be related to the diversity of the microbiota inhabiting the stone and activated upon the biotreatment application and throughout the time. González-Muñoz et al. (2008) proposed a nutritional solution that activate among the bacteria inhabiting the stone those with carbonatogenic activity. In this study, a long-term (one, two and three years) monitoring of the microbiota present on the treated and untreated stones was done using a molecular strategy, including total DNA extraction, PCR amplification of 16S rRNA sequences, construction of clone libraries and fingerprinting by DGGE (Denaturing Gradient Gel Electrophoresis) analysis. Sequencing of the 16S rDNA revealed the dominant occurrence of members of Actinobacteria (44.20%), Gamma-proteobacteria (30.24%) and Chloroflexi (25.56%) after one year of the biotreatment. Whereas after two years, members of Cyanobacteria (22.10%) appeared and three years after, the microbiota consisted of only Actinobacteria and Cyanobacteria with approximately the same percentage in comparison with the untreated stones, dominated exclusively by Actinobacteria (100%). Fungal diversity followed the same dynamic as bacterial diversity being Ascomicota the predominant order before treatment. After one year, members of Basidiomycota and Viridiplantae appeared on the stone while two years after, the Viridiplantae dominated with a percentage of 84.77%. Finally, three years after the treatment, fungi population started to stabilize again and Ascomicota predominated next to 16.67% of

  13. Violence toward health workers in Bahrain Defense Force Royal Medical Services’ emergency department

    Directory of Open Access Journals (Sweden)

    Rafeea F

    2017-11-01

    Full Text Available Faisal Rafeea,1 Ahmed Al Ansari,2–4 Ehab M Abbas,1 Khalifa Elmusharaf,5 Mohamed S Abu Zeid1 1Emergency Department, Bahrain Defense Force Hospital, Riffa, Bahrain; 2Training and Education Department, Bahrain Defense Force Hospital, Riffa, Bahrain; 3Department of General Surgery, College of Medicine and Medical Science, Arabian Gulf University, Manama, Bahrain; 4Medical Education Department, Royal College of Surgeons in Ireland - Medical University of Bahrain, Busaiteen, Bahrain; 5Graduate Entry Medical School, University of Limerick, Ireland Background: Employees working in emergency departments (EDs in hospital settings are disproportionately affected by workplace violence as compared to those working in other departments. Such violence results in minor or major injury to these workers. In other cases, it leads to physical disability, reduced job performance, and eventually a nonconducive working environment for these workers. Materials and methods: A cross-sectional exploratory questionnaire was used to collect data used for the examination of the incidents of violence in the workplace. This study was carried out at the ED of the Bahrain Defense Force (BDF Hospital. Participants for the study were drawn from nurses, support staff, and emergency physicians. Both male and female workers were surveyed.Results: The study included responses from 100 staff in the ED of the BDF Hospital in Bahrain (doctors, nurses, and support personnel. The most experienced type of violence in the workers in the past 12 months in this study was verbal abuse, which was experienced by 78% of the participants, which was followed by physical abuse (11% and then sexual abuse (3%. Many cases of violence against ED workers occurred during night shifts (53%, while physical abuse was reported to occur during all the shifts; 40% of the staff in the ED of the hospital were not aware of the policies against workplace violence, and 26% of the staff considered leaving their jobs

  14. BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer

    Science.gov (United States)

    Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.

    2010-01-01

    Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225

  15. Research on wind field algorithm of wind lidar based on BP neural network and grey prediction

    Science.gov (United States)

    Chen, Yong; Chen, Chun-Li; Luo, Xiong; Zhang, Yan; Yang, Ze-hou; Zhou, Jie; Shi, Xiao-ding; Wang, Lei

    2018-01-01

    This paper uses the BP neural network and grey algorithm to forecast and study radar wind field. In order to reduce the residual error in the wind field prediction which uses BP neural network and grey algorithm, calculating the minimum value of residual error function, adopting the residuals of the gray algorithm trained by BP neural network, using the trained network model to forecast the residual sequence, using the predicted residual error sequence to modify the forecast sequence of the grey algorithm. The test data show that using the grey algorithm modified by BP neural network can effectively reduce the residual value and improve the prediction precision.

  16. Association of Autoantibodies to BP180 with Disease Activity in Greek Patients with Bullous Pemphigoid

    Directory of Open Access Journals (Sweden)

    Aikaterini Patsatsi

    2012-01-01

    Full Text Available 39 bullous pemphigoid (BP patients were studied to assess the clinical significance of anti-BP180 and anti-BP230 circulating autoantibodies of BP and correlate their titers with the clinical scores of the BP Disease Area Index (BPDAI and the Autoimmune Bullous Skin Disorder Intensity Score (ABSIS as well as with the intensity of pruritus measured by the BPDAI pruritus component. All parameters were evaluated by the time of diagnosis (baseline, month 3, and month 6. Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with BPDAI component for the intensity of pruritus (, at baseline. At month 3, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . At month 6, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . There was no statistically significant correlation between titers of anti-BP230 autoantibodies and the BPDAI, ABSIS, and BPDAI component for the intensity of pruritus at the same time points.

  17. Prediction of Industrial Electric Energy Consumption in Anhui Province Based on GA-BP Neural Network

    Science.gov (United States)

    Zhang, Jiajing; Yin, Guodong; Ni, Youcong; Chen, Jinlan

    2018-01-01

    In order to improve the prediction accuracy of industrial electrical energy consumption, a prediction model of industrial electrical energy consumption was proposed based on genetic algorithm and neural network. The model use genetic algorithm to optimize the weights and thresholds of BP neural network, and the model is used to predict the energy consumption of industrial power in Anhui Province, to improve the prediction accuracy of industrial electric energy consumption in Anhui province. By comparing experiment of GA-BP prediction model and BP neural network model, the GA-BP model is more accurate with smaller number of neurons in the hidden layer.

  18. TopBP1 associates with NBS1 and is involved in homologous recombination repair

    International Nuclear Information System (INIS)

    Morishima, Ken-ichi; Sakamoto, Shuichi; Kobayashi, Junya; Izumi, Hideki; Suda, Tetsuji; Matsumoto, Yoshiyuki; Tauchi, Hiroshi; Ide, Hiroshi; Komatsu, Kenshi; Matsuura, Shinya

    2007-01-01

    TopBP1 is involved in DNA replication and DNA damage checkpoint. Recent studies have demonstrated that TopBP1 is a direct positive effecter of ATR. However, it is not known how TopBP1 recognizes damaged DNA. Here, we show that TopBP1 formed nuclear foci after exposure to ionizing radiation, but such TopBP1 foci were abolished in Nijmegen breakage syndrome cells. We also show that TopBP1 physically associated with NBS1 in vivo. These results suggested that NBS1 might regulate TopBP1 recruitment to the sites of DNA damage. TopBP1-depleted cells showed hypersensitivity to Mitomycin C and ionizing radiation, an increased frequency of sister-chromatid exchange level, and a reduced frequency of DNA double-strand break induced homologous recombination repair. Together, these results suggested that TopBP1 might be a mediator of DNA damage signaling from NBS1 to ATR and promote homologous recombination repair

  19. BP reactivity to public speaking in stage 1 hypertension: influence of different task scenarios.

    Science.gov (United States)

    Palatini, Paolo; Bratti, Paolo; Palomba, Daniela; Bonso, Elisa; Saladini, Francesca; Benetti, Elisabetta; Casiglia, Edoardo

    2011-10-01

    To investigate the blood pressure (BP) reaction to public speaking performed according to different emotionally distressing scenarios in stage 1 hypertension. METHODS. We assessed 64 hypertensive and 30 normotensive subjects. They performed three speech tasks with neutral, anger and anxiety scenarios. BP was assessed with the Finometer beat-to-beat non-invasive recording system throughout the test procedure. For all types of speech, the systolic BP response was greater in the hypertensive than the normotensive subjects (all p public speaking is increased in stage 1 hypertension. A speech with anxiety or anger scenario elicits a greater diastolic BP reaction than tasks with neutral content.

  20. Nuclear Enterprises portable dose rate meter type PDR4 and external probes types BP1/1, BP8 and GP9

    International Nuclear Information System (INIS)

    Burgess, P.H.; Iles, W.J.

    1979-08-01

    The performance characteristics of Nuclear Enterprises Portable Dose Rate Meter Type PDR4 are evaluated under the headings: general description, facilities and controls, radiation characteristics, electrical characteristics, environmental characteristics, mechanical characteristics, the manual, summary of performance, and conclusions. Results of an investigation of the radiation characteristics of the external probes Type BP1/1, Type BP8, and Type GP9 are also detailed. (U.K.)

  1. In the Service of the King. Concerning Royal Diplomatic Letters in the Crown of Aragon (1336-1458

    Directory of Open Access Journals (Sweden)

    María Luz Mandingorra Llavata

    2017-12-01

    Full Text Available The aim of this paper is to reconstruct the morphological evolution of the royal diplomatic letter in the Crown of Aragon between the reigns of Peter the Ceremonious and Alfonso the Magnanimous. During this period, the form taken by this document was adapted to its contents and those in receipt of it, according to the principles of the Ars dictaminis, without relinquishing its material and textual simplicity in the process. With its adaptation to the communicative requirements of the monarchy, the royal diplomatic letter became an instrument of governance that helped to strengthen royal power and anticipated mechanisms that would be fully developed during the Early Modern Period.

  2. Insulin signaling controls neurotransmission via the 4eBP-dependent modification of the exocytotic machinery.

    Science.gov (United States)

    Mahoney, Rebekah Elizabeth; Azpurua, Jorge; Eaton, Benjamin A

    2016-08-15

    Altered insulin signaling has been linked to widespread nervous system dysfunction including cognitive dysfunction, neuropathy and susceptibility to neurodegenerative disease. However, knowledge of the cellular mechanisms underlying the effects of insulin on neuronal function is incomplete. Here, we show that cell autonomous insulin signaling within the Drosophila CM9 motor neuron regulates the release of neurotransmitter via alteration of the synaptic vesicle fusion machinery. This effect of insulin utilizes the FOXO-dependent regulation of the thor gene, which encodes the Drosophila homologue of the eif-4e binding protein (4eBP). A critical target of this regulatory mechanism is Complexin, a synaptic protein known to regulate synaptic vesicle exocytosis. We find that the amounts of Complexin protein observed at the synapse is regulated by insulin and genetic manipulations of Complexin levels support the model that increased synaptic Complexin reduces neurotransmission in response to insulin signaling.

  3. Familial childhood onset neuropathy and cirrhosis with the 4977bp mitochondrial DNA deletion.

    Science.gov (United States)

    McDonald, D G M; McMenamin, J B; Farrell, M A; Droogan, O; Green, A J

    2002-08-01

    The common 4977 base pair mitochondrial deletion has been identified in association with a number of distinct clinical phenotypes. These include the Kearns-Sayre syndrome, the Pearson marrow-pancreas syndrome, and chronic progressive external ophthalmoplegia. We report the clinical and pathological findings in two siblings in whom the 4977 base pair mitochondrial DNA deletion was identified in muscle-derived mitochondrial DNA. One sibling manifested early onset liver and renal failure, and both developed prominent peripheral sensorimotor neuropathy. These clinical findings have not been previously described in association with the 4977bp mtDNA deletion and thus represent a further expansion of the spectrum of mitochondrial disease. Copyright 2002 Wiley-Liss, Inc.

  4. Odontology and the history of medicine at the Royal Society of Medicine 1907-1960 and the contributions of Lilian Lindsay--Part One. The early years of the Royal Society of Medicine and the Section of Odontology.

    Science.gov (United States)

    Papworth, Julie

    2014-01-01

    This paper examines the foundation of the Royal Society of Medicine and the Sections of Odontology. It considers the remarkable achievements of Lilian Lindsay which were made at a time when the medical world was almost entirely dominated by men.

  5. BP1, an Isoform of DLX4 Homeoprotein, Negatively Regulates BRCA1 in Sporadic Breast Cancer

    Science.gov (United States)

    Kluk, Brian J.; Fu, Yebo; Formolo, Trina A.; Zhang, Lei; Hindle, Anne K.; Man, Yan-gao; Siegel, Robert S.; Berg, Patricia E.; Deng, Chuxia; McCaffrey, Timothy A.; Fu, Sidney W.

    2010-01-01

    Introduction: Several lines of evidence point to an important role for BP1, an isoform of DLX4 homeobox gene, in breast carcinogenesis and progression. BRCA1 is a well-known player in the etiology of breast cancer. While familial breast cancer is often marked by BRCA1 mutation and subsequent loss of heterozygosity, sporadic breast cancers exhibit reduced expression of wild type BRCA1, and loss of BRCA1 expression may result in tumor development and progression. Methods: The Cister algorithm and Genomatix program were used to identify potential BP1 binding sites in BRCA1 gene. Real-time PCR, Western blot and immunohistochemistry analysis were performed to verify the expression of BRCA1 and BP1 in cell lines and breast cancer tissues. Double-stranded siRNA transfection was carried out for silencing BP1 expression. ChIP and EMSA were used to confirm that BP1 specifically binds to BRCA1. Results: A putative BP1 binding site was identified in the first intron of BRCA1, which was confirmed by chromatin immunoprecipiation and electrophoresis mobility shift assay. BP1 and BRCA1 expression were inversely correlated in breast cancer cell lines and tissues, suggesting that BP1 may suppress BRCA1 transcription through consensus sequence binding. Conclusions: BP1 homeoprotein represses BRCA1 expression through direct binding to its first intron, which is consistent with a previous study which identified a novel transcriptional repressor element located more than 500 base pairs into the first intron of BRCA1, suggesting that the first intron plays an important role in the negative regulation of BRCA1. Although further functional studies are necessary to confirm its repressor activity towards BRCA1, the elucidation of the role of BP1 in breast tumorigenesis holds great promise in establishing BP1 as a novel target for drug therapy. PMID:20877436

  6. Reaching Grid Parity Using BP Solar Crystalline Silicon Technology: A Systems Class Application

    Energy Technology Data Exchange (ETDEWEB)

    Cunningham, Daniel W; Wohlgemuth, John; Carlson, David E; Clark, Roger F; Gleaton, Mark; Posbic, John P; Zahler, James

    2010-12-06

    The primary target market for this program was the residential and commercial PV markets, drawing on BP Solar's premium product and service offerings, brand and marketing strength, and unique routes to market. These two markets were chosen because: (1) in 2005 they represented more than 50% of the overall US PV market; (2) they are the two markets that will likely meet grid parity first; and (3) they are the two market segments in which product development can lead to the added value necessary to generate market growth before reaching grid parity. Federal investment in this program resulted in substantial progress toward the DOE TPP target, providing significant advancements in the following areas: (1) Lower component costs particularly the modules and inverters. (2) Increased availability and lower cost of silicon feedstock. (3) Product specifically developed for residential and commercial applications. (4) Reducing the cost of installation through optimization of the products. (5) Increased value of electricity in mid-term to drive volume increases, via the green grid technology. (6) Large scale manufacture of PV products in the US, generating increased US employment in manufacturing and installation. To achieve these goals BP Solar assembled a team that included suppliers of critical materials, automated equipment developers/manufacturers, inverter and other BOS manufacturers, a utility company, and University research groups. The program addressed all aspects of the crystalline silicon PV business from raw materials (particularly silicon feedstock) through installation of the system on the customers site. By involving the material and equipment vendors, we ensured that supplies of silicon feedstock and other PV specific materials like encapsulation materials (EVA and cover glass) will be available in the quantities required to meet the DOE goals of 5 to 10 GW of installed US PV by 2015 and at the prices necessary for PV systems to reach grid parity in 2015

  7. Un projet ambitieux : le Dictionnaire de Port-Royal au XVIIe siècle

    OpenAIRE

    McKenna, Antony

    2016-01-01

    Le projet ambitieux d’un Dictionnaire de Port-Royal au XVIIe siècle est né d’une rencontre au colloque de la Société des Amis de Port-Royal à Alet-les-Bains en 1982 : Jean Lesaulnier avait à cette date déjà amassé des informations sur quantité de personnages autour de Port-Royal et travaillait à sa grande édition du Recueil de choses diverses ; pour ma part, je me contentais d’aborder chaque année la biographie d’un ami de Port-Royal pour une présentation au colloque de la Société. Le projet ...

  8. Royal Australian and New Zealand College of Psychiatrists clinical practice guidelines for the treatment of eating disorders.

    Science.gov (United States)

    Hay, Phillipa; Chinn, David; Forbes, David; Madden, Sloane; Newton, Richard; Sugenor, Lois; Touyz, Stephen; Ward, Warren

    2014-11-01

    This clinical practice guideline for treatment of DSM-5 feeding and eating disorders was conducted as part of the Royal Australian and New Zealand College of Psychiatrists (RANZCP) Clinical Practice Guidelines (CPG) Project 2013-2014. The CPG was developed in accordance with best practice according to the National Health and Medical Research Council of Australia. Literature of evidence for treatments of anorexia nervosa (AN), bulimia nervosa (BN), binge eating disorder (BED), other specified and unspecified eating disorders and avoidant restrictive food intake disorder (ARFID) was sourced from the previous RANZCP CPG reviews (dated to 2009) and updated with a systematic review (dated 2008-2013). A multidisciplinary working group wrote the draft CPG, which then underwent expert, community and stakeholder consultation, during which process additional evidence was identified. In AN the CPG recommends treatment as an outpatient or day patient in most instances (i.e. in the least restrictive environment), with hospital admission for those at risk of medical and/or psychological compromise. A multi-axial and collaborative approach is recommended, including consideration of nutritional, medical and psychological aspects, the use of family based therapies in younger people and specialist therapist-led manualised based psychological therapies in all age groups and that include longer-term follow-up. A harm minimisation approach is recommended in chronic AN. In BN and BED the CPG recommends an individual psychological therapy for which the best evidence is for therapist-led cognitive behavioural therapy (CBT). There is also a role for CBT adapted for internet delivery, or CBT in a non-specialist guided self-help form. Medications that may be helpful either as an adjunctive or alternative treatment option include an antidepressant, topiramate, or orlistat (the last for people with comorbid obesity). No specific treatment is recommended for ARFID as there are no trials to

  9. APP-BP1 inhibits Aβ42 levels by interacting with Presenilin-1

    Directory of Open Access Journals (Sweden)

    Neve Rachael L

    2007-02-01

    Full Text Available Abstract Background The β-amyloid precursor protein (APP is sequentially cleaved by the β- and then γ-secretase to generate the amyloid β-peptides Aβ40 and Aβ42. Increased Aβ42/Aβ40 ratios trigger amyloid plaque formations in Alzheimer's disease (AD. APP binds to APP-BP1, but the biological consequence is not well understood. Results We report that when the endogenous APP-BP1 was suppressed by small interfering RNAs (siRNAs, cell-associated Aβ42 was dramatically increased in APP695 expressing primary neurons. The accumulation of Aβ42 was accompanied by significant increases in APP and APP-CTF in APP-BP1 siRNA expressing neurons. In contrast, APP-BP1 overexpression in primary neurons significantly decreased the levels of Aβ and endogenous APP but not APLPs. We also investigated the potential mechanism of APP-BP1-mediated APP processing. APP-BP1 co-precipitated with Presenilin-1 (PS1 in native rat brain extracts, co-migrated with the γ-secretase components in brain membrane extracts in glycerol gradient centrifugation, and colocalized in primary neurons. Further, the endogenous PS1-CTF was significantly downregulated by APP-BP1 expression. Conclusion Our data suggest that APP-BP1 may inhibit Aβ42 production by interacting with PS1 under physiological conditions.

  10. Environmental change in the Limfjord, Denmark (ca 7500-1500 cal yrs BP): A multiproxy study

    DEFF Research Database (Denmark)

    Lewis, J. P.; Ryves, D.B.; Rasmussen, P.

    2013-01-01

    (and high productivity) between ca 7500–5000 BP, followed by a gradual transition to a shallow benthic system with more oceanic conditions (i.e. higher salinity, lower productivity, slower sedimentary accumulation rate and poorer fossil preservation) after ca 5000 BP and no stratification after ca 4400...

  11. InterProScan Result: BP126341 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126341 BP126341_1_ORF1 E023A90F592AFE65 PROSITE PS01175 RIBONUCLEASE_II NA T IPR001900 Ribonu...clease II/R Molecular Function: RNA binding (GO:0003723)|Molecular Function: ribonuclease activity (GO:0004540) ...

  12. InterProScan Result: BP126341 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126341 BP126341_1_ORF1 E023A90F592AFE65 PANTHER PTHR23355:SF10 RIBONUCLEASE II-RE...LATED 3.4e-50 T IPR001900 unintegrated Molecular Function: RNA binding (GO:0003723)|Molecular Function: ribonuclease activity (GO:0004540) ...

  13. InterProScan Result: BP126341 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126341 BP126341_1_ORF1 E023A90F592AFE65 PANTHER PTHR23355 RIBONUCLEASE 3.4e-50 T ...IPR001900 unintegrated Molecular Function: RNA binding (GO:0003723)|Molecular Function: ribonuclease activity (GO:0004540) ...

  14. InterProScan Result: BP125414 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125414 BP125414_2_ORF1 53AC87ED4CE73EA3 PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 0.00074 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  15. InterProScan Result: BP115758 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP115758 BP115758_4_ORF1 08B82F106E72F523 PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 1e-08 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  16. InterProScan Result: BP126555 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126555 BP126555_6_ORF2 0D05AF860DCFDE97 PANTHER PTHR11511 INSECT HEMOCYANIN-RELAT...ED 2.5e-25 T IPR013788 Arthropod hemocyanin/insect LSP Molecular Function: oxygen transporter activity (GO:0005344)|Biological Process: transport (GO:0006810) ...

  17. InterProScan Result: BP117067 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP117067 BP117067_1_ORF2 D483359C05197373 PFAM PF00067 p450 6e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

  18. InterProScan Result: BP124291 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP124291 BP124291_5_ORF1 92B626ADD33C8436 PFAM PF00067 p450 1.8e-09 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

  19. InterProScan Result: BP123442 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123442 BP123442_1_ORF1 331440C6CA592A17 PRINTS PR00385 P450 6.3e-05 T IPR001128 Cytochrome P450 Molecular... Function: monooxygenase activity (GO:0004497)|Molecular Function: iron ion binding (GO:0005506)|Molecular... Function: electron carrier activity (GO:0009055)|Molecular Function: heme binding (GO:0020037) ...

  20. InterProScan Result: BP116799 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP116799 BP116799_1_ORF2 D3F3F8C61868AD4C PRINTS PR00309 ARRESTIN 6e-17 T IPR000698 Arrestin Biolog...ical Process: signal transduction (GO:0007165)|Biological Process: sensory perception (GO:0007600) ...